5INBA

Repoman-pp1g (protein phosphatase 1, gamma isoform) holoenzyme complex
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
293
structure length
293
Chain Sequence
LNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Ki-67 and RepoMan mitotic phosphatases assemble via an identical, yet novel mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
molecule keywords Serine/threonine-protein phosphatase PP1-gamma catalytic sub
total genus 112
structure length 293
sequence length 293
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2016-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 5inbA00
1NNWA 2NXFA 1IT6A 2WDDA 4ZX2A 2Z06A 4ORBA 3PSOA 1QFCA 2BQ8X 3IVDA 4JA7A 5F3WA 1WARA 1S70A 1OIEA 2JOGA 5C1VA 3DSDA 4O5GA 3EGGA 2Z72A 1W24A 2AHDA 1KBPA 4V0XA 4JA9A 4M0VA 4TUIA 3ZU0A 1S8EA 3ICFA 4LACC 4WWLA 2BCDA 3THNA 1T71A 2O8AA 4H2FA 5JJTA 1SU1A 1WAO1 2NPPC 3RL4A 4UT3A 3KBPA 4UWQA 2ZBMA 1U32A 4V0WA 4NZVA 3ZTVA 4KKZA 4I5LC 2QJCA 3K7VC 4MOVA 2QFRA 4FBWA 4LU9A 2YVTA 3H67A 2WDEA 3FGAC 3H69A 4G9JA 3QFKA 4Q7FA 3V4YA 3H60A 2XMOA 2HYOA 3C5WC 3GVEA 1II7A 2IE4C 3RL5A 2A22A 3P71C 2QFPA 3DSCA 1T70A 1V73A 4B2OA 3H66A 2DFJA 4FBKA 4H2BA 4IYPC 4H1YP 4F0ZA 4MP0A 3E7AA 4H1SA 3T1IA 4I5NC 2IAEC 3PSNA 3LL8A 5EQVA 1AUIA 4DHLA 2USHA 2WDCA 5IOHA 3K7WC 2IE3C 1OI8A 2P6BA 4ORAA 2KKNA 2HYPA 4UT2A 2R17A 3E7BA 4IL1A 5HPEA 4LTYA 5JPFA 1QHWA 1M63A 3HVQA 1USHA 4O24A 1FJMA 3RQZA 3QFNA 3IB8A 4O4KA 1S3NA 3AUZA 3QFOA 4V0VA 3N5UA 3H68A 3IB7A 1OIDA 4MOYA 4UT3B 2CV9A 1XM7A 1JK7A 1HP1A 3THOB 4ZVZA 4HD0A 4FCXA 2WDFA 4DT2A 5J28A 1Z2XA 2Z1AA 4ORCA 3H61A 5GTUA 1UTEA 3TGHA 5INBA 2NYLC 5DNYA 4DSYA 1HO5A 1TCOA 3EGHA 3C9FA 4TUGA 1XZWA 1MF8A 3JYFA 4H2IA 3QFMA 2GJUA 2NYMC 3DW8C 1S3MA 2O8GA 1S95A 4YKEA 3CK2A 3IVEA 4H2GA 4XPNA 3H64A 1UF3A 5B8IA 1Z2WA 3AV0A 3QG5C 1HPUA 3H63A 1G5BA 2Q8UA 2BDXA 4O43A 4OR9A 3RL3A 3H62B 5JPEA 4FBQA 4KBPA 4J6OA 2HY1A 1S3LA
chains in the Genus database with same CATH superfamily
1NNWA 2NXFA 1IT6A 2WDDA 4ZX2A 2Z06A 4ORBA 3PSOA 1QFCA 2BQ8X 3IVDA 4JA7A 5F3WA 1WARA 1S70A 1OIEA 2JOGA 5C1VA 3DSDA 4O5GA 3EGGA 2Z72A 1W24A 2AHDA 1KBPA 4V0XA 4JA9A 4M0VA 4TUIA 3ZU0A 1S8EA 3ICFA 4LACC 4WWLA 2BCDA 3THNA 1T71A 2O8AA 4H2FA 5JJTA 1SU1A 1WAO1 2NPPC 3RL4A 4UT3A 3KBPA 4UWQA 2ZBMA 1U32A 4V0WA 4NZVA 3ZTVA 4KKZA 4I5LC 2QJCA 3K7VC 4MOVA 2QFRA 4FBWA 4LU9A 2YVTA 3H67A 2WDEA 3FGAC 3H69A 4G9JA 3QFKA 4Q7FA 3V4YA 3H60A 2XMOA 2HYOA 3C5WC 3GVEA 1II7A 2IE4C 3RL5A 2A22A 3P71C 2QFPA 3DSCA 1T70A 2ZO9B 1V73A 4B2OA 3H66A 2DFJA 4FBKA 4H2BA 4IYPC 4H1YP 4F0ZA 4MP0A 3E7AA 4H1SA 3T1IA 4I5NC 2IAEC 3PSNA 3LL8A 5EQVA 1AUIA 4DHLA 2USHA 2DXLA 2WDCA 3K7WC 2IE3C 5IOHA 3FLOA 1OI8A 2P6BA 4ORAA 2KKNA 2HYPA 4UT2A 2R17A 3E7BA 4IL1A 2YEQA 5HPEA 4LTYA 5JPFA 1QHWA 1M63A 3HVQA 1USHA 5JPEA 4O24A 1FJMA 3RQZA 3QFNA 3IB8A 4O4KA 1S3NA 3AUZA 3QFOA 4V0VA 3N5UA 3H68A 3IB7A 1OIDA 3E0JA 4MOYA 4UT3B 2CV9A 1XM7A 1JK7A 1HP1A 3THOB 4ZVZA 4HD0A 4FCXA 2ZOAA 2WDFA 4DT2A 5J28A 1Z2XA 2Z1AA 4ORCA 3H61A 5GTUA 1UTEA 3TGHA 5INBA 2NYLC 5DNYA 4DSYA 1HO5A 1TCOA 3EGHA 3C9FA 4TUGA 1XZWA 1MF8A 3JYFA 4H2IA 3QFMA 2GJUA 2NYMC 3DW8C 1S3MA 2O8GA 1S95A 4YKEA 3CK2A 3IVEA 4H2GA 4XPNA 3H64A 1UF3A 5B8IA 1Z2WA 3AV0A 3QG5C 1HPUA 3H63A 1G5BA 2DXNA 2BDXA 2Q8UA 4O43A 4OR9A 3H62B 3RL3A 3D03A 4FBQA 4KBPA 4J6OA 2HY1A 1S3LA
chains in the Genus database with same CATH topology
1NNWA 2NXFA 1IT6A 2WDDA 4ZX2A 2Z06A 4ORBA 3PSOA 1QFCA 2BQ8X 3IVDA 4JA7A 5F3WA 1WARA 1S70A 1OIEA 2JOGA 5C1VA 3DSDA 4O5GA 3EGGA 2Z72A 1W24A 2AHDA 1KBPA 4V0XA 4JA9A 4M0VA 4TUIA 3ZU0A 1S8EA 3ICFA 4LACC 4WWLA 2BCDA 3THNA 1T71A 2O8AA 4H2FA 5JJTA 1SU1A 1WAO1 2NPPC 3RL4A 4UT3A 3KBPA 4UWQA 2ZBMA 1U32A 4V0WA 4NZVA 3ZTVA 4KKZA 4I5LC 2QJCA 3K7VC 4MOVA 2QFRA 4FBWA 4LU9A 2YVTA 3H67A 2WDEA 3FGAC 3H69A 4G9JA 3QFKA 4Q7FA 3V4YA 3H60A 2XMOA 2HYOA 3C5WC 3GVEA 1II7A 2IE4C 3RL5A 2A22A 3P71C 2QFPA 3DSCA 1T70A 2ZO9B 1V73A 4B2OA 3H66A 2DFJA 4FBKA 4H2BA 4IYPC 4H1YP 4F0ZA 4MP0A 3E7AA 4H1SA 3T1IA 4I5NC 2IAEC 3PSNA 3LL8A 5EQVA 1AUIA 4DHLA 2USHA 2DXLA 2WDCA 3K7WC 2IE3C 5IOHA 3FLOA 1OI8A 2P6BA 4ORAA 2KKNA 2HYPA 4UT2A 2R17A 3E7BA 4IL1A 2YEQA 5HPEA 4LTYA 5JPFA 1QHWA 1M63A 3HVQA 1USHA 5JPEA 4O24A 1FJMA 3RQZA 3QFNA 3IB8A 4O4KA 1S3NA 3AUZA 3QFOA 4V0VA 3N5UA 3H68A 3IB7A 1OIDA 3E0JA 4MOYA 4UT3B 2CV9A 1XM7A 1JK7A 1HP1A 3THOB 4ZVZA 4HD0A 4FCXA 2ZOAA 2WDFA 4DT2A 5J28A 1Z2XA 2Z1AA 4ORCA 3H61A 5GTUA 1UTEA 3TGHA 5INBA 2NYLC 5DNYA 4DSYA 1HO5A 1TCOA 3EGHA 3C9FA 4TUGA 1XZWA 1MF8A 3JYFA 4H2IA 3QFMA 2GJUA 2NYMC 3DW8C 1S3MA 2O8GA 1S95A 4YKEA 3CK2A 3IVEA 4H2GA 4XPNA 3H64A 1UF3A 5B8IA 1Z2WA 3AV0A 3QG5C 1HPUA 3H63A 1G5BA 2DXNA 2BDXA 2Q8UA 4O43A 4OR9A 3H62B 3RL3A 3D03A 4FBQA 4KBPA 4J6OA 2HY1A 1S3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NNW A;  2NXF A;  1IT6 A;  2WDD A;  4ZX2 A;  2Z06 A;  4ORB A;  3PSO A;  1QFC A;  2BQ8 X;  3IVD A;  4JA7 A;  5F3W A;  1WAR A;  1S70 A;  1OIE A;  2JOG A;  5C1V A;  3DSD A;  4O5G A;  3EGG A;  2Z72 A;  1W24 A;  2AHD A;  1KBP A;  4V0X A;  4JA9 A;  4M0V A;  4TUI A;  3ZU0 A;  1S8E A;  3ICF A;  4LAC C;  4WWL A;  2BCD A;  3THN A;  1T71 A;  2O8A A;  4H2F A;  5JJT A;  1SU1 A;  1WAO 1;  2NPP C;  3RL4 A;  4UT3 A;  3KBP A;  4UWQ A;  2ZBM A;  1U32 A;  4V0W A;  4NZV A;  3ZTV A;  4KKZ A;  4I5L C;  2QJC A;  3K7V C;  4MOV A;  2QFR A;  4FBW A;  4LU9 A;  2YVT A;  3H67 A;  2WDE A;  3FGA C;  3H69 A;  4G9J A;  3QFK A;  4Q7F A;  3V4Y A;  3H60 A;  2XMO A;  2HYO A;  3C5W C;  3GVE A;  1II7 A;  2IE4 C;  3RL5 A;  2A22 A;  3P71 C;  2QFP A;  3DSC A;  1T70 A;  1V73 A;  4B2O A;  3H66 A;  2DFJ A;  4FBK A;  4H2B A;  4IYP C;  4H1Y P;  4F0Z A;  4MP0 A;  3E7A A;  4H1S A;  3T1I A;  4I5N C;  2IAE C;  3PSN A;  3LL8 A;  5EQV A;  1AUI A;  4DHL A;  2USH A;  2WDC A;  5IOH A;  3K7W C;  2IE3 C;  1OI8 A;  2P6B A;  4ORA A;  2KKN A;  2HYP A;  4UT2 A;  2R17 A;  3E7B A;  4IL1 A;  5HPE A;  4LTY A;  5JPF A;  1QHW A;  1M63 A;  3HVQ A;  1USH A;  4O24 A;  1FJM A;  3RQZ A;  3QFN A;  3IB8 A;  4O4K A;  1S3N A;  3AUZ A;  3QFO A;  4V0V A;  3N5U A;  3H68 A;  3IB7 A;  1OID A;  4MOY A;  4UT3 B;  2CV9 A;  1XM7 A;  1JK7 A;  1HP1 A;  3THO B;  4ZVZ A;  4HD0 A;  4FCX A;  2WDF A;  4DT2 A;  5J28 A;  1Z2X A;  2Z1A A;  4ORC A;  3H61 A;  5GTU A;  1UTE A;  3TGH A;  5INB A;  2NYL C;  5DNY A;  4DSY A;  1HO5 A;  1TCO A;  3EGH A;  3C9F A;  4TUG A;  1XZW A;  1MF8 A;  3JYF A;  4H2I A;  3QFM A;  2GJU A;  2NYM C;  3DW8 C;  1S3M A;  2O8G A;  1S95 A;  4YKE A;  3CK2 A;  3IVE A;  4H2G A;  4XPN A;  3H64 A;  1UF3 A;  5B8I A;  1Z2W A;  3AV0 A;  3QG5 C;  1HPU A;  3H63 A;  1G5B A;  2Q8U A;  2BDX A;  4O43 A;  4OR9 A;  3RL3 A;  3H62 B;  5JPE A;  4FBQ A;  4KBP A;  4J6O A;  2HY1 A;  1S3L A; 
#chains in the Genus database with same CATH topology
 1NNW A;  2NXF A;  1IT6 A;  2WDD A;  4ZX2 A;  2Z06 A;  4ORB A;  3PSO A;  1QFC A;  2BQ8 X;  3IVD A;  4JA7 A;  5F3W A;  1WAR A;  1S70 A;  1OIE A;  2JOG A;  5C1V A;  3DSD A;  4O5G A;  3EGG A;  2Z72 A;  1W24 A;  2AHD A;  1KBP A;  4V0X A;  4JA9 A;  4M0V A;  4TUI A;  3ZU0 A;  1S8E A;  3ICF A;  4LAC C;  4WWL A;  2BCD A;  3THN A;  1T71 A;  2O8A A;  4H2F A;  5JJT A;  1SU1 A;  1WAO 1;  2NPP C;  3RL4 A;  4UT3 A;  3KBP A;  4UWQ A;  2ZBM A;  1U32 A;  4V0W A;  4NZV A;  3ZTV A;  4KKZ A;  4I5L C;  2QJC A;  3K7V C;  4MOV A;  2QFR A;  4FBW A;  4LU9 A;  2YVT A;  3H67 A;  2WDE A;  3FGA C;  3H69 A;  4G9J A;  3QFK A;  4Q7F A;  3V4Y A;  3H60 A;  2XMO A;  2HYO A;  3C5W C;  3GVE A;  1II7 A;  2IE4 C;  3RL5 A;  2A22 A;  3P71 C;  2QFP A;  3DSC A;  1T70 A;  2ZO9 B;  1V73 A;  4B2O A;  3H66 A;  2DFJ A;  4FBK A;  4H2B A;  4IYP C;  4H1Y P;  4F0Z A;  4MP0 A;  3E7A A;  4H1S A;  3T1I A;  4I5N C;  2IAE C;  3PSN A;  3LL8 A;  5EQV A;  1AUI A;  4DHL A;  2USH A;  2DXL A;  2WDC A;  3K7W C;  2IE3 C;  5IOH A;  3FLO A;  1OI8 A;  2P6B A;  4ORA A;  2KKN A;  2HYP A;  4UT2 A;  2R17 A;  3E7B A;  4IL1 A;  2YEQ A;  5HPE A;  4LTY A;  5JPF A;  1QHW A;  1M63 A;  3HVQ A;  1USH A;  5JPE A;  4O24 A;  1FJM A;  3RQZ A;  3QFN A;  3IB8 A;  4O4K A;  1S3N A;  3AUZ A;  3QFO A;  4V0V A;  3N5U A;  3H68 A;  3IB7 A;  1OID A;  3E0J A;  4MOY A;  4UT3 B;  2CV9 A;  1XM7 A;  1JK7 A;  1HP1 A;  3THO B;  4ZVZ A;  4HD0 A;  4FCX A;  2ZOA A;  2WDF A;  4DT2 A;  5J28 A;  1Z2X A;  2Z1A A;  4ORC A;  3H61 A;  5GTU A;  1UTE A;  3TGH A;  5INB A;  2NYL C;  5DNY A;  4DSY A;  1HO5 A;  1TCO A;  3EGH A;  3C9F A;  4TUG A;  1XZW A;  1MF8 A;  3JYF A;  4H2I A;  3QFM A;  2GJU A;  2NYM C;  3DW8 C;  1S3M A;  2O8G A;  1S95 A;  4YKE A;  3CK2 A;  3IVE A;  4H2G A;  4XPN A;  3H64 A;  1UF3 A;  5B8I A;  1Z2W A;  3AV0 A;  3QG5 C;  1HPU A;  3H63 A;  1G5B A;  2DXN A;  2BDX A;  2Q8U A;  4O43 A;  4OR9 A;  3H62 B;  3RL3 A;  3D03 A;  4FBQ A;  4KBP A;  4J6O A;  2HY1 A;  1S3L A; 
#chains in the Genus database with same CATH homology
 1NNW A;  2NXF A;  1IT6 A;  2WDD A;  4ZX2 A;  2Z06 A;  4ORB A;  3PSO A;  1QFC A;  2BQ8 X;  3IVD A;  4JA7 A;  5F3W A;  1WAR A;  1S70 A;  1OIE A;  2JOG A;  5C1V A;  3DSD A;  4O5G A;  3EGG A;  2Z72 A;  1W24 A;  2AHD A;  1KBP A;  4V0X A;  4JA9 A;  4M0V A;  4TUI A;  3ZU0 A;  1S8E A;  3ICF A;  4LAC C;  4WWL A;  2BCD A;  3THN A;  1T71 A;  2O8A A;  4H2F A;  5JJT A;  1SU1 A;  1WAO 1;  2NPP C;  3RL4 A;  4UT3 A;  3KBP A;  4UWQ A;  2ZBM A;  1U32 A;  4V0W A;  4NZV A;  3ZTV A;  4KKZ A;  4I5L C;  2QJC A;  3K7V C;  4MOV A;  2QFR A;  4FBW A;  4LU9 A;  2YVT A;  3H67 A;  2WDE A;  3FGA C;  3H69 A;  4G9J A;  3QFK A;  4Q7F A;  3V4Y A;  3H60 A;  2XMO A;  2HYO A;  3C5W C;  3GVE A;  1II7 A;  2IE4 C;  3RL5 A;  2A22 A;  3P71 C;  2QFP A;  3DSC A;  1T70 A;  2ZO9 B;  1V73 A;  4B2O A;  3H66 A;  2DFJ A;  4FBK A;  4H2B A;  4IYP C;  4H1Y P;  4F0Z A;  4MP0 A;  3E7A A;  4H1S A;  3T1I A;  4I5N C;  2IAE C;  3PSN A;  3LL8 A;  5EQV A;  1AUI A;  4DHL A;  2USH A;  2DXL A;  2WDC A;  3K7W C;  2IE3 C;  5IOH A;  3FLO A;  1OI8 A;  2P6B A;  4ORA A;  2KKN A;  2HYP A;  4UT2 A;  2R17 A;  3E7B A;  4IL1 A;  2YEQ A;  5HPE A;  4LTY A;  5JPF A;  1QHW A;  1M63 A;  3HVQ A;  1USH A;  5JPE A;  4O24 A;  1FJM A;  3RQZ A;  3QFN A;  3IB8 A;  4O4K A;  1S3N A;  3AUZ A;  3QFO A;  4V0V A;  3N5U A;  3H68 A;  3IB7 A;  1OID A;  3E0J A;  4MOY A;  4UT3 B;  2CV9 A;  1XM7 A;  1JK7 A;  1HP1 A;  3THO B;  4ZVZ A;  4HD0 A;  4FCX A;  2ZOA A;  2WDF A;  4DT2 A;  5J28 A;  1Z2X A;  2Z1A A;  4ORC A;  3H61 A;  5GTU A;  1UTE A;  3TGH A;  5INB A;  2NYL C;  5DNY A;  4DSY A;  1HO5 A;  1TCO A;  3EGH A;  3C9F A;  4TUG A;  1XZW A;  1MF8 A;  3JYF A;  4H2I A;  3QFM A;  2GJU A;  2NYM C;  3DW8 C;  1S3M A;  2O8G A;  1S95 A;  4YKE A;  3CK2 A;  3IVE A;  4H2G A;  4XPN A;  3H64 A;  1UF3 A;  5B8I A;  1Z2W A;  3AV0 A;  3QG5 C;  1HPU A;  3H63 A;  1G5B A;  2DXN A;  2BDX A;  2Q8U A;  4O43 A;  4OR9 A;  3H62 B;  3RL3 A;  3D03 A;  4FBQ A;  4KBP A;  4J6O A;  2HY1 A;  1S3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...