5IOTA

Flavin-dependent thymidylate synthase r174a variant in complex with fad and dump
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
220
structure length
215
Chain Sequence
MKIDILDKGFVELVDVMGNDLSAVRAARVSFDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLAADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKEVQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Deprotonations in the Reaction of Flavin-Dependent Thymidylate Synthase.
pubmed doi rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
molecule tags Transferase
molecule keywords Thymidylate synthase ThyX
total genus 79
structure length 215
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5iotA00
4GTFA 5IOQA 2CFAA 4KARA 1O25A 1O26A 1O29A 3N3YA 3G4AA 4P5BA 4GTEA 4GTLA 4GT9A 3G4CA 5IORA 3AH5A 2CFAB 1O24A 4P5AA 5JFEA 3N0CA 1KQ4A 4KATA 4GTDA 1O27A 4FZBA 4GTBA 5CHPA 1O2BA 5IOSA 1O28A 4KASA 1O2AA 5IOTA 4GTAA 3N0BA 4GTCA
chains in the Genus database with same CATH superfamily
4GTFA 1TWCC 4C2MC 4KMDA 4WJ4A 1IBAA 3DXJA 4GT9A 5D4DA 4JK1A 2NVYA 1YNNA 4KMAA 4KATA 4O2DA 3GTKA 4A3JC 1SFOC 1I6HK 3M4OK 1WORA 1O2AA 4GTAA 2R7ZK 4A3IK 3CAGA 3A8JA 2RGRA 2YU9A 2YU9K 5IYBC 4P9SA 2E2JK 1I3QA 1JQWA 4M1XA 3L4KA 4XLPA 3IPJA 4C2MK 2JA7C 1TWCA 4LQYA 4PABA 5EGEA 4OINA 3GTPC 3S1NC 2E2HA 2KWAA 1XZPA 2PPBA 4Y7NK 4C3IC 3S16K 3S1RK 1IE0A 5M5XK 3S0XA 4A93C 3RZOC 3GTLA 3VA7A 2WAQD 1TWFA 2P5MA 4A93K 3A8KA 3GEEA 4A3KC 3QX3A 3S16C 2R92A 4XLNA 3HOZC 3AD8C 2FQTA 4C3JK 5C4XK 4C3HC 3A8IA 1R9TK 5IP7K 2RH6A 1PJ6A 1I3QC 3HOYK 5IP9K 4XCHA 4G0WA 5EGHA 4A3LK 2A69A 1B4BA 1ZVUA 3HOWK 1TWGC 4A3FC 5IOSA 3GEHA 3MMLB 2O5JA 1IQ0A 4A3BK 2GSUA 4A3EK 2PA8L 3T02A 3HOVC 3GTKC 4QIWD 3WODA 3GTLC 1TWAA 3S17K 1TWHK 4A3BC 3SZZA 4GZYA 2JA5K 3GSIA 3S2DC 5TMFA 1HI9A 1K83A 3JSTA 2NVXK 2NVXA 4PAAA 2JA8C 1WIHA 1YCLA 3K7AC 1O28A 5IOTA 1WQFA 3M3YC 4KM8A 3FKIC 5M3MK 1O25A 1EQRA 1O26A 5C3EC 4LLGA 4A3CK 1Y1VK 2NVYK 1XZQA 1PJ5A 4YG2A 1SFOA 4G7HA 1F7UA 2CFAB 3GTOK 1X31C 2V6TA 4OIQA 1KQ4A 4Q5SA 1Y1VC 4BY7C 3FKIA 3GTJC 2FQOA 4A3CC 3GTPK 4BBRC 4FM9A 2V6UA 4KM9A 1V5VA 5C44C 1WSRA 4NOIA 3FOFA 3HOXK 2B63C 3S1QK 1K83C 5L46A 1BDFA 1WQHA 4GTLA 3GTJA 3T00A 2R92C 1TWHC 2VUMC 1WCMC 1AB4A 3N0CA 4GTDA 1O27A 1XXBA 1VJEA 3I4NC 4RMFA 3M3YK 3L4JA 1DCHA 3S14C 3CQZC 2VUMK 2ZUEA 3HOYC 4MQ9A 1DD5A 2E2IC 3LPXA 3HOWC 4P5BA 5IP9C 3CQZK 1L0WA 3TFIA 2E2IA 3FHZA 5FJ8K 3EQLA 4KC6A 4KMUA 1F7VA 4X6AC 1USMA 3GTKK 4LR2A 1WCMK 4BXXK 2ZFZA 4XSXA 1HQMA 1TWFK 1UV7A 3OREA 5C4JC 2R93C 1ZQ1C 4J3NA 2NVYC 3GTGA 2W7VA 3HOUC 1I3QK 5C3EK 3GTMA 1K83K 3RZDK 2PMZL 3HOZK 2Y0SL 4DDQA 4YFNA 5JVOA 2R7ZC 3NUHA 1EFWA 2WAQL 1BGWA 2GAHC 2WB1D 3M4OC 4MEXA 3S2DK 3OEPA 1VRQC 3PO2C 2JA5C 1BJTA 5HL8A 5IYCK 3H0GC 1TWFC 1XXCA 4ILDA 1IW7A 4QJVA 3S17C 1DCPA 4C45A 4KN7A 3S1MK 1C0AA 1ISEA 3HOVK 3Q3QA 5TJ3A 4G0UA 1TWGA 1R9TA 1DCOA 4MEYA 1WSVA 4Y52C 4OIPA 4AYBD 2E2JC 3TFJA 2PMZD 4GTBA 1VH2A 5FLMK 1EK8A 3GTGC 1XXAA 1GE9A 3S14K 3GTLK 1I50A 2A6EA 1ZBSA 2A6HA 1VLOA 4BLAA 3I4NK 3GTOA 4LK0A 2JA5A 3LAJA 4A3DK 1I50C 1TWGK 4A3FK 2BE5A 3GIRA 1XZPB 2XCRB 4G7OA 1JOEA 3GTQK 5IYDC 4GFQA 4KN4A 4AH6A 4A3LC 2EBBA 3N0BA 3BP3A 3ADAC 3S1NK 3HKZL 3H3VL 4BY1K 1R9TC 3CQZA 1B4AA 3ERED 2Y3PA 3S15K 3HKZD 3H3VD 1Y1WC 4BBSK 1I50K 3G4CA 1INNA 4Q4ZA 4QIWL 1PJ7A 2GSNA 1WCMA 3GEIA 1WQGA 4Y7NC 2NVTC 4YFKA 1O2BA 4A3MK 4LOWA 4GTCA 1USOA 4ZH4A 2B63A 2CFAA 2GAGC 2A68A 4YFXA 2XCQA 3AQOA 4A3GC 2CW0A 3K7AK 4BLBA 5C44K 1BS2A 2JA8K 3LAPA 2E2IK 1TWCK 4KMHA 2GSOA 2E2HK 1ZYRA 2NVTK 4A3MC 2XCOA 4LK1A 4XSZA 3GTJK 4A3JK 1Y1VA 5JFEA 2WB1L 5C4JK 2R93K 4A3IC 3GDZA 2O5IA 5E68A 1F9NA 5CJ9A 1I6HC 1YX2A 1TWHA 3S2HC 2R92K 1XZQB 3SZYA 2JA6C 4G7ZA 3OPFA 3AH5A 2JA6A 5IYDK 1O24A 3BUEA 1I6VA 3GTQC 2NVXC 5C4XC 1WOPA 4C3HK 4BKWA 3I4MC 3FOEA 3S1MC 4A3KK 4A3DC 2R93A 3H0GA 2JH3A 3H0GK 4OIRA 4WJ3M 2D6FC 3I4MK 1WOOA 4A3EC 5M5YK 3RZOK 1IS1A 1TWAK 2PHCB 1IL2A 3PO3C 2VUMA 3GTGK 3S1RC 5FLMC 5IORA 2NVQC 3AQPA 2ZUFA 1SMYA 3V4GA 4OIOA 2JA6K 5M3FK 2E2HC 3S1QC 3GTPA 1JVIA 2JA7K 3GTMC 4FZBA 4Y52K 1J6VA 2YU9C 4C3JC 3S2HK 5IYBK 4KB4A 2PA8D 3HOUK 3T01A 2V6SA 1F93A 4BY7K 2NVQK 4KB2A 1EI6A 1J98A 1O29A 3G4AA 3PO2K 3GTOC 5IYCC 4GTEA 4X6AK 5M5WK 3HXAA 3GTMK 1Y1WK 3GTQA 1EH1A 4AYBL 4A3GK 1YNJA 2JA7A 4G0VA 4QJVB 3S15C 5CHPA 3RZDC 4KASA 5IP7C 1VGXA 1J6WA 2Y0SD 4BY1C 1G51A 1XPPA 5IOQA 4BBRK 4KARA 3PO3K 3N3YA 4WILA 2B63K 3TFHA 1TWAC 1J6XA 4BXXC 4KDDA 1ZXOA 1SFOK 1WOSA 4KAWX 4LJZA 4BBSC 4P5AA 3AD7C 2P8TA 3TTGA 3AD9C 1Y1WA 3BP8C 1RU0A 3FKIK 1O2FB 4C3IK 2R7ZA 3HOXC 5TMCA
chains in the Genus database with same CATH topology
1WQFA 4GTFA 1TWHA 1BJTA 4KM8A 4C2MC 1O25A 1O26A 1XXCA 4ILDA 4KMDA 1ISEA 4GT9A 3Q3QA 5TJ3A 3OPFA 1SFOA 4G0UA 3AH5A 1TWGA 2CFAB 2JA6A 1R9TA 2NVYA 1O24A 3BUEA 4KMAA 1KQ4A 4KATA 3FKIA 4BKWA 4GTBA 3GTKA 3FOEA 4FM9A 2R93A 1O2AA 4KM9A 4GTAA 3H0GA 2JH3A 1EK8A 1XXAA 3CAGA 1GE9A 3FOFA 1I50A 1ZBSA 2RGRA 4BLAA 2YU9A 1IS1A 2PHCB 4M1XA 1I3QA 3L4KA 1WQHA 2VUMA 4GTLA 3GTJA 3GTOA 5IORA 1TWCA 4LQYA 5EGEA 3AQPA 3LAJA 2E2HA 2JA5A 2KWAA 3V4GA 3GTPA 1AB4A 3N0CA 4C3IC 2XCRB 4GTDA 1O27A 4FZBA 3S0XA 1XXBA 4GFQA 4C3JC 3GTLA 4KB4A 3VA7A 3L4JA 3N0BA 1TWFA 2P5MA 1DD5A 3LPXA 4KB2A 3CQZA 1O29A 1B4AA 3QX3A 3ERED 2Y3PA 3G4AA 2R92A 4P5BA 4GTEA 3G4CA 2E2IA 4C3HC 3FHZA 2RH6A 2GSNA 1WCMA 3GTQA 1WQGA 4KC6A 1EH1A 4G0WA 5EGHA 4LR2A 4G0VA 2JA7A 1B4BA 1ZVUA 5CHPA 2ZFZA 1O2BA 5IOSA 3MMLB 4KASA 3OREA 4GTCA 2GSUA 2B63A 5IOQA 2CFAA 4KARA 4J3NA 2XCQA 3AQOA 3GTGA 3N3YA 4BLBA 1TWAA 3GTMA 3LAPA 4KMHA 2GSOA 4KDDA 1ZXOA 2XCOA 4KAWX 4P5AA 1Y1VA 4DDQA 1K83A 5JFEA 5JVOA 2NVXA 1Y1WA 1WIHA 3NUHA 1F9NA 5CJ9A 1BGWA 2R7ZA 1O28A 5IOTA 3OEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTF A;  5IOQ A;  2CFA A;  4KAR A;  1O25 A;  1O26 A;  1O29 A;  3N3Y A;  3G4A A;  4P5B A;  4GTE A;  4GTL A;  4GT9 A;  3G4C A;  5IOR A;  3AH5 A;  2CFA B;  1O24 A;  4P5A A;  5JFE A;  3N0C A;  1KQ4 A;  4KAT A;  4GTD A;  1O27 A;  4FZB A;  4GTB A;  5CHP A;  1O2B A;  5IOS A;  1O28 A;  4KAS A;  1O2A A;  5IOT A;  4GTA A;  3N0B A;  4GTC A; 
#chains in the Genus database with same CATH topology
 4GTF A;  1TWC C;  4C2M C;  4KMD A;  4WJ4 A;  1IBA A;  3DXJ A;  4GT9 A;  5D4D A;  4JK1 A;  2NVY A;  1YNN A;  4KMA A;  4KAT A;  4O2D A;  3GTK A;  4A3J C;  1SFO C;  1I6H K;  3M4O K;  1WOR A;  1O2A A;  4GTA A;  2R7Z K;  4A3I K;  3CAG A;  3A8J A;  2RGR A;  2YU9 A;  2YU9 K;  5IYB C;  4P9S A;  2E2J K;  1I3Q A;  1JQW A;  4M1X A;  3L4K A;  4XLP A;  3IPJ A;  4C2M K;  2JA7 C;  1TWC A;  4LQY A;  4PAB A;  5EGE A;  4OIN A;  3GTP C;  3S1N C;  2E2H A;  2KWA A;  1XZP A;  2PPB A;  4Y7N K;  4C3I C;  3S16 K;  3S1R K;  1IE0 A;  5M5X K;  3S0X A;  4A93 C;  3RZO C;  3GTL A;  3VA7 A;  2WAQ D;  1TWF A;  2P5M A;  4A93 K;  3A8K A;  3GEE A;  4A3K C;  3QX3 A;  3S16 C;  2R92 A;  4XLN A;  3HOZ C;  3AD8 C;  2FQT A;  4C3J K;  5C4X K;  4C3H C;  3A8I A;  1R9T K;  5IP7 K;  2RH6 A;  1PJ6 A;  1I3Q C;  3HOY K;  5IP9 K;  4XCH A;  4G0W A;  5EGH A;  4A3L K;  2A69 A;  1B4B A;  1ZVU A;  3HOW K;  1TWG C;  4A3F C;  5IOS A;  3GEH A;  3MML B;  2O5J A;  1IQ0 A;  4A3B K;  2GSU A;  4A3E K;  2PA8 L;  3T02 A;  3HOV C;  3GTK C;  4QIW D;  3WOD A;  3GTL C;  1TWA A;  3S17 K;  1TWH K;  4A3B C;  3SZZ A;  4GZY A;  2JA5 K;  3GSI A;  3S2D C;  5TMF A;  1HI9 A;  1K83 A;  3JST A;  2NVX K;  2NVX A;  4PAA A;  2JA8 C;  1WIH A;  1YCL A;  3K7A C;  1O28 A;  5IOT A;  1WQF A;  3M3Y C;  4KM8 A;  3FKI C;  5M3M K;  1O25 A;  1EQR A;  1O26 A;  5C3E C;  4LLG A;  4A3C K;  1Y1V K;  2NVY K;  1XZQ A;  1PJ5 A;  4YG2 A;  1SFO A;  4G7H A;  1F7U A;  2CFA B;  3GTO K;  1X31 C;  2V6T A;  4OIQ A;  1KQ4 A;  4Q5S A;  1Y1V C;  4BY7 C;  3FKI A;  3GTJ C;  2FQO A;  4A3C C;  3GTP K;  4BBR C;  4FM9 A;  2V6U A;  4KM9 A;  1V5V A;  5C44 C;  1WSR A;  4NOI A;  3FOF A;  3HOX K;  2B63 C;  3S1Q K;  1K83 C;  5L46 A;  1BDF A;  1WQH A;  4GTL A;  3GTJ A;  3T00 A;  2R92 C;  1TWH C;  2VUM C;  1WCM C;  1AB4 A;  3N0C A;  4GTD A;  1O27 A;  1XXB A;  1VJE A;  3I4N C;  4RMF A;  3M3Y K;  3L4J A;  1DCH A;  3S14 C;  3CQZ C;  2VUM K;  2ZUE A;  3HOY C;  4MQ9 A;  1DD5 A;  2E2I C;  3LPX A;  3HOW C;  4P5B A;  5IP9 C;  3CQZ K;  1L0W A;  3TFI A;  2E2I A;  3FHZ A;  5FJ8 K;  3EQL A;  4KC6 A;  4KMU A;  1F7V A;  4X6A C;  1USM A;  3GTK K;  4LR2 A;  1WCM K;  4BXX K;  2ZFZ A;  4XSX A;  1HQM A;  1TWF K;  1UV7 A;  3ORE A;  5C4J C;  2R93 C;  1ZQ1 C;  4J3N A;  2NVY C;  3GTG A;  2W7V A;  3HOU C;  1I3Q K;  5C3E K;  3GTM A;  1K83 K;  3RZD K;  2PMZ L;  3HOZ K;  2Y0S L;  4DDQ A;  4YFN A;  5JVO A;  2R7Z C;  3NUH A;  1EFW A;  2WAQ L;  1BGW A;  2GAH C;  2WB1 D;  3M4O C;  4MEX A;  3S2D K;  3OEP A;  1VRQ C;  3PO2 C;  2JA5 C;  1BJT A;  5HL8 A;  5IYC K;  3H0G C;  1TWF C;  1XXC A;  4ILD A;  1IW7 A;  4QJV A;  3S17 C;  1DCP A;  4C45 A;  4KN7 A;  3S1M K;  1C0A A;  1ISE A;  3HOV K;  3Q3Q A;  5TJ3 A;  4G0U A;  1TWG A;  1R9T A;  1DCO A;  4MEY A;  1WSV A;  4Y52 C;  4OIP A;  4AYB D;  2E2J C;  3TFJ A;  2PMZ D;  4GTB A;  1VH2 A;  5FLM K;  1EK8 A;  3GTG C;  1XXA A;  1GE9 A;  3S14 K;  3GTL K;  1I50 A;  2A6E A;  1ZBS A;  2A6H A;  1VLO A;  4BLA A;  3I4N K;  3GTO A;  4LK0 A;  2JA5 A;  3LAJ A;  4A3D K;  1I50 C;  1TWG K;  4A3F K;  2BE5 A;  3GIR A;  1XZP B;  2XCR B;  4G7O A;  1JOE A;  3GTQ K;  5IYD C;  4GFQ A;  4KN4 A;  4AH6 A;  4A3L C;  2EBB A;  3N0B A;  3BP3 A;  3ADA C;  3S1N K;  3HKZ L;  3H3V L;  4BY1 K;  1R9T C;  3CQZ A;  1B4A A;  3ERE D;  2Y3P A;  3S15 K;  3HKZ D;  3H3V D;  1Y1W C;  4BBS K;  1I50 K;  3G4C A;  1INN A;  4Q4Z A;  4QIW L;  1PJ7 A;  2GSN A;  1WCM A;  3GEI A;  1WQG A;  4Y7N C;  2NVT C;  4YFK A;  1O2B A;  4A3M K;  4LOW A;  4GTC A;  1USO A;  4ZH4 A;  2B63 A;  2CFA A;  2GAG C;  2A68 A;  4YFX A;  2XCQ A;  3AQO A;  4A3G C;  2CW0 A;  3K7A K;  4BLB A;  5C44 K;  1BS2 A;  2JA8 K;  3LAP A;  2E2I K;  1TWC K;  4KMH A;  2GSO A;  2E2H K;  1ZYR A;  2NVT K;  4A3M C;  2XCO A;  4LK1 A;  4XSZ A;  3GTJ K;  4A3J K;  1Y1V A;  5JFE A;  2WB1 L;  5C4J K;  2R93 K;  4A3I C;  3GDZ A;  2O5I A;  5E68 A;  1F9N A;  5CJ9 A;  1I6H C;  1YX2 A;  1TWH A;  3S2H C;  2R92 K;  1XZQ B;  3SZY A;  2JA6 C;  4G7Z A;  3OPF A;  3AH5 A;  2JA6 A;  5IYD K;  1O24 A;  3BUE A;  1I6V A;  3GTQ C;  2NVX C;  5C4X C;  1WOP A;  4C3H K;  4BKW A;  3I4M C;  3FOE A;  3S1M C;  4A3K K;  4A3D C;  2R93 A;  3H0G A;  2JH3 A;  3H0G K;  4OIR A;  4WJ3 M;  2D6F C;  3I4M K;  1WOO A;  4A3E C;  5M5Y K;  3RZO K;  1IS1 A;  1TWA K;  2PHC B;  1IL2 A;  3PO3 C;  2VUM A;  3GTG K;  3S1R C;  5FLM C;  5IOR A;  2NVQ C;  3AQP A;  2ZUF A;  1SMY A;  3V4G A;  4OIO A;  2JA6 K;  5M3F K;  2E2H C;  3S1Q C;  3GTP A;  1JVI A;  2JA7 K;  3GTM C;  4FZB A;  4Y52 K;  1J6V A;  2YU9 C;  4C3J C;  3S2H K;  5IYB K;  4KB4 A;  2PA8 D;  3HOU K;  3T01 A;  2V6S A;  1F93 A;  4BY7 K;  2NVQ K;  4KB2 A;  1EI6 A;  1J98 A;  1O29 A;  3G4A A;  3PO2 K;  3GTO C;  5IYC C;  4GTE A;  4X6A K;  5M5W K;  3HXA A;  3GTM K;  1Y1W K;  3GTQ A;  1EH1 A;  4AYB L;  4A3G K;  1YNJ A;  2JA7 A;  4G0V A;  4QJV B;  3S15 C;  5CHP A;  3RZD C;  4KAS A;  5IP7 C;  1VGX A;  1J6W A;  2Y0S D;  4BY1 C;  1G51 A;  1XPP A;  5IOQ A;  4BBR K;  4KAR A;  3PO3 K;  3N3Y A;  4WIL A;  2B63 K;  3TFH A;  1TWA C;  1J6X A;  4BXX C;  4KDD A;  1ZXO A;  1SFO K;  1WOS A;  4KAW X;  4LJZ A;  4BBS C;  4P5A A;  3AD7 C;  2P8T A;  3TTG A;  3AD9 C;  1Y1W A;  3BP8 C;  1RU0 A;  3FKI K;  1O2F B;  4C3I K;  2R7Z A;  3HOX C;  5TMC A; 
#chains in the Genus database with same CATH homology
 1WQF A;  4GTF A;  1TWH A;  1BJT A;  4KM8 A;  4C2M C;  1O25 A;  1O26 A;  1XXC A;  4ILD A;  4KMD A;  1ISE A;  4GT9 A;  3Q3Q A;  5TJ3 A;  3OPF A;  1SFO A;  4G0U A;  3AH5 A;  1TWG A;  2CFA B;  2JA6 A;  1R9T A;  2NVY A;  1O24 A;  3BUE A;  4KMA A;  1KQ4 A;  4KAT A;  3FKI A;  4BKW A;  4GTB A;  3GTK A;  3FOE A;  4FM9 A;  2R93 A;  1O2A A;  4KM9 A;  4GTA A;  3H0G A;  2JH3 A;  1EK8 A;  1XXA A;  3CAG A;  1GE9 A;  3FOF A;  1I50 A;  1ZBS A;  2RGR A;  4BLA A;  2YU9 A;  1IS1 A;  2PHC B;  4M1X A;  1I3Q A;  3L4K A;  1WQH A;  2VUM A;  4GTL A;  3GTJ A;  3GTO A;  5IOR A;  1TWC A;  4LQY A;  5EGE A;  3AQP A;  3LAJ A;  2E2H A;  2JA5 A;  2KWA A;  3V4G A;  3GTP A;  1AB4 A;  3N0C A;  4C3I C;  2XCR B;  4GTD A;  1O27 A;  4FZB A;  3S0X A;  1XXB A;  4GFQ A;  4C3J C;  3GTL A;  4KB4 A;  3VA7 A;  3L4J A;  3N0B A;  1TWF A;  2P5M A;  1DD5 A;  3LPX A;  4KB2 A;  3CQZ A;  1O29 A;  1B4A A;  3QX3 A;  3ERE D;  2Y3P A;  3G4A A;  2R92 A;  4P5B A;  4GTE A;  3G4C A;  2E2I A;  4C3H C;  3FHZ A;  2RH6 A;  2GSN A;  1WCM A;  3GTQ A;  1WQG A;  4KC6 A;  1EH1 A;  4G0W A;  5EGH A;  4LR2 A;  4G0V A;  2JA7 A;  1B4B A;  1ZVU A;  5CHP A;  2ZFZ A;  1O2B A;  5IOS A;  3MML B;  4KAS A;  3ORE A;  4GTC A;  2GSU A;  2B63 A;  5IOQ A;  2CFA A;  4KAR A;  4J3N A;  2XCQ A;  3AQO A;  3GTG A;  3N3Y A;  4BLB A;  1TWA A;  3GTM A;  3LAP A;  4KMH A;  2GSO A;  4KDD A;  1ZXO A;  2XCO A;  4KAW X;  4P5A A;  1Y1V A;  4DDQ A;  1K83 A;  5JFE A;  5JVO A;  2NVX A;  1Y1W A;  1WIH A;  3NUH A;  1F9N A;  5CJ9 A;  1BGW A;  2R7Z A;  1O28 A;  5IOT A;  3OEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...