5IOBA

Crystal structure of beta-n-acetylglucosaminidase-like protein from corynebacterium glutamicum
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
335
structure length
316
Chain Sequence
PTAEDLARAQIPEQQRDQVASLMMVGVANYDQALDALNQGVGGIFIGSWTDENLLTEPGRNIEALREAVGRDFSVSIDFEGGRVQRATNILGDFPSPRVMAQTMTPEQVEDLAEILGTGLAAHGVTVNFAPVVDVDAWGLPVVFSNDPAVAATYATAFAKGLSKVGITPVFKHFPGHGTPALDELKTYDLIPYGQALSETDGAVMVGHMIVPGLGTDGVPSSIDPATYQLLRSGDYPGGVPFDGVIYTDDLSGMSAISSPAEAVLASLKAGADQALWIDYGSLGSAIDRVDAAVSSGEYPQEQMLASALRVQLLYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-glucosidase-related glycosidases
publication title Crystal structure of beta-N-acetylglucosaminidase-like protein from Corynebacterium glutamicum
rcsb
source organism Corynebacterium glutamicum (strain atcc 13032 / dsm 20300 / jcm 1318 / lmg 3730
molecule tags Hydrolase
total genus 96
structure length 316
sequence length 335
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.300 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase, family 3, N-terminal domain 5iobA00
3WLTA 4IIEA 3WLJA 2X42A 1X39A 4ZOAA 1J8VA 3USZA 3ZZ1A 4ZODA 2OXNA 3WO8A 1X38A 5C0QA 1Y65A 4HZMA 4GVIA 2X40A 4GVHA 3WLRA 3ZYZA 5FJJA 4IIBA 3WLNA 4I3GA 4YYFA 3WLIA 3UT0A 3AC0A 5JU6A 4ZO6A 3WLPA 4MSSA 3WLSA 1IEVA 3WLKX 3RRXA 3ABZA 3WLQA 4GYKA 3NVDA 4GVGA 4ZO8A 4ZO9A 4IIFA 5BU9A 3U4AA 1TR9A 4I8DA 4ZOCA 5BZAA 1IEQA 3WLHA 4ZOEA 2X41A 4IIDA 1LQ2A 1IEWA 4ZOBA 3WLOA 5TF0A 3SQLA 3WLMA 5FJIA 3SQMA 4IIHA 3TEVA 5IOBA 4GYJA 3U48A 5G1MA 4IICA 4GVFA 1EX1A 3GS6A 3GSMA 4ZO7A 3LK6A 4G6CA 4IIGA 3WLLA 3BMXA 1IEXA 4GNVA
chains in the Genus database with same CATH superfamily
3U6WA 3U2CA 3PB0A 3CT7A 2G3JA 3EWBX 2IKHA 3FYOA 4GUHA 5HNTA 4Q7BA 2VZTA 3LPPA 3Q2DA 1JVNA 1NP2A 3BJFA 2V69A 3SCSA 4MMWA 1R46A 5T9CE 3CTLA 1YKWA 5LHFA 4QM1A 5LNRA 2E6DA 4LY4A 1AQHA 3ZXWA 5J5DA 2VELA 3WLPA 3ATZA 4KETA 5HR6A 4GCXA 3ABXA 1VS1A 1GOIA 2EG8A 3EX6A 1C8VA 4YNGA 2VO5A 4Q8OA 1XIJA 3HPZA 3V7PA 1SO4A 2RDTA 3FGCB 5D2YA 3APGA 2CLKA 4IQLA 4W8BA 2HVOA 4FF7A 4EANA 1Q6DA 3EXRA 4HOZA 4L1WA 4GISA 3TOPA 3GTHA 1AMKA 2WZEA 4S3AA 3WQGA 4Z2HA 4HPGA 3IIOA 1Y5VA 3L9CA 5DXYA 1J2WA 2RJHA 3G77A 4FPSA 2QUMA 4CD5A 2PDKA 3UYCA 4HZ7A 1TJ2A 3GLCA 3DKLA 2AQOA 2PDCA 2ZA1A 1CGVA 2W4XA 4G2DA 1H7OA 1JZ2A 2ZZ2A 4H9VA 4CN6A 3M0VA 1E0UA 4JEJA 1O95A 1YPFA 3E02A 2OMAA 3KTSA 1DORA 4GY7A 5T26A 4JS3A 3GHTA 2PSNA 3G1FA 4YVVA 3AJ7A 2GPTA 1TPDA 1FHUA 3TP4A 5BXPA 1JZ7A 2BFGA 1CPUA 1T5AA 3CZGA 3CPRA 4LUTB 3K8LA 4PZVA 5FD0A 5HQMA 3EX4A 2CESA 3PUOA 4OE7A 1DP0A 2OZ8A 1TR9A 4BQ3A 1M7OA 3W2KA 1NDYA 1Z41A 4XAYA 4K7VA 4UFKA 3B06A 4DJED 1LWJA 1WOBA 3G0SA 1K8CA 5BXSA 1XLJA 3KOWA 5CC6A 3THUA 2V81A 4CQ9A 3UBPC 1XCXA 2QLYA 4I7VA 3GVGA 1ZU8A 1O12A 2Z29A 4JTKA 1O1ZA 2OJPA 2CLMA 3S6DA 3HJEA 3GR7A 4LUSA 2PDJA 1SZEA 3L2MA 5A8QA 2NT1A 1NWRA 4CCZA 4FEZA 2ZKMX 3IV3A 3EOOA 1XIDA 3WYZA 2PLMA 1X39A 4CUCA 2ZRUA 3K1DA 1XDLA 4NX5A 3TOYA 5K4ZA 2OXNA 4W5UA 4QE5A 3PUDA 3TH6A 2DDXA 3C8NA 1AD1A 1VFLA 1UBSA 3UEQA 5KTLA 3AQUA 3WMLA 3BARA 4UZUA 2CHNA 4O1EA 2HZGA 1GOOA 1QPOA 4EIVA 3TFCA 1J0JA 1EP2A 4F8XA 2D69A 2WBGA 4WGXA 1OD8A 3DYPA 2E5CA 4J3VA 2AL1A 3H2MA 3WD4A 1UR3M 4JXCA 4DAFA 2ZWZA 4HSNA 3T55A 2NVDA 4KESA 2W63A 1FOBA 1VQTA 3HU7A 3WQCA 5CPNA 3BAKA 2ICSA 1ICPA 3RMJA 5CLWA 1VZWA 2Z7KA 4MWAE 2Y2WA 2E6AA 4ZO8A 1JUBA 2DEPA 1F74A 1SFSA 3QC3A 5KSWA 1BQGA 4Q4MA 2MNRA 3A4JA 4XZ9A 4TVDA 2WMKA 3H23A 4WXYA 4DZHA 1DYSA 5GQBA 4K1GA 9XIAA 3C0SA 1IGWA 5SWUA 4CNUA 1RPXA 1E15A 1HTIA 1R6WA 4KCUA 2FFIA 4X9YA 4J3UA 3ZJ8A 1XIEA 3C52A 2TMDA 1DIOA 3WIJA 3V16A 4IUOA 3UG8A 1TMQA 4XZWA 1LT7A 2XSAA 1DOSA 1F3WA 4GY0A 3EZ4A 2V0TA 3T81A 2ZICA 1VYSX 3PPFA 1T40A 5D4YA 1LT8A 1TR1A 1JYXA 1H0GA 1PZ0A 2A4AA 1EC9A 5ABHA 2PTYA 3WMCA 1AZ2A 4G1KA 5EMKA 2PCQA 2EKGA 3I65A 5IDIA 2HBXA 1TYGA 1PKMA 1PBGA 2C15A 3GAYA 4NZJA 3M7WA 4ZCWA 1KM6A 2PLCA 2BHYA 1P6BA 2PWGA 4D6GA 4W4QA 5I09A 4ZZ9A 1TZ9A 3QV8A 4DJFD 4TUFA 4PMXA 3QF0A 3H54A 3GKAA 4F9DA 4UMAA 3QXBA 4MB3A 3IGSA 3TW6A 2PWEA 5C70A 1XRVA 2PTDA 5ECVA 1EIXA 3H6OA 3K46A 4EACA 4J2MA 1JDFA 4GGBA 1V8EA 1WXZA 3N4AA 4S3DA 3MHUA 1B3ZA 1CEOA 2OWCA 3NQCA 3I6EA 2E6FA 3K30A 2CHOA 4CD4A 2C6QA 3FJNA 1RQBA 3SSJA 1BYBA 2CBJA 1TV8A 4PMOA 1J0KA 1MFVA 2OEMA 1Z32X 1R9ZA 4PCPA 4DZIA 3GVQA 3QSRA 1OZMA 3LERA 3EWWA 3GUWA 3WQEA 4UCGA 4UXDA 3PAJA 5HJLA 4IJBA 2QMJA 3WLTA 4FNQA 4HHHA 3QY7A 4TU1A 4TVUA 3NPXA 3S2JA 3KLLA 1TQJA 2C14A 3M5XA 5D05A 3H2EA 1T8QA 5EBAA 1REQB 3L2IA 2HDJA 4DF1A 4GVHA 4PMQA 1VHCA 4LYPA 2A7RA 2IKGA 3ZIZA 2E5BA 1S5NA 1HP4A 3HPSA 1SR9A 3LLFA 5I2UA 1QMLA 4QCFA 4CD6A 4KEZA 4G7EB 3MC5A 5C54A 4IGSA 1U2YA 3UGVA 3H2AA 4D8ZA 1GOXA 3OIXA 3RRAA 2ACSA 4HKPA 4PL1A 1OABA 1JPHA 1YLVA 2H3DA 4H83A 4JIIX 1D2KA 3OGRA 2V3FA 3LDVA 4YTTA 1JDDA 3LZ5A 1IEIA 1L8NA 1EYWA 1E9YB 3V4BA 3V3WA 3PZ9A 5BROA 2EO7A 4C65A 3A9IA 1W1YA 1OX5A 1ZRQA 1PYFA 2YBUA 3BUVA 3N25A 4C1LA 3S5OA 1UR8A 5A6BA 1NJJA 1G6CA 1JFHA 3VIKA 4IZGA 2BGQA 2NXGA 3RPDA 4IGHA 4NRRA 2BXZA 5TF0A 3WF1A 1V3HA 3QGVA 4N6FA 4F9JA 1X8FA 4MOZA 3LV6A 1L2UA 1RLDA 3OEXA 1R3QA 3DU0A 3TQVA 3CHFA 4MYXA 3H55A 3H21A 1A5NC 3WDJA 1GVOA 4RLIA 4U3CA 3G18A 2IPFA 1FWGC 3GDBA 4OT7A 3QYSA 3MKKA 1E9IA 1JPMA 4KS0A 2D73A 1OCJA 3DEQA 1JD7A 3DGRA 4NAFA 2GGGA 4DQWA 3T0CA 2QGYA 3RCYA 4DYJA 4D6CA 4CD7A 1XSIA 1TCMA 5HMDA 3P74A 4H9YA 2WVTA 4JTTA 1M04A 2OT1A 4QG8A 3L0KA 4N2YA 1EDTA 1UG6A 4GWEA 4JR5A 5C5YA 2CWXA 1VPYA 4K6AA 2FGBA 2WVSA 4BWLA 4I9MA 1PX4A 4AZCB 2X1UA 4HN8A 3BAIA 3G1DA 4GA8A 3V18A 5CPLA 4HU4A 2FZMA 5FEWA 1UZ1A 1DIEA 4I5UA 3ARXA 2WJFA 3V0TA 3W24A 3TTSA 2H90A 3ZSTA 1RAKA 2WW5A 3CEUA 4XUGA 2F61A 3IJ9A 6A3HA 5D30A 5DY2A 4ZXLA 5E6YA 4HA1A 2NUWA 4OJYA 4Z08A 3N2MA 1QPNA 2ATSA 4KRUA 2VYOA 4X63A 1ZFJA 3QH2A 3OODA 4FXJA 3TAOA 2QCNA 1B5TA 1XW8A 1VBGA 1P7TB 3W2LA 3AS1A 2ISSA 3ITXA 4PUMA 2J6XA 5HULA 3W2UA 4J27A 1ZCCA 5BCAA 3QMSA 1G4EA 3UG5A 2OLHA 4HYVA 3LM3A 4H6EA 4RXFA 3BSHA 3DZ1A 3E2SA 4LUJA 1R9YA 1J8VA 4US5D 3GK0A 4HNVA 2ZTJA 1AD4A 3K13A 4JICA 1JXKA 4AIOA 4MZ1A 2NT0A 2YKKA 4XD4A 5FACA 4REQA 3WQ4A 4DB7A 1PX3A 1GPWA 2ZDSA 1W31A 1UIPA 4H19A 3TCSA 1IV8A 1YW1A 5EA9A 3NL5A 2Y5JA 2ISWA 3M0ZA 2DY3A 1BRLB 3NQMA 4BS0A 4HK6A 5A6TC 5C71A 4DO6A 3WFZA 3CIWA 3STPA 3AROA 1K7EA 3NL6A 4PH6A 1OG6A 1N8WA 5D02A 1Y5XA 4QXIA 3LBCA 5LGZA 2PWVA 3EB3A 5CPSA 1RHCA 1S2VA 2J7EA 1XWYA 4TTUA 2F2KA 4GBUA 4JCLA 2CFFA 1V79A 5I23A 4WLCA 3G6LA 4O50A 4PRRA 1X1OA 3LCLA 4C90A 2XIIA 3CV1A 2VEMA 4RW3A 4I6KA 3JZUA 4XWUA 4JY9A 1VJIA 1QPQA 1JCYA 3WDQA 3WUBA 3SCOA 1PPIA 4N9EA 3EWUA 1PIIA 3KTXA 4E3TA 1X6NA 4KWOA 3F03K 1QAPA 3TSMA 3T0AA 3HA1A 4DZAA 3D47A 3ZM8A 4LUIA 4E4FA 2FDSA 2R1KA 4IH3A 1CENA 3ARYA 1F3XA 2VT0A 4H9UA 1OFOA 1C91A 4M5PA 5C0QA 2YGYA 1AJ0A 1SO6A 2GQAA 2EPMX 4DELA 4GQRA 3O0FA 1EUNA 2DT1A 1GYNA 3UPBA 4JTDA 4L4PA 5M2FX 3T0DA 1PL9A 3AXMA 3I7QA 4DWDA 1CLKA 3WSUA 1FQ0A 2QVHA 2Y5SA 5A2BA 2ESCA 4UFJA 2FMOA 3VMOA 4M82A 2FB2A 1KXVA 4YHEA 1IEVA 1U5VA 2BMBA 3UR5A 5HJYA 3BAJA 4HMCA 4PMUA 7REQB 4X3ZA 1MXSA 1GJPA 4GI6A 1U30A 1P0EA 3VCCA 3M0MA 3JRKA 3W7KA 2OOFA 2VURA 4GNKB 2RUSA 4LUYA 5A95A 3MKCA 5HA7A 2D2HA 1ECEA 2WMIB 5C9ZA 2CETA 3ZVHA 3O7UA 4UR7A 5LHEA 3VUPA 1MNZA 3AHXA 3L4YA 3KOYA 4O28A 3CUXA 2GWNA 1RP9A 4IJCA 5D2WA 3C2RA 1EX1A 1N82A 4IFRA 1NELA 1AVAA 3BXWA 3OG3A 4IL0A 1E0WA 3KVMA 1XLCA 4LVBA 1P48A 3PWGA 2NSOA 3K2GA 4ZQNA 1ODZA 3MT1A 3N15A 2Y7EA 1GHRA 2E5DA 1S39A 3N2OA 4JIPA 3B8UA 3CH0A 3W07A 4X61A 1S5MA 2X1SA 4DJEC 1ITQA 2ZRZA 4FLOA 3CHDA 3AAMA 1O68A 1DHPA 1VB9A 1JCJA 4EPEC 4FNSA 3DC0A 1OCNA 3OU8A 1W6TA 3PZVA 2A21A 1KCXA 4MAVA 2ZUWA 3W86A 4FXRA 3KUMA 4IJRA 2QPSA 1OHLA 1XS2A 3B9OA 2GVGA 5A6LA 3MJYA 2FB3A 4KGLA 3UWQA 5AHEA 3RU8X 1PWMA 3BVJA 2CC0A 2PMQA 1OT2A 5EMLA 4MVAA 5B7YA 3CMJA 4Y2WA 4F0RA 3PC0A 3SUUA 3FAXA 4IFOA 4LEFA 3E38A 3KP0A 2Y89A 3W83A 4C7GA 3VD9A 4W89A 4G9PA 4JTSA 1I2QA 1JFXA 3MANA 3Q4DA 3L23A 1EJRC 1XIIA 1DQUA 2HSAA 2VC6A 1A4LA 3GG8A 1HJWA 1G67A 3NQVA 2A3BA 2Y63A 2D1ZA 4PBEA 1P1MA 3GNDA 2X42A 3K1GA 2V67A 4AY7A 3FVMA 1BYCA 4DLMA 1AZ1A 4WF7A 4RKAA 1E1CB 3V36A 3QR3A 3QY8A 3GXDA 3C0LA 1W3IA 2B7PA 5GJNA 3GH7A 1UMLA 3RIKA 1EJXC 1FH9A 4M24A 2HXTA 3F2DA 1YE4A 1KV8A 4B5VA 1BWVA 4FAMA 2E8ZA 4WJ8A 1K9TA 6REQB 1A3XA 2BSLA 3ONBA 4LF1A 5IBXC 3SBFA 3TAKA 1WDPA 4RZ4A 1UWQA 4O57A 1RVGA 1FHVA 5I3HA 4R7OA 4LCRA 4Q4PA 3STCA 1XBXA 5LNUA 4C6LA 1EBGA 1Q7MA 1YTEA 1QXLA 3SO7A 3T0TA 5CSUA 1J4EA 1IXQA 1HKMA 1OK6A 4BZYA 3G1AA 5BWFA 3QR0A 3GHSA 2BWGA 3W7GA 3N3TA 1OFQA 3XISA 3W87A 2ZUMA 2TAAA 5CQ1A 2PUZA 3QC0A 3PFMA 2A7NA 2OQLA 4AQLA 2X41A 3I3EA 4IIDA 3IJ8A 4K39A 3ZLFA 3UA4A 1X97A 4C91A 2ZUUA 3P2VA 5EFDA 3DN5A 3H2NA 2INEA 3B9AA 2OKTA 3LHWA 2WCAA 1JYVA 2QIIA 3EWCA 4DJFC 3CV2A 2QF7A 3LK6A 4NAEA 4M6QA 1GGOA 1XIBA 5I3DA 2EF9A 5G4WA 3VTRA 1SJBA 4WQ6A 1Q6GA 1B90A 1QVBA 1UCWA 3LMZA 3VO0A 3LTYA 3MUY1 4DPQA 3AZTA 4ZODA 5BXRA 1L6YA 3FLUA 5I00A 1VGAA 2Z2UA 3IRDA 4NVTA 4ZSUA 3MUCA 3GDRA 1RD5A 4W7UA 3S1UA 1UC5A 2X40A 1Q6QA 3LPGA 4PBFA 2PB1A 2PS2A 3WLRA 3VX0A 3W01A 1LOLA 2ZDRA 3IJIA 1UMYA 2CLLA 3ZQ9A 3HO8A 3PJXA 1WZAA 2YCKX 3W75A 2UY3A 1B3WA 5FF4A 5EFFA 3UJFA 5AVNA 3OLEA 3R6IA 4P7LA 4ZTYA 4AW7A 4FSAA 3VUSA 4B2DA 4O54A 4P8XA 4KCWA 1EA0A 2ABBA 3UG4A 1XUZA 2CZ5A 3TJLA 5REQA 1AJ2A 3LHVA 1QO2A 2V9DA 4JTAA 3P67A 3SR7A 1S5WA 3M07A 2Y7GA 1NVMA 3H7UA 3M5YA 3CPGA 3RYSA 4LB4A 1IEQA 3DFHA 3C2OA 2UBPC 1TV7A 4A3HA 5DXXA 4WY0B 1MFUA 8RUCA 3APTA 1V0LA 1W5MA 2VI0A 2QVNA 1N8IA 4YJ5A 5C8BB 2ZZ3A 2YDQA 1CDGA 4KFNA 1F61A 1I1WA 4FOJA 3KXQA 4JN7A 1TPWA 1EJVC 3W1UA 1F07A 2VVSA 1TV2A 5I77A 1EX5A 2XHYA 1FFQA 4LJ3A 1E0TA 1QWKA 3I6TA 5TAOA 2WZIA 1Q63A 3RJXA 4AMAA 1EWEA 1K9DA 4DZ5A 1XC6A 3WEOA 1JAKA 4D2JA 2OZTA 3WJXA 4EX4A 3W6MA 4XV0A 4ZR8A 3DFPA 2FPYA 1WP6A 2YX0A 4Q8QA 3N4EA 1W8GA 1F3TA 4I9JA 2EQDA 4QQ3A 1XCFA 4GY1A 1DJNA 1UH3A 4GUGA 3QHMA 1R7AA 2E9BA 4JTLA 1OD0A 1BLIA 2XGBA 3PTKA 4NQ1A 5D2VA 1XD1A 3WQ6A 3NQAA 4NXSA 2OGYA 1Y7VA 2R9RA 3S47A 2IQ0A 2CIPA 2FMNA 4PEKA 4HOWA 1EDQA 4AZGA 2YA0A 1NQ6A 3WH9A 3BW3A 2VFDA 4B5WA 3OBEA 1PV8A 3H7RA 4O53A 2Z6JA 4Z1DA 2ZRXA 1H51A 3B8WA 4LVFA 3FKRA 3W37A 3E2RA 3F7JA 1US0A 3VXGA 1OGGA 3KVJA 2C1GA 2DVUA 3NO1A 3HGRA 4F0MA 3VKBA 1LLZA 2V5JA 2VD9A 1JF5A 1TJ0A 1NWTA 1S1PA 4KBXA 1H7NA 4UTLA 5I07A 2QCDB 4YTQA 3Q94A 1G69A 1TPEA 5EMMA 3EGJA 3FDKA 2WYSA 3IJDA 4Y96A 5A6JA 3JR2A 4EPDC 1RBAA 4QQUA 2PP0A 3ERPA 3B9NA 5HMEA 3VCNA 2IKJA 2XGIA 5BW6A 1D3HA 4GFSA 3PZQA 2OSYA 4CNTA 1C3FA 1XKJA 1CXFA 1IR1A 3MY9A 1M01A 2QDEA 3L0NA 5HANA 1A0DA 2E77A 3WELA 3HV8A 2EPOA 2DZXA 3G0UA 3AFBA 4FA3A 1YMYA 2YA2A 3L4UA 3LXAA 4FXFA 3BWWA 4JN6A 3BGJA 2VNCA 5DFAA 3INPA 2RHGA 1KFJA 1G01A 4H6RA 4MWAA 2PD9A 3LOTA 3DESA 3UG3A 5CC3A 3W85A 3DFYA 1QNPA 2H9AA 4JQ2A 2VDHA 3MP3A 2J78A 1PZ3A 4WSHA 3OVQA 4IICA 3RITA 1NOFA 3IEBA 1UR2A 1XRFA 1FKWA 4L1GA 3HG3A 1RJQA 2IQDA 1GTHA 5I3IA 3IUHA 4J35A 4IPNB 4IPPA 5CGMA 4PUDA 4LXFA 4Z17A 1JRCA 4BF9A 2PDUA 3WQWA 1QI0A 3H12A 1UZDA 1MQPA 4EXAA 2FVKA 2YB1A 3TWBA 1C90A 4YTRA 5FKYA 3M46A 3N04A 3E49A 1I45A 3I4EA 1KQYA 1XICA 4J4KA 4C6BA 3WQFA 4YYFA 1CX9A 3BLKA 3UFYA 1SR0A 3TXZA 3O63A 1Q6LA 4PN2A 4C6FA 2XN2A 4DBDA 3FEQA 3VINA 3OOQA 3LD5A 3W7OA 2NV1A 1UOKA 3LTSA 2INFA 1HJVA 3NUKA 2GDVA 3TYZA 1KKRA 4L1XA 1XF0A 1S2AA 1CI1A 3UGRA 4H7ZA 4DN1A 3F2CA 2HBVA 2WZHA 1DE5A 3WH8A 2CLPA 5D9MA 4F0KA 4JX4A 4XAGA 3URNA 3VDBA 3UZJA 3MQTA 3URQA 5EMJA 3G8RA 1ADSA 3N11A 5G2HA 2AGKA 3CS2A 3HG4A 4HNLA 7TIMA 2GSEA 3DFNA 1HJUA 4LTSA 2BOFX 5TIMA 1WQ5A 4HNTA 3VZZA 1H62A 3K8KA 4O0ZA 1LZOA 2GGIA 2HVNA 3NQ7A 3QJAA 4Q4RA 2WPGA 5CCZA 5FOOA 3CUFA 2EEXA 3NZRA 3GKFA 1A4MA 4DI8A 1PTAA 4B9ZA 5AZ0A 2TSYA 1C8XA 2PF0A 3RXZA 3L4XA 2BG5A 3E5PA 2PU1A 3LI1A 4Y90A 3R8RA 4PRWA 1BGAA 4RCXA 1K9FA 3GFZA 4POCA 3GYEA 4GABA 5MKGB 3N2CA 4I9AA 1RV8A 2YL6A 3NQFA 4ZE4A 4CQDA 3AHVA 3HPFA 2YYUA 5FSDC 3GIPA 1OYAA 4GPNA 2IXVA 4ACZB 2DJLA 3ID7A 4XSMA 5BMXA 1RP8A 3R7MA 3BW4A 5AC4A 3SIMA 3W84A 4DRSA 2ZX8A 4H8HA 1KM4A 4XVDA 4CNSA 2WM1A 4DAIA 1NOUA 3FJ6A 3GDKA 4D6FA 4F2TA 1Z7AA 2VC9A 3N29A 2XIJA 3DFSA 1FDYA 2ZE0A 4JTGA 2VCBA 1ZTVA 4PTDA 3FYPA 3W71A 4GLEA 2PRHA 2WNWA 3P5ZA 3TJXA 5C9UA 2D2GA 2G3IA 1LROA 5K3VA 1CNVA 1S3HA 1F73A 3KS5A 3NSMA 4Z0JA 3R0DA 1OC5A 3F4VA 2JALA 4GFIA 4JIEA 3UR2A 1E6NA 1Z48A 4DY1A 1PDZA 2FZ9A 4A8LA 4WD0A 2HK0A 3RM9A 1EH9A 2IW0A 3U57A 1GW9A 1ZSXA 3DBNA 4O13A 4W85A 3AIUA 4QJ3B 1NP0A 3WNMA 5H8MA 1PVNA 3BURA 4LEQA 5AB3A 1H41A 3AWOA 3UXDA 3UR7A 3KBWA 1EWDA 3OHMB 1TTQA 2KAUC 2VP8A 3BO9A 1Q7ZA 2QAFA 2F7FA 4NNCA 3SJ3A 5EMYA 2BV9A 2F38A 1CLXA 4G8TA 3OPSA 2REQA 3EOLA 4JAWA 4E3VA 3WEZA 5BU6A 4JDYA 1XYZA 4ZFMA 1XFBA 3OGSA 4ERGA 1KLZA 2H3BA 1AW2A 4PUUA 2QKFA 1H1NA 1TVLA 5EB8A 5IHSA 5JIPA 4QS5A 3CLWA 5CPQA 4AVFA 3QOKA 4ADUA 3T8QA 1BSIA 1P0KA 3NZPA 4NZ5A 4AF0B 3SUSA 2GGHA 1RD6A 3KBNA 4GNVA 3BG5A 7A3HA 1IWAA 4GX9A 2DSKA 1OIMA 3F4WA 4OWGA 4BK9A 3PWAA 1JZ4A 5J04A 3WDHA 1AW1A 1E71M 4I8YA 2O9TA 4CCEA 2OZ3A 1WDDA 2J75A 2VXNA 4Q4OA 1HKJA 3G1SA 3QKEA 3NSXA 2ZX9A 5E09A 3CL6A 1XLDA 2GUBA 1W3LA 1KFBA 3MO7A 3VNYA 1KBBA 4A3QA 1RR2A 1JCTA 2WSRA 1U5HA 4O8AA 1LJYA 4DWSA 3W02A 3M9YA 1H1ZA 4AU0A 5H8UA 3SI9A 4AD4A 2CW6A 2F6XA 3W25A 2O7QA 1G4SA 2Z1VA 3TCEA 1FCUA 2C18A 1OX4B 4Q8UA 3U4AA 4D1JA 1YDYA 2DH3A 3PB2A 2Y85A 2O0TA 3EMQA 1XIHA 1F6PA 2J66A 2PU0A 1DKWA 4ZOEA 2VOMA 1QW8A 3WBEA 2YZ5A 1GQLA 3BAYA 4OKDA 3G22A 2PBGA 3UJSA 1S1RA 1XLLA 1I0BA 5CH9A 1KA9F 4LVDA 5AHNA 2JQXA 8TIMA 4INFA 3UXIA 2GDQA 3DG6A 2XVPA 4Q7NA 4JBRA 4FIQA 1A5BA 3NDYA 3RM4A 3W7IA 3AYVA 4L65A 4GIYA 2ZXQA 4U5IA 1SFJA 4MPKA 3JS3A 2BZNA 2CKSA 3GXNA 1TV3A 3JZEA 4AD1A 4R3UA 5M3WA 4KWVA 5FL1A 1XGDA 2FTYA 2BVDA 3D6NA 2PDYA 2OO6A 2WLYA 1Z69A 5BOOA 2IMRA 3K8MA 2G3FA 1E1EA 2XZ7A 3WUFA 2E40A 2G3NA 2VVNA 3R0KA 5K2ZA 1TUFA 3QEZA 1GONA 1OGBA 3IVTA 2A3LA 1QI4A 3BOFA 3UXLA 3SCUA 5AFDA 4MY8A 4M1RA 4CN1A 1XINA 3QHNA 4HTBA 3B8VA 5I3KA 1R2SA 4UFLA 4QLLA 2W62A 3WLHA 5HNUA 4XD5A 4F3HA 4JTIA 2G0WA 5CZ0A 1DIDA 3PTQA 3N4FA 1EJSC 1YBQB 4GMEA 4RNHA 4H9ZA 1E40A 4Q6XA 1Q2SA 4HJFA 4UTHA 3W1PA 5CBIA 3CUHA 3IGHX 4WHBA 5D9PA 3KBMA 3E0VA 1HGWA 3TSDA 4ICMA 2YPIA 3OBAA 3B03A 1RALA 2PDLA 2ZUSA 5HWJA 3W6LA 2NQZA 4UTTA 2OFJA 1NAL1 1PTDA 3WO8A 4GH3A 3QOMA 4FALA 2YB4A 1VIZA 3HGSA 3ATYA 4KEVA 1W1PA 3R8GA 1ISZA 1XBZA 1HO1A 5IM51 2Y61A 2ZA3A 1WAUA 3E2QA 1Y0EA 2ASHA 1ZJHA 1VEOA 1CXEA 1Q5MA 4GI8A 1Z8AA 4R5EA 4Z1CA 3A4XA 1K9EA 5L6UA 1VCVA 3AIQA 3WLKX 2G97A 3MS8A 1OB0A 1ZUAX 2YFOA 4C6JA 4HSOA 2X2YA 2YR1A 5D2TA 2V5LA 3DXIA 3CH9A 4YCOA 3VNJA 2C1HA 3DYMA 2NV9A 1TRIA 3SEPA 1OFPA 4M8UA 3HG2A 1I2NA 1JZ5A 1E9ZB 1TFVA 3HB9A 1BVNP 1K4HA 3REQB 1LQ2A 2QUTA 4QEEA 2V2CA 1XV8A 1HW6A 1QNQA 3BTNA 1QNRA 1SFTA 3AUJA 2YCLB 4JKMA 1GUVA 1GZJA 6TIMA 1TUXA 2X16A 3TN5A 3CLMA 3DFOA 2ZXAA 3OHIA 5F1UA 2W3ZA 4LYKA 1ZB5A 2HWGA 4P7OA 4YN5A 5K9CA 4G1NA 3NEHA 4XO7A 1PHQA 1W54A 3UESA 2EBNA 3C3UA 3N19B 2O9PA 1VCFA 1JJKA 4JKKA 3EKLA 1VH7A 1EQPA 1W5PA 1XD0A 4M1BA 3WQVA 1KTCA 4X2PA 4H8UA 3M0KA 1AH3A 1NH6A 4X0VA 5ECUA 4E38A 2NQ5A 3CAWA 5IHRA 3Q45A 1OYCA 1QCWA 4QRNA 3IIZA 1KGUA 1TTPA 1V02A 1D9EA 2QUVA 3I7RA 4I6VA 1PS9A 3A3XA 1GKQA 5LXEA 4LNYA 3W7RA 3OG2A 3WN6A 3WQ8A 2VEGA 3BOLA 3UZ5A 4KFPA 1W5QA 5C7VA 2CITA 3FNDA 3F5JA 1LWIA 4JYFA 1SGJA 3G1XA 1TIMA 3FGCA 4P8WA 4D6HA 3L4ZA 3E0LA 4Y8FA 3QFEA 5D33A 3NO3A 4B5XA 1GYMA 1PB0A 4QIUA 4Z1AA 4JX6A 2VGBA 3VGHA 4BI5A 2HS8A 3A3HA 4ZSTA 5F2GA 1W32A 1PUDA 5FF2A 1B30A 1A5OC 3M1ZA 2XFRA 4IXHA 3CEPA 3T78A 3V35A 1JL8A 4IIGA 3I7SA 5FF0A 3O06A 5CPOA 4CNNA 2BGNE 1JDCA 3E0IA 5C9WA 4RE4A 4GBDA 3VIGA 3TA6A 3LLXA 4XBKA 5GJMA 1Q4NX 3B0PA 2DZUA 1BVWA 3MMWA 3BLLA 1DVJA 3QPYA 1QPRA 1QOXA 2ZBTA 3DX5A 3VD3A 3MZ2A 4AB4A 2GZXA 2VFFA 4GE8A 2YLAA 1KLYA 3H70A 1A5UA 3CTTA 3CAQA 4JTFA 1BPLB 3F4NA 2J13A 3CQIA 3OQEA 4IT1A 1UWSA 4HPHA 3BH4A 2ON3A 4A22A 1B57A 1SMAA 4O18A 5A6BD 7ODCA 4AYGA 4ZL1A 4LUTA 3V5CA 1GG0A 1QI2A 1KM2A 3E9AA 3HN3A 1F6YA 1PX8A 1EPXA 3KVLA 1W1B1 2J8GA 3DECA 3IAPA 1W3TA 4BEUA 3FKKA 5AECA 3IUIA 4W87A 2QDGA 3L12A 4FX7A 2FGLA 1XJBA 2FZ8A 4UR9A 3NPWA 5M1TA 4JFUA 1W0MA 3WEMA 1XLIA 2GFTA 2DU2A 4KEUA 3VIMA 3KFTA 2W66A 3H4GA 3CPUA 4H2CA 4QAIA 3HF3A 5A8MA 2WHLA 4E4UA 3ITGA 4NG3A 3PJWA 4FK9A 4OZOA 1IEXA 3FFSA 4OQVA 2DFAA 3LQGA 1ZBKA 3S1GA 1IWPA 1Q45A 1WDQA 1R38A 1K3UA 4AEFA 1EA9C 2BY0A 5LXXA 4QCEA 2OGJA 1K02A 1NQKA 2R14A 1V6TA 3QZ6A 3PG8A 3WF3A 3W70A 1R2RA 1XIMA 1XH1A 4GUFA 1UR9A 2GJXB 3ZVIA 4FR6A 3MB9A 1RY0A 3LPOA 3RFAA 1CYGA 3BAWA 2GOKA 1NDVA 1UC4A 3PK7A 1XIGA 4N9CA 3LHTA 1BTCA 1U5JA 4JFWA 2NX9A 3RPMA 1T6MA 3FA5A 2PDPA 1FWHC 3C0QA 3IIPA 4LAKA 3MV11 1TPUA 4KIEA 4N42A 4BQ4A 5T91A 4MDOA 4OU1A 1UD6A 2EJAA 3TU9A 5DANA 2CBUA 3LI0A 4DO7A 1VJZA 2W0UA 4LY8A 4AXNA 1FCQA 1V7AA 1S2CA 4XAFA 3CU2A 4IMFA 3WF0A 1XISA 2ZUNA 1LRNA 4LSBA 1TZ7A 2NVCA 4PMVA 2G95A 3NO5A 4GVFA 4Y9AA 3VGBA 2E28A 4FNUA 5G4EA 1R47A 2O9RA 3OJGA 3CUZA 5IXEA 1AL8A 1TVNA 3TLQA 1XR2A 2F2HA 4LV4A 4PBGA 4ZOAA 1WO2A 4U2ZA 1JCLA 4HMEA 2AL2B 3NL2A 3TN3A 5CAKA 4XKYB 1L2QA 5B80A 3MSRA 1GQIA 2QMKA 2E1DA 3CWNA 1CGTA 2V38A 2W91A 2B81A 2Z28A 2NQJA 1JUKA 2RDWA 3W4RA 3PHAA 4C6KA 1THFD 1ITUA 4AZ6A 4Z2IA 3VVGA 4EPBC 1RXOB 1IHIA 4PCNA 5BRQA 7CGTA 1UPMB 3UU0A 2TPSA 3A5VA 1IIHA 5CXPA 1UA3A 3TW7A 2XWDA 1V4YA 3W7NA 2NLYA 1V6WA 3UWZA 3A3WA 5A8GA 3TYBA 4F79A 4KCVA 3UJRA 3BL3A 1S46A 4AC1X 4IWWA 3GD6A 3PY2A 3DHPA 1EGMA 4Z2KA 1DWJM 1R3RA 1KFCA 1SMDA 3UZXA 2FTWA 4A8NA 3H2OA 1CGWA 1A53A 3P93A 1NM9A 1K7XA 3AS2A 2ZQ0A 2VEIA 1WDWA 1EDGA 2DZVA 6ALDA 3WBWA 2XZ9A 4GH1A 4UTWC 2YW3A 1FX6A 1OBAA 1R8LA 4ZGYA 1YPXA 1LDCA 1XLBA 1UZ4A 3D3AA 1GOMA 3LXCA 2VX5A 3UP8A 3W3OA 2VUNA 4QR6A 5M03A 1GVIA 2WWDA 4B4HA 2EPNA 1AUSL 4CLMA 3IARA 2CZFA 1DXEA 4EXQA 4HB7A 5PTDA 4MY9A 3M44A 2BNJA 3OB8A 3GC4A 1FWJC 2PA6A 3BCFA 4BI7A 4LRSA 1QJWA 4MAZA 1REQA 2F9RA 1S3TC 4IP7A 4ZQCA 2OR2A 4HMDA 3TR2A 2YBTA 2VMFA 4O14A 4XZHA 4RZ5A 3MHGA 5G1YA 3HM7A 4AYSA 1W9XA 4G7EA 1HL8A 3THDA 2PRMA 3GHRA 2A79A 5HMSA 1US2A 3W7HA 4HQVA 3WLQA 1DJXA 1ZBVA 5LIUX 3OYZA 2WSQA 2WQPA 1SSDA 2Y1HA 1UUOA 2E09A 3BC9A 4I8DA 1GOKA 2EGZA 1H4PA 3GO2A 3UD6A 3TN4A 4JY8A 1EP1A 1LL6A 4MUZA 3TZNA 5M5DA 5E93A 5E6ZA 2DIJA 1VENA 2PGWA 3OA3A 1O66A 3BDKA 3ME3A 3ITYA 1FWDC 2OT0A 4RNFA 3OP2A 4WXZA 2DVXA 4D6EA 3TA9A 1UOZA 2VC7A 1IT8A 3NYDA 3SM0A 2NQ9A 1EIBA 4R33A 4JN8A 3ZT7A 1XYLA 3EDFA 2J6VA 2BGSA 3USZA 2NVAA 2W92A 3ZZ1A 3AIWA 4M80A 4XSLA 4B90A 3VE7A 4LC8A 4S1FA 1W9UA 3TQKA 3S83A 5H8PA 1HF6A 3GYCA 3M47A 4TQTA 4FLQA 4CU6A 1X6LA 3WK2A 3T2PA 4HCHA 3OVPA 3LGEA 3VA8A 3WLIA 3N6QA 3VKJA 2VRJA 2WWCA 1AA1B 4AZCA 5EKYA 4ADTA 4NU7A 4PL2A 1IZCA 2CBIA 5JUVA 4REQB 4PMYA 4YWSA 3HG5A 4H7VA 1E51A 2DVTA 2J8TA 1ICSA 1I2RA 4DBEA 2HVMA 5BU9A 3GX9A 3KOXA 2XJ7A 4MJ4A 3VNIA 2PWUA 4L9ZA 1UQYA 3CO4A 4N4PA 5A8OA 3R0UA 1JDAA 4NKCA 2QJHA 5LIKX 1FBAA 2XH0A 7XIMA 4AZ5A 2PTXA 5IOBA 3GH5A 3S0CA 1P7TA 3EB2A 2WM0A 2ZZ4A 5AY7A 3BSGA 4YS1A 4CD8A 2QJMA 1V7YA 4JIRA 2WNZA 2HRWA 2GJRA 2WVVB 3G1RA 1K6AA 3BMXA 1BWLA 1KXQA 2X1IA 3IACA 3S2LA 1OFBA 3R58A 3U2ZA 3M0IA 4XD6A 5LIWX 4IGMA 3P6LA 3LUTA 3NEVA 3Q37A 3EWDA 2ZX5A 1HJQA 3W0KA 2HISA 5HQEA 4AHQA 4MZYA 1Y65A 1UD5A 4GJIA 2CLHA 1KBJA 2I5GA 4C6CA 4K38A 4CQ8A 4MB5A 4TX8A 3ZR6A 2Q01A 3NQ8A 4A2SA 5A6MA 4NL1A 2HXUA 3S6TA 3D0CA 3TFXA 3MZNA 3UCDA 3CQHA 4NJHA 5A8NA 4ATLA 1BF6A 4TX6A 1E6XM 3LMYA 1D3GA 3LEPA 1WOAA 4QG6A 1OVDA 1T99A 4MHBA 1KNWA 4Z0SA 2FPTA 1BRLA 2JF7A 4CKQA 2CLEA 4GXWA 1DJYA 3IJQA 3QV6A 1CXKA 2CCRA 3MPGA 2YJQA 3HMCA 4P7QA 4JYEA 4IOTA 1JF6A 3SY5A 2R94A 3VNMA 1EL3A 3NCOA 1YTDA 3MVIA 1A5CA 4B4FA 2HNEA 5FSEC 1J96A 4NZ1A 2OG9A 1UD4A 1OSEA 2XWEA 1UP0A 2YL8A 3H4WA 3GNOA 1LRTA 1F2JA 3QR1A 2EHHA 5H91A 1G94A 4KIRA 4KWSA 1NU5A 3GU1A 3KTCA 3B8TA 2ZRWA 4A35A 1ZL1A 1TWWA 1Z89A 4XIAA 3W7MA 1M41A 4TV5A 1C9DA 1POKA 4CQAA 3M5VA 4PA8A 4KERA 2QGHA 4JCMA 1GEHA 4LPCA 4AD3A 3PWIA 2VR4A 1IE7C 1ONWA 3P82A 1SFLA 3U4FA 5F2MA 3PZTA 1QUMA 5AYZA 4ZB5A 3WMSA 2I56A 4QP0A 1VYPX 2PRLA 1FH7A 3P5YA 4CGTA 3AXHA 4F4RA 5A94A 3B40A 3ZR5A 4BHYA 1VFTA 3EPOA 3L7RA 3BW2A 2EJ1A 1L9WA 2AKMA 3QSTA 4XVEA 2QUUA 3LSCA 3NYZA 3CHVA 3VD7A 1T8XA 3NZGA 2B4GA 2P3EA 2ISFA 3HMJG 2WJZA 1QATA 1WAWA 2QCHA 5XIAA 4NJGA 3ZLHA 3UWEA 2YZRA 4MJMA 1RA5A 3BGGA 4XX6A 4KRZA 3NZ1A 7REQA 1BAGA 3PS7A 4PFHA 2Q3RA 4ZOCA 3P8JA 4O1FA 1KFEA 3ARRA 1A5MC 1D3CA 2G4FA 1R5YA 4NZ4A 3U5YA 2WMFA 2WKGA 1DEDA 1W2VA 1UW9A 3QMRA 3VIHA 3AMDA 1HN1A 4AD5A 1UWRA 6TAAA 2P10A 5BNKA 2J88A 5G2WA 4PULA 3G1HA 5AZ1A 1XP3A 3WUGA 1XGZA 3VDGA 1H50A 4ZVJA 1AFSA 4MADA 3NM3A 4MNMA 1Q6EA 1N55A 2AGTA 3P60A 1VCGA 1TB3A 2D22A 2JE8A 2DT2A 1X8CA 2R91A 2DH2A 3T1GA 4G7FA 1E4LA 3FEMA 3MO4A 3B4UA 3FCPA 5C9RA 3SN0A 3N9KA 1V3IA 3FS2A 4C6EA 4JNMA 5CC7A 2I1OA 3ES7A 4UTWA 4LBSA 4TV6A 1FWEC 3MUZ1 1TREA 4E2BA 4C7FA 2VM8A 3NFUA 5H1WA 4AZBA 4N7QA 3P8IA 3MA8A 3UCQA 4GIRA 2PDNA 1FCBA 4MSSA 1W9VA 3LTPA 4H04A 2AKZA 3UXAA 1XYAA 1XPGA 3PNUA 1IZJA 2WZMA 2BHUA 2J9YA 4X22A 4US5A 3H22A 4FIRA 4B5TA 4RDZA 2P53A 3OBKA 4NF7A 4BWLC 4C1NB 4L6OA 2VRKA 3DGBA 4XTIA 3WH6A 4FHAA 1FKXA 3LA4A 1JNDA 1UR4A 4D6JA 3ZS4A 3GBEA 2VFHA 2PDGA 3GQYA 1VYRA 2PURA 2I16A 4AMCA 1XSKA 3N18A 1ISVA 3EA1A 2BBFA 4IMCA 3U48A 1XCWA 2ZVRA 3JU2A 8XIMA 1HVXA 4RE3A 2IQTA 5LSMA 1YXYA 4GHRA 1I75A 1GQJA 2WLZA 2J27A 4FOUA 4LS2A 1TG7A 3T0BA 4JIQA 3WENA 1XBYA 1NFPA 1LM1A 5AHIA 3B8DA 1V3JA 3QYQA 4JQ4A 4M81A 1GG1A 3NGJA 4ILSA 3WDIA 1I9CB 4CCCA 4JTEA 2UZ9A 5HQLA 1LTDA 4UQCA 3W1AA 1O60A 4J40A 1F4AA 2KZHA 1C7TA 3K4AA 3NTYA 1E1CA 2G4JA 5ENLA 2J47A 1P4CA 3GG0A 3IJ6A 3U5UA 1AK5A 1TV4A 1UUMA 2WVUA 1GKRA 4UTFA 1BSLA 4KQNA 4TOQA 2HROA 1BD0A 6REQA 4UZSA 1I4NA 4FLSA 4ML9A 2BVWA 5CZTA 4QSHA 4M6UA 1XFCA 1OFRA 4MWAD 4YYCA 2GQ8A 1MZRA 4GRSA 3WDRA 1PE1A 1R3WA 3ANYA 3GFXA 1DHKA 4HPNA 2BHZA 3B97A 4UTIA 1SJDA 2OODA 4NILA 4ZMGA 6XIMA 3FIGA 4IP5A 1EB3A 1KKOA 3P61A 3WBAA 3FA4A 1YX1A 1BXCA 3PJUA 3GHUA 3HPAA 3BLPX 2I7GA 2J9XA 4IL2A 4HCLA 1MUMA 4RPQA 1HFBA 1B3OA 2G37A 1TWSA 4IX2A 1SO3A 3FAWA 2AQVA 1UKPA 4MNKA 3HV9A 1ZQ5A 4O1CA 2YLLA 1NDWA 3GXIA 3UJ2A 4GI9A 1SPQA 1J93A 4GQ0A 2UV8G 2VX6A 4RZBA 1DWIM 1QNOA 3MSYA 1TA3A 1VIWA 4QEHA 1EHAA 5CEWA 1UJQA 2GQ9A 4DXKA 3ZOAA 2CLOA 3MWCA 1CGYA 8XIAA 3VD4A 3CV7A 3WJZA 3GR8A 2YA1A 4EP8C 4DUOA 5AHMA 4AUBA 1R85A 3SRDA 1MW0A 3GU9A 4AX6A 2HNHA 4GJ1A 1TJ1A 4GQBA 2XFFA 3LCGA 1E72M 4EWND 4NZ3A 3POHA 3NPVA 4QNWA 1ZJIA 4GUIA 2GVLA 4JZ5A 1MEIA 2PD5A 4Q8TA 1UHVA 4NIRA 2QJJA 1OFAA 1XDJA 2BOGX 4FOKA 3S42A 4V33A 3TK7A 4A3YA 4E2VA 4AC7C 4QITA 4M56A 4J3ZA 5CBBA 3R10A 4JNYA 4R85A 3GNNA 4PMNA 5HWMA 1YHTA 2CXGA 2PDQA 1FWIC 1NEYA 4WY0A 2VENA 1E43A 3MV01 3T9PA 2XSXA 1K03A 5EU9A 2Y8UA 2BS9A 3SCVA 4G56A 2ZVIA 4ATWA 2CXEA 2A5HA 3WD3A 1JXJA 4QJ4B 3UW6A 3S6OA 2NW0A 4R88A 3B0VC 5E5CA 2Z25A 4EXBA 4CN4A 3QW4B 5H2ZA 1Q65A 2PE4A 1JDEA 3O6AA 4HZMA 5AYXA 3LHZA 2Y70A 2WHMA 2PI6A 3W1XA 1ZCOA 1H49A 1LWHA 2NWSA 3BLOA 1YXCA 3PP7A 2VGIA 3T8LA 1O5KA 3CQJA 2V68A 1OFDA 3W23A 3NG3A 4UQAA 2GDUA 2X09A 3GXMA 1FWCC 4FNRA 1N2VA 2VCAA 4IG2A 3SJNA 1XM3A 3KE0A 8CGTA 3W38A 3KOFA 3W2MA 3WK1A 2QEZA 2YXGA 3AYTA 3EMZA 3LX9A 5ABFB 3R4IA 3KBJA 3QFWA 3W53A 4GG9A 2NQHA 1O5RA 1VAHA 3K5XA 1BHGA 1UKTA 5DCDA 1Q6FA 5TQLA 3I3DA 4H6QA 2A6NA 4LC6A 2WJDA 2OU4A 2XINA 2YBVA 4UTJA 1XUUA 2PDFA 4UB9A 2QJNA 3IUDA 1KGWA 4QX4A 4YHGA 3CAKA 3FOKA 2BP1A 2XFYA 2ACQA 1KQZA 1H63A 3VOHA 1VBHA 3OIHA 2CZDA 3QRHA 1SW7A 1ZAIA 2GJPA 2A7PA 3RMEA 3TVAA 3EDJA 1BF2A 2RDUA 3ARSA 4UR8A 1NFGA 4GQQA 3TQPA 3BLIA 3AMCA 5FCZA 4QG9A 2YSWA 3B9DA 3VDHA 2VGFA 4O11A 2QCDA 1ESWA 1XI3A 3AHTA 5K9DA 3VIFA 4L4OA 2QUNA 1R30A 2Y5EA 4UC5A 2WMGA 5CLTA 3SAZA 3W1NA 5I5RA 2WCGA 1JQXA 4DVOA 2QF8A 1EUAA 4LWWA 2EAWA 4HSHA 4AD0A 3MSGA 1ONXA 3GDTA 2Z1BA 4Q8VA 2RAGA 3DG7A 3MCMA 3LGDA 3KL5A 4ZQMA 3P0XA 3PG9A 3HQ1A 2J7GA 1V51A 3ITTA 3SRFA 4DF2A 3QZEA 2Q6ZA 1X7FA 4NNAA 3PPGA 4D9PA 2W67A 3KWXA 3A5FA 3HQOA 1NFBA 3R5EA 1R86A 5BRPA 3MYPA 4PGLA 4K2SA 3CZ8A 5KETA 4XZMX 1A3WA 5GNYA 1RQHA 2DSUA 2I9EA 3NA8A 3E3HA 2J7DA 2I17A 3PZIA 3W88A 5TBOA 4AZ7A 5DELA 3SRKA 2VFGA 2F8QA 2ZXDA 5K4XA 5DX7A 5RUBA 2BOEX 1A50A 5DN1A 3DCPA 5DEZA 1UYQA 2PC8A 2Y0FA 1B54A 3CC1A 1TWZA 3EX1A 4JD4A 5HNRA 3MMUA 3EPNA 4DWSD 4ASTA 5DQPA 3ZJ6A 4DI9A 3UNTA 1ZGDA 4GYPA 1CXIA 4MB4A 2ACUA 2A3CA 2WV8A 3KOZA 3PAOA 1MQRA 2F6KA 5LZLA 3RLGA 2C0AA 4A3RA 3A21A 2WSKA 1VLIA 1IF2A 1H7PA 3WQDA 4AZHA 4G5DA 1J5SA 1UKSA 2AAAA 4PUWA 6PTDA 2XU2A 5B7ZA 2G50A 4PCFA 1TV5A 3M0LA 1MW1A 3OW1A 1VRDA 2VGGA 1YRRA 2CEQA 2V3GA 2E1WA 1J6PA 4DJDA 2R24A 4H8NA 4HZ6A 2QW5A 1UQZA 4WRHA 4ORIA 3CGTA 4KW2A 2DUXA 3CBWA 1HO4A 3AU6A 1UBPC 3APYA 4GCAA 1OG0A 1W91A 1V6XA 3L67A 3MI2A 1P0DA 1LYXA 4HT3A 3ZT6A 2WCSA 1Z3NA 5HATA 2XVKA 3QMTA 1BXNA 4LYQA 3RHGA 3EWXA 2A3AA 5DBTA 4RDYA 1XHGA 1EZWA 3PZMA 3CL7A 5EGRA 5I7GA 4CU8A 3NURA 1IXOA 4XZNX 1B4EA 2QDDA 4ZBCA 1P5BA 4LAMA 3IS4A 2ZFAA 4JTHA 3PZGA 5AYYA 5I6SA 1CBGA 1KM3A 3A9BA 1WZLA 2WNQA 4TXEA 3HFTA 2GQ3A 4QE4A 1DJZA 2JKAA 1OC6A 1ZS2A 5IDZA 1XYMA 1R3YA 5MKGA 3UA3A 3GVVA 5LA0A 1VFFA 1HL9A 3PPHA 4AWTA 1HKIA 4F40A 2XG9A 4W86A 1I60A 2FGZA 1Z42A 3CNYA 1A5LC 3WJYA 3VU2A 2FKPA 3SADA 1PIFA 1UWUA 1E3ZA 4TMBA 4JQ3A 4XBSA 1TJRA 4YLWA 3TWAA 3IRSA 4ACZA 4A8RA 4UOQA 3NAVA 1TIWA 3UZYA 2R1MA 2QJGA 3RF9A 2WSPA 1ZALA 4S3CA 4HNUA 1MDRA 2AMGA 4E5TA 2D24A 1GVEA 1WCGA 1SVDA 3SCTA 4NYYA 4G6CA 4RXGA 2WSYA 4HNCA 1NOWA 3KZPA 3G3DA 4HA4A 1M03A 5K7JA 4ROQA 1VFOA 4MYAA 2ABAA 2HQAA 1RY8A 3CQKA 3T7VA 5L9FA 1KRAC 2FLIA 4O52A 4H4IA 3U0HA 2ANUA 2SFPA 2PC4A 1DPMA 3VKAA 1NIUA 5BWAA 3XIMA 2R1PA 5MHBA 1ME7A 2NSXA 1JCMP 4NUWA 2HS6A 4OOUA 3TUUA 1OGSA 1G1YA 3NQGA 1ISWA 2DW6A 3N9RA 3PBMA 2VKZG 1XYBA 1G4PA 1FWBC 1V3MA 1M7JA 1MUWA 1H11A 4R53A 1F8IA 4DO4A 4HNNA 4OUEA 4DBWA 3IJ7A 3RDKA 4AVOA 5CGQA 3N3MA 3BZJA 1VFUA 3W1RA 3M41A 2ZA2A 4ZTXA 2YYTA 2WBKA 1JD9A 1MMFA 4P7NA 3LHYA 1FWWA 3VABA 3F1QA 3HOJA 4HOXA 2FH8A 2JK2A 4PC8A 3VGFA 3M0HA 4ML4A 2Y6ZA 2J7FA 1ALDA 5T9BG 2G41A 3GZAA 1XC4A 2ZADA 1VFHA 4C6IA 4UTKA 3ABSA 3L4TA 4FO4A 2DIEA 1EHNA 4OUIA 3LYEA 3WLJA 3T2OA 4AF0A 1W3KA 1V08A 3E2VA 1M7XA 3QGAC 4FXSA 4MWAC 1A47A 1J0IA 4RR4A 4HU8A 3JVAA 4K8EA 3LCXA 2E4TA 4M51A 2WQDA 3R11A 4X2RA 1UR0A 2QQ6A 1DV7A 3W7DA 2ADAA 1WZMA 5EPDA 3MUAA 3A4AA 2PDXA 4KKXA 4GX8A 4WIWA 4WY0F 3NQDA 4US6A 2YW4A 4BY3A 3OLIA 1UKQA 3EBVA 3ECQA 2FJKA 1T96A 4BF7A 5ABTA 2GWGA 4PYSA 1H7WA 2DIKA 4Q32A 1C9WA 5JVLA 1BKHA 1W1A1 3AIBA 5HOSA 1SO5A 1M1BA 3EWZA 3TYUA 2P0IA 2QHAA 3CZKA 1EXBA 1W1ZA 1OX4A 2IKIA 4OV4A 3A22A 3AI0A 1OX6A 3T08A 3O6YX 1TQXA 2JIWA 4JFVA 3O3RA 3H2CA 4JGDA 2R8WA 1V6YA 3KCJA 4ADSA 1LRQA 1CECA 1KW1A 1DWAM 1M3UA 5XINA 1VHNA 4XB3A 3VKCA 1SQ7A 3AWNA 4PEEA 3G0XA 4RDWA 4EF9A 3P3BA 3B8SA 1LORA 5E9AA 1V02E 5FF7A 4HK5A 4GQGA 3SDOA 1UWIA 4M29A 1D8CA 5FJRA 3L65A 5KZ6A 4K37A 1EOMA 3WBXA 3AXIA 3K4WA 1X98A 3ARQA 3BCJA 4PSPA 3EYPA 4IMAA 1Y8BA 1QNSA 4IUGA 4IISA 4UTMA 1OIFA 3AIRA 1VBUA 2Y7DA 4LW7A 4PTXA 4MDPA 3GNPA 4LU0A 4UFIA 4EAYA 5CAHA 2DZTA 3C86A 2P3ZA 4UQBA 5A6AA 4K68A 4C6MA 1JG9A 2XIOA 3VOJA 4OV9A 4HTYA 3B9EA 5G4HC 3SW6A 5CZJA 2C91A 3B8IA 1F76A 1ZJBA 4WEVX 4S3GA 3BQ6A 1ISXA 3KBSA 4XZBA 4MGGA 1VBJA 1JZ8A 4UQ9A 9RUBA 4AAJA 3B0UX 1LUCA 2ZCGA 2NXHA 5FEZA 3W1MA 1PWLA 1V5XA 3IIXA 3HGJA 2C16A 3NQBA 1GZGA 4LCSA 1GQNA 1BEUA 3VILA 3CMGA 2PBOA 4I7WA 1GOWA 2YCIX 2E68A 3BLFA 4HHPA 1GVFA 4ZOBA 1ZZMA 3TC7A 2RJGA 2F84A 3HPXA 1P1XA 3WD0A 3BLEA 4B5NA 1WX0A 3M0YA 1YBQA 1UB3A 3SCNA 3C2VA 3I68A 1PXGA 4FLRA 5FAGA 4TIMA 3W22A 3GUGA 5CG7A 1ISYA 4BR1A 5FAJA 3TQ0A 2QCCA 3UVAA 2JEQA 5HNNA 3CMFA 4LNCA 3GG7A 2JKEA 5DRCA 4AVNA 5KZMA 2VWSA 2ZOXA 4IX0A 3VOGA 1E6QM 4EOUA 1QW9A 1EEPA 1MDLA 3NDOA 4KT2A 2L5HA 3UQNA 5JBFA 3AISA 4C6DA 3HZ3A 1BYDA 3C61A 1Q8JA 1B31A 3M0JA 3EXTA 2XYLA 3VFCA 1WBHA 2ZXBA 4O1AA 3CHEA 1K1DA 1VJSA 1VR6A 5I03A 3A13A 2B7NA 4JTCA 2PDHA 4YTSA 3A47A 3KM8A 4F2UA 3QV7A 2EKCA 2ZX7A 4BA0A 1KBKA 3VDAA 3G2GA 1QT1A 1V6UA 1WB0A 3GE7A 1FXQA 3V1PA 4J2PA 3GXPA 3QKZA 3EMCA 4U2YA 1VPXA 4JPGA 4YIWA 5HPOA 1FY6A 4PFMA 3ITVA 3W72A 2VZUA 4LH8A 3REQA 1CIUA 1BXBA 2YCEA 3ABQA 1U83A 4O8RA 1CXLA 1CW2A 2ZC1A 2DP3A 2UY2A 2XH2A 4NJJA 2YCLA 3CASA 5G1TA 3GSMA 3KCLA 2RGLA 2Y7FA 5F2IA 3MCNA 3CYJA 7TAAA 2WC3A 1KM5A 4HIBA 3EEZA 2GJLA 2ZWYA 4MIMA 4YWIA 3VM7A 4UUIA 4RE2A 1W8SA 3V75A 4R34A 3PBVA 4BEQA 4H41A 1H2JA 1L6WA 4Q22A 5DT7A 1T41A 3R89A 3U8GA 2CWNA 4F0HA 6CGTA 2OYLA 4I9TA 2XM2A 4L6DA 2FH6A 1XLKA 5DRIA 2FZDA 2QNEA 4Z2LA 6ENLA 2WC4A 3CWHA 4KGJA 4NXKA 5FEXA 3LSBA 5LNVA 2PEVA 4PRTA 1GW1A 3W74A 3GDMA 4CU7A 4BQ5A 3S1WA 5JXQA 4OBSA 3A24A 4WDUA 1ENUA 4R7WA 4H9MA 2J9ZA 2OX4A 3EOEA 1VF8A 4NRSA 3DH7A 4DWSC 1D7FA 4MKSA 5A69A 3F5LA 3ALFA 3RM8A 1WKEA 4QBXA 4CVUA 2I14A 3OA5A 2V82A 1A0CA 3NOEA 1KBLA 4GZEA 4CCDA 1DXFA 4ZENA 1ADOA 4AY1A 2XVGA 1OT1A 3KVKA 1S2UA 2X2GA 1F7BA 1KXTA 3PUGA 2Z2BA 1ZENA 3VNKA 3Q67A 3MUXA 5I3FA 2JEPA 2XN0A 2GGJA 1XSJA 3QTGA 2Z1KA 2Q09A 1SZFA 5K9XA 4H9XA 3HQPA 5EMUA 1CLVA 1BG4A 2PAJA 1CXHA 3M5ZA 1FH8A 2FPVA 1KM0A 1LG1A 5E1QA 1GWJA 4M7SA 4E4PA 3W1QA 1VEPA 2C71A 4WZHA 1UKOA 1LLOA 2Z27A 4LANA 2BVYA 2E0PA 1TVPA 1VP5A 3LRMA 3GVWA 1XDMA 1W3JA 3RJYA 1KCZA 5LA2A 3G8EA 4DXVA 1QDSA 4H8VA 4FF5A 3W1TA 3IV8A 4XO6A 1QBAA 5BRBA 2X7VA 2VR5A 1TPC1 3LGGA 2WMJA 3LCWA 3STGA 3IWPA 1TTJA 1W37A 5D9OA 1E70M 1MZHA 3T40A 3OO2A 3DUGA 1U1JA 1H60A 2OYKA 3WLOA 2FHFA 4OBTA 4OTKA 4YPJA 1EP3A 1NF7A 1Q6RA 1HJSA 3NZQA 1CCWB 3L5MA 1TJPA 1IIGA 2VEPA 4XD3A 4NX0A 3TN6A 4FZIA 3VK5A 1EF2A 1I8JA 2GVYA 5E0KA 4RNJA 4BJHA 5LIYX 1Q2RA 2FTPA 3PBGA 2CBVA 2VEFA 2P1FA 2E3ZA 4FI4A 3MP4A 3O15A 4HP5A 1XLFA 4UMCA 1RK6A 3SRHA 3RPTA 2X30A 2A3HA 5FF3A 1W5OA 3GZ3A 3FW6A 2XFWA 3G24A 4NHVA 4J9JA 1JGMA 1TTIA 3YPIA 1RCXB 3U9IA 2D0GA 1XL9A 2W9MA 3E5BA 5A3HA 1R3SA 1ADDA 2HPMA 1IGSA 4UTTC 2GJXA 5I06A 1DBTA 5KINA 3UXKA 1ME9A 2EXOA 5M17A 3N14A 1YTKA 3FSUA 4AFYA 5CZSA 1NARA 1WUEA 3ZLGA 3KDOA 3M7SA 2P76A 4WOQA 3TDFA 4YMZA 4XKMA 4LOCA 4UMBA 4ZE5A 2J77A 3C6CA 1BTMA 2QCGA 3S1XA 1LQ0A 3VNZA 1W1IE 1TSIA 3S4TA 1OJXA 4HMNA 1PJ9A 2BVTA 1TX0A 4XBJA 4OFCA 3TJ4A 2R1NA 3SUTA 2J79A 4P2VA 4WUIA 3A4WA 1O5QA 4MB1A 2X1RA 4UNLA 3M0XA 3PTMA 3CT2A 4C6OA 3BG3A 3PJTA 1MWOA 1WXJA 3SY8A 3VX1A 1XLEA 4GNJA 2AL2A 4XKYA 3TYCA 3WF4A 3ARTA 5A2AA 4UCFA 1YXDA 2IPJA 1O1HA 1HVQA 2I5QA 4W93A 1BQCA 3POCA 1XRSA 4EKJA 1JPKA 1TE6A 1M53A 1JQVA 3QTPA 2OEKA 1V93A 2GK1B 4GK8A 2YFNA 2CERA 3MSDA 1E6PA 3KWSA 2XUCA 3AS0A 1XH0A 1JR1A 2IS7A 4ZQRA 5E70A 4WDWA 4H9TA 3T07A 2FFCA 2Y24A 1QHOA 3C3NA 1PKNA 2UY5A 4LAZA 5DCEA 4ZB0A 3NDZA 4E8GA 3PNZA 4S3EA 3LS9A 3IJLA 4B92A 4L4LA 5LKYA 1F8MA 2Z24A 3NGFA 1FP8A 3TEVA 3CZEA 4U33A 2I9UA 2B31A 2GVEA 2X0SA 3KDNA 4X60A 1JULA 1U1HA 3CZJA 2Y88A 1ZJAA 3QY6A 2XGZA 3EEGA 2GSJA 2CZEA 3G6MA 2QV5A 5F7UA 3S2NA 4BI6A 2ZX6A 2HTMA 3KS6A 3OZOA 4XUYA 2XISA 3BK0A 4A21A 3ZJ7A 1L8PA 2PODA 2PZNA 3VI2A 4A6GA 3FN9A 1B0IA 4TR9A 3FYYA 4UOJA 3GBDA 1B3YA 3B0XA 3UETA 3PUEA 2WMHA 1E55A 1XYFA 3LY0A 4DUWA 2PDWA 1J5TA 3RO6A 5FIPA 4Q4KA 4YVXA 3DDMA 4WJXA 3VC5A 3QQ1A 4ACYA 2NQLA 2J7CA 4PUKA 1QPKA 3IANA 5CSYA 4DUXA 2V5BA 3GNRA 3FY1A 2GVJA 2DQWA 4S23A 4CQCA 3Q58A 4RDVA 3C5QA 3ZR4A 1A5SA 1WDSA 3PN8A 3W82A 3GY1A 4XK2A 2H8XA 3F2BA 4C60A 1UJPA 4ROPA 4HJWA 1GVRA 3LN3A 3GVRA 1K8ZA 1WZKA 3GTNA 3CAVA 2Q8XA 4IPJA 3ORWA 4S2BA 2IXUA 3WH7A 3R8HA 3SGZA 4Y9PA 4IQJA 1FWRA 3EPMA 3AMGA 3SN4A 3E74A 3AHYA 4JHMA 3T4CA 3RLHA 3GC2A 1LP6A 4I5RA 3BJTA 2GJNA 3TKFA 3PZUA 3GXTA 3GTXA 1WA3A 3B3DA 4O4VA 1KM1A 3WLNA 4KH2A 5U7SA 2V2HA 1HGYA 4L9YA 1GEQA 5I3GA 2BX7A 1FDZA 4Y7EA 5CGTA 2C1IA 1L6FA 3VGDA 2V3DA 1MYRA 5CPTA 4RV8A 3NJ3A 5KZEA 3PZNA 4H3DA 3QQWA 4GZIA 4IP4A 5BOEA 2J74A 1K70A 4ZFCA 1S5VA 3KX6A 4AWEA 4W8LA 4GKLA 5AC7A 4KCTA 2E9LA 3WJSA 2VUYA 3P81A 4QROA 4IMDA 3P80A 1E1FA 4IM4A 3CUJA 3LHUA 1EXPA 2POZA 4RJEA 4PR4A 2EPLX 3TW9A 4U4MA 3HBLA 3DI1A 3O16A 1TMHA 2OLAA 2F6UA 3XINA 1ECQA 1S38A 4XAZA 3GNXA 5DBUA 4PTNA 3O07A 5CC5A 1X1NA 3G5EA 5F4XA 3E6EA 1W17A 1H1YA 4W7WA 4BFAA 4EE9A 3WQPA 1J18A 4FNTA 2PGRA 4FX6M 3C2YA 3KP1A 5EL1A 5CBJA 4NI3A 4P7RA 1V03A 2WVVA 1MQQA 4L6HA 2J4GA 3TYDA 3VMNA 1F9CA 1S2TA 4GZJA 4PB4A 4DNHA 1SM9A 1P0NA 3P62A 1HUVA 7PTDA 1XG3A 1HKWA 3QV9A 3RAOA 2QCFA 5DMMA 3FJ4A 2NX1A 1JCXA 1AH0A 2BODX 3CB8A 4LS0A 1L6GA 5KEZA 3BGAA 4LX4A 5FJTA 1T0OA 4C6QA 1BKSA 2WHKA 3M6YA 2O4QA 3NWRA 1KRMA 2NX3A 5D38A 1KWKA 4MUPA 3UY7A 2NWRA 3AOFA 3D3FA 1JGIA 5H6HA 4HZ8A 3BLDA 3LXBA 3E1F1 5HXMA 2VJXA 3N2XA 4WR3A 1DQWA 4C6NA 3RU6A 5FJPA 4JHOA 3WH5A 4LFYA 3G1YA 2ZZ5A 1OYBA 4NT0A 2QJIA 1OEPA 3M16A 1HKKA 4E8CA 1YIXA 1UROA 4GACA 2E7FA 2W6RA 2OO0A 4H00A 1BG9A 1QHPA 4IFKB 3W7LA 4O0KA 2OOGA 4U3AA 1QBBA 3TTOA 4UBPC 1J01A 3NNTA 3GTIA 4GC4A 2WC7A 2WOQA 2C79A 1PIGA 4AIUA 2ZC8A 3LZ3A 5FL0A 1R3VA 3A12A 2C8NA 3KL0A 1ZBCA 2OQHA 1KWGA 3ANVA 5MF5A 2MANA 2D0HA 1VKFA 5C7HA 2J7HA 1RZMA 2ZYFA 1JCNA 3B05A 4YXGA 4FMVA 4H6KA 2OSWA 1Q7QA 4Q8MA 1DTNA 1EQCA 4WOZA 3FHQA 3S3GA 3F4CA 5I02A 2Z1WA 4KPLA 3BCDA 4N9DA 4N4QA 2V63A 1L0PA 1MNSA 2HK1A 4HU0A 4MY1A 3S46A 1B3VA 4EPKA 3CQ0A 3W7CA 3KZSA 3GB6A 5AVHA 4GINA 4W7VA 4ICCX 4JDBA 5D03A 4PCTA 2ZUTA 3BMVA 5D32A 1QHZA 3ZO9A 2X8RA 3PBWA 2Y4SA 3DOPA 4FX8A 3SSZA 1EO5A 2OPJA 4NJIA 5D8ZA 3CB3A 1FDJA 2D2OA 2VR2A 3O6DA 1LOQA 3RCMA 2E67A 3UWUA 3F4DA 3CHCA 3ZMRA 4XIMA 1HP5A 1TELA 3DKJA 2VZOA 2QV4A 3S9YA 3H7VA 1OC7A 1T7LA 5GNZA 4Y8EA 1ITCA 1W56A 1EZ2A 4B15A 1UPPA 2CNCA 3BAXA 2ZZ6A 3UCCA 3VIOA 3H24A 3TJIA 3JUGA 3MDUA 1DQXA 1CB2A 3WFAA 4GVIA 1NSJA 2FHCA 4ERIA 4ZQPA 4HNOA 5JQ9A 3GFYA 3BV4A 3ZWSA 3MVTA 4LV9A 1K6WA 4D71A 5JMUA 1MVYA 1J0ZA 3AZRA 4O17A 4RNIA 1X1ZA 3DHUA 4IHCA 3FX4A 1UH2A 4U10A 4HCDA 2O7SA 2PWDA 1NTHA 1NDZA 2P5NA 3T44A 2IPWA 1HNYA 3LNMA 4GOAA 4QJ1A 1PZ1A 2DT3A 3SUVA 1LL7A 4B5SA 4IPIA 3KRUA 4AEEA 4F2BA 3UPWA 9XIMA 2JFEX 1WKDA 4C1NA 1H7RA 5HJXA 1TO3A 1B2YA 3VAVA 4AG0A 4LALA 1E5JA 1X6UA 3LV5A 1LG2A 4GUJA 1DJHA 4UNIA 3NIYA 1MSSA 2VTFA 1EC7A 2DZSA 4PB5A 4DUVA 1IYXA 3P7YA 4LUSB 1I6NA 1IXPA 3OGVA 5TNVA 5D8WA 2V8ZA 3RCNA 4JQ1A 2B7OA 2JBMA 3AS3A 3WNLA 4JTQA 1OCQA 4LBRA 3ABOA 1KD0A 3W7JA 4D72A 1JIBA 4IXXA 1YPIA 4LGXA 4Z1YA 4H7CA 4JX5A 1V0MA 4RW5A 2GLKA 1DWHM 4A2RA 3MYOA 2B7QA 3NR0A 4DEFA 1M65A 2FZBA 3GW0A 4KFOA 1PCKA 1XGEA 1J0YA 1KC7A 3MUIA 4F0SA 4JOMA 4CNPA 1G5AA 2OVLA 4TVCA 1JZ3A 3MKVA 2ISVA 1TA3B 3JW7A 3UR8A 4OHQA 1E9LA 3MTWA 1F3EA 2EG6A 3TXVA 2RDXA 1JPDX 1OF6A 3MBDA 3KLKA 1SJAA 4MKVA 3SUWA 1PKYA 2WKJA 1JYWA 3ICJA 1GJUA 4LAOA 1H7XA 3LRLA 3EX2A 1PZ2A 4MJZA 3C8FA 2ZRYA 3NVDA 1AQ0A 1KRCC 4B3KA 5DY3A 1SYTA 4Z2GA 1PDYA 4MPQA 4UWMA 4K8HA 4Y9MA 4RPPA 3GDLA 1XLHA 3SECA 5DLCA 1XLMA 2DSVA 3C0JA 2DZBA 3PSWA 4R9XA 4LRTA 3SQLA 1A49A 4YTUA 1H0IA 5FJIA 4AZIA 3L66A 3CYVA 1UA7A 1C7SA 4CQBA 3QPZA 4V1XA 3GTFA 2DZAA 1FUYA 1RA0A 4ZB2A 3BMWA 2FVLA 3BSMA 1AQMA 3C4UA 3W76A 4UIOA 3AO0A 4DXXA 1KFLA 3SCWA 1E0VA 5A1AA 2H6RA 1R9XA 3EAUA 3S2MA 3ABRA 4MKNA 1WKFA 3TC3A 1M9HA 2VX4A 4QDMA 3Q65A 1UP3A 5KITA 1FWNA 2B0MA 4R27A 2GUYA 3WNNA 4MF4A 3RLUA 4QDWA 1PHWA 3WJWA 3S8HA 2OELA 2PTWA 3B0YA 4V27A 1UH4A 4DJDD 3QW3A 4DM2A 2CYGA 4E8DA 2J62A 4GYKA 3LBOA 1G7VA 3VYLA 4R7JA 2YCJA 5DMYA 1YDNA 2WJEA 3W00A 3U7VA 1K4GA 4IG2B 3E12A 3IIVA 3SURA 5AC8A 4QAWA 3MDWA 5BOFA 3NQ6A 2NV2A 2I5IA 4AD2A 1TWIA 5HBFA 1TPB1 2R1LA 4LB3A 2VFIA 1XG4A 5AC6A 3R25A 4D1IA 3ANUA 2JKPA 4PMDA 2Z4GA 4PTVA 3LCFA 3SQMA 4D8LA 3W2NA 4QTGA 5HPCA 1JPIA 4PUJA 4AIBA 2VC5A 1EO7A 3GS6A 1WBJA 3MMDA 2IPGA 1XX1A 3USBA 3NOYA 1DTUA 3FSTA 2H8ZA 2QS8A 5CZKA 1W1VA 3NPUA 3OZMA 7ENLA 1QK2A 3ARPA 1F05A 3II1A 3ALGA 1SZNA 3MMTA 4O10A 3EOSA 4HPJA 3QQ0A 5ABEA 4ERAA 1UZHA 2XDFA 4O1DA 4DF0A 5GVJA 4A3UA 4QE1A 2YIHA 4LS1A 4NYUA 3N1AA 3AIEA 2YOCA 5BYWA 3LCHA 1QRQA 1TPVA 2ZZ7A 1V6VA 2GOUA 5JU6A 4O0QA 1P6WA 3WLSA 2V30A 4W88A 3S2CA 3VMPA 3AMKA 3TTQA 1KTNA 3WD2A 2ZE3A 2HPIA 3MP5A 5HR7A 5ABFA 1J10A 1WUFA 1YNQA 3PBYA 3QM3A 1LBFA 1EBHA 3W7PA 4W9TA 1FWTA 1WYIA 4GZ7A 3AYSA 1IT7A 4J3XA 1BVZA 1CT5A 3PF3A 1RBOB 1IEWA 3UZZA 4OVXA 5EY5A 1F4HA 1XBVA 1IR2A 2ZZ1A 4PMZA 1H5VA 4KF1A 4DJEA 2EPKX 4J3SA 3VCRA 2WB5A 3LB0A 3ITOA 3M6DA 2PDIA 4D6IA 1YEYA 4L5ZA 1I2OA 1SW0A 3NQEA 3MWAA 4NAFB 1VPQA 3DBPA 4KRTA 3HGOA 1VEMA 4TMCA 5AC5A 4Q8NA 3H4XA 1X38A 2XIQA 3TR9A 4C5YA 4R9OA 4Z2JA 1H09A 2OKOA 5E0FA 4EK7A 1IWBA 4GIEA 4YVPA 3KAOA 2WHJA 1E4NA 4J28A 1EFZA 3COTA 1RPKA 1OY0A 2P0OA 3IPWA 1EGVA 2G3MA 1IXNA 5AOUA 3RILA 4JTJA 4HA3A 3O05A 3L68A 1R2TA 5DT5A 1M5WA 4KEMA 1KFKA 2WANA 2BY3A 4JFSA 1H61A 5AHFA 1QOQA 3PTDA 1R87A 1ICQA 3LG3A 2YXOA 4ZQOA 1Q13A 3VOCA 1E6RA 1JZ6A 3AYRA 1W2PA 1AQFA 2HJPA 1SSGA 1YYAA 3KW3A 3ENLA 2Q71A 1SJCA 3WD1A 4AX7A 4MFEA 3LNPA 3R79A 3URBA 1XPYA 3N73A 4C1KA 4H2HA 4AH7A 2GGEA 3SFWA 4HN4A 3VKDA 3PSVA 3O2LA 1ELSA 4IIEA 2FDMA 1JAEA 1EJ7L 5IBXA 2OSXA 5I79A 3UWWA 1KO0A 3P14A 3UWYA 4RX0A 4UFMA 3L4WA 3DERA 2OTDA 2C0HA 1VLWA 3HURA 4JNZA 4LVGA 3PVFA 3AICA 3KEHA 5DO8A 2HEJA 1CZ1A 1Z9AA 4UTUA 4JIHA 3DFQA 5A6KA 1WDRA 4Q3MA 2E8YA 2Y8KA 4W84A 1DWGM 4IPLA 4GYFA 3NSNA 2Z7GA 5A8PA 5HK4A 3R1ZA 1PKLA 1QOPA 1TKKA 4GIAA 2D20A 2CU0A 3T42A 3AXKA 1MEHA 2WK2A 5HUPA 4GVGA 3ITLA 1C29A 4A05A 4DJFA 4S3KA 5CJMA 4IQDA 1QNVA 1B9ZA 3EB4A 3L4VA 3VZYA 3C56A 4B3ZA 4PMRA 1BFNA 3OZPA 1XLAA 2OYMA 3PR2A 5JBDA 5EBUA 3S5YA 3TTYA 1J12A 4WCJA 5I0DA 1L6SA 1UD3A 3O6CA 3TNOA 3FJLA 1H3GA 1FCVA 1JUEA 3BV7A 1EF3A 4HHMA 8A3HA 5C9XA 2CPUA 4AEOA 2GYIA 4WSJA 3VDCA 2DUZA 2Q02A 3W7EA 3FVDA 3SB0A 5D2XA 2WZTA 1C8YA 2E6YA 1AW5A 3TROA 4N9BA 3CJPA 4JTRA 3THQA 3TYAA 4ICNA 5D37A 3WK0A 3G3MA 3DC8A 5AN7A 4K8GA 3LM7A 1V3LA 3STEA 1UASA 4XG1A 1N7KA 3WFLA 1ML1A 2FVMA 3KRBA 2BDQA 4NSBA 4CNOA 2QT3A 2OWXA 4JEQA 1EJTC 3SCRA 4KMQA 4B3LA 1KFWA 5LNSA 1R0MA 3ZYZA 3GWQA 2VCCA 2O56A 4MLJA 1KTBA 1JI2A 1EKOA 1IT0A 1CGUA 2V5KA 3IVSA 1MO0A 3AC0A 3IGXA 3KHDA 1BGGA 2FHBA 1ZNNA 4RUBA 5LYRA 1MEWA 4QNEA 1TMLA 1BYAA 4DPPA 1RJPA 4M19A 1J0HA 3UZWA 3ELFA 4C6PA 3N12A 3W9ZA 1QU4A 5C2XA 4PODA 3GU2A 1FWSA 4A29A 1WNOA 3ARVA 4FNPA 4WKFA 1EYEA 1LQAA 5BZAA 4GKTA 3SCQA 2HE5A 3SZ8A 1O5XA 3VC6A 1V77A 5CG0A 3EOUA 3CIXA 3ZVHB 1U33A 3EX3A 3WCZA 3MI3A 3MU7A 2QYGA 3QZAA 2Z2AA 2DPEA 1DJQA 4PE8A 1OFEA 3QPEA 3UPMA 5FI8A 3PBUA 4NZCA 3SGUA 4QLJA 1OM0A 3UYIA 1XLGA 4JFTA 4ZO7A 4B2DD 1J11A 2XIMA 3FK4A 5A6SA 5LNWA 1MRQA 1E5NA 3O0KA 1EJWC 4ATDA 1S5TA 3DENA 1TZZA 3CM4A 2VQTA 1E6ZA 3BJSA 3MHFA 2D3NA 3I6RA 4U31A 2XPKA 4HBKA 5AYIA 4AISA 4S3FA 3T2QA 1ZHAA 4J3WA 4QDPA 1E56A 4OIFA 4WKAA 3W6YA 1RCQA 1RH9A 3S9IA 5D04C 2J25A 4WDTA 4FS9A 1POJA 1MW2A 3WQ5A 3K4DA 1SZGA 2XVLA 3TIMA 5CSRA 2XTKA 4BF5A 3L21A 2ODOA 1WV2A 4H01A 4TX9A 4QLKA 4UNKA 3W27A 5C6MA 1RJRA 2WMIA 3UERA 1MI3A 5AKQA 3MCOA 1UD2A 2BB0A 1A80A 1V0NA 4F0LA 4JHZA 1TPFA 3EDKA 5D09A 1NWUA 1HXJA 3WG6A 2NXIA 3WKZA 3NXFA 4ENLA 3W81A 3ARZA 3OVGA 3PULA 3IAQA 5I24A 4LVAA 2D2JA 1UP2A 4RE0A 3TMQA 3VGEA 1DXIA 2Z1XA 3WNKA 3UNDA 1ZAJA 3V5OA 1E3XA 3HQNA 4LF2A 2FJUB 1WKYA 4S3BA 1NF0A 1EOKA 1NY1A 3W1LA 3M64A 4QHRA 1KB3A 1W5NA 4AHOA 4Y9NA 3RUBL 4O15A 3WNPA 4S3JA 2IUZA 4V2XA 4O16A 3CWOX 4PUNA 3SQSA 1K8YA 2Q8ZA 2EG7A 1AJZA 3OLGA 5FJJA 1FVPA 3MI6A 4IIBA 2QXWA 1YNYA 4C5ZA 3W7QA 4LT9A 3WF2A 4IMGA 2CLFA 1D7KA 3V0UA 3IGUA 1DJWA 3TYEA 5CKSA 1HIZA 4ZO6A 2DJXA 4RV3A 4JL2A 3FXYA 4GJJA 2BXYA 3TZFA 3V1HA 1RBLA 4WGHA 1TCDA 3U7BA 2QPUA 5AYBA 3RO8A 1JEZA 4GYPC 1CTNA 1E4IA 4MTVA 4JQAA 2YDAA 4PMJA 1GKPA 1N8FA 1LUCB 3ITCA 2RFGA 3P0WA 1F5ZA 1U1UA 2QCMA 4IQEA 5F2LA 4NJKA 2O9OA 3DHFA 1IQ8A 5HMFA 3S5SA 3OTRA 1NWSA 2VD8A 3DYOA 3C2EA 5XIMA 1CWYA 3OYXA 1QTWA 4NAEB 2A6LA 2G96A 2A3EA 4O19A 3H2FA 2VZSA 4DJDC 1UD8A 5FEPA 1ONEA 1DL3A 3G1VA 4A8IA 3STFA 5KZDA 3TC6A 2ZUVA 1H5YA 1GYLA 3HIJA 1W9PA 3WY1A 4Y9OA 1FWAC 1Q4WA 3RR1A 4Q8WA 4NNBA 2HV5A 4OECA 3GW3A 3TX9A 1WXYA 3LBMA 3D5HA 2X1TA 1Q3NA 3NQ2A 4JTUA 4FP1A 3M4HA 1MW3A 1UWAA 4DHGA 4S39A 4QFUA 1KBIA 4B5UA 1QWGA 3LENA 4K7YA 4M0XA 3UT0A 4E0CA 4EF8A 5LIXX 5JBEA 2FYMA 5C2CA 4J5NA 4YCPA 1QK0A 1J9YA 1O4UA 3ZT5A 3MJMA 1DE6A 4MNJA 2E9MA 3DHDA 5REQB 1YE6A 1XH2A 1P43A 3QN3A 3PZOA 3IK2A 4QS6A 4I5XA 1K8XA 3DFTA 3T05A 1OADA 4L64A 3FA3A 4V15A 4Q6JA 1R3TA 2WXDM 4WJEA 3AU2A 2D3LA 4HVXA 1OQFA 1D8WA 1ZY9A 3WX7A 1XYCA 1V3KA 3L2LA 2WNNA 1WPCA 3RX2A 3AHZA 4N02A 3SN1A 4M3PA 3WLMA 2CZVA 4E2DA 2P8CA 5A2CA 5HDRA 3RLVA 1AL7A 2V5DA 3CUGA 4N0RA 5D9NA 4OBRA 4JYDA 3WK3A 4ORMA 4AHPA 3WL0A 1I2PA 4LQ1A 2FZNA 1K77A 5CJNA 2C13A 1Q66A 3EKZA 5GPRA 5JH2A 5G2IA 1TE1A 2P88A 1SU5A 3WNOA 2QULA 4S2CA 3GXFA 3UVIA 4B16A 4W5ZA 4Q4QA 4GO9A 3TV8A 2GL5A 3EDDA 3I3BA 2X0YA 2OWWA 1X7IA 1YNPA 1M6JA 4HU3A 4V1YA 3R13A 2NUXA 3KRZA 1UUQA 5A5WA 3WZ0E 3OLDA 1KXHA 4C7DA 3WDPP 3VZXA 3U3HA 2WAGA 2QCLA 1JI1A 3N9SA 3W28A 3FXGA 1PO9A 4UQDA 5HINA 4OGZA 1CB7B 4KWUA 1U22A 4MJ2A 2V5CA 2WKLA 3HTWA 2AAMA 2CHRA 3PPCA 5FJOA 2D0FA 3IK4A 2TODA 5I78A 1J2BA 2HE8A 2NUYA 2GUUA 4GXPA 3TLLA 3N6JA 1W1TA 1X96A 1OZQA 2PLJA 2BXVA 5CSSA 2KX9A 3URAA 1SUXA 1M68A 1YQ2A 4MFDA 5GNXA 4NZFA 3CL8A 3DG3A 4MNLA 1FRBA 3U2EA 2DGAA 1HG3A 1PEZA 3TE9A 1XRTA 1PSCA 3N2BA 3VE9A 4LYRA 1EPVA 1GVSA 1DWFM 3GR4A 1RVKA 2X0HA 4WSKA 3GIYA 3V5FA 2VZVA 3EA3A 4XTDA 3VNDA 2XVNA 5IRPA 3ES8A 4XZLX 1FTXA 4J1OA 1RQEA 3GIQA 1SW3A 4MM1A 4HPXA 4GGHA 4QJ5B 3RG6A 2A0NA 4B9YA 1OCBA 3O9NA 1DJGA 1G4TA 1GPFA 2DV0A 4I7UA 3UY8A 3VD5A 1J6OA 1QR7A 3VKKA 2E25A 1KR1A 2Q8LA 3AIVA 5J5RA 1ODUA 3FV9A 3RRXA 4DNMA 3I10A 4IIFA 5HAOA 2ACRA 1LLWA 4PCSA 2V3EA 3N34A 3GRIA 1Q8AA 2PPGA 1F6KA 2VRQA 3W29A 4HGXA 2G8ZA 2W61A 4Z42C 4MWAB 3VGGA 5KMYA 4WVXA 2H9AB 3ZJKA 1ITXA 4L61A 1FWFC 1A0EA 3OVRA 5J8LA 3KRSA 4I90A 4LCQA 3BANA 1G7UA 2J8FA 4D6DA 2RGMA 3BPWA 1OINA 2ONEA 1C92A 5F1VA 3WBYA 2WO5A 4RZ6A 1GHSA 1KCLA 3VIIA 3H8AA 3VIPA 3QLLA 2BY2A 1LOSA 4B91A 2QDHA 4GO8A 3L5LA 2AMXA 2QZRA 3CO8A 4DYKA 2R6OA 4NY2A 4AWSA 1E6SM 3VOIA 3ARWA 1QW7A 1GORA 2PTZA 2DW7A 1FXPA 1ZBWA 4I3GA 5HUOA 5TD4A 1GK8A 4GD0A 4M7TA 1PTGA 3NL3A 3H26A 1MUCA 3A64A 1LF1A 4UOZA 3LLDA 3N13A 1Z6KA 1Q6CA 3LPFA 4F66A 3LCIA 3N2TA 4WKHA 1CGXA 4U5KA 3DI0A 3TTEA 2RKXA 1FHDA 2YDRA 4FB7A 3VIJA