5IN5A

Crystal structure of gdp-mannose 4,6 dehydratase in complex with natural inhibitor gdp-fucose
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
351
structure length
351
Chain Sequence
GRNVALITGITGQDGSYLAEFLLEKGYEVHGIVRRSSSFNTGRIEHLYKNPQAHIEGNMKLHYGDLTDSTCLVKIINEVKPTEIYNLGAQSHVKISFDLAEYTADVDGVGTLRLLDAVKTCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPRSPYGAAKLYAYWIVVNFREAYNLFAVNGILFNHESPRRGANFVTRKISRSVAKIYLGQLECFSLGNLDAKRDWGHAKDYVEAMWLMLQNDEPEDFVIATGEVHSVREFVEKSFLHIGKTIVWEGKNENEVGRCKETGKVHVTVDLKYYRPTEVDFLQGDCTKAKQKLNWKPRVAFDELVREMVHADVELMRTNPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Facile Modulation of Antibody Fucosylation with Small Molecule Fucostatin Inhibitors and Cocrystal Structure with GDP-Mannose 4,6-Dehydratase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase/inhibitor
molecule keywords GDP-mannose 4,6 dehydratase
total genus 131
structure length 351
sequence length 351
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.47: GDP-mannose 4,6-dehydratase.
pdb deposition date 2016-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5in5A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 5in5A02
1GL3A 4Q3CA 1I01A 3M1AA 3DL2A 3QWIA 1DOHA 2VWHA 3JQDA 3AI2A 5KJ1A 5K6AA 1DC3A 1GQYA 3W4JA 1H6BA 1I30A 4N18A 4LW8A 3DBLB 3TWOA 4H3VA 3MOIA 4XD2A 3SC4A 1ZK4A 3CEAA 4QFDA 1R15A 3D5QA 3ZH2A 1KY5A 1ZK0A 4RF2A 3GMSA 3KXDA 1Y8RB 4F6CA 3L6DA 2W2KB 1X13A 3FPLA 3ITKA 1SC6A 4P38A 3ON5A 2X0NA 3I5MA 4HV4A 2PKQP 2P91A 3HDQA 4RF3A 3K2EA 3SJUA 4QSMA 1PGNA 5FEUA 1C1DA 3WXBA 9LDTA 3T4EA 1OFGA 1UXGA 1VPDA 4JCOA 1XR3A 2VWQA 4B7XA 1R12A 1HYHA 2X9NA 1C1DB 3D5TA 4O6VA 4OAQA 1ZMTA 3FNFA 2I76A 1E1NA 3TZ6A 2J5RA 4JROA 4I8XA 2HQ1A 2JKVA 3LDHA 1YQGA 2XXBA 2JD2A 2PGJA 3K6JA 4Z0PA 3FTNA 2GDZA 1V3TA 3OHSX 2ZYGA 1P3DA 2VNAA 4IIVA 3DMTA 4D43A 5GZ1A 1E3SA 2GN6A 1ZK1A 4IDAA 1WZEA 1V35A 1J0XO 3JQAB 2V6GA 3GG9A 4HP8A 3ANLA 2Y93A 3DBLA 3UFXA 1WMBA 1NPDA 4HY3A 2WD7B 3TPCA 3DZJA 4RVUA 2YV3A 3L4BA 1LDMA 3ZWCA 3QE3A 4FJ0A 4E2XA 4YXFA 1XEAA 5ILOA 4LVUA 5C7IO 4BNUA 1QYVA 4IMRA 1QRRA 3VDQA 3SLKA 4BO2A 2VRCD 2B69A 4PG8A 3DTTA 3NTOA 4II2A 4CM6A 2WTBA 3ZI0A 4XDYA 2EKPA 3GQVA 3HDJA 1DBVO 1ISHA 4ZVVA 4YAIA 4PZEA 4FFLA 4RVDA 1HDCA 4OSOA 5HA5A 5I9MA 3JD4A 3ZWMA 4BO3A 3DBRA 4XYEA 3ULKA 4RV9A 4EJMA 4PZDA 1LX6A 1HE2A 4IJKA 2NNLD 5U1PA 1U28A 4R4JA 4W9NC 4ZA2A 4BO4A 1CQJA 5B12A 3CZMA 3WGYA 4YPOA 1K2WA 3O4RA 4KQXA 1GPJA 3U62A 2PV7A 5JNLA 1WXDA 3PYXA 4IDDA 3OIFA 1LDGA 5H83A 1UZLA 4A27A 5A02A 4N5LA 3JQBC 4B8ZA 2O23A 1OC4A 4IDFA 5F21A 2A35A 1MFPA 3X2EA 2YHIA 4HFMA 4GKVA 1M67A 2A9FA 3EC7A 5JFOA 2YYYA 1GADO 2X8LA 3BMNB 4XRRA 1MX3A 3WWYA 7MDHA 3IP1A 3RC9A 3OJLA 5KVQA 4ALNA 1FXSA 3G1TA 3I23A 2CVOA 3NX4A 4L73A 2PD4A 2RHRA 2VYNA 2Q1WA 2YFHA 4XJTA 3I6QA 3ZU5A 2G17A 2P9EA 3F4BA 4JJIA 3RUIA 4BIIA 2ZCUA 4NDNE 1I8TA 3KYBA 3U4HA 5LDHA 3G0OA 1C0LA 4GX0A 1EUCA 5JS6A 5DULA 1PS0A 3U09A 1YL7A 3DWFA 3IC5A 3WTCA 4A26A 4CMHA 4EUFA 5F1OA 5IG2A 3EK2A 4Q3AA 4NBVA 1A9YA 4TSKA 3ZV5A 2GN9A 3DOCA 2DBZA 3OH8A 4NIMA 1GY8A 4R5MA 3DHEA 5IDXA 1CRWG 3OIDA 1PQUA 1UXHA 1ONPA 3IUPA 1P1IA 1O5IA 4F45A 4LMRA 1NHWA 4PZCA 4RVHA 2AQKA 3WQSB 7ADHA 1W6UA 2IRWA 2AE2A 3ETGA 1ENOA 1XLTA 2GYYA 4M8SA 5IZCA 4H15A 1FDWA 3ICPA 4J1NA 2GUGA 5AXAA 1J49A 5BT9A 1LJ8A 3BA1A 3E18A 5L51A 2UDPA 2D5CA 5IN5A 1E3WA 3DTYA 1KVUA 1QG6A 1BXKA 1B8PA 2Q2QA 2J3HA 3A28A 3QVOA 4YCAA 5GMOA 4J7UA 4AJLA 1HXHA 1QYXA 2FOIA 1E6WA 4I1IA 2Y0EA 3GN2A 3VKVA 2Y99A 4ZQGA 3D4NA 3TFOA 3PHLA 1NQAO 5L40A 4I5DA 4UVIA 3IAHA 3K92A 1JKFA 2J3KA 3HSKA 5U4QA 1ZO8A 3VZSA 3F1KA 3F46A 1QV6A 5FYDA 3PYLA 4J2OA 3JQGA 1H6CA 1K6JA 4II3A 3VDRA 2DC1A 1S7CA 3JSAA 3IP3A 1DIAA 1HEUA 1I3KA 3QIVA 2R00C 1F8GA 4L0QA 3BMCB 1ZVMA 3CIFA 3BMQB 3HADA 1UXJA 4J7XA 2EW8A 4XYBA 5DCUA 4RVGA 5F5LA 4Z0HO 3JQFA 5JAZA 3GAZA 5JW6A 2DVMA 2I65A 3OQ1A 5HS4A 2B4TO 4K6FA 1I2BA 1BXGB 4Y6SA 3C1TA 3GFBA 2Y05A 3H9JA 1ISJA 3A1NA 4DQUA 5IZ4A 1V3UA 4BGUA 4CM5A 5JDCC 2BFOA 3WQRA 4AJIA 4CPDA 4U8GA 2HLPA 4BGIA 3ZHBA 2NVWA 3WYEA 3DFZA 4ITUA 1I36A 1U7HA 4DPLA 1XA0A 5I8WA 4B3HA 1NVMB 2O2YA 2YDXA 1H9AA 3JQFC 4R3WA 2PZMA 3PI7A 5F1PA 3ZDFA 2HJRA 1FDUA 5G4KA 4EI2A 4H16A 2AA3A 1GDHA 4CMJA 4R1TA 2Q1SA 5JMWA 2C20A 5CDSA 1XSEA 5G0TA 3LLSA 3OM9A 5L45A 2I6TA 1Q7GA 3H8VA 2H63A 4B3IA 3W8DA 4CV3A 4YDRA 5MDHA 4NMHA 5C7OO 4WKGA 1PSDA 3MJSA 3H9UA 4JLWA 2QW8A 2X5OA 1M66A 4CM9D 3DONA 3H9EO 3I9OA 2QIOA 4L75A 4ESOA 4BNVA 1TT7A 1P1JA 4YAEA 4J6FA 5DDIP 5CDUA 3VZRA 1WZIA 4E5KA 5EJ2A 1RPNA 3WLEA 1RYEA 4Z9XA 1LLQA 4LGVA 2AG8A 3E5MA 4MP3A 9LDBA 1LSOA 2IDZA 3QVSA 4OSPA 5HBRA 3ZV3A 2EJVA 2DUUA 3GPIA 3G49A 3B1KA 5CP8A 3KETA 3WIDA 4MVJI 1MXHA 3BMOB 3PIIA 4M89A 4MVJH 4DPMA 4BKUA 1TA4A 4XQCA 4CM3A 3ENNA 4D3DA 3Q9UA 4PRLA 2BELA 2RBEA 1PS8A 4WJZA 1DO8A 4J0FA 3WGZA 5EQDA 3UW3A 3LT2A 3RCBA 1KEWA 1CYDA 1Q0HA 1DRVA 1HTBA 3M6IA 4PLFA 4MIYA 5I8ZA 2FN7A 1GV1A 3S2IA 1MG5A 1IYZA 2OHXA 1GUYA 4TVOA 3ZWWA 4U6QA 3GVIA 3IKVA 2HK8A 1W8DA 2V7PA 3CPSA 4IXWA 4NK4A 3WJ7A 3U3XA 1ZKMA 1GZ3A 2OUIA 2PNFA 3GDFA 3EUWA 5FI5A 4Z6KA 3RASA 4AJHA 4FIZA 1ML3A 1DPGA 3CUKA 4MOWA 4PLZA 3DZHA 4E5YA 1T1SA 1PTJA 2C2YA 4RZIA 5CDYA 3QV1A 4JBGA 3KB6A 3SX2A 1PWXA 2WWRA 2VTEA 1NFFA 3OMLA 4BO7A 1ULUA 1JAYA 5IJZA 3H5AA 1K89A 1UZNA 1ZZEA 2OL4A 4MIOA 2NQ8A 2ZATA 1V8BA 1R37A 3GEMA 4CUZA 3ADPA 3ZW8A 3WG9A 1NXQA 4PG7A 2RCYA 3V1YA 5A3VA 5FI3A 2F00A 1P1RA 2WYWA 3E8XA 4BNGA 2JL1A 5AYVA 3O38A 4Z9FA 2BFPA 4J43A 1E1KA 5LCXA 3EVTA 5G0SA 3GEDA 1VLLA 3ZNPA 1BMDA 3ZWBA 3BYZA 1L7DA 4IS3A 3I4CA 4GMFA 1E3LA 3NT5A 1VI2A 4DYDA 1LRJA 4I08A 4CL3A 1T1RA 3GRPA 3OQ6A 2HCTA 3RJ5A 1C14A 2ZKLA 5DZSA 3LT0A 4U7WA 5CEJA 4QUKA 2WD8A 2Y1CA 2P9GA 1MP0A 4L9RA 2ZYAA 1K5HA 3ONDA 3L6EA 3ASUA 3ROKA 3X2FA 2YJZA 3C1OA 4YWJA 5ER6A 4PLCA 5AQ1A 4FS3A 1XHLA 4QQRA 2Q1UA 4HUJA 5HS6A 2RIRA 4GWGA 2E49A 4W82A 2OXIA 1TI7A 1ZXBA 1OAAA 1QORA 1SB8A 3DOOA 3PLNA 1P44A 1NNUA 2BI8A 3PJDA 1R4NA 2R2GA 2O3QA 3WOHA 2GR9A 2G1UA 3LZ6A 4HADA 5BSEA 2J5KA 2POQX 4G81A 1R4MA 4HKTA 1JWBB 1HZZA 4BHTA 4RJTA 3A06A 1OOEA 1ZJYA 4DMLA 3C7AA 3PYMA 1HL3A 1F06A 3ZNQA 3TZCA 1ZIDA 3JYNA 4NBWA 1QYWA 2E4AA 1N2SA 1R4MB 4E31A 1DIRA 4CMIA 1WNTA 3QSGA 4J4BA 4Y8VA 3ORFA 4XB2A 2HMTA 1WW8A 1E1MA 2ZB7A 5LDGA 3WGTA 4OQYA 4IS2A 5J23A 4EYEA 1YO6A 4YAKA 4ZQEA 3WMWA 3JQAD 4DREA 3E03A 5KJEA 1SOWA 1M6HA 2Y68A 1WP4A 1BXZA 3B70A 3BTSA 3GDOA 2IZ0A 1ZK2A 4Y67A 3RROA 3H9GA 3ADOA 4EBFA 1E92A 4R5HA 1T2AA 3D7LA 2B4RO 2EG9A 3VH2A 1E7YA 2X58A 1VKOA 3UVEA 1O9BA 5EQFA 2EEZA 1H93A 3OP4A 3C7CB 5ICSA 2I9PA 3LC7O 4FW8A 4CV0A 3TQHA 1IY8A 1QR6A 3DBHA 2CSUA 1LRKA 2XAAA 3Q11A 5T5QA 1YRLA 4MINA 4NNJA 1R6DA 1Z74A 2Q50A 1DAPA 1ZMOA 1P9LA 3P7MA 2NTJA 3DO5A 3H5RA 3OICA 1MA0A 2B5VA 2FWMX 4XYGA 3AOEC 1QLJA 3CINA 5COAA 1EBFA 1B16A 2P5YA 5DCWA 3AM5A 4JBIA 4FOOA 4KWIA 4IQ8A 3LC1O 2P4QA 3RUDA 4CQLA 1BDMA 3F5SA 1ARZA 3OJFA 1WPQA 3OF2A 4NBRA 2Y1OA 3O8QA 5GY7A 1NWHA 4CV1A 1DAOA 1Z7BA 1Y1PA 5T8KC 4GBJA 4BQRA 4CLDA 5TIIA 1LSSA 1VJ1A 3UGKA 4XQGA 2IEBA 5BR7A 4TMFA 2IXBA 4RF4A 4BNLA 3QLJA 3LT4A 4JK3A 1NFQA 4Y6RA 4OXYA 1P45A 2JJYA 3ZHYA 3DBRB 3EVNA 5EMHA 1ADFA 4XYLA 4XRGA 4CMBA 5T67A 1MV8A 2BH9A 3JD2A 4J1TA 5ICMA 2OOSA 3QVWA 4TZTA 5A9TA 1KYQA 6ADHA 4IUYA 3RJ9A 1PJBA 3RIHA 5CEFA 5TS3A 4WGGA 3DEYX 5A9SA 1PS9A 2DKNA 4RPKA 3SXPA 3AY3A 1K3TA 1UR5A 3RC2A 2BHLA 3VH3A 4YT4A 4EUHA 5CDTA 5L4SA 3RU7A 8ADHA 4EUEA 3U49A 3F6YA 2B0JA 3RBVA 1DRWA 2YW9A 1JN0A 4FQ8A 1KEUA 3VVCA 5AVOA 2P9CA 2NV6A 2H6EA 1GYPA 4LCJA 2RAFA 4GL4A 1BXGA 4BMSA 5BNIA 3SBOA 4GX5A 2DAPA 1T2DA 3AI3A 3VPFA 3ETDA 1T24A 3IJRA 1UDBA 4ZQHA 2QZZA 3NDIA 2FSVA 1ZK3A 1UDAA 4I9HA 1ONNA 5TSDA 5JDCA 4PLVA 5BQFA 1JKJA 3LVFO 4M1QA 1DJQA 3KSZO 1J5PA 2OFPA 4J1QA 5CG1A 3DDNA 4Z0TA 1C0IA 1LXCA 1ZXLA 4B7UA 4QTZA 4EW6A 5K6AC 1UP4A 3F9IA 4R3NA 3PWSA 4UVEA 2CF5A 4XGIA 4EJ0A 3PZRA 2NVUA 4IPTA 1UP7A 3JTMA 4R54A 1NR1A 1A7AA 3HFSA 2ZJ0A 5KJFA 1IHYA 4YJHA 4RDIA 4Q3NA 1B14A 5A3JA 1R16A 1VM6A 4FC7A 1JA9A 2WMDA 3KUXA 3JQ8A 4PIVA 3QP9A 2H5LA 4TQGA 1GEEA 3B20A 3WBBA 4BMNA 2GLXA 3ICCA 3R0IA 2G0TA 3AM3A 3U4DA 3RVDA 4W9NA 2D3TA 3T7CA 2Q3EA 3DBHB 5B1YA 4AJJA 1U8XX 3VHRA 1PQPA 1I33A 4DRYA 2AQHA 1OC2A 4NJMB 4ND3A 1WAMA 1RYDA 1J6UA 4Z3KA 2FR8A 1I5RA 3AWDA 4CQMD 4J0EA 1JDJA 4KP7A 4F3YA 3Q9NA 3CTMA 5TJHA 4XYMA 5I7FA 2BI7A 3IMFA 3KTDA 4IDGA 3WGOA 3G3EA 2FY8A 1GR0A 1JWAB 3HFGA 1H6AA 3GZNA 3TZHA 3HN7A 1A4UA 4E33A 3DB2A 2JHGA 1DC4A 2UAGA 2YY7A 1XQ1A 2VZ9A 3P5SA 1HDRA 3JQ7B 3MJTA 3UHAA 4TRRA 1XDWA 3LYLA 4AJKA 4NK5A 1DIHA 5TGDA 1CQIA 1ZFNA 1VL0A 4MVJA 5EIOA 3HJAA 1MUUA 1ZSVA 2C29D 1FJHA 3Q1LA 1B3BA 2YFQA 1MC5A 2X0IA 1X1TA 4FFNA 1XELA 2B35A 1PGPA 2YHUA 2OP1A 3ZCXA 2CDCA 3NTRA 2E37A 1G0OA 3PQDA 4B4UA 5I7SA 2CDBA 4P22A 5KWEA 1H2BA 2PZKA 3QJ5A 2I66A 2ZQZA 1C1XB 2B36A 3ENKA 5BNFA 1SB9A 2FZEA 3LK7A 2Y66A 3BTOA 3GVPA 2Z5LA 4XDZA 4RQUA 1F8FA 1Y9AA 2Q99A 3UAGA 1P74A 1QYCA 3OA0A 3K31A 2YDYA 4K1LA 4NBTA 4OKIA 1EZ4A 4PGFA 2DQ4A 1M6WA 1PJQA 2SCUA 4J90A 1E7MA 1NBOA 1YH3A 3K30A 4A03A 4ND5A 3GZNB 1SEVA 4DMMA 1EK5A 1U3TA 2X22A 3PJGA 2O4UX 3LF2A 5U9CA 2WE7A 5B4TA 2CNBA 1FMCA 3ONFA 2GERA 3A9WA 1GU7A 4RGBA 3QVXA 3ZV6A 4JJGA 4I9UA 2V6MA 5EERA 4DIBA 4F6LA 1BW9A 4QECA 1U3WA 4KMSA 1NP3A 3CXRA 3WBFA 3W8EA 4E13A 2NUAA 4M86A 5GZ3A 3E1KA 1Y5MA 3B1JA 1K6XA 3V2UA 1GUZA 3M1LA 3CH6A 1JKIA 3GF4A 3DOJA 3NYWA 2TMDA 3PK0A 1PGQA 1PZHA 3S55A 3TOZA 5JSFA 4R69A 5K9ZA 1LQUA 2OZPA 3KEOA 2DM6A 4W6ZA 1PJTA 4FDAA 3AUUA 3QWAA 2EERA 1JLLA 4BNWA 1WVGA 5L4LA 3ROPA 5HTOA 5THQA 1HETA 5I9LA 1YBVA 3GVXA 1NHGA 3V1TC 4QX6A 2P4HX 2AMFA 3INGA 3NDJA 4U5QA 1R0KA 3OIGA 3PJFA 2O7QA 2GF2A 2DBVO 3G17A 3PEFA 4PLPA 4J9VA 4JXKA 1PZEA 1LLUA 2WJPA 2ZIZA 3I1JA 4JQCA 2C07A 4BNNA 4D0SA 3MJVA 2ET6A 5EN4A 2EJWA 2HJSA 4XR9A 2C82A 4WECA 2Z1MA 3NDRA 1V0JA 5AXBA 3PWKA 5TQVA 5JC1A 4RVFA 3DHYA 3H3JA 5KNLA 2GN4A 2X86A 2CVZA 4MIEA 3I9KA 4AFNA 4YRAA 1TVEA 3HB5X 4B4WA 1PGOA 3V2GA 1H0KA 4GVXA 4EZBA 1PZGA 1TLTA 4HXYA 1L1FA 5A9SB 4U6SA 5JAIA 3IL2A 3E82A 3PRJA 1EBUA 4NFYA 4AJ1A 2C7GA 3NEPX 4BL5A 5ES3A 1LQTA 3GNQA 3HZZA 4P8RA 2W90A 3C3XA 3WFJA 3WQQA 3PDUA 3GPDG 4L8VA 4Z9YA 1XWFA 3AU8A 1JVSA 4K26A 1FDVA 3L9WA 3GGPA 4ZRMA 4BOYA 1UZMA 3AFNA 3Q3CA 3HUDA 4UUPA 3WFIA 1XKQA 3RFVA 3H2ZA 5BSGA 4BNJA 4A5OA 4ZN6A 1HYEA 3P2YA 4KWHA 3A4VA 4DC1A 5HM8A 3N7UA 1XG5A 3JV7A 1P33A 1VSUA 2ZYDA 1O8CA 3AI1A 3FBGA 3JQGB 3WYCA 2C59A 4CM8B 5G4KB 2IE0A 5T64A 3VPSA 1DLJA 4BGEA 3PZBA 2BGLA 5L4NA 1IPEA 4ALKA 1WLYA 5JCJA 4INAA 4KTTE 4R41A 3PXXA 1GQ2A 5G0WA 1PJ2A 4UULA 1KY4A 4MVJM 3WS7A 3FHLA 1MLDA 1T2FA 2O3UA 3OBBA 4FFPA 3QVTA 1OMOA 1NASA 1LDYA 1EFLA 2DLDA 4J4TA 3ANMA 3PGJA 2DPGA 1P1HA 2VRBA 2PFGA 3ZNOA 2Z95A 3AY7A 1LLDA 3FI9A 4DWVA 4W7IA 2AHRA 4DA9A 3GMDA 3FRJA 3HN2A 4Q9NA 1HDZA 4OXKA 4TROA 4X54A 1ENZA 1P1FA 4LRTB 5ER9A 4NG5A 4GGOA 5G4LA 1XCBA 3K8ZA 1QSGA 2VHYA 2W4QA 3U4IA 4BO9A 4E5MA 3V2HA 1XGKA 2YQ4A 4FOSA 1EVZA 3Q2KA 5DOZA 1TT5B 1PEDA 2D0IA 1OBFO 5JMPA 4CR7A 3UUWA 4OOFA 1Q1NA 1ISGA 4A0SA 4ZQBA 1HE5A 1GAEO 1TT5A 4IXTA 4FB5A 2X4GA 4MVJD 2NU6A 3CKYA 1A4IA 2DBRA 4TRMA 4KDEA 1YJ8A 2WM3A 2HMUA 3JYLA 4J9UE 2HMWA 5TF4A 4A2CA 4WLVA 4OMUA 4BNXA 5KKCA 3ZU3A 4JGBA 1T2EA 1HSZA 4MJLA 2JAPA 4O63O 1YE3A 5CPBA 1PIWA 3HDHA 3GFGA 4WNIA 4YQZA 2IYPA 3I6IA 2CVQA 1DFHA 2PD3A 2PGDA 1HF3A 1E3EA 4GWKA 1EFKA 3W4KA 5H81A 2O3RA 2PKQO 4ND2A 3L9XA 4FC6A 4QFCA 4YRBA 4BMVA 1IE3A 4S1VA 1BWSA 3HHPA 4WCFC 5DBFA 1DEHA 1G0NA 1SO8A 2BKAA 1HLDA 4RPJA 1X0VA 1JQBA 2QYTA 2VYND 3GUYA 3MJEA 3WICA 3KVOA 3K5PA 4MPDA 4RORA 4EEZA 1LSUA 4BV8A 1KC1A 4OXNA 4DXHA 1YBMA 3QA9A 4WOKA 4QO7A 4EITA 1GYRA 2EWMA 2Y1FA 3ETEA 3WLFA 5DOVA 2J6IA 2HU2A 3F5QA 3ITDA 2C7VA 4GAEA 1HT0A 2NACA 2YQ5A 2HO5A 3GLQA 1M76A 2NU8A 2NTVA 2QRKA 1GQQA 2O50A 1DFGA 3VTZA 4BO1A 3K73O 3KYCB 2FRDA 3CZRA 2GRAA 2PTGA 1P0CA 3JD1A 3HQ4O 4DIFA 2RH4A 3COSA 3NJ4A 1ISIA 4LVCA 5T57A 5CG2A 2J3JA 2AQ8A 4OYRA 1GD1O 5A5FA 3DZIA 3GY0A 1DXYA 3L77A 1LBEA 4NPCA 3GT0A 5JC8A 2UUOA 4BNTA 2O3TA 1NPTO 2X0JA 3T4XA 5DNAA 3WMXA 4XX0A 4B79A 2ZTLA 1B26A 3OECA 4YJGB 3STHA 3ABIA 4P4NA 3OEYA 2PZLA 3RUHA 4JP2A 3LF1A 3EDMA 3PP8A 4E2WA 4IGEA 3RKRA 1XQ6A 1UUFA 3PFWO 4AL4A 4LCEA 3ROQA 1MFZA 2PK3A 3JQEA 1B15A 3B6ZA 3WX0A 5L53A 5DP1A 2AW5A 2QG4A 4O0LA 1NWCA 1YXMA 3DC2A 2DFVA 3AUSA 3NTQA 3RBXA 4ONEA 4R9SA 1X1EA 4NI5A 2P5UA 2C5EA 4LISA 5I7EA 1I0ZA 1XU7A 2UUPA 4QEDA 3KRTA 5COQA 3SLGA 3U5TA 3KYDB 5CHEA 3O9ZA 1I3LA 2WYUA 1E7SA 4E5NA 2I3GA 4QO8A 4AJOA 4CM7A 5DCYA 1GFSA 4BNMA 1KBZA 1NM5A 1FF9A 4D3FA 2JFGA 1YGYA 2QHXA 4XR4A 3C85A 2JFFA 3MEQA 4JP3A 3PHJA 2YZ7A 5IN4A 4UUMA 5ITVA 4KQWA 4K28A 1O89A 1RWBA 2B4QA 2V6BA 2W2KA 3C24A 4PRKA 1CIVA 5IDWA 1ENYA 3JQ8B 3GC6A 1RKXA 3VKUA 1E3IA 3DFUA 3EY4A 1K6IA 2VUUA 5B4UA 1HE4A 3QWHA 1N7HA 4CJXA 1R4NB 3WWZA 1PL7A 1D4FA 3UKOA 3TZQA 1BVUA 2HRBA 2V65A 3E5RA 4A7PA 4BNYA 3IOYA 2X1HA 3PWZA 4BKQA 2QX7A 4DTIA 2IXAA 2HMVA 4YR9A 2DPHA 4L4XA 5L95A 5BSFA 1Y8QA 1AXEA 4C7JA 2AEFA 2GO1A 2WDZA 1PGJA 4RL6A 1HDYA 3H9QA 1HDGO 5LC1A 2EP7A 4J49A 4XJSA 2E48A 2HRZA 2Q2VA 3IS3A 4NQZA 1N5DA 3FSRA 1QKIA 5F5NA 3E9MA 1Z75A 2I67A 1CEQA 4DGSA 2NQTA 3AM4A 4FSHA 4DC0A 4UVDA 3MZ0A 5CFZA 1YB5A 3I9JA 4FFMA 4E21A 2ZQYA 1WDMA 3D3EA 3GG2A 3GK3A 5KJCA 2X7HA 3LLVA 1ZH8A 1RM3A 3KEQA 4WOJA 1WWKA 1UH5A 2IEDA 4DL9A 1NPYA 1GTMA 2UV8A 5C5IA 1PQWA 1M75A 4L4SA 1K0UA 3UH1A 1LUAA 3DHNA 2ZTMA 3MOGA 3GNTA 3AOGA 5HWSA 2VTDA 4YB8A 4MKRA 4KDFA 3GVHA 3W1VA 3E9NA 4UVGA 4DBZA 4RLSA 5L7YA 3UN1A 3FNHA 3PQFA 5I9NA 3QWFA 3R6DA 1EEHA 2PH5A 3WYBA 2VHWA 3D4OA 1Q0QA 1DRUA 4EJ6A 1DHRA 4RF5A 5FFFA 1RM5A 3ZHXA 1A7KA 3GA0A 4NU5A 3AK4A 4TVBA 3DAPA 3EYWA 5K0ZA 3VH1A 3G79A 3AOEA 4TKMA 5TX7A 4A10A 4BB5A 4IBOA 3TOXA 1A5ZA 2HKIA 4OO3A 4LSWA 4GPD1 3PIDA 3LSYA 3TJRA 1QV7A 4I5EA 3R3SA 3VTFA 2HMSA 4ZJUA 1ISFA 3I9LA 3GRKA 5KVCA 4PFJA 4KUHA 1WDLA 3UOGA 1GPDG 4OKNA 1EQUA 3BHMA 1E6EA 1SAYA 1O95A 1D8AA 1QXSA 1YL6A 1UAYA 2NADA 4BNFA 2O48X 4AJ4A 2FPPA 4PCVA 1F14A 3RC7A 4ALMA 1NQOA 4YJHB 5EESA 1PWZA 1U4OA 4RPLA 4OL9A 3VVBA 3WGIA 3GVCA 2JHFA 3GNSA 3DZGA 4IJUA 4LK3A 2NVUB 3RU9A 1NVGA 4MVJG 4N54A 3JQBA 1VJ0A 1ZBQA 2BMAA 1YS4A 1PR3A 3FR8A 1R0LA 2C0CA 4WLUA 1U3VA 4AG3A 3BHJA 2NU7A 4IZIA 5TLSA 1LA2A 3U4CA 3H5NA 4BV9A 3PQEA 4FFRA 5KTKA 3JD0A 3OETA 4PG5A 4B7CA 3QHAA 3GOHA 3Q6IA 4FN4A 1SEPA 4GMGA 4ZHSA 4BO8A 5B4VA 2C5AA 1B8UA 4E2ZA 1N92A 5IFLA 4EGFA 3ST7A 3MJCA 4NBUA 1GEGA 1AXGA 3O26A 3PVZA 1Y8RA 3NAQA 2EP5A 1BTOA 1YDWA 4K6CA 5JE8A 1ID1A 3MTJA 3QW2A 3IDSA 3KV3O 2VT2A 1W0CA 4AJ2A 1I24A 1DB3A 1U8FO 3AUAA 4YJGA 4BO0A 4MDHA 4AJNA 4CQMB 1J4AA 5FWNA 2O2SA 3GR6A 4KUGA 1YQDA 2O4CA 1PJ4A 2Q49A 3HDYA 1BW9B 3WSVA 4OIMA 3U9LA 1A72A 1EVIA 1E0DA 1E5LA 3DMTC 2FHSA 3GH3A 1RM4A 3PJEA 4B4OA 1EMDA 2JD1A 1KEPA 2VHXA 3G1UA 4D3SA 2C54A 3ASVA 4H7PA 2F1KA 4UUNA 3AU9A 4W99A 3H7AA 3NGLA 4DYVA 4IJWA 3IJPA 1UAGA 4IDBA 2FR1A 1HKUA 2FPIA 2PWZA 2RHCA 3BMCA 3M2PA 4J4HA 4LSMA 1ONOA 1GCOA 1Z73A 3E9QA 5AXDA 1NFRA 4FJ1A 1LNQA 1EVYA 3D4PA 1ZCJA 1U3UA 3WGGA 1HRDA 1YB1A 3DAFA 3WDSA 4E4YA 2QRJA 5ENVA 1X15A 4CUKA 4YJDA 3FWNA 4CR8A 1NVTA 1EK6A 4RPHA 3I52A 4J16A 4BNKA 2GZ2A 3DXFA 1I32A 4WLFA 4BGVA 1JU9A 3EHEA 3PHIA 3HWRA 3D1LA 2YV1A 4L74A 4PG4A 1IZ9A 1YB4A 1E1LA 3DQPA 4OM8A 1KIFA 2C2XA 4XZ3A 3NV9A 1MXFA 2NSDA 5MGBA 2WD7A 4R1UA 2VHVA 2AXQA 2E82A 4Y98A 3HG7A 4A73A 1IB6A 1U5CA 1YOVA 4FPXA 8LDHA 1BSVA 4J1SA 1LSJA 3U0BA 3WB9A 3VZPA 3KM0A 2Y67A 2W8ZA 3BMQA 1MGOA 3KZVA 2VWPA 2QQ5A 1LDNA 3I83A 4IJVA 3SEFA 4HWKA 1XYGA 2GCGA 1IUKA 1TXGA 1NX6A 2BFAA 1IULA 1U9JA 3NKLA 3V5NA 2EKQA 4NU6A 1EE9A 1F17A 1U2GA 2GSDA 1EUZA 3WNQA 1QMGA 1KETA 2IODA 2OP0A 4R01A 3INRA 4O59O 4YJFB 2Q2WA 1Y6JA 4RVSA 2ILTA 2ZJ1A 3KBOA 3JD3A 5TJ9A 2LDBA 1H5QA 4IDCA 4YT2A 3KLPX 5ADHA 4L76A 1C0KA 3H2SA 3JQ9C 3TRIA 1VC2A 5T8KA 1CJCA 4MVJE 1KVTA 2VQ3A 1R66A 1MG0A 1PJCA 1YONA 2D1YA 4MKXA 5EPOA 4B8WA 4XGKA 4CLOB 3BXXA 1TB4A 4KTVE 3FNGA 4UEKA 2X23A 2X5JO 2PR2A 2EGHA 4ND1A 4F46A 2D59A 2EF1A 2VT3A 1DHTA 1HWYA 4ILKA 2XF8A 4XQEA 4IGFA 5TC4A 3L4BC 5A06A 1UP6A 4WNCA 1PL8A 5JCXA 4YBZA 2EIHA 2R00A 3CMMA 5BNTA 1G1AA 4MVJP 5JLAA 4IDEA 4DLBA 4XWYA 3VC7A 5A4DA 3HB4X 4B3JA 1SZJG 4CM8A 1P31A 2AQIA 1VL8A 1ZEJA 3RUEA 1ULSA 2DBQA 3H65A 3EMKA 5G0VA 2AG5A 5IDQA 2G5CA 4NJOA 1DC5A 4OHUA 4DQXA 1D3AA 2D5AA 4IINA 3D64A 2Z1NA 5IDYA 2PZJA 1E7WA 1GUFA 2JD0A 3B1FA 4O5OA 4HFNA 2NWQA 3QQPA 3FTPA 2BGKA 2BGMA 2VYVA 2NU9A 4OQZA 4JNKA 3DZKA 2AEJA 1EE2A 3BMNA 3ZGYA 5JY1A 2ZTVA 1JW9B 4IIUA 3S1LA 4WEQA 2LDXA 4O1MA 1PJLA 1EQ2A 3JQ9A 1IL0A 1EUDA 1B8VA 4G5HA 4ZGWA 2GNAA 4UVHA 2OORA 1ADBA 3WSWA 4JJFA 2Y1DA 3EAGA 4Z3DA 3OJEA 5DBGA 1E6UA 4XB1A 3OJ0A 1T4BA 4GQAA 4OGWA 2JCYA 3ROMA 2H9IA 3K96A 5C37A 3L07A 4K9DA 2Q4EA 3AUTA 4CODB 1LC3A 4YEDA 4RDHA 4ALLA 3ZWPA 1N8KA 1DSSG 1JAXA 3L4SO 3KYDA 3GGOA 5TT0A 3O03A 3I9MA 3RFTA 2Q45A 1DDOA 2OBYA 4AJPA 2HUNA 1KVQA 4D0RA 5DBIA 3FR7A 4WK6A 5B37A 4PG6A 3VPXA 3AJRA 1LDBA 4CMCA 4PVDA 3O8QB 4PLTA 2DFDA 2BF7A 4YYZA 4N5NA 4CR6A 2XXJA 2VOEA 3CMCO 4N7RA 3DMYA 1P77A 3RD5A 3S2GA 2X5KO 5T6BA 4IZHA 1F0YA 4HNGA 1V9LA 1T25A 2CZCA 3JYOA 2JFHA 4UREA 3DAGA 3RUAA 1IOLA 3ZU4A 1YDEA 2JCXA 1D7OA 3GEGA 3NJ8A 1HDXA 2WYVA 3ZHZA 2GGSA 1ZNQO 3ZWNA 4G65A 1AHHA 1TEHA 3FD8A 3RC1A 2PD6A 4AJEA 1T26A 1VRWA 3RUCA 4CM4B 1I10A 2A4KA 1NYTA 2OBNA 4DIOA 1EVJA 1ZSYA 4GH5A 3H3FA 1FDTA 3MWEB 4QT0A 2G76A 1KERA 3KOUA 2YV2A 4FCCA 4Q3EA 1NTOA 1T2CA 4J2HA 3OEWA 1XU9A 4YRDA 5KOIA 3ZWYA 3PTZA 3S2FA 1WDKA 4GSLA 4UEJA 1LLCA 3Q0EA 5KVVA 1DJNA 3NT2A 2DTDA 3OA2A 3TFQA 4CMGA 4WE3A 3IIEA 4UEOA 4BKRA 1P0FA 5I7VA 2GPTA 3UCFA 3TZKA 4XCVA 1UDCA 1PL6A 5DP2A 4D45A 3CE6A 2W2LD 3D0OA 1IPFA 1VKNA 5JYDA 5JY6A 1OI7A 4FFOA 5BSHA 3OFSA 3RQSA 4PLYA 1MC4A 4XIJA 2RH8A 4JX8A 1E7QA 4Q3BA 5AOVA 2P2SA 3GUCA 5G0UA 4I5GA 5JDIA 4YVFA 4E2YA 1RJWA 2X9GA 4R68A 4YQYA 2WSBA 4ZQFA 3TN7A 3MTGA 4KZPA 1YWGO 3KLMX 5AXCA 3WJAA 2X9VA 2O3JA 4CM4A 1ZJZA 1FDSA 4RPGA 4URFA 2CY0A 4RLHA 1I2CA 4GGPA 2D4AA 1C0PA 3C8MA 3SVTA 3BAZA 4M54A 5JPIA 3ZWAA 2CFCA 3NGXA 4E32A 5ILGA 3JQ7A 1ADCA 1Q7BA 2IZZA 2QZ9A 1VE9A 4WEOA 4E12A 5CDGA 1JVBA 4U0JA 1NR7A 2FSSA 5A5EA 3LC2O 1V6AA 4CM1A 4M87A 2ZB8A 4J91A 2VN8A 3F47A 3HE3A 1QLHA 1PJ3A 5ENDA 3BHIA 1UXIA 5DF1A 1N7GA 1BRMA 1HDOA 4OJNA 5KJ6A 1AHIA 1S6YA 4R1SA 1LRLA 3FWZA 3RAJA 1YQXA 3UCEA 3AFMA 3E6AA 2WEKA 4ID9A 5KVSA 1IHXA 2EHDA 3TL2A 2OMEA 3AW9A 4TKLA 1GZ4A 5CEEA 3R3JA 4FR5A 4HFJA 4WASA 2YHIB 4ZU3A 5TT1A 1HE3A 2HK9A 2ZB4A 3KHUA 4TZKA 3BTVA 4AVYA 5L9AA 3GN1A 4NZ9A 1BGVA 2EV9A 5L7TA 3C7DB 4QXMA 4R1NA 4MVJF 4FD3A 1D1SA 4ZD6A 1YOVB 1Z6ZA 4IM7A 1E5QA 5KCZA 3F3SA 3RSHA 4HNHA 3PHGA 1R0SA 1WMAA 4R51A 4RQTA 1Z82A 2ZCVA 4M55A 1ZEMA 1DC6A 1PU2A 1Q2XA 2CUKA 4C4OA 4D79A 2GN8A 4ZICA 2OO5A 1N1GA 3ANNA 3BZUA 4HFRA 2CD9A 3OSUA 1I3MA 4MO2A 3K2BA 1Y5RA 2EXXA 4WLEA 4LN1A 1IZ0A 2XOXA 4JIGA 4CLXA 3ZV4A 1I3NA 4HBGA 1DLIA 1PZFA 4NH4A 4YT8A 1E7RA 1CERA 4CM9A 4P4GA 5COBA 3GZ4A 2HDHA 4WLOA 5G2OA 4FGSA 3HNPA 4RO0A 4GSKA 2PLAA 3WR5A 1B3RA 2PGLA 3MCVA 2VNSA 1A71A 4D44A 2DUWA 3L0DA 1Y7TA 5JAMA 2A92A 3JQAA 1OZAA 3OJOA 3V8BA 2E6UX 4E0BA 1NAIA 3W8FA 3ZWVA 3VPHA 1VL6A 1YL5A 1EDZA 4BKOA 4YAGA 1U5AA 4JBHA 1DIBA 4NFSA 1KOLA 3P19A 5A9RA 4PLWA 2PA3A 2NM0A 1L7EA 2NLOA 4TRNA 4J3FA 3RI3A 3TDKA 1NQTA 3F4LA 1CWUA 2Y0DA 1HLPA 4D46A 4PLGA 5JYEA 2O3SA 2VZ8A 2NVBA 5IF3A 2ZB3A 4XGNA 4BS9A 1U2DA 5A04A 2EKLA 3LU1A 4LMPA 4MKZA 1KC3A 2I3AA 2D2IA 3FN4A 4R16A 4WCFB 3W6ZA 4DLLA 2B83A 3LQFA 3GGGA 5KIAA 1LDEA 4B4VA 1UJMA 1X7GA 3LT1A 5EL0A 4WPGA 4BKPA 3RBZA 3ZWOA 1ADGA 1FK8A 1GV0A 3SC6A 2W2LA 2P68A 4CLEA 2UYYA 1AGNA 5JO0A 1Y9EA 2BRUA 3FF4A 1E77A 3DBVO 1ISMA 4E30A 3P2OA 4NHEA 3GHHA 4TRJA 4BVAA 4OH1A 4GLLA 3CSDA 5TNXA 4ALJA 2J3IA 4Y6PA 2GZ1A 3INTA 4XEHA 2JAHA 1KVSA 4NJMA 1LI4A 3I9NA 4XA8A 1V3VA 5GZ6A 4RCVA 3S2EA 4E3ZA 4ALIA 1X7DA 1P1KA 4D42A 2X0RA 3JYQA 1KEVA 4C7KA 3TL3A 4DVJA 5JO9A 3QY9A 5A03A 3H4VA 4YACA 4N5MA 2DTXA 2UVDA 1E3WB 3EZYA 3KSUA 3RFXA 1AN9A 1B0AA 4HX5A 4NR0A 1N9GB 4BO6A 4CMEC 3RUFA 5CAEA 3IUSA 1H94A 2YUTA 4CLHA 1PR9A 1UXKA 5ITWA 3JYPA 1DFIA 3AY6A 5IXYA 4W4TA 5THKA 1H6DA 1A9ZA 1SNYA 2QRLA 3FNEA 3N58A 4L4RA 1X0XA 4TWRA 2Y0CA 3VPGA 4CMAA 1SCUA 3EZLA 3PHHA 3UXYA 4G2NA 2DU8A 1GYQA 2VZ0A 3KSDO 1T4DA 2VCYA 5C3MA 4R9RA 1BG6A 4KOAA 5IXSA 1LC0A 1O0SA 2WE8A 2VRCA 3RKUA 1LTHR 3EW7A 4YT5A 1U4SA 4YJFA 1LU9A 1F12A 3F1LA 1U1IA 4EEXA 2I99A 4IY1A 4DLAA 3L6OO 3NUGA 3ZWXA 1AUPA 1KS9A 3WIEA 3K9QO 1G6KA 1Q0LA 4CV2A 2NTNA 3GDGA 4WCFA 3WNVA 2CMDA 3UF0A 3W4IA 2Q1TA 3DR3A 3QRWA 3H6KA 1E3JA 3S8MA 4U0KA 4YTEA 5A05A 1ORRA 1Y8QB 3I3OA 4BO5A 2H1SA 3JQCA 2XPCA 4CUJA 1YKFA 1NAHA 4WLNA 2JCVA 3JCZA 3D3WB 4GX2A 3FPCA 3PFFA 2FP4A 2VWGA 2TMGA 4GKBA 5DN9A 5F1KA 3EGOA 3MJ4A 3R1IA 5EINA 2CDAA 1HYGA 2D8AA 1H2HA 1ZSNA 4ROSA 3PPIA 4S3MA 2AEMA 5L7WA 4CQMA 2VYVD 3ZW9A 5JAQA 4BB6A 1HZJA 2FR0A 2HSDA 2ZTUA 4CMKA 4W7HA 1H9BA 4DPKA 5IZCC 3W6UA 3ZU2A 3KYCA 4MP8A 3T7EA 3ZN2A 3TF5A 2Y1GA 1AE1A 2V6FA 4FJ2A 4AICA 4PN3A 3I4FA 1W4ZA 4YA6A 1XIVA 5CPFA 3QWBA 2QYSA 1U7TA 4XKJA 1SBYA 4BNIA 4J7CA 5JDIC 4RZHA 2J8ZA 3DZFA 1HSOA 1A27A 4DQVA 3WGHA 4GVLA 1D1TA 4E6PA 2IZ1A 2J5QA 5IAAA 1PX0A 4BUCA 1YJQA 1VSVA 2BD0A 2VHZA 3TSCA 4CQLB 2Q4BA 4Q3DA 4BNHA 2CF6A 3KO8A 2GD1O 3PDJA 3WGQA 2PKRA 3E48A 2W98A 3Q2IA 3WTBA 1NQ5A 3IKTA 3D3WA 2BFMA 4IQGA 2VOJA 4CLOA 2B5WA 2G82A 2HK7A 5TRTA 4M49A 4PVCA 2EGGA 4WCDA 3FBTA 1M2WA 3V1UA 2B37A 3MWDB 4GLOA 4BQPA 3NRCA 3UICA 4I9NA 3VZQA 3RWBA 2BLLA 2Q46A 1VJTA 4Q39A 4D7AA 3BIOA 4FBGA 4XQ9A 1QYDA 4IQ0A 1Y81A 4CMEA 5HRUA 2FPGA 5JCJD 3SJ7A 3ZZNA 3OQBA 4MP6A 4BNZA 1EDOA 2Y1EA 1CF2O 4EDFA 1O6ZA 5DT9A 4YAJA 5F3RA 2GASA 2FZWA 5L3ZA 2OGUA 4WUVA 4DBVO 2X6TA 1YBAA 4Y9DA 3M2TA 3JQ6A 1ENPA 2VUTA 1DIGA 2ZK7A 3FCOA 4FGWA 4ND4A 3VH4A 3C1AA 4E5PA 1SOVA 1YVEI 2GZ3A 4D41A 1SMKA 1KVRA 3DZBA 4XIYA 1JTVA 2AE1A 4KUEA 5JBIA 2EW2A 2A94A 4CL8A 4CMIB 3BMOA 4OOEA 1ZUD1 3ONEA 2PY6A 1QP8A 1CETA 1SPXA 3N74A 1CDOA 2VUSA 1LEHA 1B7GO 2DTEA 2PH3A 3IQDB 5FF9A 5JXWA 3GHYA 1X14A 3VOSA 4ZRNA 1B2LA 1N1EA 1Z45A 4JN6B 1Z7EA 1PJSA 3PLRA 4P4LA 1GZ6A 2I5PO 2IYOA 5C7LO 5A1TA 1RM0A 4UAGA 1Q7CA 4IMPA 4GX1A 4NFHA 1BVRA 1W73A 1C3VA 1X7HA 3BTUA 1O94A 3ZNNA 3A14A 4DUPA 1MB4A 3VAZA 4I5FA 4CLRB 2DT5A 4PLHA 1BHSA 3NT4A 5KKAA 4CLRA 3UCXA 4LRSB 3GAFA 1BDBA 2HAEA 2O7SA 5H82A 3PGXA 1I2ZA 1GCUA 2FMUA 2R6JA 4UUOA 3TNLA 6LDHA 1ZW1A 4GI2A 1C1XA 1N9GA
chains in the Genus database with same CATH superfamily
2Y6VA 4XCQA 2JGFA 4Q3CA 2P7HA 1JJBA 2JFPA 1T9CA 3H05A 3QWIA 5FTNA 2SBTA 1JLSA 2FEMA 1GFZA 3IKMB 5BV8A 3AI2A 2WWXA 5HNKA 3T9DA 4EARA 1GQYA 4JA0A 1ZN8A 3NONA 1Q0UA 3O2QB 3OTGA 4GC9A 3QKUA 4HX9A 1OFHA 1ELOA 4N18A 4LW8A 1QF7A 5FNZA 3UWSA 2YNMA 1JG2A 2H29A 3DCIA 1EJBA 4NZPA 2DWCA 3W1EA 2BLNA 4B9EA 4KQFA 4GD3Q 5LZ7A 1R15A 3LUAA 3DFMA 3QLUA 3ZH2A 1XALA 4WHMA 3EGXA 3CG4A 2ZITA 3BE5A 2WU4A 3SEQA 2BHTA 3GMSA 1QAMA 4MAMA 4RTPA 3LVRE 4A82A 4F6CA 3NZEA 1DMSA 1PTKA 2IPLA 4OGFA 3WL5A 1Y1RA 1GGNA 4P53A 3ON5A 2QTZA 4N7MA 2X0NA 1RXEA 3CA8A 1I1OA 1YS6A 3I5MA 4J0HA 4M9XA 5ESDA 4DN6A 4HV4A 5K3EA 4RF3A 4CNBA 3BK1A 3CJQA 3WZMA 4K88A 3SM9A 1SUDA 1T5HX 2C4WA 2PLRA 2Z57A 1ZRHA 3IDZA 4FNMA 4EGJA 4YX9A 1UWCA 1YQQA 3P2IA 4MW6A 1B42A 4P31A 5KYKA 3RIYA 3BCUA 3WXBA 1CJKC 1E3TA 1ZXXA 1UXGA 1VPDA 2A5GA 2OGZA 4KAAA 3C97A 2VWQA 4TS3A 2ZJ2A 2HQBA 3D5TA 1K68A 4P4SB 1XZQA 1HI9A 4YI3A 2I76A 4H4DA 1JSRA 2AF4C 2FAXA 2JKVA 2P2ZA 4I8XA 4MEJA 3LDHA 2QMOA 2TS1A 1H65A 4WY5A 3HV2A 3R8CA 3TM5A 1TEVA 3TW8B 1UJCA 2GJ9A 3U3JA 1D9XA 4N40A 4A8PA 2JFOA 2PKYX 5L3VA 3KHSA 3C5HA 1Q3HA 3T9BA 3UQZA 4ZTUB 2AXEA 2ZYGA 4OI2A 1P3DA 4S2UA 4IIFA 4D43A 4W5OA 5KYXA 3PG5A 1WZEA 3PC2A 1HBJA 1TCCA 2PZFA 5HSGA 2Y93A 1N2IA 2JCGA 2QX8A 1MT0A 1PUJA 1R10A 1NLZA 3KFLA 4Y2YA 3J7TA 4KPYA 1XJCA 1SBQA 3JVDA 3A9SA 3CVVA 1BE1A 2YV3A 3L4BA 3ETCA 1KI7A 2IXGA 1OLUB 4YXFA 1TJNA 3VR5A 4US0R 3BDAA 2Y6UA 3AXTA 3S2SA 1EJ2A 2B69A 2A0FA 2JAUA 3NTOA 4CM6A 1AG9A 1RKQA 3ZI0A 1DDIA 2OPHA 4C0SA 4B3BA 3ZHUA 1NF3A 1ULAA 2NO4A 2EZTA 3MD0A 2J31A 3E05A 2ERCA 3G1WA 1PT6A 2OE2A 3KKEA 4HF7A 4WV3A 4BX0A 2EX0A 3JD4A 5DEIA 3LV8A 3A6FA 4JVOA 3KIPA 2ERXA 4HGYA 1LX6A 4D8UA 3ZHSA 1YK1A 2C42A 3K0KA 2X15A 2NNLD 3QFRA 1FL9A 4K7JA 2QTCA 3RWMB 5H3LA 1U28A 4R4JA 3IIKA 4W9NC 3TLCA 4B9AA 4BO4A 2XOEA 4YPOA 2CD7A 3DVLA 1P6XA 1ZMRA 3AVWA 1OY1A 2PO5A 3HVUA 2PV7A 1Y8ZA 4KO3S 4O2RA 5DYNA 2IX3A 2QLTA 1SUBA 1LDGA 3CRMA 1SWVA 3GBVA 1UZLA 3ZLTA 4B8ZA 4GXQA 4Z4CA 1OC4A 4LSGA 3WK6A 1BNCA 4N48A 3E5NA 3K8YA 4UNIA 4WXMA 3HCDA 1M67A 3EC7A 2OCLA 2YYYA 4CI0B 1HQDA 2BMWA 3FA2A 4F6RB 3SI7A 5EE0A 4C5AA 2IVFA 3I61A 2NO0A 2PBFA 3JRXA 3OOYA 3ET5A 4IYRA 4U39A 3OJLA 5KVQA 5BN3B 2BFWA 2FW9A 3CU5A 3DL0A 4D9KA 2HA6A 3I6QA 2E21A 1OKKA 3ZU5A 3K0SA 8MHTA 1G20A 1M7GA 2F9FA 2NP7A 2O54A 4NDNE 2ZE8A 1I8TA 3ANYB 3IEUA 2HA3A 2IY7A 1XA4A 1BX3A 2H18A 5FI0B 1EUCA 4X24A 1W76A 3CBGA 3PQ4A 4JDUA 3ZKAA 2MDTA 1GWNA 1Q77A 3DWFA 3R3YA 3WOVA 5T7BA 4EUFA 5F1OA 1VPTA 2ZWOA 3JATA 5IG2A 3AVXA 4MQBA 5LNK1 1BH2A 1NIJA 3EK2A 3A7EA 2H5EA 4DG8A 3MT9A 2GBFA 1WSAA 1E2BA 5DNVA 3EHDA 1GY8A 4NECA 1JT9A 1PQ4A 1YZGA 3GAMA 4JELA 1PQUA 3C43A 4KFRA 1MX5A 3RDPA 2CC2A 4QE3A 3CJRA 3L02A 4F86A 2Z9DA 1E32A 2UKDA 4PZCA 3X1YA 4ID3A 1T0IA 5A4KA 7ADHA 3BD6A 2AE2A 5EWJA 3RS7A 1IG3A 2J32A 4H15A 1X8LA 1LNZA 2QENA 4TXHA 3GJ3A 3ICPA 4O2BA 3L7AA 4J1NA 2C2GA 1HYBA 3MRXA 4ZAXA 5AXAA 3ZXIA 5HM6A 2VAMA 4Y30A 4A8JB 4RKRA 2DHEA 1I2DA 1XJWA 3MCTA 3U4QB 3WB1A 1KVUA 3FZNA 3PUJA 2COUA 1BXKA 4N0EA 4UATA 4XARA 2F3PA 3OP1A 4QVIA 4RDXA 1ZVKA 3B3FA 4V0RA 2F3UA 4LBWA 1OWLA 2FOIA 3L1VA 2IS2A 4I4CA 4RIFA 4TTRA 1KO5A 2Y0EA 1RD4A 2XVZA 2JGDA 1Z62A 1QGYA 2Y99A 3VKVA 1KOJA 1A82A 3NYIA 2B7LA 4ZQGA 3BK7A 2YVQA 3T5TA 2REBA 3IAHA 4X44A 3K92A 3UJBA 3VZSA 2R5WA 3FHJA 1QV6A 2DPYA 1J2RA 4LRWA 3PYLA 5FBKA 3PFCA 1I4DD 3JQGA 3MINA 4F1WA 1K6JA 5EJEA 2GPWA 3EOZA 1S7CA 2WICA 1DIAA 1HEUA 3W8RA 2F90A 3QIVA 1ETUA 1GLNA 1CCWA 1F8GA 4KV7A 2ZRFA 5AM0A 1CJMA 4L0QA 2ERYA 5JYBA 3C70A 4NESA 3BMQB 1XAGA 4KODA 1UXJA 6ABPA 4J7XA 1NATA 2EW8A 4G1BA 4FGUA 1QIEA 5EA2A 2K6GA 1U7DA 5JOQA 3JQFA 5HCUA 1PAUA 3D4IA 4JLAA 4N1AA 2I65A 2W0MA 4NP6A 5HS4A 3MJFA 6PFKA 1I2BA 1H2YA 2JFNA 1ZONA 4WA7A 4GR9A 3A26A 4ZEVA 1P7WA 3A1NA 3SK0A 1JBKA 1N2BA 4DQUA 1OHHA 5F9FA 2A78A 1YZ3A 1M1NA 5JDCC 4U7PB 2LCFA 3UGTA 4JB3A 4CPDA 4DSZA 3MAJA 5D3KA 1YA6A 3NM5A 4Z53A 4FFWA 3ZHBA 4G1CA 4LWZA 4MR9A 4XVRA 3M3PA 2NZUG 3WYEA 3B82A 1I36A 4ZOQI 3VR5D 5AO9A 2O1XA 3QVVA 5HJ5A 2AMLA 2ZS7A 1R27A 3KOMA 4BXOB 3L0OA 2QKYA 5IFKA 3R0VA 4UD2A 3HPQA 3JQFC 5FBZA 4R3WA 1ANKA 2PZMA 3REFA 4AZTA 2RHHA 4OHMA 1ZP6A 4PC1A 3SE7A 2PFKA 4F12A 1FDUA 4WOBA 1HFJA 4ETWA 5KWSA 5GPBA 2GAOA 4GNKA 3W77A 2N75A 1GDHA 2ZIAA 2BTQB 1TKAA 2C20A 4JASB 1P5HA 3CT6A 3TCXB 5G0TA 5LOVF 5CTAA 4XTCS 1ZQ9A 1JU3A 2YXPX 5EFZA 3WYGA 1DT5A 3IE0A 3NC0C 4DV5B 4O08A 4CV3A 2I55A 3T5GA 1X87A 5MDHA 1XN4A 1SXJC 5NLLA 4M6WA 4NMHA 4ZYTA 5C7OO 4R2LA 3MFYA 4JBXA 4WKGA 4PINA 1KARA 1PSDA 3LGSA 4ZV7A 3K70D 1CSEE 1W96A 2DFPA 4UQPA 2ZJ8A 3CUWA 2OHIA 2EL7A 3ZV7A 5REQA 5BW5A 5LUAA 4CM9D 4JSTA 4ZP1A 1K2VN 1LVGA 2AT1A 3GUHA 1HKHA 4ZVRA 1WZIA 3GGCA 3HR4A 4H3SA 4HAXA 1JWLA 1R4AA 4WNAA 3G68A 4XFJA 4Z9XA 2IZ5A 3ILHA 2ZE6A 1UEJA 3ODGA 2AG8A 3TUZC 2XB6A 4G0XA 3FGOA 4EHHA 2QVBA 2AR7A 3ZGVA 4OSPA 4DV2B 3OLYA 4RJ2A 4BVJA 3WIDA 5ELXA 1UT8A 4HB4A 2XYQA 1KMMA 3PIIA 3WI7A 3ZE8A 1YCHA 3L43A 1TA4A 3NKFA 4MGIR 2HRDA 4CM3A 3AEQA 5GWXA 4PRLA 5AI0A 2RBEA 1PS8A 5A6SB 1VI6A 2R8XA 2TMKA 3LT2A 4M0LA 4GE0A 2DWPA 4G23A 4CIBA 4ON9A 3EBPA 5FUWA 4DBLE 2RIPA 1RP1A 2W6ID 2XCOA 4X66B 4UE6A 1USVA 3R5JA 3DOUA 2QAGA 4FEYA 1GV1A 4R6XA 5AI5A 1FIUA 4D9EA 1GUYA 2IHZA 1CFZA 2AXNA 3GVIA 1EM6A 2HK8A 2PX8A 3EVGA 3I76A 3IKVA 2VF8A 3CPSA 4DJTA 2MR6A 1JQJC 1W2HA 1ZKMA 1GZ3A 1RCTE 3ED1A 3LL7A 4JJ8A 4RC9A 4TM8A 2PNFA 5FUXA 3GDFA 3D6AA 5K3OA 2CJFA 4OLFA 4CIWA 1B6SA 2MYNA 4AJHA 4JQSA 1ML3A 1VCOA 3PEEA 3UXEA 3AF2A 3TIGA 3U3RA 1OLSA 4JT9A 4E5YA 2QT0A 4DNFA 4W5HA 3SXUA 3QV1A 3IQZA 4JBGA 4Q66C 3KB6A 2XZLA 2R84A 3SX2A 3M3DA 5F7XA 1KDPA 1NFFA 1SHKA 3EXIB 1ULUA 2JFVA 2QX9A 3JR3A 3PC8A 3P0RA 2OL4A 2YIDA 1GTVA 4G5OA 3QEJA 3GEMA 4FU0A 1RYMA 4CUZA 4E15A 3VPCA 2AG6A 4ZYVA 2C95A 3WG9A 4Y2XA 1E2KA 1NXQA 3R09A 3BE6A 4PG7A 4YCJA 3V1YA 4O4IB 1O57A 5FI3A 2HFKA 5LP1A 1KZ1A 1T8UA 4LZNA 2ODAA 5FB3A 2QM0A 5HF8A 2JL1A 4RM3A 5AYVA 4BNGA 2BFPA 1EP1B 1E8MA 5EIEA 4CNQA 5G0SA 1KQPA 4PAWA 2I2FA 2BMDA 1E2HA 3A4TA 3CNBA 1BMDA 1TKBA 2QQFA 1SQ5A 1L7DA 1G59A 2MR5A 3NJRA 2XECA 2Z4RA 4LDZA 3ZOKA 5EKSA 4GMFA 1F0KA 4GRIA 4GXNA 4KXFB 4MROA 4O0MA 1G7TA 1ZD9A 4RAOA 5DI3B 4DW8A 3CZ9A 3J7AC 2C88A 5ICFA 1E2QA 2Y1LA 4RK1A 2NVOA 1HLFA 3CCFA 5IARA 9LDTA 2GAIA 3E9CA 4JLBA 4HXGA 5CEJA 1WRBA 4QUKA 4GZLA 3GA7A 3O94A 2F3SA 5A1JA 4PANA 4ZXFA 4L9RA 3L6EA 3CZAA 2YJZA 3OZCA 2WW8A 4YWJA 4PLCA 1YJAA 2OXRA 3ZHRA 2QPLA 4DR6B 5K3FB 3GJ5A 3WRYA 4QQRA 2Q1UA 4UM5A 2HJWA 2P90A 2E49A 3EZ6A 4K5QA 4W82A 1TI7A 2FVYA 4LXHA 3HDVA 3BGSA 3N2KB 4FSDA 4NMLA 3D8UA 1P44A 5FA6A 1QRSA 2BI8A 2BV3A 3OIVA 2MMGA 2O0HA 3LFUA 1XLVA 2Q6OA 2R2GA 2X13A 3E3NA 4I36A 4K0RA 4LHEA 2F8MA 3EWIA 2G1UA 1XK6A 5C7YA 5BSEA 3BWYA 2J5KA 4X92A 4NYJQ 5EP1A 1HZZA 3GELA 1NBHA 1M72A 3EQZA 4H35A 3NGMA 4M38A 1AQLA 1WCWA 1HL3A 2VG8A 1F06A 2V5UA 1UXOA 1NVKA 4GGMX 1UKYA 4MI6A 1FP2A 3THRA 4LV8B 4Z54A 3GEEA 1WF3A 3JARB 4KWTA 3WMGA 1DIRA 4YYEA 1IQUA 1PNOA 2HPHA 1JFFB 2A1TS 4DANA 5AVWA 1KI6A 3KQNA 4LWPA 1F2DA 1GRRA 2G1JA 1MNAA 2Y3IA 1QGAA 3INNA 4J4BA 4XB2A 3FMVA 2HMTA 1L4FA 3WGTA 3PD7A 5LDGA 3IEVA 3C6ZA 1BKDR 4MYDA 3T3DA 1O97C 1H1LB 5ALWA 1PX2A 3QFTA 2RHDA 1W5FA 3AONB 3PGVA 5FQOA 4AXBA 4KITB 4GR5A 4CL0A 3OCJA 4ZQEA 3WMWA 1KRXA 1YZKA 1I5OA 5HP4A 1IZ8A 2A4MA 3O3CA 3E03A 1S5PA 5KJEA 5E6UA 2Y68A 3CHYA 4WGFA 1JFSA 2P11A 4MMZB 1RC1A 4YR7A 1J0BA 4QA9A 3FOEC 1CDDA 2GBCA 2W2XA 3FFTA 4NMWA 5B1HA 1E92A 1RKUA 1O95C 1T2AA 4L8YA 4QUHA 5LB4A 4DVGA 2B4RO 3E3AA 4GEGA 4WDQA 2ZR7A 1SXJA 2Y92A 2YOGA 1D6MA 3CZPA 3UVEA 1ES9A 1SG9A 4EK9A 3CNQS 4F2PA 2P2CA 3OP4A 3MF4A 3K6RA 1KP3A 1R3DA 3LC7O 4FW8A 4YRPA 5ICSA 5E8RA 3DBHA 1VE7A 1B2RA 2CSUA 1U28C 1OILA 1T9AA 5LJLA 1RYFA 3OZUA 4MINA 3L8FA 1OH8A 2VDPB 1RHMA 1ZMOA 5FOQA 5LU9A 3DO5A 1MB9A 3FLAA 2QX4A 1MA0A 2B5VA 2ODWA 2LD4A 3TTVA 1VL1A 4FOOA 4HYQA 2CL5A 3TQCA 3LC1O 2P4QA 3MCAA 1E3QA 1BDMA 3K8OE 2VDVE 1GPUA 4FGZA 4OAOA 5A71A 4HNVA 2O8FA 1THZA 2MT9A 2Y1OA 1EGVB 5HJ7A 2QBYB 2C9BA 1ADJA 2E3JA 1P73A 4IUBS 5DVZA 1Q11A 4Y2QA 5HHTA 4Q6WA 1Y1PA 4DJDC 2UYCA 1NJFA 1PW7A 4GI1A 2QVGA 3NOVA 2PRKA 1JHPA 3P52A 4WI1A 2IQIA 1VJ1A 3S27A 3SYMA 4ZK2A 1VBFA 3K1ZA 4Z4EA 4FHFA 5I5EA 2JIZA 1QKJA 1R6UA 5LKAA 2IXBA 4LXXA 5EIHA 3VYWA 4KQMA 1T2VA 4JK3A 1NFQA 4JJZA 3T9EA 4UW9A 2C7QA 2GRJA 4WW0A 3WC4A 4EAAA 4UMDA 3NH6A 4LJSA 3EIUA 2IHBA 2ZJ7A 3O6VA 4EEKA 1C9MA 1J7KA 1JR3A 1T9DA 4IKOA 5DHRA 4BVKA 2BTQA 1XUOA 16PKA 3SSAA 3IGFA 3RS9A 3B5JA 4HAUA 1K63A 2FEXA 2RCNA 2FFJA 2Q5OA 1KYQA 1QIGA 2IT1A 3M9XA 4H1TA 4TZTA 1KWKA 4I4LA 3GJ4A 5KSPA 4P84A 3W0LB 4EJSA 1IZ7A 1PJBA 5CEFA 2HREA 5TS3A 1JHDA 2VPYA 3DULA 4XUGB 3NPAA 3DEYX 4XUEA 5EY5B 5TR9A 3VU8A 3UXMA 1YB6A 2IEIA 2VXOA 1I7QB 1UR5A 2BHLA 4X8LA 4R0MA 3GMIA 4Z7QB 3KXLA 4FZJA 2GT1A 4KOEC 4Z4FA 4MR9B 3DWEX 3IB6A 4UZSA 2VDWB 4EUEA 4MICA 2IH2A 3U49A 1WXIA 1W47A 2CNWA 2F62A 3CTPA 2WF7A 2P3LA 5B55A 1DRWA 2IITA 2YW9A 1JN0A 3CKMA 3DKIA 1A9TA 1KPHA 5AKJA 5DV9A 3NUZA 5ALRA 2GS9A 5AVOA 2H6EA 4YIKA 4M7RA 5JHGB 3NAGA 4LCJA 3REGA 3OLZA 1NRXA 1ODLA 4EECA 5BNIA 1ZOOA 4EKIA 4I8DA 2BHSA 4GX5A 1YB2A 2DAPA 3O1IC 1IRXA 1T2DA 1WM1A 3HBJA 1EFPA 2H2HA 3ETDA 5H70A 3VPFA 1UDBA 4EUSA 1TL7C 2GMWA 2QZZA 3NDIA 1CDZA 4LQ4A 3BH6A 4Y3UA 1GGMA 4I9HA 2H1OA 3TQRA 1VHLA 1A4XA 4L8GA 1A9XA 1KNXA 3DUWA 3QTTA 4GU5A 4F85A 3L7CA 3D54D 4M99A 4Y6LA 2Q5IA 1DJQA 5BV0A 3SZRA 1X7ZB 3VPDA 2XODA 3STWA 3ICEA 5CG1A 2FMXA 4PSVA 3HXMA 1NYQA 4ZHQB 1PK8A 2ZR9A 5GQSA 5KDLA 4Z9AA 3C5EA 5K6AC 2OWDA 4XGIA 2XUDA 5D8DA 4KXMA 1G8SA 1UFVA 4RHFA 5DHAA 4LHSA 1I4OA 3CNEA 4YXWA 3G7SA 3JTMA 4F2DA 1GGKA 1A7AA 4OEHA 3HFSA 3HCAA 4LE0A 5AK5A 5BYJA 1H2FA 2ZJ0A 4O2BB 4S04A 3LUJA 4JWTA 4WVFA 1FEZA 1JQAA 2Z2ZA 3QYAA 5HIMA 1V71A 1Z4PX 1RXVA 1M2NA 1B14A 3I5AA 4Z8YA 5LA6A 2OHJA 3CVYA 1YAJA 2WMDA 3FI0A 3FVRA 3R75A 2VATA 3JQ8A 1M1ZA 1Y3HA 4RVOA 4KI7A 4GP9A 4V38A 1ZRMA 1FQOA 5IYZF 1CHDA 3VU9A 1XI2A 3ICCA 2OLEA 3R0IA 2G0TA 2WUEA 3OT5A 1Z7WA 1KZ6A 2E9SA 4OSEA 2XMPA 4JMPA 5HDBB 3RVDA 3RHSA 1T6XA 1UF9A 2YZ2A 1TCAA 2VHEA 2G67A 1N1DA 4DLVA 4OIFA 2GAJA 4DRYA 2AQHA 1N57A 3M70A 1K0FA 2BP7A 2FR8A 3AWDA 3K9NA 3QKWA 2B6NA 1QWOA 2GEFA 1JDJA 4HHEA 5JI3E 1EXMA 3Q9NA 1XE3A 5TJHA 5F2EA 1K7YA 1NM5C 3D6NB 3G3EA 1XHEA 1ONSA 2FWPA 4GICA 1C8LA 1JWAB 1XZLA 1UEIA 4M22A 1ZUIA 2Q0QA 2WSMA 3GZNA 3GL9A 3MIZA 4UU7A 5ALLA 1G20B 1RWQA 3CF0A 4OQXA 2B8WA 1DC4A 4XDGA 5DH9A 1A88A 2UAGA 5HE9A 1XDZA 3C3BA 3PCRB 3G7UA 4ML3A 3D1VA 2WYOA 1C2YA 3BZWA 4R2MA 5CYOA 3RBAA 1I0IA 5K0CA 3UAZA 1KF0A 1USUA 3UHAA 4QUGA 3ABRB 3DEIA 1FLNA 4AJKA 4DMKA 5MF6A 3SR0A 2YYAA 1MIOA 3A3PA 4BFXA 1YIAA 1RWNA 5TGDA 4ITVA 1KDVA 3U7IA 4B31A 4DLWA 5C4IA 5K3BA 4MVJA 1JDSA 4I55B 5EIOA 1A8SA 2R25B 5KOYA 2ID4A 3Q1LA 3F4KA 2E4YA 2YFQA 5CU7A 1D1PA 3FCSB 4MS1A 3FTFA 3IXMA 1SUIA 4QFMA 1NU6A 4EHLA 3VR6A 3TLGB 4YUVA 2YHUA 2GBPA 4IO1A 1EM8B 4UQLA 1UT5A 1IOVA 2Q3CA 3L7OA 2EOAA 3W7AA 4AP5A 5AKHA 3U7EB 1NA5A 5E9JA 2Z5VA 3HCNA 5BQXA 4V2UA 4BPBA 1Y5IA 4RZ3A 2DYKA 1T8TA 1RMYA 2UZ3A 1XC7A 2OCIA 2ZQZA 4U2DA 4G09A 5BNFA 1ZN9A 4O02B 1KK0A 4OMCA 2JJ1D 3BTOA 2EJCA 3BC1A 2NXNA 4LE1A 3VHQA 3WIBA 1AMOA 4XDZA 3W5AA 3GJ7A 4GP7A 3SN6A 3DCYA 2BCGY 4RQUA 3WNBA 1E9BA 4OGKA 2ONJA 2WIBA 4X8MA 1QNFA 4Z4HA 1MRSA 2W0SA 4RKYA 1QYCA 3K31A 3SSOA 1JV2B 4F3KA 4CKWA 3O7WA 2VK1A 2P6OA 3HWSA 2CHEA 3RRZA 4B35A 1R5JA 1R0XA 1S8FA 3C0KA 5BWNA 4DC9A 2G09A 1M6WA 1ABFA 2C9MA 1SXHA 1YH3A 2C84A 3D8HA 3K30A 4JVLA 4ND5A 4RABA 4EO4A 1IFXA 1U2GC 1EK5A 1U3TA 1Y8CA 2WTMA 4FN5A 5KYYA 1TO2E 4KAJA 5JBQA 2GD6A 1NJ8A 2WJJA 3SPXA 3V97A 3D2BA 4CDMA 1FC0A 2R6DA 4HYEA 3FUTA 1GILA 2IP2A 3INYA 4Q37A 5SZKB 5JH7B 3K9CA 4KPUB 1FLAA 3A9WA 3B6JA 2FHPA 4RGBA 5JXJA 4PYIA 3H99A 1QPBA 4I9UA 2P35A 4G63A 1VA4A 3EMVA 4MR7A 4LFBB 4G0MA 3CXRA 2X0KA 3WBFA 2WPDA 3CEHA 5GJVC 1KO1A 3W8EA 2M6LA 2NUAA 1JFLA 2XCTB 5AVXA 1J5EB 1I7PA 3E1KA 2V9ZA 4LG1A 3A1UA 5FUVA 3CH6A 3IUBA 2JJ8A 1N7JA 3FZQA 1KHHA 2VJMA 3NYWA 5LP6F 3WRYC 3NHLA 1PGQA 1PZHA 3D1JA 3OZVA 3QV2A 3TOZA 5JSFA 5K9ZA 2HHLA 1SVMA 2HRCA 3IEXA 3MERA 4ZYYA 5JZ9A 3LUKA 1JHVA 4RANA 2OZPA 3UMRA 2DM6A 5DO9A 5E7QA 3WYFA 1X1SA 1G17A 3G02A 3BPSA 4F4CA 4ZI7F 5JXGA 2BM1A 1S1MA 3AUUA 2WYHA 3PC4A 2WMYA 3WXMA 2YWHA 1W85B 3EGEA 1JLLA 1Y7PA 4H6PA 4ZANA 4YPFA 5BYBA 3R7FA 4AX4A 1W7AA 2FLWA 3E9YA 4NEQA 5L4LA 1H0SA 2IIQA 2SCUB 4DSAA 3ID6C 3G0HA 1T9GS 3BB1A 1JLLB 4ENTA 4MKFA 4RIGA 1IK4A 4X8HA 2FW8A 1AURA 4G0ZA 2V03A 1S02A 2D2VA 2AMFA 3INGA 3CKLA 2C98A 3JASA 5GIOE 1UINA 2Z58A 2LCQA 1I3OA 2VF7A 1VYUA 4FD2A 4L6IA 5AWFC 1KJIA 3A6DA 3OM8A 3PB3A 1KRWA 3B8EA 4D56A 4XPIB 3VNUA 4L7QA 3PEFA 2XUFA 4RW0A 1EB9A 5B1EA 5AKLA 5A3SA 3RR2A 1PZEA 2O7RA 4JQCA 4IIEA 3KVYA 5KOHB 2PYIA 4C0LA 2YWRA 4BJ6A 2ET6A 1M8GA 4P7GA 4ENPA 3NDRA 4HRVA 1SQFA 1AKRA 3DHYA 5KNLA 4GEKA 2X86A 1L5OA 4TWBA 3PE3A 1G7RA 1MEEA 3I9KA 4AFNA 4BBAA 3F5FA 4DS3A 2CXTA 1PGOA 4QUEA 1L1RA 421PA 1SVSA 5JAIA 1LKZA 1TLTA 5FOTA 3IDOA 3O74A 3PRJA 4KPEC 1GT6A 2C7GA 1X8XA 4OFBA 3HI4A 4AS1A 2OHFA 1QH0A 3GNQA 2NU9B 4DIEA 1J22A 5ECGC 1G8HA 4TL7A 3WFJA 1CK4A 3WQQA 1NVXQ 5F4BA 4K26A 3LLCA 3M3HA 3KQOA 4OHCA 5CB8A 4UUPA 1O95D 3LVQE 3W2IA 1JEDA 3X0DA 5BSGA 3SZLA 3I1IA 1HYEA 1DKOA 4P3YA 4KWHA 1H2ZA 1NE7A 2VCHA 4YECA 1ESEA 1L4MA 3WKAA 2O5EA 1DS6A 1XMXA 2PZ8A 3JV7A 5E9WA 3WK5A 1FYVA 4QGHA 1O8CA 2Q8QA 2Z09A 5DBOA 1XMVA 1E1DA 3WYCA 4TV9A 1IBCA 1U3FA 4BWVA 3F96A 5T64A 4EB8A 3I12A 2F48A 3KPYA 3KHKA 2VJCA 4KKXB 5FWAA 1W94A 4GI3A 5EZYF 1R8JA 1Y3BE 5JCJA 4WFQA 3ZBPA 4ALKA 4ZDJA 5I4CA 3U5ZB 1SN7A 5E38A 2WHYA 1NLUA 2GLTA 4RWEA 4ANFA 1GQ2A 5JD6A 3EDYA 3PTAA 4UBOA 5G0WA 1W0KA 3OCUA 1ZH2A 3HPRA 3PUIA 4MVJM 3WS7A 8ATCA 3ZD6A 3FCYA 4FMDB 4DSTA 1GG5A 3QVTA 4HDAA 1OMOA 1NASA 1LDYA 4ZVPA 3UOAB 3VHXB 5EG5A 1XMJA 5A4FS 3ANMA 4ZMBA 3PGJA 3NBQA 1FFXB 5LMCA 1TJ5A 5TQJA 3SQXA 1XZBA 5IDVA 3OPVA 5U4XA 1E62A 4RHXA 2XUPA 1WB5A 3U3MA 2AKYA 5KNBA 3N59A 3KK0A 3PLAE 3N8HA 1JIQA 1Q19A 4W7IA 2AHRA 5EEGA 6YASA 3OTQA 4KLZA 4O1HA 5IK2A 5FPTA 3WA7A 1XF1A 3BJZA 5IEJA 1CZOA 4UHHA 1SA0A 4TROA 4BYGA 1P1FA 3PVSA 4R8MA 4JB2A 3QLTA 3N6XA 5CGQB 3AEXA 1GUDA 1N5IA 1TVKA 2ATIA 3A6HA 4H0FA 2GXAA 4WZAE 4LYDA 4BO9A 1IEXA 3FSGD 3UAVA 3N7TA 5CBKA 4HXFB 1R9JA 1EVZA 1N2JA 1UDRA 2V1XA 2XOKD 1TTPB 3DNPA 1PEDA 3Q2KA 4UHEA 2ONZA 5ELMA 5GAJA 1D2GA 2PEZA 3R3UA 4BMPB 4BQNA 5KTYA 5CURA 5K4AA 1ISGA 4FHEA 1MJGM 3RSSA 1RDFA 3CKYA 5LIPA 4K40A 5TPZD 3ILSA 4FGJA 3GZTB 2XF2A 3RE1A 2JLSA 4F2WA 1QFJA 3A1EA 3EZXA 3HYSA 3JYLA 2GZDA 1GFWA 4J9UE 2QU8A 1ZGHA 2C0PA 4A2CA 3WAJA 4NBSA 4EAQA 2C97A 2KW5A 4ZAYA 3DL7A 2W6IA 3KL2A 4Y2GA 2R1TB 3MELA 4O63O 4DA8A 1KDRA 1PIWA 3ZBTA 1T9BA 1A2QA 3GFGA 1P60A 4BQEA 3W5JA 1VMDA 3EWAA 4TYMA 2GVDC 1BKYA 2PGDA 1OZ0A 4RMHA 1GXSB 1F9AA 5DM70 3AKEA 3TB4A 2BFCB 3UAYA 2V5VA 4ACAA 4BEBA 5FAKA 4ZRDA 2NUAB 2NZYA 2EDCA 3M1YA 5H81A 1Z6XA 2O3RA 2R6R1 5EQJB 1V8DA 4DWJA 1NW3A 2H65A 3O8LA 4ND2A 3L9XA 1OU4A 1GTL1 4I4TF 1DQSA 3AGPA 4KGZA 5JRJA 5LQCA 2FWAA 3VR6H 2YIVX 3JPYA 4WCFC 3WL6A 1G0NA 1RRVA 1U3DA 3FWKA 1X0VA 4U63A 1K8XB 3GUYA 3MJEA 4MTLA 4QU5A 2WM2A 3K4PA 3KVOA 4MPDA 3V2IA 2AZDA 4LTNA 5ALOA 1KDOA 5KX5B 1KMNA 3O1LA 1IMOA 2BBSA 3A2KA 2PGAA 4CEIA 1J9ZA 4DXHA 3PX7A 1YUMA 5KYYB 2ZUSA 4O4LF 1ISSA 1NDQA 1KYTA 2GBIA 2I4IA 2GA8A 4WOKA 3V8RA 2WF9A 3K0AB 5KMGB 2JJQA 3ETEA 3I9V6 3WLFA 3B78A 3F5QA 1MR3F 3ITDA 1HT0A 3X1WA 5KNCA 2CZQA 3GLQA 1KQOA 3EA0A 2VJPA 2QN3A 3P9PA 4AIRA 1UK8A 2O50A 1N6OA 4FBMA 1CKEA 4YCNA 2VDQB 3H2YA 1JDPA 4RVCA 5J58A 2PMFA 4GPBA 4L0DA 5KINB 4BZWA 3URMA 3DDUA 1W9MA 1ZOPA 2JFQA 3GLHE 4DIFA 3ZVMA 2Y0BA 4OTZA 1QQBA 3PNKA 3QFSA 4ASUD 5A5FA 1U8AA 2RHBA 2ZT7A 3A0RB 2AL7A 1EPUA 2P6UA 2QMYA 1M2OB 4RSHA 5JC8A 1RZRA 2OBLA 3TLGA 2GYVA 4ESVA 1USGA 3T4XA 3AIIA 1NMYA 5A5DA 1ZD5A 4XX0A 5IM4F 1B26A 3STHA 3OZSA 1JE0A 4IX9A 2EWVA 2C3UA 3I2JA 5E2AA 2FWBA 3OESA 1GOTA 3SFTA 3WB0A 4BIMA 3RUHA 4CHTA 4DWOA 4YMIA 5CFQA 2V9CA 3MJRA 4E2WA 1YMUA 5EJGA 3BSSA 1GCIA 1XQ6A 3PFWO 5CXUA 4YCMA 2X2EA 3LP5A 2D8MA 2QTMA 5BMVB 1P4SA 3KB1A 4M7WA 2A0WA 5E3JA 1U1EA 4C30A 2AJDA 3B6ZA 3RLIA 1AKNA 3GLHA 4O0LA 1YXMA 3NTQA 3DUFA 2DFVA 4K6OA 1YHNA 2E4WA 1X1EA 1V43A 4R9SA 3S1AB 2C5EA 3T7IA 2VJKA 4KAFA 1I0ZA 1RZUA 2H7YA 2I6XA 2XTMA 3KRTA 4IF6A 1Z5ZA 1ZCZA 3BAFA 4WKOA 1GAJA 1MIHA 4LXTA 1ML4A 2WAAA 5J3JA 4V0QA 1OHHD 4N41A 2XV1A 4MRPA 3OE7D 4CM7A 1Z26A 3NM6B 4P2GA 3OUZA 1FF9A 3R6GA 1BFKA 3DEAA 2QPAA 4LMBA 3IFSA 5AIBA 1REQA 1U0SY 3FYUA 4UUMA 3AFGA 4EGQA 4YIHA 3IULA 4YLEA 3ZY4A 4K28A 4NBNA 3FNBA 4G37A 4OBWA 4X93A 2V6BA 3C24A 4PRKA 3ZLAA 1NVVQ 2YOFA 5IDWA 2ZSUA 3UT6A 2IP4A 3EW9A 4UQOA 1QGUA 3JQ8B 4GPZA 4MJ3A 3UJNA 4M9CA 4YO8A 1T13A 1K6IA 2O57A 1RFGE 1K8QA 2YN2A 2ZBUA 3NEYA 4G26A 2I62A 3N2EA 1N7HA 3TOCA 4CJXA 1WETA 2ZIWB 1BN7A 4QJ3A 1R4NB 4OA8A 3LDUA 3QOWA 5I8PA 1Y1TA 1PL7A 2WWVD 1SXJB 1A2KC 3AG5A 5PGMA 1GKKA 3HVKA 3IP7A 3R6LA 1TK3A 4BBZA 3OOEA 4DMHA 5A4MS 3SNKA 2QRGA 2G1AA 2IXAA 2YL2A 1F4VA 1QP4A 3ROFA 1T0HB 2BONA 4L4XA 5BSFA 3NS7A 1GQOA 5A6VA 4C7JA 3F97A 3JQRA 2GO1A 2VIIA 1CEXA 1SCKA 1U02A 4NMXB 1YASA 2EP7A 4FZVA 4U9UA 3HM2A 4C88A 4U3JB 1HL7A 4LYAA 2Q2VA 2P69A 1YJCA 3AB7A 1XZAA 3RIEA 1O9GA 1KJNA 3CZCA 1B93A 2I67A 3E9MA 3IV7A 3Q2OA 1CEQA 3UMCA 3VFDA 1QANA 2NQTA 2QW1A 3AM4A 3KZCA 4L8LA 5CFZA 4D8VA 4MUMA 4LJ6A 1MBZA 1OX4B 1XPRA 2CVPA 1WDMA 4O4IF 5IH3A 4C1NA 4YRZA 3DMRA 3K72B 5KJCA 1AD2A 3LLVA 1QQ5A 4R9UC 3DTNA 4U2CA 1QV9A 3KEQA 2GXSA 1IJFA 2HNAA 1LPOA 1QONA 2R6AA 3EPHA 2HLHA 2YHBA 2DXIA 1UZUA 4HLQB 3P9RA 1OLUA 2IEDA 5KWVA 1MHPA 3B9PA 1CF9A 2Q8NA 3ABZA 2A7XA 5BSVA 4L4SA 3FPSA 5KOJB 2C8VA 1LUAA 1JPVA 3LPLA 3CB4A 1L5GB 3BJMA 3AOGA 1YF3A 3HJGA 4K9OA 2VTDA 5C51B 4O2LA 2QMQA 5BMVF 1QGED 3QVKA 2JFXA 1E94E 1HQKA 3IODA 1FPQA 5CCDA 3W1VA 5JJIA 3QFFA 5EKXA 4P54A 1NZDA 4RLSA 4NKRA 2IS1A 1KYIA 3PQFA 1ESZA 5CVVA 5EJAA 2QVXX 1E58A 1A2OA 2DHCA 1XYYA 5ED4A 1M10A 4O8CA 4EJ6A 1DHRA 3N2YA 2IHUA 4TTJA 3TKLA 4O2AF 4NU5A 2OCAA 4B2LA 4KHPB 2I3ZA 3PQ3A 2B0CA 3P8ZA 4WSOA 2CXHA 4YAFA 3G79A 3KHTA 3ZE9A 1TIBA 1E0AA 5TX7A 2OCXA 2HF2A 2O7NA 3REQB 2WIFA 1AH2A 1V3QE 4A36A 2ZIFA 4G8JA 4OO3A 5FV4A 4Q4HA 1NMSA 2C9DA 3K3PA 2A0XA 3L7DA 3CS3A 4GPD1 4RFLA 3BMXA 2RJ3A 3TJRA 3VJMA 1WIWA 1S3FA 2ZPUA 3KJFA 2WAXA 3N7AA 5FPKA 4OCZA 4YP5A 3NOXA 4PPYA 1MPTA 3MWFA 1RQ2A 1MC1A 1FP7A 4EJ0A 4CTJA 2FPKA 2I78A 2PUJA 1VJDA 2DQYA 4ZI7B 1EQUA 4QRDA 4JI8B 1SAYA 3O9VA 1D8AA 1KH3A 4BRSA 2SNIE 3QOXA 5HOQA 3U1BA 4BNFA 5H59A 3UUEA 2O48X 2FPPA 3ILYA 3IT2A 4NCIA 3SLRA 1F14A 5IJ9B 4JJ4A 1NUUA 2I6GA 1GVHA 1NQOA 4N0PA 3CJTA 3F49S 1WXHA 2ATEA 3T7AA 4URXR 5GOZA 5EC8A 1V96A 2NZWA 4JLSA 1H8ED 3AKCA 3U4GA 2FX2A 4JYAB 1IN6A 3QEOA 2NVUB 1YR8A 1HFWA 2Q2OA 4GW3A 4MVJG 4F3NA 1I51A 1NXOA 1JHXA 2X5XA 1Y4SA 2YMPA 3FR8A 4QULA 4DDWA 4WLUA 4MR7B 2YRFA 1U3VA 1EZZA 4AG3A 1E5VA 5JCPA 4IZIA 4KNYA 3U4CA 4BV9A 3EN0A 2J0UA 4IKEA 3SQDA 5KTKA 1PD0A 3LSTA 4QHTA 7ABPA 4UHCA 3TRJA 2FVXA 1X7YB 2J9XB 2EKZA 3ELDA 2A3RA 2ZYRA 4ZHSA 3QUBA 4WACA 4JQZA 3N8GA 4E2ZA 4WFKA 1XT6A 3CVWA 3RV4A 3ZIAA 3ZZ0A 4ES6A 2EHJA 2QJFA 4QVKA 4UXHA 4FT4A 4V0SA 2FMFA 4RMGA 3IE1A 1TA9A 2ZBFA 3ST7A 4YUYA 2HCJB 3DE2X 2GM5A 3H5VA 3KWMA 4DLXA 1U8ZA 5KSYA 4FUQA 3MJCA 2OQRA 3D0QA 4GMKA 4IFTA 1B0UA 4C6HA 2GA9A 3DFFA 3PVZA 1Y8RA 4ITRC 2EP5A 4K6CA 5JCOC 3K71B 1X2BA 3QVGA 4JNCA 4KACA 2BTOA 2VT2A 5I45A 3ZZTA 1W0CA 3IVXA 4B3TB 3X2SA 1I24A 5JALA 2CB0A 3AUAA 3JAWA 4YJGA 5JVDB 4H0NA 1Z9BA 4OB8A 2OG1A 2Z5GA 2HN9A 4MDHA 3WNZA 5FWNA 2WYIA 4Q4JB 1YA4A 4PYLA 5DKFA 3ABOB 3ENWA 3MTAA 2PCJA 1XVAA 4OIMA 1EVIA 4R31A 1OYVA 4AROA 1E5LA 1NF9A 2BRUC 2WAMA 3Q40A 4BLOA