5IOTA

Flavin-dependent thymidylate synthase r174a variant in complex with fad and dump
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
220
structure length
215
Chain Sequence
MKIDILDKGFVELVDVMGNDLSAVRAARVSFDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLAADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKEVQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase ThyX
publication title Deprotonations in the Reaction of Flavin-Dependent Thymidylate Synthase.
pubmed doi rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
molecule tags Transferase
total genus 79
structure length 215
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5iotA00
4GTEA 1O24A 4GTLA 1O29A 4GTDA 1O2BA 3AH5A 4GTBA 4GTCA 4KATA 2CFAB 5IOQA 3N0BA 4GT9A 3G4AA 5IORA 4KASA 1O2AA 4GTAA 5IOSA 1KQ4A 4P5BA 3N3YA 3G4CA 2CFAA 4FZBA 1O26A 4GTFA 5IOTA 5CHPA 4P5AA 4KARA 1O27A 5JFEA 1O28A 1O25A 3N0CA
chains in the Genus database with same CATH superfamily
4A3GK 1J98A 2W7VA 1G51A 2NVTC 3GTLK 2RGRA 1EQRA 1XXCA 3GTPK 3S17K 4KAWX 4BBRC 3GTLA 1UV7A 1TWFC 4OIRA 3GTPA 1X31C 4KDDA 5M5XK 2NVTK 1IBAA 2PMZD 1EI6A 5C4XC 4BBRK 5IYCC 4Y52C 1TWFK 4LJZA 3T01A 3S1NC 5FJ8K 1HQMA 4G7ZA 5M3FK 1TWFA 1VLOA 4KN4A 3S14C 4QIWL 5C4XK 2E2IC 4GZYA 5IYCK 4Y52K 3N0BA 2JA6C 2R7ZC 3S1NK 3FHZA 3LAPA 1BJTA 3S14K 2E2IK 3AQOA 5IOSA 2CFAA 2JA6K 5IOTA 2R7ZK 2E2IA 3VA7A 3V4GA 5JFEA 4KMUA 5C3EC 1I50C 1TWAC 2JA6A 2R7ZA 1SMYA 4OIPA 3Q3QA 2XCQA 3S1QC 3GDZA 3AD8C 1ZXOA 3BUEA 5C3EK 1I50K 4YG2A 1TWAK 2GSUA 3OEPA 4KMAA 4Y7NC 1YNJA 4G0UA 3H3VD 2A6EA 1F7UA 3S1QK 1PJ6A 1TWAA 1I50A 1WOOA 1B4BA 3HKZL 1EH1A 3GEHA 4P5AA 3N0CA 4Y7NK 1EFWA 1HI9A 1J6WA 5L46A 4BY7C 4RMFA 1PJ7A 1XZPB 1IS1A 3NUHA 1VH2A 5CJ9A 1XXBA 1IE0A 1V5VA 1YX2A 5TJ3A 4A3CC 4G0WA 4BY7K 4XSZA 4XLPA 1IQ0A 1O2AA 3S2HC 4KMDA 4KMHA 1I6VA 4BBSC 1I6HC 4KARA 1O28A 3LPXA 4A3CK 1VRQC 4OINA 4GTEA 1ZQ1C 3AD7C 3S2HK 2JH3A 1O2BA 1TWCA 1WQGA 3OREA 4C3IC 3S16C 4BBSK 1XXAA 4XLNA 2GSOA 4C3HC 1I6HK 3GTGC 4A3BC 3I4MC 4G7OA 1F9NA 4XSXA 1XZPA 2PA8D 3QX3A 4C3IK 1K83C 4FZBA 3S16K 5E68A 1VGXA 1B4AA 2JA5C 3GTGK 3MMLB 4A3BK 4NOIA 4LK1A 3I4MK 4YFNA 3GTGA 1USOA 1INNA 3JSTA 1K83K 3HXAA 4O2DA 2JA5K 4KB2A 1K83A 4WJ4A 1WSRA 4AYBD 2JA5A 4OIOA 3H0GC 3HOZC 3S1MC 4JK1A 1F7VA 2Y0SD 1WIHA 2YU9C 5M3MK 1J6VA 2XCRB 2P8TA 3H0GK 3SZYA 3GTJC 3HOZK 3S1MK 4GTDA 3GTQC 2GSNA 1J6XA 3H0GA 2VUMC 3GTMC 4KM9A 2YU9K 4DDQA 3G4AA 1XZQB 2YU9A 3GTJK 1F93A 3GTQK 3GIRA 1EK8A 3S2DC 2VUMK 3GTMK 2BE5A 3T00A 3GTQA 1Y1VC 4M1XA 4C45A 2VUMA 3GTMA 4AYBL 3HOVC 2NVXC 3FKIC 2PMZL 3S2DK 4KATA 3AQPA 4YFXA 4Q4ZA 4C2MC 1DCPA 1Y1VK 1IL2A 4LK0A 4Q5SA 3HOVK 5IP7C 1Y1VA 1L0WA 1WOPA 1BS2A 2NVXK 3FKIK 1WCMC 3HOYC 2R93C 2NVXA 3A8KA 3FKIA 4C2MK 1WSVA 1XZQA 3AD9C 5IP7K 4MEXA 3A8JA 4BLBA 1WCMK 3HOYK 4GTBA 4QJVB 4A3EC 2R93K 2B63C 1WCMA 4LOWA 4AH6A 3GTOC 4A3IC 2NVQC 1WORA 4G0VA 3WODA 1GE9A 3RZOC 3RZDC 5IYBC 3FOFA 1Y1WC 4A3EK 5HL8A 3G4CA 2B63K 3S1RC 4OIQA 3GTOK 4A3IK 2NVQK 1PJ5A 2B63A 2R92C 4GTLA 3RZOK 3H3VL 3GTOA 3RZDK 5IYBK 1Y1WK 4GTCA 3S1RK 5JVOA 1WQFA 1DD5A 1Y1WA 2R92K 4BXXC 1I3QC 2R92A 4P5BA 4QJVA 1JVIA 5EGHA 3L4JA 3HOWC 4KN7A 1YCLA 1TWGC 3FOEA 4C3HK 3TFIA 4BLAA 4J3NA 4BXXK 1O24A 3GEEA 2FQTA 1DCOA 5IYDC 2V6UA 2PPBA 1I3QK 3HOWK 3TFHA 3IPJA 5C4JC 1TWGK 2A69A 3TTGA 1I3QA 4PAAA 1AB4A 4A3LC 3GEIA 2FQOA 1ZYRA 1VJEA 1TWGA 4KC6A 3TFJA 1SFOC 5IYDK 1RU0A 3LAJA 4BY1C 5C4JK 3S15C 4A3LK 1SFOK 2O5JA 1ZBSA 2PA8L 1TWHC 1SFOA 4BY1K 2CFAB 2ZUFA 3S15K 3OPFA 5IP9C 3I4NC 3CAGA 4A3KC 1BDFA 1O2FB 4MEYA 3M3YC 2WB1D 1TWHK 5FLMC 4A93C 3GTJA 4GTFA 2CW0A 2XCOA 1TWHA 5IP9K 3I4NK 4A3KK 3M3YK 2WAQD 2Y0SL 2V6SA 5FLMK 3AH5A 3PO3C 4A93K 5IOQA 2EBBA 5M5WK 2E2HC 3HKZD 3GSIA 3K7AC 5IORA 5TMCA 4ILDA 2KWAA 1ZVUA 4KASA 3CQZC 5TMFA 4KM8A 1C0AA 2E2JC 1KQ4A 3PO3K 3N3YA 2E2HK 3L4KA 1O26A 1ISEA 4ZH4A 4BKWA 1XPPA 3K7AK 5EGEA 2E2HA 3CQZK 3GTKC 2WB1L 2JA8C 1O29A 2E2JK 1BGWA 1WOSA 3SZZA 4LR2A 3CQZA 3BP3A 3ERED 1JQWA 4G7HA 2R93A 3GTKK 4A3MC 4C3JC 2JA8K 4KB4A 3A8IA 3BP8C 1USMA 2WAQL 3HOXC 4LLGA 3GTKA 5D4DA 4PABA 3M4OC 2NVYC 1DCHA 3PO2C 1O25A 4A3MK 4C3JK 2P5MA 3HOXK 1JOEA 4A3DC 5C44C 3HOUC 4P9SA 3M4OK 2NVYK 4A3FC 2A6HA 3PO2K 1TWCC 2A68A 2NVYA 4FM9A 2RH6A 1IW7A 4A3DK 5C44K 3HOUK 2ZUEA 4GTAA 2PHCB 2D6FC 4X6AC 2JA7C 3ADAC 4A3FK 4XCHA 4YFKA 5CHPA 1TWCK 2ZFZA 4A3JC 1R9TC 3T02A 2Y3PA 2O5IA 4X6AK 2JA7K 4GFQA 5M5YK 3DXJA 4WJ3M 4WILA 3S0XA 2JA7A 4A3JK 1R9TK 4A3GC 1YNNA 2GAGC 3GTLC 1R9TA 4QIWD 3GTPC 3S17C 1WQHA 3EQLA 4LQYA 2GAHC 2V6TA 1O27A 4MQ9A 4GT9A
chains in the Genus database with same CATH topology
4GTEA 4BLBA 2RGRA 2JH3A 1O2BA 1XXCA 1TWCA 3AH5A 1WQGA 3OREA 4GTBA 4C3IC 5IOQA 4KAWX 3GTLA 1WCMA 1XXAA 3GTPA 2GSOA 4C3HC 5IORA 4ILDA 2KWAA 1ZVUA 4KASA 4G0VA 1GE9A 4KDDA 4KM8A 1F9NA 3FOFA 3QX3A 1KQ4A 3N3YA 3G4CA 4FZBA 3L4KA 1O26A 1ISEA 4BKWA 1B4AA 3MMLB 5EGEA 2E2HA 2B63A 1TWFA 4GTLA 1O29A 3GTGA 1BGWA 3GTOA 4LR2A 3CQZA 4GTCA 3N0BA 4KB2A 5JVOA 1WQFA 1DD5A 1Y1WA 1K83A 3FHZA 3LAPA 1BJTA 3ERED 2R93A 2JA5A 4C3JC 4KB4A 3AQOA 5IOSA 2R92A 3GTKA 4P5BA 1WIHA 5EGHA 3L4JA 2CFAA 5IOTA 2E2IA 3VA7A 3FOEA 3V4GA 5JFEA 2XCRB 1O25A 4BLAA 4J3NA 2JA6A 2R7ZA 1O24A 2P5MA 3Q3QA 4GTDA 2XCQA 2GSNA 3H0GA 4KM9A 4DDQA 1I3QA 1ZXOA 1AB4A 3G4AA 3BUEA 2NVYA 1TWGA 2GSUA 3OEPA 4KC6A 4KMAA 2RH6A 4FM9A 2YU9A 4G0UA 3LAJA 4GTAA 1TWAA 1I50A 1EK8A 2PHCB 1B4BA 1EH1A 5CHPA 3GTQA 4M1XA 4P5AA 2VUMA 2ZFZA 3GTMA 3N0CA 2Y3PA 1ZBSA 1IS1A 3NUHA 1SFOA 4KATA 2CFAB 3AQPA 4GFQA 4C2MC 3OPFA 5CJ9A 3S0XA 1XXBA 2JA7A 5TJ3A 3CAGA 4G0WA 1Y1VA 1R9TA 1O2AA 4KMDA 4KMHA 1WQHA 3GTJA 4GTFA 2NVXA 4LQYA 3FKIA 2XCOA 1TWHA 4KARA 1O27A 1O28A 3LPXA 4GT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTE A;  1O24 A;  4GTL A;  1O29 A;  4GTD A;  1O2B A;  3AH5 A;  4GTB A;  4GTC A;  4KAT A;  2CFA B;  5IOQ A;  3N0B A;  4GT9 A;  3G4A A;  5IOR A;  4KAS A;  1O2A A;  4GTA A;  5IOS A;  1KQ4 A;  4P5B A;  3N3Y A;  3G4C A;  2CFA A;  4FZB A;  1O26 A;  4GTF A;  5IOT A;  5CHP A;  4P5A A;  4KAR A;  1O27 A;  5JFE A;  1O28 A;  1O25 A;  3N0C A; 
#chains in the Genus database with same CATH topology
 4A3G K;  1J98 A;  2W7V A;  1G51 A;  2NVT C;  3GTL K;  2RGR A;  1EQR A;  1XXC A;  3GTP K;  3S17 K;  4KAW X;  4BBR C;  3GTL A;  1UV7 A;  1TWF C;  4OIR A;  3GTP A;  1X31 C;  4KDD A;  5M5X K;  2NVT K;  1IBA A;  2PMZ D;  1EI6 A;  5C4X C;  4BBR K;  5IYC C;  4Y52 C;  1TWF K;  4LJZ A;  3T01 A;  3S1N C;  5FJ8 K;  1HQM A;  4G7Z A;  5M3F K;  1TWF A;  1VLO A;  4KN4 A;  3S14 C;  4QIW L;  5C4X K;  2E2I C;  4GZY A;  5IYC K;  4Y52 K;  3N0B A;  2JA6 C;  2R7Z C;  3S1N K;  3FHZ A;  3LAP A;  1BJT A;  3S14 K;  2E2I K;  3AQO A;  5IOS A;  2CFA A;  2JA6 K;  5IOT A;  2R7Z K;  2E2I A;  3VA7 A;  3V4G A;  5JFE A;  4KMU A;  5C3E C;  1I50 C;  1TWA C;  2JA6 A;  2R7Z A;  1SMY A;  4OIP A;  3Q3Q A;  2XCQ A;  3S1Q C;  3GDZ A;  3AD8 C;  1ZXO A;  3BUE A;  5C3E K;  1I50 K;  4YG2 A;  1TWA K;  2GSU A;  3OEP A;  4KMA A;  4Y7N C;  1YNJ A;  4G0U A;  3H3V D;  2A6E A;  1F7U A;  3S1Q K;  1PJ6 A;  1TWA A;  1I50 A;  1WOO A;  1B4B A;  3HKZ L;  1EH1 A;  3GEH A;  4P5A A;  3N0C A;  4Y7N K;  1EFW A;  1HI9 A;  1J6W A;  5L46 A;  4BY7 C;  4RMF A;  1PJ7 A;  1XZP B;  1IS1 A;  3NUH A;  1VH2 A;  5CJ9 A;  1XXB A;  1IE0 A;  1V5V A;  1YX2 A;  5TJ3 A;  4A3C C;  4G0W A;  4BY7 K;  4XSZ A;  4XLP A;  1IQ0 A;  1O2A A;  3S2H C;  4KMD A;  4KMH A;  1I6V A;  4BBS C;  1I6H C;  4KAR A;  1O28 A;  3LPX A;  4A3C K;  1VRQ C;  4OIN A;  4GTE A;  1ZQ1 C;  3AD7 C;  3S2H K;  2JH3 A;  1O2B A;  1TWC A;  1WQG A;  3ORE A;  4C3I C;  3S16 C;  4BBS K;  1XXA A;  4XLN A;  2GSO A;  4C3H C;  1I6H K;  3GTG C;  4A3B C;  3I4M C;  4G7O A;  1F9N A;  4XSX A;  1XZP A;  2PA8 D;  3QX3 A;  4C3I K;  1K83 C;  4FZB A;  3S16 K;  5E68 A;  1VGX A;  1B4A A;  2JA5 C;  3GTG K;  3MML B;  4A3B K;  4NOI A;  4LK1 A;  3I4M K;  4YFN A;  3GTG A;  1USO A;  1INN A;  3JST A;  1K83 K;  3HXA A;  4O2D A;  2JA5 K;  4KB2 A;  1K83 A;  4WJ4 A;  1WSR A;  4AYB D;  2JA5 A;  4OIO A;  3H0G C;  3HOZ C;  3S1M C;  4JK1 A;  1F7V A;  2Y0S D;  1WIH A;  2YU9 C;  5M3M K;  1J6V A;  2XCR B;  2P8T A;  3H0G K;  3SZY A;  3GTJ C;  3HOZ K;  3S1M K;  4GTD A;  3GTQ C;  2GSN A;  1J6X A;  3H0G A;  2VUM C;  3GTM C;  4KM9 A;  2YU9 K;  4DDQ A;  3G4A A;  1XZQ B;  2YU9 A;  3GTJ K;  1F93 A;  3GTQ K;  3GIR A;  1EK8 A;  3S2D C;  2VUM K;  3GTM K;  2BE5 A;  3T00 A;  3GTQ A;  1Y1V C;  4M1X A;  4C45 A;  2VUM A;  3GTM A;  4AYB L;  3HOV C;  2NVX C;  3FKI C;  2PMZ L;  3S2D K;  4KAT A;  3AQP A;  4YFX A;  4Q4Z A;  4C2M C;  1DCP A;  1Y1V K;  1IL2 A;  4LK0 A;  4Q5S A;  3HOV K;  5IP7 C;  1Y1V A;  1L0W A;  1WOP A;  1BS2 A;  2NVX K;  3FKI K;  1WCM C;  3HOY C;  2R93 C;  2NVX A;  3A8K A;  3FKI A;  4C2M K;  1WSV A;  1XZQ A;  3AD9 C;  5IP7 K;  4MEX A;  3A8J A;  4BLB A;  1WCM K;  3HOY K;  4GTB A;  4QJV B;  4A3E C;  2R93 K;  2B63 C;  1WCM A;  4LOW A;  4AH6 A;  3GTO C;  4A3I C;  2NVQ C;  1WOR A;  4G0V A;  3WOD A;  1GE9 A;  3RZO C;  3RZD C;  5IYB C;  3FOF A;  1Y1W C;  4A3E K;  5HL8 A;  3G4C A;  2B63 K;  3S1R C;  4OIQ A;  3GTO K;  4A3I K;  2NVQ K;  1PJ5 A;  2B63 A;  2R92 C;  4GTL A;  3RZO K;  3H3V L;  3GTO A;  3RZD K;  5IYB K;  1Y1W K;  4GTC A;  3S1R K;  5JVO A;  1WQF A;  1DD5 A;  1Y1W A;  2R92 K;  4BXX C;  1I3Q C;  2R92 A;  4P5B A;  4QJV A;  1JVI A;  5EGH A;  3L4J A;  3HOW C;  4KN7 A;  1YCL A;  1TWG C;  3FOE A;  4C3H K;  3TFI A;  4BLA A;  4J3N A;  4BXX K;  1O24 A;  3GEE A;  2FQT A;  1DCO A;  5IYD C;  2V6U A;  2PPB A;  1I3Q K;  3HOW K;  3TFH A;  3IPJ A;  5C4J C;  1TWG K;  2A69 A;  3TTG A;  1I3Q A;  4PAA A;  1AB4 A;  4A3L C;  3GEI A;  2FQO A;  1ZYR A;  1VJE A;  1TWG A;  4KC6 A;  3TFJ A;  1SFO C;  5IYD K;  1RU0 A;  3LAJ A;  4BY1 C;  5C4J K;  3S15 C;  4A3L K;  1SFO K;  2O5J A;  1ZBS A;  2PA8 L;  1TWH C;  1SFO A;  4BY1 K;  2CFA B;  2ZUF A;  3S15 K;  3OPF A;  5IP9 C;  3I4N C;  3CAG A;  4A3K C;  1BDF A;  1O2F B;  4MEY A;  3M3Y C;  2WB1 D;  1TWH K;  5FLM C;  4A93 C;  3GTJ A;  4GTF A;  2CW0 A;  2XCO A;  1TWH A;  5IP9 K;  3I4N K;  4A3K K;  3M3Y K;  2WAQ D;  2Y0S L;  2V6S A;  5FLM K;  3AH5 A;  3PO3 C;  4A93 K;  5IOQ A;  2EBB A;  5M5W K;  2E2H C;  3HKZ D;  3GSI A;  3K7A C;  5IOR A;  5TMC A;  4ILD A;  2KWA A;  1ZVU A;  4KAS A;  3CQZ C;  5TMF A;  4KM8 A;  1C0A A;  2E2J C;  1KQ4 A;  3PO3 K;  3N3Y A;  2E2H K;  3L4K A;  1O26 A;  1ISE A;  4ZH4 A;  4BKW A;  1XPP A;  3K7A K;  5EGE A;  2E2H A;  3CQZ K;  3GTK C;  2WB1 L;  2JA8 C;  1O29 A;  2E2J K;  1BGW A;  1WOS A;  3SZZ A;  4LR2 A;  3CQZ A;  3BP3 A;  3ERE D;  1JQW A;  4G7H A;  2R93 A;  3GTK K;  4A3M C;  4C3J C;  2JA8 K;  4KB4 A;  3A8I A;  3BP8 C;  1USM A;  2WAQ L;  3HOX C;  4LLG A;  3GTK A;  5D4D A;  4PAB A;  3M4O C;  2NVY C;  1DCH A;  3PO2 C;  1O25 A;  4A3M K;  4C3J K;  2P5M A;  3HOX K;  1JOE A;  4A3D C;  5C44 C;  3HOU C;  4P9S A;  3M4O K;  2NVY K;  4A3F C;  2A6H A;  3PO2 K;  1TWC C;  2A68 A;  2NVY A;  4FM9 A;  2RH6 A;  1IW7 A;  4A3D K;  5C44 K;  3HOU K;  2ZUE A;  4GTA A;  2PHC B;  2D6F C;  4X6A C;  2JA7 C;  3ADA C;  4A3F K;  4XCH A;  4YFK A;  5CHP A;  1TWC K;  2ZFZ A;  4A3J C;  1R9T C;  3T02 A;  2Y3P A;  2O5I A;  4X6A K;  2JA7 K;  4GFQ A;  5M5Y K;  3DXJ A;  4WJ3 M;  4WIL A;  3S0X A;  2JA7 A;  4A3J K;  1R9T K;  4A3G C;  1YNN A;  2GAG C;  3GTL C;  1R9T A;  4QIW D;  3GTP C;  3S17 C;  1WQH A;  3EQL A;  4LQY A;  2GAH C;  2V6T A;  1O27 A;  4MQ9 A;  4GT9 A; 
#chains in the Genus database with same CATH homology
 4GTE A;  4BLB A;  2RGR A;  2JH3 A;  1O2B A;  1XXC A;  1TWC A;  3AH5 A;  1WQG A;  3ORE A;  4GTB A;  4C3I C;  5IOQ A;  4KAW X;  3GTL A;  1WCM A;  1XXA A;  3GTP A;  2GSO A;  4C3H C;  5IOR A;  4ILD A;  2KWA A;  1ZVU A;  4KAS A;  4G0V A;  1GE9 A;  4KDD A;  4KM8 A;  1F9N A;  3FOF A;  3QX3 A;  1KQ4 A;  3N3Y A;  3G4C A;  4FZB A;  3L4K A;  1O26 A;  1ISE A;  4BKW A;  1B4A A;  3MML B;  5EGE A;  2E2H A;  2B63 A;  1TWF A;  4GTL A;  1O29 A;  3GTG A;  1BGW A;  3GTO A;  4LR2 A;  3CQZ A;  4GTC A;  3N0B A;  4KB2 A;  5JVO A;  1WQF A;  1DD5 A;  1Y1W A;  1K83 A;  3FHZ A;  3LAP A;  1BJT A;  3ERE D;  2R93 A;  2JA5 A;  4C3J C;  4KB4 A;  3AQO A;  5IOS A;  2R92 A;  3GTK A;  4P5B A;  1WIH A;  5EGH A;  3L4J A;  2CFA A;  5IOT A;  2E2I A;  3VA7 A;  3FOE A;  3V4G A;  5JFE A;  2XCR B;  1O25 A;  4BLA A;  4J3N A;  2JA6 A;  2R7Z A;  1O24 A;  2P5M A;  3Q3Q A;  4GTD A;  2XCQ A;  2GSN A;  3H0G A;  4KM9 A;  4DDQ A;  1I3Q A;  1ZXO A;  1AB4 A;  3G4A A;  3BUE A;  2NVY A;  1TWG A;  2GSU A;  3OEP A;  4KC6 A;  4KMA A;  2RH6 A;  4FM9 A;  2YU9 A;  4G0U A;  3LAJ A;  4GTA A;  1TWA A;  1I50 A;  1EK8 A;  2PHC B;  1B4B A;  1EH1 A;  5CHP A;  3GTQ A;  4M1X A;  4P5A A;  2VUM A;  2ZFZ A;  3GTM A;  3N0C A;  2Y3P A;  1ZBS A;  1IS1 A;  3NUH A;  1SFO A;  4KAT A;  2CFA B;  3AQP A;  4GFQ A;  4C2M C;  3OPF A;  5CJ9 A;  3S0X A;  1XXB A;  2JA7 A;  5TJ3 A;  3CAG A;  4G0W A;  1Y1V A;  1R9T A;  1O2A A;  4KMD A;  4KMH A;  1WQH A;  3GTJ A;  4GTF A;  2NVX A;  4LQY A;  3FKI A;  2XCO A;  1TWH A;  4KAR A;  1O27 A;  1O28 A;  3LPX A;  4GT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...