5INBA

Repoman-pp1g (protein phosphatase 1, gamma isoform) holoenzyme complex
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
293
structure length
293
Chain Sequence
LNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Ki-67 and RepoMan mitotic phosphatases assemble via an identical, yet novel mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
molecule keywords Serine/threonine-protein phosphatase PP1-gamma catalytic sub
total genus 112
structure length 293
sequence length 293
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2016-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 5inbA00
3KBPA 4H2FA 1S95A 4ZX2A 2XMOA 3H62B 4F0ZA 4ORCA 1UTEA 3EGHA 4JA7A 1XZWA 2QFPA 4H2BA 3T1IA 5JPFA 1JK7A 1NNWA 1WAO1 2HYOA 3H60A 4V0WA 4KKZA 2Q8UA 1HPUA 3N5UA 3THNA 3PSNA 1II7A 2QFRA 3EGGA 5C1VA 2WDEA 3IB7A 2ZBMA 3K7VC 4HD0A 4FCXA 4B2OA 4OR9A 4I5NC 2HYPA 2R17A 3AV0A 4LTYA 1HP1A 3H63A 1S70A 1AUIA 2IE4C 2CV9A 2DFJA 3DW8C 4I5LC 2BCDA 4O4KA 4ORAA 1OIDA 4XPNA 4ZVZA 4KBPA 4Q7FA 4FBQA 4IYPC 3IVEA 4LACC 1W24A 3H69A 5INBA 3PSOA 4V0VA 4ORBA 3THOB 3HVQA 2BDXA 2Z1AA 3ZTVA 1T70A 2KKNA 2HY1A 5F3WA 2Z72A 1XM7A 1Z2XA 2A22A 2NPPC 3ZU0A 1UF3A 4MOVA 3H66A 4H1SA 2JOGA 3H68A 3QFMA 3H64A 1TCOA 2NXFA 4H1YP 3V4YA 1KBPA 4DSYA 3TGHA 4UT2A 2GJUA 1M63A 4TUIA 1WARA 2QJCA 3QFKA 4YKEA 4UWQA 1IT6A 2NYLC 1QFCA 3E7BA 3GVEA 4M0VA 4JA9A 1QHWA 5J28A 3C9FA 4FBKA 3P71C 3AUZA 4G9JA 4O43A 5IOHA 3DSDA 3RQZA 4MOYA 2O8AA 3CK2A 4H2GA 4UT3A 3H61A 2BQ8X 2WDDA 2WDCA 4NZVA 5GTUA 1Z2WA 3RL3A 1FJMA 1MF8A 3IVDA 4DT2A 3K7WC 3QG5C 2P6BA 5DNYA 1G5BA 2NYMC 1S3NA 2O8GA 2IAEC 3E7AA 3RL5A 2USHA 4J6OA 1OI8A 4UT3B 1S3LA 4WWLA 3DSCA 3FGAC 5JPEA 4IL1A 4O5GA 1S8EA 5B8IA 1USHA 3ICFA 4H2IA 1U32A 4FBWA 3LL8A 2YVTA 2Z06A 2WDFA 3QFNA 1HO5A 2AHDA 4MP0A 5JJTA 4DHLA 3JYFA 1SU1A 3H67A 3QFOA 5EQVA 1OIEA 4LU9A 1T71A 3RL4A 1V73A 2IE3C 3IB8A 4O24A 4V0XA 1S3MA 5HPEA 4TUGA 3C5WC
chains in the Genus database with same CATH superfamily
3KBPA 4H2FA 1S95A 4ZX2A 2XMOA 3H62B 4F0ZA 4ORCA 1UTEA 3EGHA 4JA7A 1XZWA 2QFPA 4H2BA 3T1IA 5JPFA 1JK7A 1NNWA 1WAO1 2HYOA 3H60A 4V0WA 4KKZA 2Q8UA 1HPUA 3N5UA 3THNA 3PSNA 1II7A 2QFRA 3EGGA 5C1VA 2WDEA 3IB7A 2ZBMA 3K7VC 4HD0A 4FCXA 4B2OA 4OR9A 4I5NC 2HYPA 2R17A 3AV0A 4LTYA 1HP1A 3H63A 1S70A 1AUIA 2IE4C 2CV9A 2DFJA 2ZO9B 3DW8C 2BCDA 4I5LC 4O4KA 1OIDA 2DXNA 4XPNA 4ZVZA 4KBPA 4Q7FA 4FBQA 4IYPC 3IVEA 4LACC 1W24A 3H69A 5INBA 3PSOA 4V0VA 4ORBA 3THOB 3HVQA 2BDXA 2Z1AA 3ZTVA 1T70A 2KKNA 2HY1A 5F3WA 2Z72A 1XM7A 1Z2XA 2A22A 2NPPC 3ZU0A 1UF3A 4MOVA 3H66A 4H1SA 2JOGA 3H68A 3QFMA 3H64A 1TCOA 2NXFA 4H1YP 3V4YA 1KBPA 3E0JA 3TGHA 4UT2A 2GJUA 1M63A 4DSYA 4TUIA 1WARA 2QJCA 3QFKA 4YKEA 4UWQA 1IT6A 2NYLC 1QFCA 3E7BA 3GVEA 4M0VA 4JA9A 1QHWA 5J28A 3C9FA 4FBKA 3P71C 3AUZA 4G9JA 4O43A 5IOHA 3DSDA 3RQZA 4MOYA 2O8AA 3CK2A 4H2GA 4UT3A 3H61A 2BQ8X 2WDDA 2WDCA 4NZVA 5GTUA 1Z2WA 3RL3A 1FJMA 1MF8A 3IVDA 4DT2A 3K7WC 3QG5C 2P6BA 5DNYA 1G5BA 2NYMC 1S3NA 2O8GA 2IAEC 3E7AA 3RL5A 2YEQA 2USHA 4J6OA 1OI8A 4UT3B 1S3LA 4WWLA 3DSCA 3FGAC 5JPEA 4IL1A 4O5GA 1S8EA 5B8IA 1USHA 3ICFA 4H2IA 1U32A 4FBWA 4ORAA 3LL8A 2YVTA 2Z06A 2WDFA 3QFNA 1HO5A 2DXLA 2AHDA 4MP0A 5JJTA 3D03A 4DHLA 3JYFA 1SU1A 3H67A 3QFOA 5EQVA 1OIEA 4LU9A 1T71A 2ZOAA 3RL4A 1V73A 3FLOA 2IE3C 3IB8A 4O24A 4V0XA 1S3MA 5HPEA 4TUGA 3C5WC
chains in the Genus database with same CATH topology
3KBPA 4H2FA 1S95A 4ZX2A 2XMOA 3H62B 4F0ZA 4ORCA 1UTEA 3EGHA 4JA7A 1XZWA 2QFPA 4H2BA 3T1IA 5JPFA 1JK7A 1NNWA 1WAO1 2HYOA 3H60A 4V0WA 4KKZA 2Q8UA 1HPUA 3N5UA 3THNA 3PSNA 1II7A 2QFRA 3EGGA 5C1VA 2WDEA 3IB7A 2ZBMA 3K7VC 4HD0A 4FCXA 4B2OA 4OR9A 4I5NC 2HYPA 2R17A 3AV0A 4LTYA 1HP1A 3H63A 1S70A 1AUIA 2IE4C 2CV9A 2DFJA 2ZO9B 3DW8C 2BCDA 4I5LC 4O4KA 1OIDA 2DXNA 4XPNA 4ZVZA 4KBPA 4Q7FA 4FBQA 4IYPC 3IVEA 4LACC 1W24A 3H69A 5INBA 3PSOA 4V0VA 4ORBA 3THOB 3HVQA 2BDXA 2Z1AA 3ZTVA 1T70A 2KKNA 2HY1A 5F3WA 2Z72A 1XM7A 1Z2XA 2A22A 2NPPC 3ZU0A 1UF3A 4MOVA 3H66A 4H1SA 2JOGA 3H68A 3QFMA 3H64A 1TCOA 2NXFA 4H1YP 3V4YA 1KBPA 3E0JA 3TGHA 4UT2A 2GJUA 1M63A 4DSYA 4TUIA 1WARA 2QJCA 3QFKA 4YKEA 4UWQA 1IT6A 2NYLC 1QFCA 3E7BA 3GVEA 4M0VA 4JA9A 1QHWA 5J28A 3C9FA 4FBKA 3P71C 3AUZA 4G9JA 4O43A 5IOHA 3DSDA 3RQZA 4MOYA 2O8AA 3CK2A 4H2GA 4UT3A 3H61A 2BQ8X 2WDDA 2WDCA 4NZVA 5GTUA 1Z2WA 3RL3A 1FJMA 1MF8A 3IVDA 4DT2A 3K7WC 3QG5C 2P6BA 5DNYA 1G5BA 2NYMC 1S3NA 2O8GA 2IAEC 3E7AA 3RL5A 2YEQA 2USHA 4J6OA 1OI8A 4UT3B 1S3LA 4WWLA 3DSCA 3FGAC 5JPEA 4IL1A 4O5GA 1S8EA 5B8IA 1USHA 3ICFA 4H2IA 1U32A 4FBWA 4ORAA 3LL8A 2YVTA 2Z06A 2WDFA 3QFNA 1HO5A 2DXLA 2AHDA 4MP0A 5JJTA 3D03A 4DHLA 3JYFA 1SU1A 3H67A 3QFOA 5EQVA 1OIEA 4LU9A 1T71A 2ZOAA 3RL4A 1V73A 3FLOA 2IE3C 3IB8A 4O24A 4V0XA 1S3MA 5HPEA 4TUGA 3C5WC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KBP A;  4H2F A;  1S95 A;  4ZX2 A;  2XMO A;  3H62 B;  4F0Z A;  4ORC A;  1UTE A;  3EGH A;  4JA7 A;  1XZW A;  2QFP A;  4H2B A;  3T1I A;  5JPF A;  1JK7 A;  1NNW A;  1WAO 1;  2HYO A;  3H60 A;  4V0W A;  4KKZ A;  2Q8U A;  1HPU A;  3N5U A;  3THN A;  3PSN A;  1II7 A;  2QFR A;  3EGG A;  5C1V A;  2WDE A;  3IB7 A;  2ZBM A;  3K7V C;  4HD0 A;  4FCX A;  4B2O A;  4OR9 A;  4I5N C;  2HYP A;  2R17 A;  3AV0 A;  4LTY A;  1HP1 A;  3H63 A;  1S70 A;  1AUI A;  2IE4 C;  2CV9 A;  2DFJ A;  3DW8 C;  4I5L C;  2BCD A;  4O4K A;  4ORA A;  1OID A;  4XPN A;  4ZVZ A;  4KBP A;  4Q7F A;  4FBQ A;  4IYP C;  3IVE A;  4LAC C;  1W24 A;  3H69 A;  5INB A;  3PSO A;  4V0V A;  4ORB A;  3THO B;  3HVQ A;  2BDX A;  2Z1A A;  3ZTV A;  1T70 A;  2KKN A;  2HY1 A;  5F3W A;  2Z72 A;  1XM7 A;  1Z2X A;  2A22 A;  2NPP C;  3ZU0 A;  1UF3 A;  4MOV A;  3H66 A;  4H1S A;  2JOG A;  3H68 A;  3QFM A;  3H64 A;  1TCO A;  2NXF A;  4H1Y P;  3V4Y A;  1KBP A;  4DSY A;  3TGH A;  4UT2 A;  2GJU A;  1M63 A;  4TUI A;  1WAR A;  2QJC A;  3QFK A;  4YKE A;  4UWQ A;  1IT6 A;  2NYL C;  1QFC A;  3E7B A;  3GVE A;  4M0V A;  4JA9 A;  1QHW A;  5J28 A;  3C9F A;  4FBK A;  3P71 C;  3AUZ A;  4G9J A;  4O43 A;  5IOH A;  3DSD A;  3RQZ A;  4MOY A;  2O8A A;  3CK2 A;  4H2G A;  4UT3 A;  3H61 A;  2BQ8 X;  2WDD A;  2WDC A;  4NZV A;  5GTU A;  1Z2W A;  3RL3 A;  1FJM A;  1MF8 A;  3IVD A;  4DT2 A;  3K7W C;  3QG5 C;  2P6B A;  5DNY A;  1G5B A;  2NYM C;  1S3N A;  2O8G A;  2IAE C;  3E7A A;  3RL5 A;  2USH A;  4J6O A;  1OI8 A;  4UT3 B;  1S3L A;  4WWL A;  3DSC A;  3FGA C;  5JPE A;  4IL1 A;  4O5G A;  1S8E A;  5B8I A;  1USH A;  3ICF A;  4H2I A;  1U32 A;  4FBW A;  3LL8 A;  2YVT A;  2Z06 A;  2WDF A;  3QFN A;  1HO5 A;  2AHD A;  4MP0 A;  5JJT A;  4DHL A;  3JYF A;  1SU1 A;  3H67 A;  3QFO A;  5EQV A;  1OIE A;  4LU9 A;  1T71 A;  3RL4 A;  1V73 A;  2IE3 C;  3IB8 A;  4O24 A;  4V0X A;  1S3M A;  5HPE A;  4TUG A;  3C5W C; 
#chains in the Genus database with same CATH topology
 3KBP A;  4H2F A;  1S95 A;  4ZX2 A;  2XMO A;  3H62 B;  4F0Z A;  4ORC A;  1UTE A;  3EGH A;  4JA7 A;  1XZW A;  2QFP A;  4H2B A;  3T1I A;  5JPF A;  1JK7 A;  1NNW A;  1WAO 1;  2HYO A;  3H60 A;  4V0W A;  4KKZ A;  2Q8U A;  1HPU A;  3N5U A;  3THN A;  3PSN A;  1II7 A;  2QFR A;  3EGG A;  5C1V A;  2WDE A;  3IB7 A;  2ZBM A;  3K7V C;  4HD0 A;  4FCX A;  4B2O A;  4OR9 A;  4I5N C;  2HYP A;  2R17 A;  3AV0 A;  4LTY A;  1HP1 A;  3H63 A;  1S70 A;  1AUI A;  2IE4 C;  2CV9 A;  2DFJ A;  2ZO9 B;  3DW8 C;  2BCD A;  4I5L C;  4O4K A;  1OID A;  2DXN A;  4XPN A;  4ZVZ A;  4KBP A;  4Q7F A;  4FBQ A;  4IYP C;  3IVE A;  4LAC C;  1W24 A;  3H69 A;  5INB A;  3PSO A;  4V0V A;  4ORB A;  3THO B;  3HVQ A;  2BDX A;  2Z1A A;  3ZTV A;  1T70 A;  2KKN A;  2HY1 A;  5F3W A;  2Z72 A;  1XM7 A;  1Z2X A;  2A22 A;  2NPP C;  3ZU0 A;  1UF3 A;  4MOV A;  3H66 A;  4H1S A;  2JOG A;  3H68 A;  3QFM A;  3H64 A;  1TCO A;  2NXF A;  4H1Y P;  3V4Y A;  1KBP A;  3E0J A;  3TGH A;  4UT2 A;  2GJU A;  1M63 A;  4DSY A;  4TUI A;  1WAR A;  2QJC A;  3QFK A;  4YKE A;  4UWQ A;  1IT6 A;  2NYL C;  1QFC A;  3E7B A;  3GVE A;  4M0V A;  4JA9 A;  1QHW A;  5J28 A;  3C9F A;  4FBK A;  3P71 C;  3AUZ A;  4G9J A;  4O43 A;  5IOH A;  3DSD A;  3RQZ A;  4MOY A;  2O8A A;  3CK2 A;  4H2G A;  4UT3 A;  3H61 A;  2BQ8 X;  2WDD A;  2WDC A;  4NZV A;  5GTU A;  1Z2W A;  3RL3 A;  1FJM A;  1MF8 A;  3IVD A;  4DT2 A;  3K7W C;  3QG5 C;  2P6B A;  5DNY A;  1G5B A;  2NYM C;  1S3N A;  2O8G A;  2IAE C;  3E7A A;  3RL5 A;  2YEQ A;  2USH A;  4J6O A;  1OI8 A;  4UT3 B;  1S3L A;  4WWL A;  3DSC A;  3FGA C;  5JPE A;  4IL1 A;  4O5G A;  1S8E A;  5B8I A;  1USH A;  3ICF A;  4H2I A;  1U32 A;  4FBW A;  4ORA A;  3LL8 A;  2YVT A;  2Z06 A;  2WDF A;  3QFN A;  1HO5 A;  2DXL A;  2AHD A;  4MP0 A;  5JJT A;  3D03 A;  4DHL A;  3JYF A;  1SU1 A;  3H67 A;  3QFO A;  5EQV A;  1OIE A;  4LU9 A;  1T71 A;  2ZOA A;  3RL4 A;  1V73 A;  3FLO A;  2IE3 C;  3IB8 A;  4O24 A;  4V0X A;  1S3M A;  5HPE A;  4TUG A;  3C5W C; 
#chains in the Genus database with same CATH homology
 3KBP A;  4H2F A;  1S95 A;  4ZX2 A;  2XMO A;  3H62 B;  4F0Z A;  4ORC A;  1UTE A;  3EGH A;  4JA7 A;  1XZW A;  2QFP A;  4H2B A;  3T1I A;  5JPF A;  1JK7 A;  1NNW A;  1WAO 1;  2HYO A;  3H60 A;  4V0W A;  4KKZ A;  2Q8U A;  1HPU A;  3N5U A;  3THN A;  3PSN A;  1II7 A;  2QFR A;  3EGG A;  5C1V A;  2WDE A;  3IB7 A;  2ZBM A;  3K7V C;  4HD0 A;  4FCX A;  4B2O A;  4OR9 A;  4I5N C;  2HYP A;  2R17 A;  3AV0 A;  4LTY A;  1HP1 A;  3H63 A;  1S70 A;  1AUI A;  2IE4 C;  2CV9 A;  2DFJ A;  2ZO9 B;  3DW8 C;  2BCD A;  4I5L C;  4O4K A;  1OID A;  2DXN A;  4XPN A;  4ZVZ A;  4KBP A;  4Q7F A;  4FBQ A;  4IYP C;  3IVE A;  4LAC C;  1W24 A;  3H69 A;  5INB A;  3PSO A;  4V0V A;  4ORB A;  3THO B;  3HVQ A;  2BDX A;  2Z1A A;  3ZTV A;  1T70 A;  2KKN A;  2HY1 A;  5F3W A;  2Z72 A;  1XM7 A;  1Z2X A;  2A22 A;  2NPP C;  3ZU0 A;  1UF3 A;  4MOV A;  3H66 A;  4H1S A;  2JOG A;  3H68 A;  3QFM A;  3H64 A;  1TCO A;  2NXF A;  4H1Y P;  3V4Y A;  1KBP A;  3E0J A;  3TGH A;  4UT2 A;  2GJU A;  1M63 A;  4DSY A;  4TUI A;  1WAR A;  2QJC A;  3QFK A;  4YKE A;  4UWQ A;  1IT6 A;  2NYL C;  1QFC A;  3E7B A;  3GVE A;  4M0V A;  4JA9 A;  1QHW A;  5J28 A;  3C9F A;  4FBK A;  3P71 C;  3AUZ A;  4G9J A;  4O43 A;  5IOH A;  3DSD A;  3RQZ A;  4MOY A;  2O8A A;  3CK2 A;  4H2G A;  4UT3 A;  3H61 A;  2BQ8 X;  2WDD A;  2WDC A;  4NZV A;  5GTU A;  1Z2W A;  3RL3 A;  1FJM A;  1MF8 A;  3IVD A;  4DT2 A;  3K7W C;  3QG5 C;  2P6B A;  5DNY A;  1G5B A;  2NYM C;  1S3N A;  2O8G A;  2IAE C;  3E7A A;  3RL5 A;  2YEQ A;  2USH A;  4J6O A;  1OI8 A;  4UT3 B;  1S3L A;  4WWL A;  3DSC A;  3FGA C;  5JPE A;  4IL1 A;  4O5G A;  1S8E A;  5B8I A;  1USH A;  3ICF A;  4H2I A;  1U32 A;  4FBW A;  4ORA A;  3LL8 A;  2YVT A;  2Z06 A;  2WDF A;  3QFN A;  1HO5 A;  2DXL A;  2AHD A;  4MP0 A;  5JJT A;  3D03 A;  4DHL A;  3JYF A;  1SU1 A;  3H67 A;  3QFO A;  5EQV A;  1OIE A;  4LU9 A;  1T71 A;  2ZOA A;  3RL4 A;  1V73 A;  3FLO A;  2IE3 C;  3IB8 A;  4O24 A;  4V0X A;  1S3M A;  5HPE A;  4TUG A;  3C5W C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...