5IP9G

Structure of rna polymerase ii-tfiif complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5ip9G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 5ip9G01
1CUKA 5GADC 5FLMH 3T1HQ 1HNXL 1YHQA 4BBSH 2WP8J 4JBWA 4AH6A 1MIUA 4R4IA 4JI0L 4DR5L 3S1NH 2RF4A 2F4VL 1VQMA 4UY8C 3U4VA 1KRTA 3GTMH 1SMXA 1IYJB 4DPGA 3CPWA 5C3EG 3CXCA 1XPRA 1HNWL 1KD1C 1X56A 2N3SA 3SGIA 1KQSA 1Y1VH 1W3SA 3I7FA 4GKJQ 4A3LG 2IHFA 2I5MX 3J80c 2DUDA 2Q2HA 1QUQB 2CQOA 2VQFQ 1XNRL 2D0OA 4HIOA 4LFAL 2JJQA 2IY5B 3PO2H 1V43A 3CF5A 1X55A 1C9OA 1Z9FA 4X66Q 1QVFA 1SR3A 5IY0A 2F3IA 1JB7A 1K73C 2KBNA 4OONA 3ULLA 1HR0Q 4UP7A 2VUMH 1A63A 3G71A 4AQYL 4JI4Q 2YTVA 1EOVA 1IBKL 4NXML 1FJGL 1Q46A 4C3HH 4A3GG 4GLXA 4A3KH 3RZDH 1OTCA 3PO3G 3AYHB 4APVA 4DR3L 4HJ7A 3CC4A 2A19A 3H0GG 3PSIA 1HNXQ 1BBWA 3CW2C 1AE2A 2UXDL 5GAGC 2PQAB 4H02A 1VQ6A 1AH9A 4QY7A 3S16H 1XMQL 1VQ9A 3LGJA 1X6OA 1L1OA 4PG3A 3M4PA 2FXQA 3K8AA 3KF6B 4WJ3M 3S1MH 2R92H 2N49A 3K7AH 3RN5A 1E3PA 3ULPA 3L0OA 4WJ4A 1UWVA 2UUCQ 4JI8Q 3D31A 3HOXG 1CKMA 5IP7H 2ZM6Q 1A8VA 2OCEA 1N8RC 3I4OA 1E22A 4OO1I 3I4MG 3HOWH 5IE8A 3HOUG 1EIYB 1MJCA 4LUZA 3TS0A 4LF4L 3RN2A 3M4QA 1EWIA 3KF8B 1JMCA 4A3IH 3KJOA 3K0XA 3NEMA 4JI2L 2BH2A 4DR7L 3OTOL 4JI7L 1K8AC 1KRSA 1E1OA 2K75A 1HNZQ 3S15H 1N36L 1GD7A 4DK3C 1FJGQ 2DGYA 2C35B 3TQYA 4ME3A 1K83H 2CWPA 4DR3Q 4A3EG 4DKAC 1PH7A 3IRBA 1HR0W 4BBSG 1N33L 3EN2A 1N32L 2R6GA 2Z0SA 3E9IA 5IWAL 1D8LA 5IWAQ 3F2DA 2OTJA 4EX5A 1FL0A 1VQEA 1VS0A 3CAMA 2VQEL 3S2HH 2OTLA 3HOYH 4A3FG 4LW1A 1KXLA 1X3EA 2KCMA 4POFA 3BZKA 1J6QA 3GTGH 3PUXA 1Y1WG 1M90C 4OO1G 1V1QA 2GVAA 4P75A 2AWNA 1SFOH 1WOCA 2RHQB 4GOPA 4A4IA 1UEBA 2K5HA 3W1BA 4YHHL 4GKJL 3HOYG 2KENA 4NPSA 4JI8L 3K80C 2E2IH 3M7NA 2VL6A 4LF6L 4C2MH 5HGQA 3U4ZA 2IT1A 4XTCS 4DNIA 4A3JG 1Q8KA 2YTYA 3ULJA 3T1HL 4A3KG 4JI0Q 3PO3H 4BXXH 2ZJPA 2ZJRA 4IO9A 3KDFB 4DR4L 3KF6A 4DUZL 2HQLA 4B3RQ 4JC0A 4DAMA 2VUMG 2K14A 1VQLA 1VQCA 2BA0A 4J15A 1XPOA 1WCMG 4JI4L 4NXNQ 4EQ5A 2Q2UA 3CQZH 2PQAA 3S1RH 3W1GA 3PO2G 1TWFH 5IT9c 3H15A 4JV5Q 4KHPQ 5M5WH 4PZ6A 3F8TA 5IP7G 5M3FG 1YIJA 1MJEA 3HOWG 1CSPA 4A3DH 4JOIA 4HJAA 4BY7G 4DV3L 3FP9A 3U50C 1S40A 1E7ZA 1ASYA 1OXVA 1WCMH 2YU9H 4DV2L 2IHEA 1LTLA 3HFZB 3STBD 5C3EH 3CCUA 1M1KC 2R92G 1VCIA 2LXKA 4YCWA 3F2CA 1HZAA 3PF5A 2WB1E 3H0GH 5DLQE 4MTNA 4BXXG 4GN5A 4X65Q 4DV0L 2XGTA 2Z6KC 4KI0A 4O2DA 1PH8A 2AKWB 2GN5A 4HJ5A 4X66L 4DR5Q 1FGUA 1VQJA 4GOPC 1YVCA 2B3GA 1X3GA 1XJVA 5JJLA 5LMNL 1CKOA 1K0RA 1Q82C 3CPFA 1XMOL 2E8GA 1YZ6A 3ICEA 1X54A 4R4CA 2PMZE 4LFCQ 2ZM6L 2ZJQA 1IL2A 4LUVA 2HHHQ 2OQKA 3CMAA 4YY3L 1N9WA 5BR8Q 1K3RA 3CD6A 2PI2E 4QIWE 3J81c 4JI3L 4OWXB 4GLVB 1Y1VG 1WYDA 3JAMi 4GS3A 4DV6Q 4TQUS 1V9PA 3VDYA 1Q1EA 2CFMA 2PNHA 2UU9Q 1HZCA 1KHIA 4JI1Q 4L5QA 2F52A 3PUZA 5JEAJ 3UE1A 5IP9H 2QA4A 4OWWB 2JA7H 4A93H 2ALYB 4GKKL 3CCEA 4HJ9A 2KHJA 3U58A 1HH2P 3T1YL 1VQKA 3ZJYC 1HZ9A 1TWHH 1PH3A 1HZBA 2E5LQ 5E7NA 1GVPA 2UUBQ 3CCQA 3GTQH 1Y14B 5IYCG 4AYBE 1IBML 1VQIA 3CC7A 5C0XG 3J7ZC 2K5VA 4DR1Q 4BY1H 4DV1L 2NVYH 4X62L 3PGZA 4A3IG 1XTDA 4DK6C 1EYGA 1YBYA 3AQQA 3PCOB 3S17H 2QEXA 1E1TA 1Q86C 3OW2A 1XPUA 4GNXB 4A75A 1VQNA 3GTJH 2KHIA 5ELOA 3CCJA 3CC2A 1N33Q 2A8VA 1YNXA 4YWKA 5GROA 1PH9A 1HNWQ 1P16A 2WB1G 4FDBA 5J3BA 4GOPB 3M3YH 4DV4L 3ER0A 3MXNB 2EXDA 3S14H 1NMGA 4LF7Q 4JBMA 3GTLH 2JA8H 4JI2Q 4UPAA 3CCLA 2LSSA 4IJLA 5LMNW 3T1YQ 2JA8G 2I5LX 3ERSX 5GAEC 3Q8DA 4A3CG 5C44G 1EUJA 3I2ZA 5M3FH 2R7DA 1J5EQ 5H1SE 5K36G 3KJPA 4UP9A 2CKZB 5C4JH 3HKZE 2N8NA 3A74A 3CCVA 4DV7L 2PI2A 4A76A 4YHHQ 2Y0SE 1PA6A 4LF6Q 4YWMA 1KL9A 3KFUA 2CCZA 4YCUA 1JJCB 2KCTA 5ELNA 1LM0A 4QL5A 3GO5A 3EBEA 3PUWA 5FJ8H 1Q7YC 2Q2TA 3KOJA 3K7UC 2HHHL 4QJFA 1B7YB 2K50A 3M85A 2I5HA 4A3MH 1D7QA 4R4TA 1WJJA 3JAMc 2RCNA 4YWLA 2YV5A 1OXSC 1TWGH 2UXDQ 2JA9A 4IJHA 3PIPA 3CCMA 1XNQL 1XMQQ 4OX9L 4GN3B 3RLFA 2VZAA 1PFSA 4X62Q 4DR6Q 2AMCB 1EIFA 3G48A 1G6PA 5C4XH 4NB3A 5GAHC 3DM3A 1DGSA 4DR1L 1IBKQ 4B3SQ 4R1JA 4LF7L 3GTKH 4A3LH 2QGQA 5IYDH 4ALPA 1YJNA 1BVSA 3TREA 4C3IH 1MKHA 3DLLA 2XTIA 2R93H 3KLWA 4X65L 2UXBQ 3JC66 2N78A 5M5YH 1HNZL 2B63H 5AJ3Q 1SRUA 4B3MQ 2E5LL 2ZTCA 1YI2A 2JA5H 1QUQA 2BA1A 2NZOA 3UDIA 3PF4A 2Q2IA 2JEBI 4A3FH 2K52A 3HOVH 3TS2A 3M4OH 4JI5L 4TVAB 2MO0A 5JJIA 4PMWA 3PUVA 3RLNA 4IOAA 5JEAG 1I3QH 2WAQE 3L2PA 2ID0A 3EIVA 1I94Q 1X9NA 2E2JH 2NVXH 4JI3Q 1PHJA 3I4MH 1VQDA 3A5ZB 4RG1A 4DV7Q 5BR8L 4IPGA 4A3EH 4XIGS 1UE6A 1CKNA 2MQHA 4YY3Q 4QQBX 1VQ7A 3RZOH 1I6HH 5IYCH 3UE0A 4IFDJ 1C0AA 3J81i 1YJ9A 4L5TA 1QVCA 2EIFA 2L15A 2RHSB 4HIMA 2HT1A 5JJKA 1PVOA 4DV6L 1CKNB 1OXUA 5FLMG 4JYAQ 3HKZG 1NY4A 1JJ2A 3CP0A 5C44H 1PYBA 2BH8A 2MO1A 4KLKA 1I50H 4A3CH 1VQ4A 2Z6KA 3J81j 4B3TQ 1X65A 4LF5Q 3NENA 3E9HA 4K0KL 2ASBA 4A3BH 1T9HA 4IOCA 1PH5A 3M9BA 1TWCH 3J7A5 3HOXH 3WWVA 2UUAQ 4DV1Q 2JEAI 2EQSA 1I94L 2CWAA 4JOIC 3PIOA 5FJ8G 4PZ8A 2JA6G 4DV3Q 4IFDG 3I4NH 4LNQA 1W2BA 2A1AA 4LUOA 2UUBL 3NBHB 3CCSA 5C0XI 1IBMQ 4JV5L 1NMFA 1IBLQ 1ASZA 1SLJA 1QZHA 3HOZG 1Q81C 5C4XG 2GVBA 4LFBL 3HOVG 4DV5Q 4JI6L 2B29A 1L1OC 4X64Q 3CMEA 4IFDI 1N34L 1VQHA 3RR5A 4BBRG 3I55A 3TRZA 1IXRA 1JJGA 3GD7A 1VQFA 4LF5L 3H3VI 4HIDA 4JYAL 5LMUL 1Z47A 4Y7NH 1Q1BA 4LF9L 1EQQA 3F2BA 3NELA 3GTOH 3H3VH 1G51A 1NTGA 2V1CC 3RLOA 2VY3A 3W5OA 4DUYQ 4HJ8A 3B6YA 1VQ8A 3KDFA 1KIXA 1SE8A 4P73A 4K0KQ 4IPDA 1QVGA 2R7FA 5M3MH 1R9TH 1YJWA 3S2DH 4DR2L 4C3JH 1TWAH 4GNXC 3BZCA 4JBKA 1BBUA 2IX0A 3BJUA 4L5RC 4PZ7A 1P8LA 3HKSA 2JE6I 2ZTEA 1S72A 4LF9Q 3I56A 2I0QA 5LMNQ 1SN8A 1I5FA 3AFQA 3UDGA 5IYDG 3RNUA 1SROA 4RMFA 1N34Q 4A3GH 4X64L 5C0XJ 2ZTDA 3FKIG 1KAWA 1NE3A 1VQAA 3AFPA 5AJ3L 1PV4A 1WFQA 4LFBQ 2UXBL 4IPHA 4JCVE 1PH4A 1WI5A 2UXCL 3CCRA 2YYZA 1CSQA 2JQOA 3G4SA 2D0PA 2MFIA 4DV2Q 4AQYQ 4L5SA 4DR6L 4JI5Q 2R7ZG 1HR0L 3OTOQ 4JI7Q 4R4QA 3BU2A 1VQBA 2UUAL 4DAYB 5FLXc 4LFAQ 4QGUA 2OWOA 1TXYA 2NVQH 1A0IA 1G291 1U5KA 4AYBG 1BKBA 1HJPA 3FHWA 1NJIC 4B3ML 4X6AH 1VQPA 2R93G 4Y52H 1IZ6A 1U0LA 1OXXK 4O0AA 4KHZA 4P74A 4AIMA 2NVTH 2UXCQ 2NN6G 1PH2A 1PYSB 1O7IA 4OXPA 4DR7Q 3PUYA 4B3RL 4JBJA 4LF8Q 4GLAC 5IP9G 2JA7G 2OQ0A 3A0JA 2NN6I 3D0FA 3GTPH 1H95A 3UDXA 4A3MG 2AHOB 4BBRH 2B63G 3A5UA 2WFWA 3STBC 4BA2I 2VNUD 1FVIA 1Y1WH 4LF4Q 2K4KA 4LWCA 1VQGA 3UDFA 4R4OA 3AEVA 1B70B 1L2FA 2IX1A 3KYHC 1L0WA 4P71A 4DV4Q 4LF8L 1EFWA 2ES2A 4NXMQ 2UUCL 3HOZH 3E0EA 4A93G 1GO3E 3S24A 1RIPA 4BA1I 1YEZA 5M3MG 2D62A 4MNOA 4P72A 3J80i 1LUZA 3L7ZC 4LFCL 1VQ5A 1J5EL 1PH6A 5M5XH 2H5XA 3F1ZA 2Y0SG 4JG2A 5LMUQ 3PV0A 3K81C 2JA5G 2VQEQ 5IYBH 1N32Q 3GDEA 1XMOQ 2VS1A 2YTXA 5HY6A 1OXTA 1UE7A 3OYYA 4JI6Q 1LYLA 2JK8A 5EAYA 1RL2A 1UE5A 2E2HH 1UE1A 4A3BG 1Q12A 4A3JH 1IBLL 2ATWA 2NZHA 3FKIH 4B3SL 4DV5L 4HIKA 1N36Q 4DV0Q 2HIXA 2MNAA 4MZ9A 1K9MC 1AE3A 1B8AA 1JT8A 4BY7H 4OX9Q 2F4VQ 1S3OA 1X3FA 4OWTB 5IYBG 3TEHB 1XNQQ 2JA6H 1YHAA 2WAQG 5GQOA 1JE5A 4UP8A 1NBWA 3I4NG 4GN4B 2AWOA 4BY1G 1L1OB 2UU9L 2VQFL 1PH1A 1C7YA 1EQRA 1XNRQ 4GKKQ 2R7ZH 4KHPL 2LXJA 2K5NA 4JI1L 4IPCA 4DR2Q 1E24A 1GM5A 1K8GA 2HIVA 2VW9A 3S1QH 1GKHA 3HOUH 4A3DG 4B3TL 4GNXA 1YHBA 1A62A 4YCVA 1KC8C 1QZGA 4DUZQ 4DUYL 1VQOA 4NXNL 3MEFA 1YITA 4DR4Q 4POGA 3G6EA
chains in the Genus database with same CATH superfamily
1HQMC 1ZXTA 3ETHA 3OSNA 4S3SA 1HPCA 1V1PB 2FMCA 2WP8J 4KJOA 5I6YA 1BF4A 4KTAA 1CS0A 4R4IA 4JI0L 3MEHA 1ZYRC 2RF4A 3S1NH 1E4GT 2F4VL 1VQMA 4UY8C 3U4VA 1KRTA 2Y0SA 3GTQA 3CPWA 3OUUA 2QF7A 3K5LA 4L63B 2W6PA 1KD1C 4MA5A 2HDMA 2N3SA 4K0KH 2A6EC 1K28A 1JX4A 2DUDA 4Q8FA 2AQ3B 3GQBA 2AQ1B 4PMCA 1XX8A 1YNND 4NDXA 2VQFQ 4N8X1 4LFAL 2WDTA 1L0YB 3PO2H 3CF5A 1X55A 3FDTA 1Z9FA 4PMBA 2X6GA 3RV3A 2W9CB 1GUSA 3NUCA 2KBNA 1TS2A 4OONA 2FPPB 2R8IA 1A63A 1VMCA 5KFAA 3R5HA 1RK6A 5EWEA 3S14B 4KKUA 4LFBH 1FJGL 1LTRD 1Q46A 5I2XA 2R3ZA 5KG2A 4A3KH 3K3VA 3AYHB 4FU0A 2A19A 5D1OB 3PSIA 4HCSA 1WTOA 1AE2A 3SE7A 2A69D 2PQAB 5GAGC 1BNCA 3N42B 5G3LD 4QWAA 2Z4IA 1XMQL 3J81L 3KF6B 1LTBD 2R92H 2XWJB 4A3JB 3JSLA 3ORQA 1EWCA 1HQRD 2BQ3A 1MD2D 1L0XB 3HOXG 1PFMA 4OO1I 1ZETA 3I4MG 1B9MA 2O2LD 5CR3A 2Z1CA 5L1JA 1MJCA 4OEMB 3TS0A 1E2ZA 2HVQA 2F0JA 2YW2A 3NTKA 3KJOA 4JI2L 2BH2A 1SMYD 5EKLA 3OTOL 3S9WA 1LT4D 1HNZQ 4A3BB 3A8JE 2EYLA 3EYYA 4MV7A 1N36L 2N55A 2BCOA 3DWQA 3M4YA 2B2YC 4A3EG 1K83H 4RGTA 4BBSG 4XX0B 3IRBA 3LWEA 3UI2A 2R6GA 2Z0SA 5C4XB 1D8LA 5C4HA 3T5JA 1JDBB 4R8UA 4E6IA 4K2LA 3RFCA 3J80W 5BN5A 2VQEL 3S2HH 2KEDA 1K8OA 3V6HA 1IYVA 1C8CA 5FLXW 1JR0D 3I8ZA 5J22A 3K6OA 4A93B 3JZIA 3BZKA 3MXGA 2QILA 2K33A 1ET9A 1SNDA 1Y1WG 4RAYA 1JB3A 4B3RH 3TIIA 1SFOH 4CDCC 2RHQB 1BNZA 1I6HB 3GV3A 4C1NI 1J8IA 3KHRA 3P1HA 1EZ8A 4HSVA 4GKJL 3ERQA 2KENA 4DAPA 2XRQD 4JI8L 1GXDC 1KJ9A 2VL6A 5JJZA 5HGQA 3U4ZA 4XTCS 5KFEA 2IA6A 3T1HL 4F7XA 4C3HG 2F0FA 3MWMA 4B9WA 1CTMA 1BCPB 2ZJRA 1WTWA 2K5WA 2WE6A 5J2UF 3L9AX 4JC0A 2GPWA 3GTKA 3E6ZX 4L6TB 1XPOA 4I50F 1Z6HA 3CRKC 2UVRA 2Q2UA 1TS4A 3S1RH 1TWFH 3H15A 2EYPA 1TY0A 3F8TA 3P7JA 1DOLA 5JEAH 2FPIB 5IP7G 5C1PA 5C3WA 4DK0A 1CSPA 1WD0A 3P75A 4BY7G 4MV6A 3MR5A 4HN7A 1ASYA 3M4IA 1OXVA 5LP6F 2EY2A 1M4VA 2UUCH 3S2DB 5KG0A 2IHEA 4RZRA 3KXYT 3CCUA 1M1KC 2R92G 2LXKA 3EPGA 1IW7C 1HZAA 1PTOF 2BOSA 1ET6A 2KJXA 4BXXG 1ZEQX 4DV0L 5JVLA 2XGTA 2Z6KC 4LH6A 5M9OA 4HJ5A 4MTEA 5EWGA 1VQJA 3IKJA 5FLXL 1PLFA 2BQRA 4DXGA 3O13A 1GHJA 1STYA 5LMNL 4KN7C 4G3IA 3TZUA 1EIGA 1X54A 1JC7A 1LT6D 4LUVA 3VPBA 2ZDQA 2OQKA 1J9OA 4B3MH 2NWGA 3CD6A 5C5JA 2PI2E 3PW7A 1KNAA 2YRXA 2A6HD 4ECYA 4GLVB 2UVWA 1WYDA 3JAMi 1X32A 2CFMA 3W2DA 2PNHA 3C1FA 3SR1A 1GGOA 2QA4A 3MHBA 4A93H 4EBDA 1Y8NB 2KUMA 3MWYW 4IR1A 5KG3A 2FFKB 2WIIB 1T5EA 5LA6F 4N9TA 2KVMA 1JWSD 1HH2P 3K58A 2L4NA 2F0EA 4JI4H 5KEEA 4TSSA 3SI8A 3Q22A 1RHPA 2KCCA 3GTKB 1GVPA 2UUBQ 3GTQH 4FS1A 1I7NA 5IYCG 4AYBE 1FKAH 3S1QB 3CC7A 1OWTA 5C0XG 4HR7A 2FLPA 3Q8PB 4B3SH 1W93A 1CK1A 4X62L 4A3IG 5CV9A 3OSPA 1I7LA 2R85A 3PCOB 1BCPC 2RGRA 1XPUA 1CA5A 1VQNA 5JOBA 1N33Q 4G4KA 4O3QA 1PH9A 1P16A 1SJED 4FDBA 3RJ0A 1K0SA 5CORA 3ER0A 4N8FA 4HNVA 2LSSA 4IJLA 5LMNW 4KK7A 3NP8A 4A3CG 1NNXA 3RUZA 1J5EQ 5H1SE 4EQOA 3KJPA 2B63B 4J9LA 3HKZE 3CCVA 1PA6A 2PI2A 4ZYSA 5DLGA 2NUAB 1GYFA 2CCZA 4DAVA 4NKLA 4NXNH 1JJCB 4EG0A 1LM0A 4QL5A 3N41B 4C5BA 3PUWA 5I4DA 5CB4F 4QJFA 3JRXA 4F88A 3M85A 1LACA 2RA4A 4FBUA 4UHVA 1HNWH 1CZGA 2E5LH 3SE0A 1KABA 1OXSC 1TWGH 1ML0D 1WTPA 1TVXA 2XC9A 3AMUA 4ECWA 1ENAA 5A2QW 4DR6Q 5IT9L 1GHKA 5C4XH 3GTKH 1IBKQ 4LF7L 3S1MB 5K36G 1YJNA 4F87A 3TREA 2XTIA 1ICFB 3KLWA 2RCFA 4IUVA 3IFDA 3JC66 2UXBQ 2SNMA 3K5IA 3OHAA 1QB5D 2ZTCA 4DNTB 4Q0FA 1Y1WA 5C6AA 2WTFA 2PZWA 1QUQA 3JAME 2ENBA 3NSWA 2JEBI 5BN4A 3GTLB 5LMUH 2MO0A 3RLNA 4IOAA 3M3YB 1TA8A 3L2PA 2ID0A 2E2JH 3I4MH 2TMPA 3A5ZB 2KA7A 4DV7Q 5M5WB 3BQ0A 5EPKA 1CKNA 2MQHA 1I6HH 2ASLA 5IYCH 4IFDJ 2IP4A 4IURA 2E2HB 4L5TA 1PTOB 5JJKA 4MTDA 2W9CA 3MA2B 5F2DA 3MTSA 4CDDC 4JYAQ 3HKZG 1JJ2A 1S0MA 4TKOB 1UAPA 1WTQA 5C44H 2BH8A 3NTHA 3OOCA 2F0QA 1I50H 3PN1A 3PW2A 2Z6KA 4NW2A 2J6SA 3E9HA 4O4IF 3NTIA 2ASBA 4UFZA 1STHA 1T9HA 4IOCA 4Y8VB 3M9BA 3J7A5 1O7ZA 4DV1Q 2EQSA 1S5BD 1B04A 2FKLA 1I94L 4YAJB 1RJTA 1GSOA 5FJ8G 2JA6G 3PIP3 4TQSA 2PZUA 2JA5B 4F4ZA 4JV2A 4LUOA 4EGVA 2V5AA 4FNFA 3CCSA 5C0XI 1IBMQ 3RGXA 1SSOA 2J6UA 4JV5L 4FP5D 1QZHA 2R92A 4LFBL 2N88A 2YRWA 1L1OC 4JV5H 2EE1A 2HCCA 2YCHA 2KQ3A 4J6HA 2F0PA 3I55A 2FP4B 1IXRA 1G8ZD 1S5ED 2NVXB 1GLVA 3KAJA 1SE2A 4HIDA 1Z47A 5KFXA 3MZ5A 1TWGB 2DJGC 3K5MA 2V1CC 3RLOA 2GLTA 2KOLA 2DZDA 4RHSA 1WTXA 1BDOA 2R7FA 3N52A 1R9TH 1KEEA 1TIID 4DL4A 1BBUA 1F2YA 3Q1KA 2JYOA 3BJUA 4RUCA 4LF9H 1EL0A 3HKSA 5J39A 2EYHA 2VQDA 4LF9Q 2NVQB 5KYIA 4MTKA 1TWFA 1HR0H 4X64H 2FE3A 1RTOA 4RMFA 1A3VA 3QB3A 2W57A 3NBIA 5C0XJ 3AFPA 1DOKA 1KAWA 4KY7A 3NGDA 5COYA 1WFQA 3JAML 4N9PA 2YZMA 1WTHA 4JCVE 1STNA 1TY2A 2B8FA 4J9NA 1PH4A 2F0NA 3T5HA 1WI5A 4O4LF 2YYZA 1CSQA 2JQOA 5KFSA 1LTGD 4DV2Q 4L5SA 5L1KA 3I90A 3V6JA 3W3AA 4RAUC 4KKSA 5CV7A 1PFNA 1VQBA 2UUAL 3V2TA 1C48A 1TXYA 2A6ED 4QUCA 1U5KA 2V58A 2NTSA 1BKBA 3FHWA 4B3ML 2PMZA 3T1HH 5A35A 2V4RA 1KDBA 4ED6A 4P74A 4KHZA 3I4MB 2VA3A 2NN6G 4JV1A 4DR7Q 4OXPA 3Q23A 4LF8Q 3HKZB 3NPPA 4RNMA 3FPUB 1LTTD 1SE4A 3F2UA 3GTPH 1PYWD 1H95A 2W9BB 4BBRH 4LSXA 2K28A 3I91A 3RZOB 1FVIA 3R8BA 1Y1WH 4DN4M 2CZGA 4LWCA 1VQGA 4LF5H 1XWEA 3GV5B 4FYDA 1WVLA 4LF8L 4O3PA 3ONAB 2UUCL 3E0EA 1GO3E 1HA6A 3RD4A 4BA1I 5M3MG 1T36A 2D62A 1PRTD 2XD4A 1LUZA 3L7ZC 2LFNA 1PH6A 1QWYA 2H5XA 3D4DA 2Y0SG 1XNRH 4JI2H 1D1KA 5I9OA 2G5DA 5IYBH 5E1FA 2H4OA 1MGSA 2VS1A 2AQ2B 2PQEA 1OXTA 4MV4A 2FINB 3OYYA 1UE5A 3KLSA 5IODA 4J9OA 1IBLL 1N33H 1WD1A 3FKIH 3FRPB 4B3SL 3R23A 1AE3A 4OX9Q 1H9MA 3H3VC 3V6KA 5KFRA 1LTSD 1E2VA 2J4XA 2WAQG 1NBWA 4M8AA 2W6OA 3BDLA 1L1OB 4J8QA 1EQRA 2WINB 2L5TA 1TWCB 2LKVA 2ASDA 4ME5A 4A3DG 4B3TL 4LFCH 1G6ZA 1QNKA 1S03G 4J9QA 4ZUJA 4DUYL 1VQOA 4F50A 3MEFA 2W9AA 4G7ZC 2EZVA 5FO7B 4POGA 5KG7A 2VOBA 4R7RA 2E2HA 2F0DA 2M2LA 3T13A 1ILPA 4LF4H 1EQTA 2K05A 1HNXL 1HFNA 4BBSH 1E4EB 4JBWA 3GIMA 4CBVA 2WB1B 4AH6A 2WACA 4LFAH 3I73A 4DR5L 2CHBD 4WD3A 5IT9W 1JICA 1K3BC 4MIUA 1XNQH 3GTMH 1IYJB 4DPGA 4DV5H 4J9PA 2DNEA 4JPBW 3SGIA 2NN6H 2AUKA 1W3SA 2R6FA 2I5MX 1BO0A 4DR4H 1GSHA 3SHLA 3QOLA 1QUQB 2CQOA 2D0OA 1Y1WB 3KAKA 2IY5B 2VQEH 4BBRB 4ZKBB 4K8JA 1OO9B 4JI6H 2F3IA 4RGNA 1K73C 1JB7A 5H80A 1WTVA 3A8IE 3VYSA 1HTPA 3K59A 1EOVA 5IIFA 1S68A 3H4BA 4C3HH 1GUGA 4A3GG 4GLXA 3RZDH 2B2VC 1CZWA 4GZYC 2RDJA 5HGTA 4JI1H 3Q6SA 3CHBD 1GJXA 2F3WA 1HNXQ 2MUYA 4ECZA 1IYUA 1VQ9A 2B2TA 2R8GA 3M4PA 2FXQA 3K8AA 4WJ3M 1PMRA 2N49A 3Q8RB 4HTHA 2K1BA 4YIJA 4JI8Q 3N40P 3D31A 1N8RC 5IP7H 4EQNA 5KFIA 3RBEA 1EIYB 2WAQB 4LF4L 2RBMA 2JA7B 3KF8B 3CQZA 4QCLA 5JVDF 2BQUA 1DONA 3LMLA 3PQIA 1E1OA 2QK4A 4DK3C 2R93B 2EXZA 5FKAC 2C35B 5F9NA 4ME3A 2CWPA 4DV2H 3PVXA 5ISRA 1S10A 2G9HD 3E9IA 3F2DA 3BS1A 3MFIA 1II3A 1JQYD 3N44B 5EKIA 5KT2A 3K5HA 5D1PA 1AZQA 3HGBA 3TBIB 2A73B 2F03A 4RAZA 3PO2B 3HOYH 5EPJA 4A3FG 4LW1A 3ORRA 1X3EA 3H6MA 4ZQIA 1SYBA 4POFA 5C0XH 2UU9H 4FF2A 3GTGH 5C8YF 4BY7B 1I4XA 3X3MA 3TMEA 2CW7A 2DNCA 1WOCA 3UQ8A 4RB1A 1E4EA 2EOTA 2P5ZX 1S97A 2J0TD 3HOUB 1TWHB 4YHHL 3EROA 5DG8A 4XZ3B 3KHHA 4IWYA 4NPSA 3K80C 4Q43A 3M7NA 1A3TA 4WRDA 4A3KG 1GUWA 2NU9B 1E2WA 4Q44A 1A2UA 3KDFB 4DR4L 3KHGA 2HQLA 3DEOA 1K83A 3MWEA 4ED0A 3BQ2A 3JAMW 1WCMG 3GIIA 4A3GB 4HNUA 3GV6A 2AGPA 3J80E 2XSCA 3CQZH 4XYLB 2HD3A 4JV5Q 1MBYA 2XIWA 4HQ6A 3HB9A 3CRLC 4KHPQ 4EEQA 2W6QA 5M3FG 1YIJA 3HOWG 1GUNA 3OIPA 2OH2A 1KJQA 3FP9A 3U50C 3EA6A 5A2QE 1AN7A 1EEID 3HXLA 3H94A 1B3QA 4DV2L 1LTLA 3HFZB 3TSSA 5C3EH 2BE5D 3ITPA 1VCIA 4LSAA 1B9NA 1HTLD 4O3NA 2F1MA 4HYKA 2PW7A 2Q8IB 3OWFA 2WB1E 1V4YA 3RTXA 5KFCA 3CU7A 2R8JA 4X65Q 1I4RA 4O2DA 4DR5Q 4X66L 1FGUA 3N6RA 1EYDA 1FYCA 1X3PA 4CJ2C 1XJVA 2VPQA 1SXTA 1K0RA 1Q82C 2SEBD 1PRTF 2YS7A 5DAUA 1N48A 4R4CA 3D3RA 3KBGA 4LFCQ 3MXNA 1W96A 2HHHQ 1N56A 3CMAA 2Z4HA 5JAVA 3Q8SB 2F0HA 4QIWE 1IOWA 4OWXB 4PV1C 5DG9A 5ELFA 2YU9A 2NVYA 2LMCB 4DV6Q 1Q1EA 1HZCA 1KHIA 3E0JA 2JA7H 5E3FA 1EY7A 1GUOA 4FBTA 1F2MA 1JDEA 2KHJA 5EZYF 5KG6A 4G57A 3U58A 4RB0A 2JEGA 1BCPD 4ME6A 1HZBA 5KT7A 1B53A 3BVZA 1F77A 3BG3A 3HG9A 1Q90A 1IBML 1LLRD 3MFYA 4IUQA 3J7ZC 2K5VA 3N8DA 4MN3A 4RFBA 2K32A 4E4TA 3GIJA 4OIKA 2K03A 4C1NK 3QJYA 1E1TA 3OW2A 3DMUA 2DIKA 4GNXB 4A75A 3GTJH 2KHIA 5ELOA 1F2LA 3KK7A 4YWKA 5GROA 4RU9A 5FD5A 2WB1G 3M9MB 5J3BA 5DQIA 1I3QB 1JIHA 1RF2D 5KFFA 1XYIA 5FO8B 1CT1D 3IFTA 3VYUA 4JBMA 3GTLH 2JA8H 5L1LA 1S5FD 3S15B 5M3FB 4RB2C 3OMGA 3GP7A 4O3SA 1GUTA 3ERSX 2QW7A 1NUCA 2XCLA 3GTOB 2JA6A 5M3FH 3HRZC 3TINA 5CMDA 1JWMD 2F0WA 2MGSA 5C4JH 2JEFA 3DXJC 4YHHQ 5F9LA 4O2BF 4ZAIA 5IGCA 2KCTA 5LOVF 3DHQA 4PNYA 1SEIA 3GO5A 3KUPA 3EBEA 5FJ8H 1Q7YC 2HHHL 3RIZA 1AP0A 1JCKB 2X69A 5D1OA 5IGDA 1TAEA 1NSNS 1WJJA 3HKZA 2UXDQ 2C22A 4OX9H 1U4LA 4OX9L 4GN3B 3K57A 3QIAA 3NWTA 4X3SA 3RLFA 2VZAA 4X62Q 3GQCA 2M00A 2AMCB 1G6PA 1CA6A 4NB3A 4RHRA 4B3SQ 2W6MA 4X62H 1LV9A 1I4GA 4K5VA 2R93H 1PFBA 4X65L 2I80A 3VR6A 3ZYYX 1NCVA 1SRUA 1QILA 5BR8H 1CM9A 5FOBB 4MV3A 1Y8PB 2NZOA 1RYRA 3PF4A 2D2CC 3BYTB 2E2IA 2K52A 3TS2A 3TQ1A 4TVAB 3KBXA 4WORA 4YBZB 3J7AF 1TU2B 4NXMH 3OSOA 1I94Q 1X9NA 1ENCA 1EYAA 4IPGA 4ZCKA 3EFXD 5TSSA 3RZOH 5KFHA 1YJ9A 2HT1A 1QVCA 4HIMA 1SYDA 2QKIC 4C5CA 5KFWA 2QYZA 2HUGA 1T3NA 2OT2A 1M0TA 1CKNB 1OXUA 2J7ZA 1NY4A 1C4QA 3CP0A 4KHVA 1PYBA 5CYUA 4KLKA 4DXFA 4XYMB 3GTMB 1VQ4A 2UVUA 4FF3A 2VXWA 4U7CA 4EGJA 1KTKA 2EDGA 4DF7A 4K0KL 2H1EA 2YZGA 3C46A 2UUAH 1PH5A 2NVTB 1LABA 4H7BA 1W6KA 5DEHA 2UUAQ 2JEAI 2NZ1D 2RQXA 2CWAA 1XDNA 2R92B 4B9XA 3NQTA 3I4NH 1W2BA 2A1AA 2FJ2A 4EEYA 3MXPA 2EYOA 3NBHB 4OGQC 4C3JB 4EQPA 2KECA 3HOZG 5C4XG 3FKIB 3A8KE 2IWHA 2B29A 3CMEA 4JI6L 4L1KA 4DV4H 1VQHA 3RR5A 4K5XA 4BBRG 5BN3A 2ZXOA 3CVZA 4NP5A 1JJGA 3S1NB 3GD7A 5L1IA 1VQFA 2R8HA 4LF5L 3H3VI 4JYAL 3A55A 5LMUL 4LF9L 1Q1BA 2QDBA 1WTRA 5DQGA 3GTOH 4ECQA 2HVRA 1G51A 1SYGA 4DUYQ 1PZJD 2ATLA 1VQ8A 3KDFA 1KIXA 4K0KQ 1QVGA 1H9SA 3VYTA 2XGQA 1O80A 1YJWA 3BQ1A 4QB4A 1TWAH 1NR2A 3MJFA 2JE6I 3QFFA 1E4FT 5LMNQ 1SN8A 4MV1A 3AFQA 4MV8A 5IYDG 3DUZA 3MR6A 2B39A 3RNUA 1AFPA 3GIQA 4GC7A 1PZKD 1AZPA 2DJFC 4LFBQ 2FMAA 2GA4B 1PV4A 2I46A 1CHPD 5CV5A 2UXBL 4IPHA 4C3IB 5CV8A 2M05A 2OF1A 1RJPA 2PZTA 4XT3B 2ASJA 1I4QA 3G4SA 1TWAA 2D0PA 2MFIA 4DR6L 4NMZA 3J7AK 3OTOQ 4TV8F 3LWBA 4KD3A 2PN1A 1DIKA 3OTOH 4QGUA 3T5KA 3Q2OA 1DOMA 1G291 4AYBG 1NJIC 1HJPA 2XRSD 1DZ1A 4APMA 2WV6D 4X6AH 4DV0H 3S1RB 1VDZA 1U0LA 1WH2A 2NVTH 3RAXA 4IRDA 4CJ0B 1DXMA 3PUYA 4C56C 1DD2A 4GLAC 4IALA 2JA7G 4M9UA 4GKKH 2ICEC 2NN6I 5ELDA 2M9VA 3GTJA 2B63G 3WOEA 3STBC 4DL7A 2VNUD 5D65A 3ND8A 4LF4Q 2L12A 3EPIA 4OHJA 4C2MB 2C2EA 4ECSA 3UDFA 2B63A 3BZDB 4P71A 5KNCA 1SNQA 2UXCH 1DYQA 1ZYRD 2ES2A 3HOZH 1EIHA 3S24A 5LYJF 3NK9A 1SFOB 1H9KA 1JKJB 4EFBA 4LFCL 4B3TH 4DA2A 5JPNC 1KJ8A 5KFKA 5IOCA 5KT5A 1QCBD 5LMUQ 3PV0A 2A69C 3K81C 4AYBA 2VQEQ 3K0YA 1Z7TA 3DF7A 1RYSA 2YTXA 1JORA 4IUPA 1UE7A 3MWDA 4JI6Q 4DFAA 1UE1A 4A3BG 1O7YA 3H4DA 4U6PA 5T14A 2ATWA 3TIGA 4KD4A 1N36Q 3VR3A 4DV0Q 2HIXA 4F8MA 2F4VQ 3DWPA 5IYBG 4P2CB 3TEHB 1PRTB 3SK5A 1PTOC 2R7ZB 4JYAH 4DV6H 3MFGA 4RUAA 1PH1A 1C7YA 4GKKQ 3FMCA 2R7ZH 2OXPA 3HOXB 1DV1A 4KHPL 2R7ZA 2LXJA 5DM73 4JI1L 2FLLA 2WB1A 4GC6A 4ABNA 1K8GA 2VW9A 3S1QH 4QWDA 3HOUH 3HS0C 4YHHH 1FNUA 4XQQA 1A62A 5CA0F 1KC8C 2AGQA 1ILQA 1IBKH 1YITA 4DR4Q 3TP5A 5C44B 2FB9A 2DPIA 3KALA 1E0BA 5GADC 5FLMH 2IW3A 2UXDH 1MIUA 4IFDH 5M5XB 4A3KB 4ED7A 1TS3A 2EPBA 3R5FA 2JA8B 4YY3H 3CXCA 4RGOS 1XPRA 3MC0B 1X56A 4GKJQ 3I7FA 2K5DA 2B2UC 1G91A 2K7VA 3L4KA 2PPBC 3J80c 5EGTA 3TN2A 2W71A 1SYCA 5C4JB 5FLXE 1NR4A 4HIOA 2C00A 2L11A 4F4WA 1QOHA 2JJQA 4U673 1C9OA 4X66Q 1QVFA 5IY0A 4UP7A 4HMIA 3G71A 2NTTA 2E75C 5KFJA 1Z2OX 2E2DC 4X3TA 4NXML 1SCUB 4KMUC 4C3IG 3A56A 2W7PA 1HHVA 4LJZC 1AW7A 5J1ZA 3NE5B 3CW2C 1MHWC 1M8AA 5JVH3 2UXDL 3M9OB 1VQ6A 3KLSX 4DR3H 4ECVA 3FEWX 4YJ2F 4F4YA 2RDIA 4BWSC 3S1MH 3K7AH 1E3PA 4WJ4A 2AQ4A 2FK1A 2UUCQ 4HAEA 1EY8A 5KFYA 1Q3LA 1E22A 3S17B 3HOWH 5IE8A 4JI0H 3VA7A 4LUZA 1CQJB 3RN2A 1EWIA 1JMCA 2L55A 1TWCA 4A3IH 2PMZB 3K0XA 4AYBB 3NEMA 4JI7L 5G3LF 2K75A 2BDOA 1GSAA 1LT5D 2DGYA 3TQYA 4I65A 1PH7A 1HR0W 1A15A 5I2YA 2B2WA 5IWAL 2JXMB 2MPMA 4EX5A 1VQEA 4DNRB 4CKEA 3C3LA 1KXLA 4C2MA 3P20A 3MFHA 3PUXA 1U9RA 1V1QA 1K1SA 1N32H 1BQQT 1FJGH 4GOPA 3ND9A 4A4IA 4WBNF 1UEBA 3D6CA 2K5HA 3MVVA 4Z9CB 3HOYG 2A68C 4MAMA 4FS2A 3D8GA 3KTMA 1STEA 4C2MH 2BR0A 2IT1A 4A3JG 2YTYA 1PRTC 3OPOA 3ULJA 4JI8H 4JI0Q 2R86A 3PO3H 1LTAD 2ZXRA 4BXXH 5LMNH 2OEOA 4IO9A 1CQIB 3NQIA 3KF6A 3X3NA 4FM9A 1VQLA 5LL6X 2BA0A 4LH7A 1UNSA 4J15A 3I12A 1FR3A 1AUVA 4TUYF 2IX3A 1EUCB 1QJOA 2PQAA 1KAAA 3W1GA 3BDOA 5M5WH 5BPHA 5EBCA 3QR8A 1MJEA 4JOIA 4HJAA 2E76C 1S40A 1D2BA 2HJWA 1I50A 1E7ZA 3SK8A 1KC7A 4PDBA 1WCMH 3DM1A 3STBD 2KEEA 3BYYB 3I70A 1EHIA 4ODGA 3F2CA 1H9JA 3PF5A 3H0GH 1R4PB 4K6LA 2EVBA 3LNNA 4KJNA 4V190 4KI0A 1PH8A 2D9UA 2AKWB 2GN5A 3J81E 1CHQD 2W6NA 1YVCA 2SNSA 1CKOA 1LT3D 4HEDA 4DGZA 4KN4C 3MXUA 3K5NA 2Y0SB 2ZJQA 3GTQB 1IL2A 2CH4A 4RKBA 4F4XA 3A54A 4LAAA 4IAJA 2K5QA 4JI3L 3FKIA 3L3OC 2UXBH 1I50B 1Y1VG 2DWCA 4TQUS 1V9PA 5JJIA 5BPFA 2WKDA 4L5QA 3UE1A 4OWWB 4R8NA 1Y1VA 2K6AA 1VQKA 3ZJYC 1HZ9A 4QWBA 1TWHH 2VB3X 5E7NA 2CQAA 3CCQA 4C5AA 1Y14B 4EFEA 3PW4A 5DM63 2EY6A 1VQIA 4DR1Q 4PQXA 2KSWA 1N36H 4DV1L 1JWUD 1U4RA 2BDNA 4DK6C 3AQQA 2V4QA 1Q86C 1RJQA 3CCJA 2IMWP 2C28A 4GOPB 4FXKC 2Z6BA 4DV4L 1NMGA 1D5MC 4LF7Q 5K2MA 4DV1H 2NU6B 1ESRA 4Q45A 4KY6A 1HFGA 4ID6A 3J81W 4KY5A 2IJ0A 2I5LX 2C2RA 2HHHH 3Q8DA 2GPSA 1BOSA 5C3XA 2VA2A 3I2ZA 3UFXB 2R7KA 1STAA 1S9FA 2N8NA 4DV7L 4A76A 2E2IB 4LF6Q 2W6ZA 4YWMA 2EJMA 5IT9E 5J2TF 2XIGA 4JV0A 1CQFA 3KOJA 3K7UC 3WNZA 2R7NA 1TWHA 1ICWA 3G6JB 2I5HA 3SVMA 3PIO3 4R4TA 1B6RA 3OUZA 5ELBA 1XNQL 4J0MA 1XMQQ 1PFSA 1EIFA 3G48A 1T94A 1N34H 4UDUC 4ZRZA 5GAHC 2CVRA 1DGSA 2KCNA 2NVYB 2ZT9C 3DM3A 4R1JA 4A3LH 4I7HA 2QGQA 5IYDH 1MI2A 4ALPA 1BVSA 4C3IH 3IN5A 2FHTA 3J80L 1IOVA 1HNZL 1VBHA 5M5YH 2LY7A 4B3MQ 2E5LL 3NWSA 4IUNA 5KNBA 4PWQA 2JA5H 5IGFA 3UDIA 2J6TA 4JI5H 2Q2IA 5E4WC 3HOVH 1F2ZA 3M4OH 5EWFA 1EU4A 2ZXPA 4PMWA 3TZDA 5KFVA 2JA6B 3GTOA 5JEAG 1I3QH 4RNOA 2NVXH 4FVMA 4K14A 3TP7A 2RDGA 2ZJTA 5BR8L 3SK6A 4XIGS 1HUMA 4YY3Q 1C0AA 1VQ7A 4V0BA 3D6WA 1JOQA 4B08A 3LWUA 2RHSB 5LL6S 3C0FB 1Z2PX 4DV6L 3RB6A 1S4ZA 4XXEA 3RV4A 3EVQA 2A68D 4ZI7F 2F0OA 5D3DA 4RGMA 5KYLA 4B3TQ 3J81j 3T5LA 2IBKA 4C3HB 4YR0A 4DR7H 1G2SA 1EU3A 1X3QA 2A5HA 4DR5H 1EUDB 4QWCA 2X6LA 4Q5VA 3WWVA 3IG0A 3GIPA 4JOIC 3Q24A 2OLSA 1KNEA 4LF8H 2C5CA 4PZ8A 4DV3Q 4IFDG 4O42A 2PNRC 2W7OA 2UUBL 2AGOA 3GILA 4IQZA 1M0WA 4FF4A 3HOWB 1AN8A 1V8QA 1NMFA 3FVQA 1IBLQ 1Q81C 4LK1C 2GVBA 3HOVG 4IFDI 3VA5A 1N34L 3K3PA 2E2JB 2EY1A 4Y7NH 1KLGD 2VQFH 2PW5A 3H3VH 1NTGA 1C30A 3R2IA 2FPGB 2O5IC 1VF5C 2HGSA 4XT1B 3FPPA 2L9HA 3B6YA 2DY8A 4IPDA 3U9TA 1CFMA 2VUMA 2XCPA 1I4PA 3SEBA 2MCTA 1V1OA 5KRUA 4YR3A 1DJRD 3BZCA 2IX0A 3OHXC 4OELB 3V4ZA 1EYCA 4UAIA 1ZQ7A 4PZ7A 1P8LA 5KNDA 1D1IA 1S72A 3I56A 2I0QA 1BUVT 1JE4A 5KG5A 1SAPA 1A9XA 1SROA 3HOZB 1IL8A 3VR4A 5EPLA 4IRCA 4ED8A 4A3GH 4X64L 5LXTF 4IUTA 2ZTDA 5JVG3 3FDSA 1J5EH 5AJ3L 1NAPA 1SYXB 4K2KA 2XVSA 2F0LA 3OW7A 3CCRA 1R9TB 1FGBD 3H09A 2EYJA 2R7ZG 3BA9A 4ZOLF 1XMOH 1LO5D 4XYQA 2F0GA 3BU2A 2W70A 4DAYB 5FLXc 2FMMA 1VBGA 4LFAQ 2OWOA 5L9XA 5IGBA 1I94H 2MJ8A 1VQPA 2NU8B 1IZ6A 1OXXK 4O0AA 1YNJD 2UXCQ 1G2TA 1EQVA 2WKCA 4LMQD 1EZ1A 1PYSB 4I7ZC 3EJIA 1Y69U 4B3RL 4JBJA 1FNWA 4RKLA 5FO9B 2AUJD 4CHTB 4UCUA 5KFZA 3RGZA 2OQ0A 3A0JA 4YB8B 5KFBA 5C4ZA 4NLGA 4IN3A 3UDXA 5T1IA 4A3MG 4J9RA 3A5UA 5CC4A 4BA2I 1Z2NX 1ONLA 2DLNA 4QMGA 2O4XA 2V59A 3AEVA 1B70B 1L2FA 2IX1A 3KYHC 4QIWB 3H0GB 5DGAA 1B4OA 2Z8LA 4WJWA 3DWAA 3RF2A 5BMVF 1EY0A 3J80i 2QDLA 1VQ5A 3GTMA 2JSOA 1J5EL 2W8KA 3SDZA 5KFPA 1SMYC 2XGPA 4JG2A 4RA8A 4J1MA 4O3RA 1JLLB 4O1NA 1BJTA 2R82A 4OIJA 4BY1B 1PTOD 3GDEA 1XMOQ 2I8CA 2ALZA 2VB2X 1EEFD 3GTPB 1RL2A 2E2HH 3RB4A 1Q12A 1Q8IA 1XXGA 2FJZA 4DV5L 4HIKA 2F0MA 4M7EA 2MNAA 4MZ9A 1K9MC 1H9SB 1JT8A 4BY7H 2R87A 1KBLA 4OWTB 5AFWA 3D4WA 2JA6H 4FXDA 1I6UA 3E5NA 4UCVA 1JE5A 4UP8A 1WSCA 2AWOA 4BY1G 3WDNA 5CAEB 2UU9L 2VQFL 2CH4W 4G7HC 2R8KA 1TWFB 2K5NA 5CV6A 2RSNA 4YP3A 4UCRA 4KKTA 4DR2Q 1O78A 1GM5A 3N6XA 2G9DA 1STGA 3U9SA 5M3MB 1GKHA 2VPSA 4K8IA 2CW0C 2MHVA 3NBHA 4J9KA 1YHBA 4YCVA 3BG5A 3M9NB 1QZGA 4Q8EA 4NXNL 2RVLA 3MR2A 3A7LA 4ECRA 3PR5B 5FPOA 3G6EA 1CUKA 3QWNA 3H91A 3T1HQ 1YHQA 4A3MB 2RSOA 4MHEA 3BA8A 1TWGA 3RZDB 5I6WA 2NYZD 2JN4A 1SMXA 1F9SA 5C3EG 1RODA 5LHY1 1HNWL 1KQSA 2Q8TA 1Y1VH 4XQNA 1S0OA 4A3LG 1ZHSA 2IHFA 3NXWA 1M7JA 4YR2A 3I4NB 4CC6A 3LX0A 5FK9C 2Q2HA 1PK8A 2JEIA 1XNRL 2F0TA 1BBXC 4UCSA 3RMHA 3BJYA 1IW7D 1V43A 3I4LA 2YYAA 4MV9A 1M6VA 1SR3A 1CE8A 3IL8A 1HR0Q 2VUMH 3ULLA 1B1ZA 5IGEA 3V4SA 4AQYL 4JI4Q 1EY4A 2YTVA 4ZQ3A 1TKWB 1IBKL 5JQWA 3HP3A 4ILWA 5D8DA 3VR5A 1OTCA 3PO3G 4APVA 4DR3L 4HJ7A 4A3EB 3CC4A 4DR6H 3H0GG 1BBWA 1B3AA 4IHJF 4H02A 1AH9A 4KHPH 4UCOA 3BDCA 4QY7A 3S16H 3LGJA 1X6OA 5KT6A 3L4JA 1L1OA 4WFN3 4PG3A 4FF1A 4A3DB 4XYOA 2HDLA 1V1PA 3RN5A 1D5XC 1SE3A 3ULPA 3L0OA 1ULZA 1MSHA 3PW5A 1UWVA 2C2DA 1CKMA 2ZM6Q 2A74C 1A8VA 2OCEA 4CC5A 3I4OA 5IGGA 3HOUG 3GTGB 4DK1A 5KFLA 3AB9A 4O4HF 5KFMA 1EY9A 3M4QA 4EYIB 1UC9A 1TS5A 4X3KA 1EYZA 3WOFA 1EZ6A 3G6YA 3DEPA 3E5SA 4DR7L 1K8AC 1KRSA 4ZKCB 3BABA 3S15H 4ED3A 1GD7A 2SOBA 1FJGQ 2YU9H 4DR3Q 5M5YB 4ECUA 4DKAC 4A2AA 2UUBH 1N33L 2BE5C 2Q8RE 2XN9C 3EN2A 5IWAQ 1N32L 2J9GA 2OTJA 5D3IB 3VYRA 4HCEA 3I3CA 1FL0A 1B50A 2A6HC 1A2TA 2VUGA 5IWAH 2F4VH 1VS0A 3CAMA 4A3FB 2OTLA 4TQRA 4JK1C 2KCMA 4H0LC 1J6QA 3GLKA 3R3OA 4OO1G 1M90C 1V51A 2GVAA 4P75A 2AWNA 4CKBA 1I3QA 3IAYA 1TR5A 3CKIB 4CJ1B 1PDQA 4KV6A 2I07B 3W1BA 3J7AV 5DGBA 2F0VA 3EQLC 1KDAA 1PX2A 1SDFA 3OIQA 4Q0YA 1T5XD 1FD7D 5JH7F 2V4DA 2E2IH 4LF6L 2EYFA 4R8IA 2ZM6H 4DNIA 3SK4A 1Q8KA 4EBCA 4CDEC 2EYMA 1JOKA 1SNCA 2ZJPA 4FO2A 4DUZL 4B3RQ 4DAMA 4BS9A 2K14A 1QE6A 1VQCA 2VUMG 1PXUA 1L2ZA 4NXNQ 4JI4L 4EQ5A 4IR9A 2UVVA 3PO2G 5IT9c 2Z9HA 4C3JG 4PZ6A 2B2TC 4A3DH 4DV3L 2I87A 2PYKA 4I55F 2WYOA 2C9OA 3JRWA 2B8GA 3ETJA 3S2HB 1D6EC 4CDFC 2B2VA 2YU9B 2KHSA 4YCWA 3MAQA 4U68A 4HR7B 5DLQE 4MTNA 4GN5A 3HEJA 5KG1A 4M1UB 3R93A 1B2TA 4BBSB 1HA5A 2O5JC 4GOPC 4Y7NB 4YAKB 1YNJC 1X3GA 2B3GA 3BAAA 1ENFA 3PZPA 5JJLA 3M4OB 5C5LA 3GTLA 3D4RA 3CPFA 1XMOL 2E8GA 1YZ6A 3ICEA 4G7OC 1F9PA 2PMZE 4EYHB 2ZM6L 2D5DA 5KFUA 5LL6b 1EOTA 1JOOA 4RCOA 2R61A 3V05A 3T1YH 4YY3L 1N9WA 2NBFA 3T51B 5CBEE 5BR8Q 1K3RA 4XDXA 2R93A 2B2WC 1I4HA 3J81c 3RUPA 1F9RA 3VPCA 2X0SA 5KT4A 3H40A 3VR2A 2YZNA 3PW0A 2F0KA 4GS3A 3VDYA 2W8LA 2UU9Q 2F0SA 3PO3B 3OHBA 4JI1Q 2F52A 3PUZA 5JEAJ 5IP9H 3CQZB 3KF8A 3Q0AA 2ALYB 4XQJA 4GKKL 5EDWA 1SNMA 1XMQH 5K36H 2HQEA 3PMFA 3CCEA 4HJ9A 3N43B 1K8MA 2WAQA 1KJIA 1LTID 3T1YL 2F3VA 4HSPA 2FLNA 1XTCD 3RBDA 3RAQA 1PH3A 4L8JA 5KGUA 2E5LQ 5HBRB 5C1OA 3AU7A 1WR2A 3BVGA 3OMCA 1B33N 2K01A 1HNZH 5CV4A 3K7AB 4BY1H 1UUPA 2NU7B 1K1QA 3R2TA 2NVYH 5JPMC 3PGZA 2VR1A 1S0NA 1XTDA 3S17H 1EYGA 1YBYA 1MSGA 2QEXA 3FMAA 4QW9A 5EBDA 2XNAC 2A8VA 3CC2A 3GTPA 3OWEB 1YNXA 1HNWQ 3G7LA 3M3YH 3HBLA 4DR2H 2F4IA 3MXNB 2EXDA 3S14H 4EBEA 1D5ZC 1EY5A 4IZ8A 4K5WA 4JI2Q 4UPAA 3CCLA 2R84A 5KIXA 3T1YQ 2JA8G 1IKMA 1EFID 2QEJC 4YQWA 5EQ0A 3H20A 5GAEC 2RGVA 5C44G 1EUJA 2R7DA 3QO2A 2O03A 4DV7H 1SYEA 3E3XA 2R7MA 4DL3A 1UNNC 5GONF 4J9SA 4JI3H 4UP9A 2CKZB 3H0GA 3A74A 4QIWA 2L0CA 2Y0SE 2ZDGA 1KL9A 3KFUA 3MR3A 2PBZA 5FPRA 4YCUA 5CGKA 4DL2A 5ELNA 1WCMA 1PZID 5L37A 2Q2TA 4RWSC 1B7YB 1RJRA 5A2QL 2K50A 5CA1F 4X65H 5DG7A 3KLRA 4A3MH 1STBA 1D7QA 2EY5A 2RCNA 1H9RA 2YV5A 1A3UA 4YWLA 3JAMc 2JA9A 4IJHA 3PIPA 3CCMA 3GV7B 2JEJA 2JA7A 5HURA 4ZLTF 4DUZH 5KFOA 4ULLA 4DR1L 2TSSA 4BWGB 1F9QA 3DLLA 1MKHA 4H44C 3QZ7A 2N78A 1K83B 4DAYA 5AJ3Q 3NHHA 1HXYD 2B63H 1TT2A 1KDCA 1YI2A 1R9TA 5KFNA 2BA1A 3RB3A 4QW8A 1CQVA 4A3FH 2RKSA 4JI5L 2B2UA 5NUCA 1U4PA 3BVMA 3PUVA 1MZBA 5FD6A 3K5OA 2WAQE 1JXLA 3EIVA 2HVSA 1U4MA 3V96A 4ZK9B 4JI3Q 1PHJA 1ZHQA 1VQDA 4RG1A 4CKCA 2FK2A 3QZ8A 4A3EH 1UE6A 1W6JA 4QQBX 3UE0A 3PR4A 3J81i 1HUNA 2EIFA 1S5DD 2L15A 5I9PA 4RNNA 1PVOA 1WCMB 3QOJA 1VF7A 3URYA 5CBAE 2VUMB 3HOYB 1CI3M 5FLMG 2V9WA 2HCIA 1TWAB 5KFDA 2IL8A 2MO1A 4A3CH 2B2YA 2CW8A 4IUUA 3G8CA 1X65A 4LF5Q 3NENA 1IBLH 2PO4A 1DV2A 4A3BH 5D14A 1KJJA 1TWCH 3C2PA 5KG4A 3HOXH 4DR1H 4QWEA 3HZXA 4A3IB 1QNUA 3PIOA 2ZDHA 1O75A 1RKNA 4YJ3F 2E74C 1SYFA 4LNQA 1R4QB 1DM0B 3Q8QB 4AQYH 1ASZA 1SLJA 5EKKA 2XCAA 2SDFA 4DV5Q 4X64Q 1EY6A 4TRDA 2NUCA 1UC8A 2CQYA 4DL6A 3TRZA 3A7AB 2JP1A 1RD9D 4H13C 3TDQA 1I6VC 3S16B 3RB0A 1EQQA 3F2BA 3NELA 2DN8A 1SFOA 4IRKA 3W5OA 2VY3A 4HJ8A 1PTOH 5KFQA 5DNFA 2DY7A 4R9WA 1S5CD 1SE8A 2LS01 4P73A 3U9OA 4R8UB 4ECXA 5JUMA 4GKJH 5M3MH 5E4XA 1SNPA 3S2DH 4JW0A 4C3JH 4DR2L 5T1GA 4GNXC 4JBKA 2QCPX 4K6DA 4ED1A 4QF4A 3GTJB 4L5RC 4MA0A 3VPDA 3JSNA 2ZTEA 4I7AA 4DU9A 1I5FA 3UDGA 1HNXH 4IWXA 2DPJA 3VMMA 1ESFA 1N34Q 4X3UA 4RZQA 3WO0A 4HMJA 3FKIG 1NE3A 1VQAA 2K04A 5IYZF 1AEXA 1DCZA 5EJWA 1YNNC 2IPKD 5ELEA 2UXCL 2NB0A 4AQYQ 2PCFB 2P0AA 1ZKOA 3T16A 4JI5Q 4JUZA 1HR0L 5DLFA 2XWBB 4JI7Q 5K5PA 1IHZA 1RCVD 4R4QA 4EVOA 1O7LA 4ZHQF 4JI7H 2W9BA 2SCUB 4LF6H 2NVQH 5HV6A 1A0IA 2PVPA 2NVXA 2YL2A 1TQOA 1IBMH 4O2AF 1VMPA 2R93G 4RB3C 4Y52H 3G6VA 2ICIA 4AIMA 5ELCA 1PH2A 3GTGA 1O7IA 1B6SA 4O3OA 4DLKA 1UEAB 5IP9G 5I47A 1KLUD 2JA5A 2EJFC 1SBBB 3D0FA 3GIKA 4UCTA 2AHOB 4X66H 2EJGC 2WFWA 4OO1H 4FXGC 3T4AC 4IZOA 4ED2A 2K4KA 4OL7A 1SNOA 4R4OA 5KX5F 2AU0A 2MP1A 1L0WA 4I4TF 4RH6A 4DV4Q 1BXTA 4QUFA 1RK5A 5KFGA 1EFWA 4NXMQ 2CW0D 3C1EA 1SEBD 3QG1A 4A93G 2F0IA 1RIPA 1YEZA 3HOVB 4MNOA 4P72A 3R5XA 3M7GA 5M5XH 3GV8B 4DUYH 3F1ZA 3WO1A 3TP8A 4HNTA 4DV3H 2YS6A 3I72A 3T56B 3GIDA 2JA5G 4LF7H 3TQTA 1N32Q 1IKLA 4JVZA 4ECTA 5HY6A 1QG7A 2F0UA 2FK3A 1LYLA 2JK8A 5EAYA 1BXRA 4TV9F 5KKNB 4A3JH 1B44D 1HCZA 4J9MA 3T53B 2NZHA 4EGQA 2RDFA 1C3OA 3KHLA 5C3EB 1B8AA 1GOZA 1S3OA 1X3FA 1XNQQ 5EOYA 1BCPF 1BGWA 1YHAA 5GQOA 3I4NG 4GN4B 3LP8A 5C5MA 1BR9A 4RCNA 1XNRQ 4ETSA 3TP6A 1VKZA 2R7LA 4ZUIA 4IPCA 1E24A 1A6XA 3J7YW 3G6XA 1Y1VB 2HIVA 1AUXA 3SXHA 4A2BA 1SJHD 5KFTA 1Y8OB 4GNXA 1VAJA 4DUZQ 5DQHA 4CGYB 2L1BA 4DL5A 1FNVA 1RTNA 5KT3A 1HRJA 3F8NA 2RDHA 1EWHA 1RDPD 4LMYA
chains in the Genus database with same CATH topology
1CUKA 5GADC 5FLMH 3T1HQ 1HNXL 1YHQA 4BBSH 2WP8J 4JBWA 4AH6A 1MIUA 4R4IA 4JI0L 4DR5L 3S1NH 2RF4A 2F4VL 1VQMA 4UY8C 3U4VA 1KRTA 3GTMH 1SMXA 1IYJB 4DPGA 3CPWA 5C3EG 3CXCA 1XPRA 1HNWL 1KD1C 1X56A 2N3SA 3SGIA 1KQSA 1Y1VH 1W3SA 3I7FA 4GKJQ 4A3LG 2IHFA 2I5MX 3J80c 2DUDA 2Q2HA 1QUQB 2CQOA 2VQFQ 1XNRL 2D0OA 4HIOA 4LFAL 2JJQA 2IY5B 3PO2H 1V43A 3CF5A 1X55A 1C9OA 1Z9FA 4X66Q 1QVFA 1SR3A 5IY0A 2F3IA 1JB7A 1K73C 2KBNA 4OONA 3ULLA 1HR0Q 4UP7A 2VUMH 1A63A 3G71A 4AQYL 4JI4Q 2YTVA 1EOVA 1IBKL 4NXML 1FJGL 1Q46A 4C3HH 4A3GG 4GLXA 4A3KH 3RZDH 1OTCA 3PO3G 3AYHB 4APVA 4DR3L 4HJ7A 3CC4A 2A19A 3H0GG 3PSIA 1HNXQ 1BBWA 3CW2C 1AE2A 2UXDL 5GAGC 2PQAB 4H02A 1VQ6A 1AH9A 4QY7A 3S16H 1XMQL 1VQ9A 3LGJA 1X6OA 1L1OA 4PG3A 3M4PA 2FXQA 3K8AA 3KF6B 4WJ3M 3S1MH 2R92H 2N49A 3K7AH 3RN5A 1E3PA 3ULPA 3L0OA 4WJ4A 1UWVA 2UUCQ 4JI8Q 3D31A 3HOXG 1CKMA 5IP7H 2ZM6Q 1A8VA 2OCEA 1N8RC 3I4OA 1E22A 4OO1I 3I4MG 3HOWH 5IE8A 3HOUG 1EIYB 1MJCA 4LUZA 3TS0A 4LF4L 3RN2A 3M4QA 1EWIA 3KF8B 1JMCA 4A3IH 3KJOA 3K0XA 3NEMA 4JI2L 2BH2A 4DR7L 3OTOL 4JI7L 1K8AC 1KRSA 1E1OA 2K75A 1HNZQ 3S15H 1N36L 1GD7A 4DK3C 1FJGQ 2DGYA 2C35B 3TQYA 4ME3A 1K83H 2CWPA 4DR3Q 4A3EG 4DKAC 1PH7A 3IRBA 1HR0W 4BBSG 1N33L 3EN2A 1N32L 2R6GA 2Z0SA 3E9IA 5IWAL 1D8LA 5IWAQ 3F2DA 2OTJA 4EX5A 1FL0A 1VQEA 1VS0A 3CAMA 2VQEL 3S2HH 2OTLA 3HOYH 4A3FG 4LW1A 1KXLA 1X3EA 2KCMA 4POFA 3BZKA 1J6QA 3GTGH 3PUXA 1Y1WG 1M90C 4OO1G 1V1QA 2GVAA 4P75A 2AWNA 1SFOH 1WOCA 2RHQB 4GOPA 4A4IA 1UEBA 2K5HA 3W1BA 4YHHL 4GKJL 3HOYG 2KENA 4NPSA 4JI8L 3K80C 2E2IH 3M7NA 2VL6A 4LF6L 4C2MH 5HGQA 3U4ZA 2IT1A 4XTCS 4DNIA 4A3JG 1Q8KA 2YTYA 3ULJA 3T1HL 4A3KG 4JI0Q 3PO3H 4BXXH 2ZJPA 2ZJRA 4IO9A 3KDFB 4DR4L 3KF6A 4DUZL 2HQLA 4B3RQ 4JC0A 4DAMA 2VUMG 2K14A 1VQLA 1VQCA 2BA0A 4J15A 1XPOA 1WCMG 4JI4L 4NXNQ 4EQ5A 2Q2UA 3CQZH 2PQAA 3S1RH 3W1GA 3PO2G 1TWFH 5IT9c 3H15A 4JV5Q 4KHPQ 5M5WH 4PZ6A 3F8TA 5IP7G 5M3FG 1YIJA 1MJEA 3HOWG 1CSPA 4A3DH 4JOIA 4HJAA 4BY7G 4DV3L 3FP9A 3U50C 1S40A 1E7ZA 1ASYA 1OXVA 1WCMH 2YU9H 4DV2L 2IHEA 1LTLA 3HFZB 3STBD 5C3EH 3CCUA 1M1KC 2R92G 1VCIA 2LXKA 4YCWA 3F2CA 1HZAA 3PF5A 2WB1E 3H0GH 5DLQE 4MTNA 4BXXG 4GN5A 4X65Q 4DV0L 2XGTA 2Z6KC 4KI0A 4O2DA 1PH8A 2AKWB 2GN5A 4HJ5A 4X66L 4DR5Q 1FGUA 1VQJA 4GOPC 1YVCA 2B3GA 1X3GA 1XJVA 5JJLA 5LMNL 1CKOA 1K0RA 1Q82C 3CPFA 1XMOL 2E8GA 1YZ6A 3ICEA 1X54A 4R4CA 2PMZE 4LFCQ 2ZM6L 2ZJQA 1IL2A 4LUVA 2HHHQ 2OQKA 3CMAA 4YY3L 1N9WA 5BR8Q 1K3RA 3CD6A 2PI2E 4QIWE 3J81c 4JI3L 4OWXB 4GLVB 1Y1VG 1WYDA 3JAMi 4GS3A 4DV6Q 4TQUS 1V9PA 3VDYA 1Q1EA 2CFMA 2PNHA 2UU9Q 1HZCA 1KHIA 4JI1Q 4L5QA 2F52A 3PUZA 5JEAJ 3UE1A 5IP9H 2QA4A 4OWWB 2JA7H 4A93H 2ALYB 4GKKL 3CCEA 4HJ9A 2KHJA 3U58A 1HH2P 3T1YL 1VQKA 3ZJYC 1HZ9A 1TWHH 1PH3A 1HZBA 2E5LQ 5E7NA 1GVPA 2UUBQ 3CCQA 3GTQH 1Y14B 5IYCG 4AYBE 1IBML 1VQIA 3CC7A 5C0XG 3J7ZC 2K5VA 4DR1Q 4BY1H 4DV1L 2NVYH 4X62L 3PGZA 4A3IG 1XTDA 4DK6C 1EYGA 1YBYA 3AQQA 3PCOB 3S17H 2QEXA 1E1TA 1Q86C 3OW2A 1XPUA 4GNXB 4A75A 1VQNA 3GTJH 2KHIA 5ELOA 3CCJA 3CC2A 1N33Q 2A8VA 1YNXA 4YWKA 5GROA 1PH9A 1HNWQ 1P16A 2WB1G 4FDBA 5J3BA 4GOPB 3M3YH 4DV4L 3ER0A 3MXNB 2EXDA 3S14H 1NMGA 4LF7Q 4JBMA 3GTLH 2JA8H 4JI2Q 4UPAA 3CCLA 2LSSA 4IJLA 5LMNW 3T1YQ 2JA8G 2I5LX 3ERSX 5GAEC 3Q8DA 4A3CG 5C44G 1EUJA 3I2ZA 5M3FH 2R7DA 1J5EQ 5H1SE 5K36G 3KJPA 4UP9A 2CKZB 5C4JH 3HKZE 2N8NA 3A74A 3CCVA 4DV7L 2PI2A 4A76A 4YHHQ 2Y0SE 1PA6A 4LF6Q 4YWMA 1KL9A 3KFUA 2CCZA 4YCUA 1JJCB 2KCTA 5ELNA 1LM0A 4QL5A 3GO5A 3EBEA 3PUWA 5FJ8H 1Q7YC 2Q2TA 3KOJA 3K7UC 2HHHL 4QJFA 1B7YB 2K50A 3M85A 2I5HA 4A3MH 1D7QA 4R4TA 1WJJA 3JAMc 2RCNA 4YWLA 2YV5A 1OXSC 1TWGH 2UXDQ 2JA9A 4IJHA 3PIPA 3CCMA 1XNQL 1XMQQ 4OX9L 4GN3B 3RLFA 2VZAA 1PFSA 4X62Q 4DR6Q 2AMCB 1EIFA 3G48A 1G6PA 5C4XH 4NB3A 5GAHC 3DM3A 1DGSA 4DR1L 1IBKQ 4B3SQ 4R1JA 4LF7L 3GTKH 4A3LH 2QGQA 5IYDH 4ALPA 1YJNA 1BVSA 3TREA 4C3IH 1MKHA 3DLLA 2XTIA 2R93H 3KLWA 4X65L 2UXBQ 3JC66 2N78A 5M5YH 1HNZL 2B63H 5AJ3Q 1SRUA 4B3MQ 2E5LL 2ZTCA 1YI2A 2JA5H 1QUQA 2BA1A 2NZOA 3UDIA 3PF4A 2Q2IA 2JEBI 4A3FH 2K52A 3HOVH 3TS2A 3M4OH 4JI5L 4TVAB 2MO0A 5JJIA 4PMWA 3PUVA 3RLNA 4IOAA 5JEAG 1I3QH 2WAQE 3L2PA 2ID0A 3EIVA 1I94Q 1X9NA 2E2JH 2NVXH 4JI3Q 1PHJA 3I4MH 1VQDA 3A5ZB 4RG1A 4DV7Q 5BR8L 4IPGA 4A3EH 4XIGS 1UE6A 1CKNA 2MQHA 4YY3Q 4QQBX 1VQ7A 3RZOH 1I6HH 5IYCH 3UE0A 4IFDJ 1C0AA 3J81i 1YJ9A 4L5TA 1QVCA 2EIFA 2L15A 2RHSB 4HIMA 2HT1A 5JJKA 1PVOA 4DV6L 1CKNB 1OXUA 5FLMG 4JYAQ 3HKZG 1NY4A 1JJ2A 3CP0A 5C44H 1PYBA 2BH8A 2MO1A 4KLKA 1I50H 4A3CH 1VQ4A 2Z6KA 3J81j 4B3TQ 1X65A 4LF5Q 3NENA 3E9HA 4K0KL 2ASBA 4A3BH 1T9HA 4IOCA 1PH5A 3M9BA 1TWCH 3J7A5 3HOXH 3WWVA 2UUAQ 4DV1Q 2JEAI 2EQSA 1I94L 2CWAA 4JOIC 3PIOA 5FJ8G 4PZ8A 2JA6G 4DV3Q 4IFDG 3I4NH 4LNQA 1W2BA 2A1AA 4LUOA 2UUBL 3NBHB 3CCSA 5C0XI 1IBMQ 4JV5L 1NMFA 1IBLQ 1ASZA 1SLJA 1QZHA 3HOZG 1Q81C 5C4XG 2GVBA 4LFBL 3HOVG 4DV5Q 4JI6L 2B29A 1L1OC 4X64Q 3CMEA 4IFDI 1N34L 1VQHA 3RR5A 4BBRG 3I55A 3TRZA 1IXRA 1JJGA 3GD7A 1VQFA 4LF5L 3H3VI 4HIDA 4JYAL 5LMUL 1Z47A 4Y7NH 1Q1BA 4LF9L 1EQQA 3F2BA 3NELA 3GTOH 3H3VH 1G51A 1NTGA 2V1CC 3RLOA 2VY3A 3W5OA 4DUYQ 4HJ8A 3B6YA 1VQ8A 3KDFA 1KIXA 1SE8A 4P73A 4K0KQ 4IPDA 1QVGA 2R7FA 5M3MH 1R9TH 1YJWA 3S2DH 4DR2L 4C3JH 1TWAH 4GNXC 3BZCA 4JBKA 1BBUA 2IX0A 3BJUA 4L5RC 4PZ7A 1P8LA 3HKSA 2JE6I 2ZTEA 1S72A 4LF9Q 3I56A 2I0QA 5LMNQ 1SN8A 1I5FA 3AFQA 3UDGA 5IYDG 3RNUA 1SROA 4RMFA 1N34Q 4A3GH 4X64L 5C0XJ 2ZTDA 3FKIG 1KAWA 1NE3A 1VQAA 3AFPA 5AJ3L 1PV4A 1WFQA 4LFBQ 2UXBL 4IPHA 4JCVE 1PH4A 1WI5A 2UXCL 3CCRA 2YYZA 1CSQA 2JQOA 3G4SA 2D0PA 2MFIA 4DV2Q 4AQYQ 4L5SA 4DR6L 4JI5Q 2R7ZG 1HR0L 3OTOQ 4JI7Q 4R4QA 3BU2A 1VQBA 2UUAL 4DAYB 5FLXc 4LFAQ 4QGUA 2OWOA 1TXYA 2NVQH 1A0IA 1G291 1U5KA 4AYBG 1BKBA 1HJPA 3FHWA 1NJIC 4B3ML 4X6AH 1VQPA 2R93G 4Y52H 1IZ6A 1U0LA 1OXXK 4O0AA 4KHZA 4P74A 4AIMA 2NVTH 2UXCQ 2NN6G 1PH2A 1PYSB 1O7IA 4OXPA 4DR7Q 3PUYA 4B3RL 4JBJA 4LF8Q 4GLAC 5IP9G 2JA7G 2OQ0A 3A0JA 2NN6I 3D0FA 3GTPH 1H95A 3UDXA 4A3MG 2AHOB 4BBRH 2B63G 3A5UA 2WFWA 3STBC 4BA2I 2VNUD 1FVIA 1Y1WH 4LF4Q 2K4KA 4LWCA 1VQGA 3UDFA 4R4OA 3AEVA 1B70B 1L2FA 2IX1A 3KYHC 1L0WA 4P71A 4DV4Q 4LF8L 1EFWA 2ES2A 4NXMQ 2UUCL 3HOZH 3E0EA 4A93G 1GO3E 3S24A 1RIPA 4BA1I 1YEZA 5M3MG 2D62A 4MNOA 4P72A 3J80i 1LUZA 3L7ZC 4LFCL 1VQ5A 1J5EL 1PH6A 5M5XH 2H5XA 3F1ZA 2Y0SG 4JG2A 5LMUQ 3PV0A 3K81C 2JA5G 2VQEQ 5IYBH 1N32Q 3GDEA 1XMOQ 2VS1A 2YTXA 5HY6A 1OXTA 1UE7A 3OYYA 4JI6Q 1LYLA 2JK8A 5EAYA 1RL2A 1UE5A 2E2HH 1UE1A 4A3BG 1Q12A 4A3JH 1IBLL 2ATWA 2NZHA 3FKIH 4B3SL 4DV5L 4HIKA 1N36Q 4DV0Q 2HIXA 2MNAA 4MZ9A 1K9MC 1AE3A 1B8AA 1JT8A 4BY7H 4OX9Q 2F4VQ 1S3OA 1X3FA 4OWTB 5IYBG 3TEHB 1XNQQ 2JA6H 1YHAA 2WAQG 5GQOA 1JE5A 4UP8A 1NBWA 3I4NG 4GN4B 2AWOA 4BY1G 1L1OB 2UU9L 2VQFL 1PH1A 1C7YA 1EQRA 1XNRQ 4GKKQ 2R7ZH 4KHPL 2LXJA 2K5NA 4JI1L 4IPCA 4DR2Q 1E24A 1GM5A 1K8GA 2HIVA 2VW9A 3S1QH 1GKHA 3HOUH 4A3DG 4B3TL 4GNXA 1YHBA 1A62A 4YCVA 1KC8C 1QZGA 4DUZQ 4DUYL 1VQOA 4NXNL 3MEFA 1YITA 4DR4Q 4POGA 3G6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CUK A;  5GAD C;  5FLM H;  3T1H Q;  1HNX L;  1YHQ A;  4BBS H;  2WP8 J;  4JBW A;  4AH6 A;  1MIU A;  4R4I A;  4JI0 L;  4DR5 L;  3S1N H;  2RF4 A;  2F4V L;  1VQM A;  4UY8 C;  3U4V A;  1KRT A;  3GTM H;  1SMX A;  1IYJ B;  4DPG A;  3CPW A;  5C3E G;  3CXC A;  1XPR A;  1HNW L;  1KD1 C;  1X56 A;  2N3S A;  3SGI A;  1KQS A;  1Y1V H;  1W3S A;  3I7F A;  4GKJ Q;  4A3L G;  2IHF A;  2I5M X;  3J80 c;  2DUD A;  2Q2H A;  1QUQ B;  2CQO A;  2VQF Q;  1XNR L;  2D0O A;  4HIO A;  4LFA L;  2JJQ A;  2IY5 B;  3PO2 H;  1V43 A;  3CF5 A;  1X55 A;  1C9O A;  1Z9F A;  4X66 Q;  1QVF A;  1SR3 A;  5IY0 A;  2F3I A;  1JB7 A;  1K73 C;  2KBN A;  4OON A;  3ULL A;  1HR0 Q;  4UP7 A;  2VUM H;  1A63 A;  3G71 A;  4AQY L;  4JI4 Q;  2YTV A;  1EOV A;  1IBK L;  4NXM L;  1FJG L;  1Q46 A;  4C3H H;  4A3G G;  4GLX A;  4A3K H;  3RZD H;  1OTC A;  3PO3 G;  3AYH B;  4APV A;  4DR3 L;  4HJ7 A;  3CC4 A;  2A19 A;  3H0G G;  3PSI A;  1HNX Q;  1BBW A;  3CW2 C;  1AE2 A;  2UXD L;  5GAG C;  2PQA B;  4H02 A;  1VQ6 A;  1AH9 A;  4QY7 A;  3S16 H;  1XMQ L;  1VQ9 A;  3LGJ A;  1X6O A;  1L1O A;  4PG3 A;  3M4P A;  2FXQ A;  3K8A A;  3KF6 B;  4WJ3 M;  3S1M H;  2R92 H;  2N49 A;  3K7A H;  3RN5 A;  1E3P A;  3ULP A;  3L0O A;  4WJ4 A;  1UWV A;  2UUC Q;  4JI8 Q;  3D31 A;  3HOX G;  1CKM A;  5IP7 H;  2ZM6 Q;  1A8V A;  2OCE A;  1N8R C;  3I4O A;  1E22 A;  4OO1 I;  3I4M G;  3HOW H;  5IE8 A;  3HOU G;  1EIY B;  1MJC A;  4LUZ A;  3TS0 A;  4LF4 L;  3RN2 A;  3M4Q A;  1EWI A;  3KF8 B;  1JMC A;  4A3I H;  3KJO A;  3K0X A;  3NEM A;  4JI2 L;  2BH2 A;  4DR7 L;  3OTO L;  4JI7 L;  1K8A C;  1KRS A;  1E1O A;  2K75 A;  1HNZ Q;  3S15 H;  1N36 L;  1GD7 A;  4DK3 C;  1FJG Q;  2DGY A;  2C35 B;  3TQY A;  4ME3 A;  1K83 H;  2CWP A;  4DR3 Q;  4A3E G;  4DKA C;  1PH7 A;  3IRB A;  1HR0 W;  4BBS G;  1N33 L;  3EN2 A;  1N32 L;  2R6G A;  2Z0S A;  3E9I A;  5IWA L;  1D8L A;  5IWA Q;  3F2D A;  2OTJ A;  4EX5 A;  1FL0 A;  1VQE A;  1VS0 A;  3CAM A;  2VQE L;  3S2H H;  2OTL A;  3HOY H;  4A3F G;  4LW1 A;  1KXL A;  1X3E A;  2KCM A;  4POF A;  3BZK A;  1J6Q A;  3GTG H;  3PUX A;  1Y1W G;  1M90 C;  4OO1 G;  1V1Q A;  2GVA A;  4P75 A;  2AWN A;  1SFO H;  1WOC A;  2RHQ B;  4GOP A;  4A4I A;  1UEB A;  2K5H A;  3W1B A;  4YHH L;  4GKJ L;  3HOY G;  2KEN A;  4NPS A;  4JI8 L;  3K80 C;  2E2I H;  3M7N A;  2VL6 A;  4LF6 L;  4C2M H;  5HGQ A;  3U4Z A;  2IT1 A;  4XTC S;  4DNI A;  4A3J G;  1Q8K A;  2YTY A;  3ULJ A;  3T1H L;  4A3K G;  4JI0 Q;  3PO3 H;  4BXX H;  2ZJP A;  2ZJR A;  4IO9 A;  3KDF B;  4DR4 L;  3KF6 A;  4DUZ L;  2HQL A;  4B3R Q;  4JC0 A;  4DAM A;  2VUM G;  2K14 A;  1VQL A;  1VQC A;  2BA0 A;  4J15 A;  1XPO A;  1WCM G;  4JI4 L;  4NXN Q;  4EQ5 A;  2Q2U A;  3CQZ H;  2PQA A;  3S1R H;  3W1G A;  3PO2 G;  1TWF H;  5IT9 c;  3H15 A;  4JV5 Q;  4KHP Q;  5M5W H;  4PZ6 A;  3F8T A;  5IP7 G;  5M3F G;  1YIJ A;  1MJE A;  3HOW G;  1CSP A;  4A3D H;  4JOI A;  4HJA A;  4BY7 G;  4DV3 L;  3FP9 A;  3U50 C;  1S40 A;  1E7Z A;  1ASY A;  1OXV A;  1WCM H;  2YU9 H;  4DV2 L;  2IHE A;  1LTL A;  3HFZ B;  3STB D;  5C3E H;  3CCU A;  1M1K C;  2R92 G;  1VCI A;  2LXK A;  4YCW A;  3F2C A;  1HZA A;  3PF5 A;  2WB1 E;  3H0G H;  5DLQ E;  4MTN A;  4BXX G;  4GN5 A;  4X65 Q;  4DV0 L;  2XGT A;  2Z6K C;  4KI0 A;  4O2D A;  1PH8 A;  2AKW B;  2GN5 A;  4HJ5 A;  4X66 L;  4DR5 Q;  1FGU A;  1VQJ A;  4GOP C;  1YVC A;  2B3G A;  1X3G A;  1XJV A;  5JJL A;  5LMN L;  1CKO A;  1K0R A;  1Q82 C;  3CPF A;  1XMO L;  2E8G A;  1YZ6 A;  3ICE A;  1X54 A;  4R4C A;  2PMZ E;  4LFC Q;  2ZM6 L;  2ZJQ A;  1IL2 A;  4LUV A;  2HHH Q;  2OQK A;  3CMA A;  4YY3 L;  1N9W A;  5BR8 Q;  1K3R A;  3CD6 A;  2PI2 E;  4QIW E;  3J81 c;  4JI3 L;  4OWX B;  4GLV B;  1Y1V G;  1WYD A;  3JAM i;  4GS3 A;  4DV6 Q;  4TQU S;  1V9P A;  3VDY A;  1Q1E A;  2CFM A;  2PNH A;  2UU9 Q;  1HZC A;  1KHI A;  4JI1 Q;  4L5Q A;  2F52 A;  3PUZ A;  5JEA J;  3UE1 A;  5IP9 H;  2QA4 A;  4OWW B;  2JA7 H;  4A93 H;  2ALY B;  4GKK L;  3CCE A;  4HJ9 A;  2KHJ A;  3U58 A;  1HH2 P;  3T1Y L;  1VQK A;  3ZJY C;  1HZ9 A;  1TWH H;  1PH3 A;  1HZB A;  2E5L Q;  5E7N A;  1GVP A;  2UUB Q;  3CCQ A;  3GTQ H;  1Y14 B;  5IYC G;  4AYB E;  1IBM L;  1VQI A;  3CC7 A;  5C0X G;  3J7Z C;  2K5V A;  4DR1 Q;  4BY1 H;  4DV1 L;  2NVY H;  4X62 L;  3PGZ A;  4A3I G;  1XTD A;  4DK6 C;  1EYG A;  1YBY A;  3AQQ A;  3PCO B;  3S17 H;  2QEX A;  1E1T A;  1Q86 C;  3OW2 A;  1XPU A;  4GNX B;  4A75 A;  1VQN A;  3GTJ H;  2KHI A;  5ELO A;  3CCJ A;  3CC2 A;  1N33 Q;  2A8V A;  1YNX A;  4YWK A;  5GRO A;  1PH9 A;  1HNW Q;  1P16 A;  2WB1 G;  4FDB A;  5J3B A;  4GOP B;  3M3Y H;  4DV4 L;  3ER0 A;  3MXN B;  2EXD A;  3S14 H;  1NMG A;  4LF7 Q;  4JBM A;  3GTL H;  2JA8 H;  4JI2 Q;  4UPA A;  3CCL A;  2LSS A;  4IJL A;  5LMN W;  3T1Y Q;  2JA8 G;  2I5L X;  3ERS X;  5GAE C;  3Q8D A;  4A3C G;  5C44 G;  1EUJ A;  3I2Z A;  5M3F H;  2R7D A;  1J5E Q;  5H1S E;  5K36 G;  3KJP A;  4UP9 A;  2CKZ B;  5C4J H;  3HKZ E;  2N8N A;  3A74 A;  3CCV A;  4DV7 L;  2PI2 A;  4A76 A;  4YHH Q;  2Y0S E;  1PA6 A;  4LF6 Q;  4YWM A;  1KL9 A;  3KFU A;  2CCZ A;  4YCU A;  1JJC B;  2KCT A;  5ELN A;  1LM0 A;  4QL5 A;  3GO5 A;  3EBE A;  3PUW A;  5FJ8 H;  1Q7Y C;  2Q2T A;  3KOJ A;  3K7U C;  2HHH L;  4QJF A;  1B7Y B;  2K50 A;  3M85 A;  2I5H A;  4A3M H;  1D7Q A;  4R4T A;  1WJJ A;  3JAM c;  2RCN A;  4YWL A;  2YV5 A;  1OXS C;  1TWG H;  2UXD Q;  2JA9 A;  4IJH A;  3PIP A;  3CCM A;  1XNQ L;  1XMQ Q;  4OX9 L;  4GN3 B;  3RLF A;  2VZA A;  1PFS A;  4X62 Q;  4DR6 Q;  2AMC B;  1EIF A;  3G48 A;  1G6P A;  5C4X H;  4NB3 A;  5GAH C;  3DM3 A;  1DGS A;  4DR1 L;  1IBK Q;  4B3S Q;  4R1J A;  4LF7 L;  3GTK H;  4A3L H;  2QGQ A;  5IYD H;  4ALP A;  1YJN A;  1BVS A;  3TRE A;  4C3I H;  1MKH A;  3DLL A;  2XTI A;  2R93 H;  3KLW A;  4X65 L;  2UXB Q;  3JC6 6;  2N78 A;  5M5Y H;  1HNZ L;  2B63 H;  5AJ3 Q;  1SRU A;  4B3M Q;  2E5L L;  2ZTC A;  1YI2 A;  2JA5 H;  1QUQ A;  2BA1 A;  2NZO A;  3UDI A;  3PF4 A;  2Q2I A;  2JEB I;  4A3F H;  2K52 A;  3HOV H;  3TS2 A;  3M4O H;  4JI5 L;  4TVA B;  2MO0 A;  5JJI A;  4PMW A;  3PUV A;  3RLN A;  4IOA A;  5JEA G;  1I3Q H;  2WAQ E;  3L2P A;  2ID0 A;  3EIV A;  1I94 Q;  1X9N A;  2E2J H;  2NVX H;  4JI3 Q;  1PHJ A;  3I4M H;  1VQD A;  3A5Z B;  4RG1 A;  4DV7 Q;  5BR8 L;  4IPG A;  4A3E H;  4XIG S;  1UE6 A;  1CKN A;  2MQH A;  4YY3 Q;  4QQB X;  1VQ7 A;  3RZO H;  1I6H H;  5IYC H;  3UE0 A;  4IFD J;  1C0A A;  3J81 i;  1YJ9 A;  4L5T A;  1QVC A;  2EIF A;  2L15 A;  2RHS B;  4HIM A;  2HT1 A;  5JJK A;  1PVO A;  4DV6 L;  1CKN B;  1OXU A;  5FLM G;  4JYA Q;  3HKZ G;  1NY4 A;  1JJ2 A;  3CP0 A;  5C44 H;  1PYB A;  2BH8 A;  2MO1 A;  4KLK A;  1I50 H;  4A3C H;  1VQ4 A;  2Z6K A;  3J81 j;  4B3T Q;  1X65 A;  4LF5 Q;  3NEN A;  3E9H A;  4K0K L;  2ASB A;  4A3B H;  1T9H A;  4IOC A;  1PH5 A;  3M9B A;  1TWC H;  3J7A 5;  3HOX H;  3WWV A;  2UUA Q;  4DV1 Q;  2JEA I;  2EQS A;  1I94 L;  2CWA A;  4JOI C;  3PIO A;  5FJ8 G;  4PZ8 A;  2JA6 G;  4DV3 Q;  4IFD G;  3I4N H;  4LNQ A;  1W2B A;  2A1A A;  4LUO A;  2UUB L;  3NBH B;  3CCS A;  5C0X I;  1IBM Q;  4JV5 L;  1NMF A;  1IBL Q;  1ASZ A;  1SLJ A;  1QZH A;  3HOZ G;  1Q81 C;  5C4X G;  2GVB A;  4LFB L;  3HOV G;  4DV5 Q;  4JI6 L;  2B29 A;  1L1O C;  4X64 Q;  3CME A;  4IFD I;  1N34 L;  1VQH A;  3RR5 A;  4BBR G;  3I55 A;  3TRZ A;  1IXR A;  1JJG A;  3GD7 A;  1VQF A;  4LF5 L;  3H3V I;  4HID A;  4JYA L;  5LMU L;  1Z47 A;  4Y7N H;  1Q1B A;  4LF9 L;  1EQQ A;  3F2B A;  3NEL A;  3GTO H;  3H3V H;  1G51 A;  1NTG A;  2V1C C;  3RLO A;  2VY3 A;  3W5O A;  4DUY Q;  4HJ8 A;  3B6Y A;  1VQ8 A;  3KDF A;  1KIX A;  1SE8 A;  4P73 A;  4K0K Q;  4IPD A;  1QVG A;  2R7F A;  5M3M H;  1R9T H;  1YJW A;  3S2D H;  4DR2 L;  4C3J H;  1TWA H;  4GNX C;  3BZC A;  4JBK A;  1BBU A;  2IX0 A;  3BJU A;  4L5R C;  4PZ7 A;  1P8L A;  3HKS A;  2JE6 I;  2ZTE A;  1S72 A;  4LF9 Q;  3I56 A;  2I0Q A;  5LMN Q;  1SN8 A;  1I5F A;  3AFQ A;  3UDG A;  5IYD G;  3RNU A;  1SRO A;  4RMF A;  1N34 Q;  4A3G H;  4X64 L;  5C0X J;  2ZTD A;  3FKI G;  1KAW A;  1NE3 A;  1VQA A;  3AFP A;  5AJ3 L;  1PV4 A;  1WFQ A;  4LFB Q;  2UXB L;  4IPH A;  4JCV E;  1PH4 A;  1WI5 A;  2UXC L;  3CCR A;  2YYZ A;  1CSQ A;  2JQO A;  3G4S A;  2D0P A;  2MFI A;  4DV2 Q;  4AQY Q;  4L5S A;  4DR6 L;  4JI5 Q;  2R7Z G;  1HR0 L;  3OTO Q;  4JI7 Q;  4R4Q A;  3BU2 A;  1VQB A;  2UUA L;  4DAY B;  5FLX c;  4LFA Q;  4QGU A;  2OWO A;  1TXY A;  2NVQ H;  1A0I A;  1G29 1;  1U5K A;  4AYB G;  1BKB A;  1HJP A;  3FHW A;  1NJI C;  4B3M L;  4X6A H;  1VQP A;  2R93 G;  4Y52 H;  1IZ6 A;  1U0L A;  1OXX K;  4O0A A;  4KHZ A;  4P74 A;  4AIM A;  2NVT H;  2UXC Q;  2NN6 G;  1PH2 A;  1PYS B;  1O7I A;  4OXP A;  4DR7 Q;  3PUY A;  4B3R L;  4JBJ A;  4LF8 Q;  4GLA C;  5IP9 G;  2JA7 G;  2OQ0 A;  3A0J A;  2NN6 I;  3D0F A;  3GTP H;  1H95 A;  3UDX A;  4A3M G;  2AHO B;  4BBR H;  2B63 G;  3A5U A;  2WFW A;  3STB C;  4BA2 I;  2VNU D;  1FVI A;  1Y1W H;  4LF4 Q;  2K4K A;  4LWC A;  1VQG A;  3UDF A;  4R4O A;  3AEV A;  1B70 B;  1L2F A;  2IX1 A;  3KYH C;  1L0W A;  4P71 A;  4DV4 Q;  4LF8 L;  1EFW A;  2ES2 A;  4NXM Q;  2UUC L;  3HOZ H;  3E0E A;  4A93 G;  1GO3 E;  3S24 A;  1RIP A;  4BA1 I;  1YEZ A;  5M3M G;  2D62 A;  4MNO A;  4P72 A;  3J80 i;  1LUZ A;  3L7Z C;  4LFC L;  1VQ5 A;  1J5E L;  1PH6 A;  5M5X H;  2H5X A;  3F1Z A;  2Y0S G;  4JG2 A;  5LMU Q;  3PV0 A;  3K81 C;  2JA5 G;  2VQE Q;  5IYB H;  1N32 Q;  3GDE A;  1XMO Q;  2VS1 A;  2YTX A;  5HY6 A;  1OXT A;  1UE7 A;  3OYY A;  4JI6 Q;  1LYL A;  2JK8 A;  5EAY A;  1RL2 A;  1UE5 A;  2E2H H;  1UE1 A;  4A3B G;  1Q12 A;  4A3J H;  1IBL L;  2ATW A;  2NZH A;  3FKI H;  4B3S L;  4DV5 L;  4HIK A;  1N36 Q;  4DV0 Q;  2HIX A;  2MNA A;  4MZ9 A;  1K9M C;  1AE3 A;  1B8A A;  1JT8 A;  4BY7 H;  4OX9 Q;  2F4V Q;  1S3O A;  1X3F A;  4OWT B;  5IYB G;  3TEH B;  1XNQ Q;  2JA6 H;  1YHA A;  2WAQ G;  5GQO A;  1JE5 A;  4UP8 A;  1NBW A;  3I4N G;  4GN4 B;  2AWO A;  4BY1 G;  1L1O B;  2UU9 L;  2VQF L;  1PH1 A;  1C7Y A;  1EQR A;  1XNR Q;  4GKK Q;  2R7Z H;  4KHP L;  2LXJ A;  2K5N A;  4JI1 L;  4IPC A;  4DR2 Q;  1E24 A;  1GM5 A;  1K8G A;  2HIV A;  2VW9 A;  3S1Q H;  1GKH A;  3HOU H;  4A3D G;  4B3T L;  4GNX A;  1YHB A;  1A62 A;  4YCV A;  1KC8 C;  1QZG A;  4DUZ Q;  4DUY L;  1VQO A;  4NXN L;  3MEF A;  1YIT A;  4DR4 Q;  4POG A;  3G6E A; 
#chains in the Genus database with same CATH topology
 1HQM C;  1ZXT A;  3ETH A;  3OSN A;  4S3S A;  1HPC A;  1V1P B;  2FMC A;  2WP8 J;  4KJO A;  5I6Y A;  1BF4 A;  4KTA A;  1CS0 A;  4R4I A;  4JI0 L;  3MEH A;  1ZYR C;  2RF4 A;  3S1N H;  1E4G T;  2F4V L;  1VQM A;  4UY8 C;  3U4V A;  1KRT A;  2Y0S A;  3GTQ A;  3CPW A;  3OUU A;  2QF7 A;  3K5L A;  4L63 B;  2W6P A;  1KD1 C;  4MA5 A;  2HDM A;  2N3S A;  4K0K H;  2A6E C;  1K28 A;  1JX4 A;  2DUD A;  4Q8F A;  2AQ3 B;  3GQB A;  2AQ1 B;  4PMC A;  1XX8 A;  1YNN D;  4NDX A;  2VQF Q;  4N8X 1;  4LFA L;  2WDT A;  1L0Y B;  3PO2 H;  3CF5 A;  1X55 A;  3FDT A;  1Z9F A;  4PMB A;  2X6G A;  3RV3 A;  2W9C B;  1GUS A;  3NUC A;  2KBN A;  1TS2 A;  4OON A;  2FPP B;  2R8I A;  1A63 A;  1VMC A;  5KFA A;  3R5H A;  1RK6 A;  5EWE A;  3S14 B;  4KKU A;  4LFB H;  1FJG L;  1LTR D;  1Q46 A;  5I2X A;  2R3Z A;  5KG2 A;  4A3K H;  3K3V A;  3AYH B;  4FU0 A;  2A19 A;  5D1O B;  3PSI A;  4HCS A;  1WTO A;  1AE2 A;  3SE7 A;  2A69 D;  2PQA B;  5GAG C;  1BNC A;  3N42 B;  5G3L D;  4QWA A;  2Z4I A;  1XMQ L;  3J81 L;  3KF6 B;  1LTB D;  2R92 H;  2XWJ B;  4A3J B;  3JSL A;  3ORQ A;  1EWC A;  1HQR D;  2BQ3 A;  1MD2 D;  1L0X B;  3HOX G;  1PFM A;  4OO1 I;  1ZET A;  3I4M G;  1B9M A;  2O2L D;  5CR3 A;  2Z1C A;  5L1J A;  1MJC A;  4OEM B;  3TS0 A;  1E2Z A;  2HVQ A;  2F0J A;  2YW2 A;  3NTK A;  3KJO A;  4JI2 L;  2BH2 A;  1SMY D;  5EKL A;  3OTO L;  3S9W A;  1LT4 D;  1HNZ Q;  4A3B B;  3A8J E;  2EYL A;  3EYY A;  4MV7 A;  1N36 L;  2N55 A;  2BCO A;  3DWQ A;  3M4Y A;  2B2Y C;  4A3E G;  1K83 H;  4RGT A;  4BBS G;  4XX0 B;  3IRB A;  3LWE A;  3UI2 A;  2R6G A;  2Z0S A;  5C4X B;  1D8L A;  5C4H A;  3T5J A;  1JDB B;  4R8U A;  4E6I A;  4K2L A;  3RFC A;  3J80 W;  5BN5 A;  2VQE L;  3S2H H;  2KED A;  1K8O A;  3V6H A;  1IYV A;  1C8C A;  5FLX W;  1JR0 D;  3I8Z A;  5J22 A;  3K6O A;  4A93 B;  3JZI A;  3BZK A;  3MXG A;  2QIL A;  2K33 A;  1ET9 A;  1SND A;  1Y1W G;  4RAY A;  1JB3 A;  4B3R H;  3TII A;  1SFO H;  4CDC C;  2RHQ B;  1BNZ A;  1I6H B;  3GV3 A;  4C1N I;  1J8I A;  3KHR A;  3P1H A;  1EZ8 A;  4HSV A;  4GKJ L;  3ERQ A;  2KEN A;  4DAP A;  2XRQ D;  4JI8 L;  1GXD C;  1KJ9 A;  2VL6 A;  5JJZ A;  5HGQ A;  3U4Z A;  4XTC S;  5KFE A;  2IA6 A;  3T1H L;  4F7X A;  4C3H G;  2F0F A;  3MWM A;  4B9W A;  1CTM A;  1BCP B;  2ZJR A;  1WTW A;  2K5W A;  2WE6 A;  5J2U F;  3L9A X;  4JC0 A;  2GPW A;  3GTK A;  3E6Z X;  4L6T B;  1XPO A;  4I50 F;  1Z6H A;  3CRK C;  2UVR A;  2Q2U A;  1TS4 A;  3S1R H;  1TWF H;  3H15 A;  2EYP A;  1TY0 A;  3F8T A;  3P7J A;  1DOL A;  5JEA H;  2FPI B;  5IP7 G;  5C1P A;  5C3W A;  4DK0 A;  1CSP A;  1WD0 A;  3P75 A;  4BY7 G;  4MV6 A;  3MR5 A;  4HN7 A;  1ASY A;  3M4I A;  1OXV A;  5LP6 F;  2EY2 A;  1M4V A;  2UUC H;  3S2D B;  5KG0 A;  2IHE A;  4RZR A;  3KXY T;  3CCU A;  1M1K C;  2R92 G;  2LXK A;  3EPG A;  1IW7 C;  1HZA A;  1PTO F;  2BOS A;  1ET6 A;  2KJX A;  4BXX G;  1ZEQ X;  4DV0 L;  5JVL A;  2XGT A;  2Z6K C;  4LH6 A;  5M9O A;  4HJ5 A;  4MTE A;  5EWG A;  1VQJ A;  3IKJ A;  5FLX L;  1PLF A;  2BQR A;  4DXG A;  3O13 A;  1GHJ A;  1STY A;  5LMN L;  4KN7 C;  4G3I A;  3TZU A;  1EIG A;  1X54 A;  1JC7 A;  1LT6 D;  4LUV A;  3VPB A;  2ZDQ A;  2OQK A;  1J9O A;  4B3M H;  2NWG A;  3CD6 A;  5C5J A;  2PI2 E;  3PW7 A;  1KNA A;  2YRX A;  2A6H D;  4ECY A;  4GLV B;  2UVW A;  1WYD A;  3JAM i;  1X32 A;  2CFM A;  3W2D A;  2PNH A;  3C1F A;  3SR1 A;  1GGO A;  2QA4 A;  3MHB A;  4A93 H;  4EBD A;  1Y8N B;  2KUM A;  3MWY W;  4IR1 A;  5KG3 A;  2FFK B;  2WII B;  1T5E A;  5LA6 F;  4N9T A;  2KVM A;  1JWS D;  1HH2 P;  3K58 A;  2L4N A;  2F0E A;  4JI4 H;  5KEE A;  4TSS A;  3SI8 A;  3Q22 A;  1RHP A;  2KCC A;  3GTK B;  1GVP A;  2UUB Q;  3GTQ H;  4FS1 A;  1I7N A;  5IYC G;  4AYB E;  1FKA H;  3S1Q B;  3CC7 A;  1OWT A;  5C0X G;  4HR7 A;  2FLP A;  3Q8P B;  4B3S H;  1W93 A;  1CK1 A;  4X62 L;  4A3I G;  5CV9 A;  3OSP A;  1I7L A;  2R85 A;  3PCO B;  1BCP C;  2RGR A;  1XPU A;  1CA5 A;  1VQN A;  5JOB A;  1N33 Q;  4G4K A;  4O3Q A;  1PH9 A;  1P16 A;  1SJE D;  4FDB A;  3RJ0 A;  1K0S A;  5COR A;  3ER0 A;  4N8F A;  4HNV A;  2LSS A;  4IJL A;  5LMN W;  4KK7 A;  3NP8 A;  4A3C G;  1NNX A;  3RUZ A;  1J5E Q;  5H1S E;  4EQO A;  3KJP A;  2B63 B;  4J9L A;  3HKZ E;  3CCV A;  1PA6 A;  2PI2 A;  4ZYS A;  5DLG A;  2NUA B;  1GYF A;  2CCZ A;  4DAV A;  4NKL A;  4NXN H;  1JJC B;  4EG0 A;  1LM0 A;  4QL5 A;  3N41 B;  4C5B A;  3PUW A;  5I4D A;  5CB4 F;  4QJF A;  3JRX A;  4F88 A;  3M85 A;  1LAC A;  2RA4 A;  4FBU A;  4UHV A;  1HNW H;  1CZG A;  2E5L H;  3SE0 A;  1KAB A;  1OXS C;  1TWG H;  1ML0 D;  1WTP A;  1TVX A;  2XC9 A;  3AMU A;  4ECW A;  1ENA A;  5A2Q W;  4DR6 Q;  5IT9 L;  1GHK A;  5C4X H;  3GTK H;  1IBK Q;  4LF7 L;  3S1M B;  5K36 G;  1YJN A;  4F87 A;  3TRE A;  2XTI A;  1ICF B;  3KLW A;  2RCF A;  4IUV A;  3IFD A;  3JC6 6;  2UXB Q;  2SNM A;  3K5I A;  3OHA A;  1QB5 D;  2ZTC A;  4DNT B;  4Q0F A;  1Y1W A;  5C6A A;  2WTF A;  2PZW A;  1QUQ A;  3JAM E;  2ENB A;  3NSW A;  2JEB I;  5BN4 A;  3GTL B;  5LMU H;  2MO0 A;  3RLN A;  4IOA A;  3M3Y B;  1TA8 A;  3L2P A;  2ID0 A;  2E2J H;  3I4M H;  2TMP A;  3A5Z B;  2KA7 A;  4DV7 Q;  5M5W B;  3BQ0 A;  5EPK A;  1CKN A;  2MQH A;  1I6H H;  2ASL A;  5IYC H;  4IFD J;  2IP4 A;  4IUR A;  2E2H B;  4L5T A;  1PTO B;  5JJK A;  4MTD A;  2W9C A;  3MA2 B;  5F2D A;  3MTS A;  4CDD C;  4JYA Q;  3HKZ G;  1JJ2 A;  1S0M A;  4TKO B;  1UAP A;  1WTQ A;  5C44 H;  2BH8 A;  3NTH A;  3OOC A;  2F0Q A;  1I50 H;  3PN1 A;  3PW2 A;  2Z6K A;  4NW2 A;  2J6S A;  3E9H A;  4O4I F;  3NTI A;  2ASB A;  4UFZ A;  1STH A;  1T9H A;  4IOC A;  4Y8V B;  3M9B A;  3J7A 5;  1O7Z A;  4DV1 Q;  2EQS A;  1S5B D;  1B04 A;  2FKL A;  1I94 L;  4YAJ B;  1RJT A;  1GSO A;  5FJ8 G;  2JA6 G;  3PIP 3;  4TQS A;  2PZU A;  2JA5 B;  4F4Z A;  4JV2 A;  4LUO A;  4EGV A;  2V5A A;  4FNF A;  3CCS A;  5C0X I;  1IBM Q;  3RGX A;  1SSO A;  2J6U A;  4JV5 L;  4FP5 D;  1QZH A;  2R92 A;  4LFB L;  2N88 A;  2YRW A;  1L1O C;  4JV5 H;  2EE1 A;  2HCC A;  2YCH A;  2KQ3 A;  4J6H A;  2F0P A;  3I55 A;  2FP4 B;  1IXR A;  1G8Z D;  1S5E D;  2NVX B;  1GLV A;  3KAJ A;  1SE2 A;  4HID A;  1Z47 A;  5KFX A;  3MZ5 A;  1TWG B;  2DJG C;  3K5M A;  2V1C C;  3RLO A;  2GLT A;  2KOL A;  2DZD A;  4RHS A;  1WTX A;  1BDO A;  2R7F A;  3N52 A;  1R9T H;  1KEE A;  1TII D;  4DL4 A;  1BBU A;  1F2Y A;  3Q1K A;  2JYO A;  3BJU A;  4RUC A;  4LF9 H;  1EL0 A;  3HKS A;  5J39 A;  2EYH A;  2VQD A;  4LF9 Q;  2NVQ B;  5KYI A;  4MTK A;  1TWF A;  1HR0 H;  4X64 H;  2FE3 A;  1RTO A;  4RMF A;  1A3V A;  3QB3 A;  2W57 A;  3NBI A;  5C0X J;  3AFP A;  1DOK A;  1KAW A;  4KY7 A;  3NGD A;  5COY A;  1WFQ A;  3JAM L;  4N9P A;  2YZM A;  1WTH A;  4JCV E;  1STN A;  1TY2 A;  2B8F A;  4J9N A;  1PH4 A;  2F0N A;  3T5H A;  1WI5 A;  4O4L F;  2YYZ A;  1CSQ A;  2JQO A;  5KFS A;  1LTG D;  4DV2 Q;  4L5S A;  5L1K A;  3I90 A;  3V6J A;  3W3A A;  4RAU C;  4KKS A;  5CV7 A;  1PFN A;  1VQB A;  2UUA L;  3V2T A;  1C48 A;  1TXY A;  2A6E D;  4QUC A;  1U5K A;  2V58 A;  2NTS A;  1BKB A;  3FHW A;  4B3M L;  2PMZ A;  3T1H H;  5A35 A;  2V4R A;  1KDB A;  4ED6 A;  4P74 A;  4KHZ A;  3I4M B;  2VA3 A;  2NN6 G;  4JV1 A;  4DR7 Q;  4OXP A;  3Q23 A;  4LF8 Q;  3HKZ B;  3NPP A;  4RNM A;  3FPU B;  1LTT D;  1SE4 A;  3F2U A;  3GTP H;  1PYW D;  1H95 A;  2W9B B;  4BBR H;  4LSX A;  2K28 A;  3I91 A;  3RZO B;  1FVI A;  3R8B A;  1Y1W H;  4DN4 M;  2CZG A;  4LWC A;  1VQG A;  4LF5 H;  1XWE A;  3GV5 B;  4FYD A;  1WVL A;  4LF8 L;  4O3P A;  3ONA B;  2UUC L;  3E0E A;  1GO3 E;  1HA6 A;  3RD4 A;  4BA1 I;  5M3M G;  1T36 A;  2D62 A;  1PRT D;  2XD4 A;  1LUZ A;  3L7Z C;  2LFN A;  1PH6 A;  1QWY A;  2H5X A;  3D4D A;  2Y0S G;  1XNR H;  4JI2 H;  1D1K A;  5I9O A;  2G5D A;  5IYB H;  5E1F A;  2H4O A;  1MGS A;  2VS1 A;  2AQ2 B;  2PQE A;  1OXT A;  4MV4 A;  2FIN B;  3OYY A;  1UE5 A;  3KLS A;  5IOD A;  4J9O A;  1IBL L;  1N33 H;  1WD1 A;  3FKI H;  3FRP B;  4B3S L;  3R23 A;  1AE3 A;  4OX9 Q;  1H9M A;  3H3V C;  3V6K A;  5KFR A;  1LTS D;  1E2V A;  2J4X A;  2WAQ G;  1NBW A;  4M8A A;  2W6O A;  3BDL A;  1L1O B;  4J8Q A;  1EQR A;  2WIN B;  2L5T A;  1TWC B;  2LKV A;  2ASD A;  4ME5 A;  4A3D G;  4B3T L;  4LFC H;  1G6Z A;  1QNK A;  1S03 G;  4J9Q A;  4ZUJ A;  4DUY L;  1VQO A;  4F50 A;  3MEF A;  2W9A A;  4G7Z C;  2EZV A;  5FO7 B;  4POG A;  5KG7 A;  2VOB A;  4R7R A;  2E2H A;  2F0D A;  2M2L A;  3T13 A;  1ILP A;  4LF4 H;  1EQT A;  2K05 A;  1HNX L;  1HFN A;  4BBS H;  1E4E B;  4JBW A;  3GIM A;  4CBV A;  2WB1 B;  4AH6 A;  2WAC A;  4LFA H;  3I73 A;  4DR5 L;  2CHB D;  4WD3 A;  5IT9 W;  1JIC A;  1K3B C;  4MIU A;  1XNQ H;  3GTM H;  1IYJ B;  4DPG A;  4DV5 H;  4J9P A;  2DNE A;  4JPB W;  3SGI A;  2NN6 H;  2AUK A;  1W3S A;  2R6F A;  2I5M X;  1BO0 A;  4DR4 H;  1GSH A;  3SHL A;  3QOL A;  1QUQ B;  2CQO A;  2D0O A;  1Y1W B;  3KAK A;  2IY5 B;  2VQE H;  4BBR B;  4ZKB B;  4K8J A;  1OO9 B;  4JI6 H;  2F3I A;  4RGN A;  1K73 C;  1JB7 A;  5H80 A;  1WTV A;  3A8I E;  3VYS A;  1HTP A;  3K59 A;  1EOV A;  5IIF A;  1S68 A;  3H4B A;  4C3H H;  1GUG A;  4A3G G;  4GLX A;  3RZD H;  2B2V C;  1CZW A;  4GZY C;  2RDJ A;  5HGT A;  4JI1 H;  3Q6S A;  3CHB D;  1GJX A;  2F3W A;  1HNX Q;  2MUY A;  4ECZ A;  1IYU A;  1VQ9 A;  2B2T A;  2R8G A;  3M4P A;  2FXQ A;  3K8A A;  4WJ3 M;  1PMR A;  2N49 A;  3Q8R B;  4HTH A;  2K1B A;  4YIJ A;  4JI8 Q;  3N40 P;  3D31 A;  1N8R C;  5IP7 H;  4EQN A;  5KFI A;  3RBE A;  1EIY B;  2WAQ B;  4LF4 L;  2RBM A;  2JA7 B;  3KF8 B;  3CQZ A;  4QCL A;  5JVD F;  2BQU A;  1DON A;  3LML A;  3PQI A;  1E1O A;  2QK4 A;  4DK3 C;  2R93 B;  2EXZ A;  5FKA C;  2C35 B;  5F9N A;  4ME3 A;  2CWP A;  4DV2 H;  3PVX A;  5ISR A;  1S10 A;  2G9H D;  3E9I A;  3F2D A;  3BS1 A;  3MFI A;  1II3 A;  1JQY D;  3N44 B;  5EKI A;  5KT2 A;  3K5H A;  5D1P A;  1AZQ A;  3HGB A;  3TBI B;  2A73 B;  2F03 A;  4RAZ A;  3PO2 B;  3HOY H;  5EPJ A;  4A3F G;  4LW1 A;  3ORR A;  1X3E A;  3H6M A;  4ZQI A;  1SYB A;  4POF A;  5C0X H;  2UU9 H;  4FF2 A;  3GTG H;  5C8Y F;  4BY7 B;  1I4X A;  3X3M A;  3TME A;  2CW7 A;  2DNC A;  1WOC A;  3UQ8 A;  4RB1 A;  1E4E A;  2EOT A;  2P5Z X;  1S97 A;  2J0T D;  3HOU B;  1TWH B;  4YHH L;  3ERO A;  5DG8 A;  4XZ3 B;  3KHH A;  4IWY A;  4NPS A;  3K80 C;  4Q43 A;  3M7N A;  1A3T A;  4WRD A;  4A3K G;  1GUW A;  2NU9 B;  1E2W A;  4Q44 A;  1A2U A;  3KDF B;  4DR4 L;  3KHG A;  2HQL A;  3DEO A;  1K83 A;  3MWE A;  4ED0 A;  3BQ2 A;  3JAM W;  1WCM G;  3GII A;  4A3G B;  4HNU A;  3GV6 A;  2AGP A;  3J80 E;  2XSC A;  3CQZ H;  4XYL B;  2HD3 A;  4JV5 Q;  1MBY A;  2XIW A;  4HQ6 A;  3HB9 A;  3CRL C;  4KHP Q;  4EEQ A;  2W6Q A;  5M3F G;  1YIJ A;  3HOW G;  1GUN A;  3OIP A;  2OH2 A;  1KJQ A;  3FP9 A;  3U50 C;  3EA6 A;  5A2Q E;  1AN7 A;  1EEI D;  3HXL A;  3H94 A;  1B3Q A;  4DV2 L;  1LTL A;  3HFZ B;  3TSS A;  5C3E H;  2BE5 D;  3ITP A;  1VCI A;  4LSA A;  1B9N A;  1HTL D;  4O3N A;  2F1M A;  4HYK A;  2PW7 A;  2Q8I B;  3OWF A;  2WB1 E;  1V4Y A;  3RTX A;  5KFC A;  3CU7 A;  2R8J A;  4X65 Q;  1I4R A;  4O2D A;  4DR5 Q;  4X66 L;  1FGU A;  3N6R A;  1EYD A;  1FYC A;  1X3P A;  4CJ2 C;  1XJV A;  2VPQ A;  1SXT A;  1K0R A;  1Q82 C;  2SEB D;  1PRT F;  2YS7 A;  5DAU A;  1N48 A;  4R4C A;  3D3R A;  3KBG A;  4LFC Q;  3MXN A;  1W96 A;  2HHH Q;  1N56 A;  3CMA A;  2Z4H A;  5JAV A;  3Q8S B;  2F0H A;  4QIW E;  1IOW A;  4OWX B;  4PV1 C;  5DG9 A;  5ELF A;  2YU9 A;  2NVY A;  2LMC B;  4DV6 Q;  1Q1E A;  1HZC A;  1KHI A;  3E0J A;  2JA7 H;  5E3F A;  1EY7 A;  1GUO A;  4FBT A;  1F2M A;  1JDE A;  2KHJ A;  5EZY F;  5KG6 A;  4G57 A;  3U58 A;  4RB0 A;  2JEG A;  1BCP D;  4ME6 A;  1HZB A;  5KT7 A;  1B53 A;  3BVZ A;  1F77 A;  3BG3 A;  3HG9 A;  1Q90 A;  1IBM L;  1LLR D;  3MFY A;  4IUQ A;  3J7Z C;  2K5V A;  3N8D A;  4MN3 A;  4RFB A;  2K32 A;  4E4T A;  3GIJ A;  4OIK A;  2K03 A;  4C1N K;  3QJY A;  1E1T A;  3OW2 A;  3DMU A;  2DIK A;  4GNX B;  4A75 A;  3GTJ H;  2KHI A;  5ELO A;  1F2L A;  3KK7 A;  4YWK A;  5GRO A;  4RU9 A;  5FD5 A;  2WB1 G;  3M9M B;  5J3B A;  5DQI A;  1I3Q B;  1JIH A;  1RF2 D;  5KFF A;  1XYI A;  5FO8 B;  1CT1 D;  3IFT A;  3VYU A;  4JBM A;  3GTL H;  2JA8 H;  5L1L A;  1S5F D;  3S15 B;  5M3F B;  4RB2 C;  3OMG A;  3GP7 A;  4O3S A;  1GUT A;  3ERS X;  2QW7 A;  1NUC A;  2XCL A;  3GTO B;  2JA6 A;  5M3F H;  3HRZ C;  3TIN A;  5CMD A;  1JWM D;  2F0W A;  2MGS A;  5C4J H;  2JEF A;  3DXJ C;  4YHH Q;  5F9L A;  4O2B F;  4ZAI A;  5IGC A;  2KCT A;  5LOV F;  3DHQ A;  4PNY A;  1SEI A;  3GO5 A;  3KUP A;  3EBE A;  5FJ8 H;  1Q7Y C;  2HHH L;  3RIZ A;  1AP0 A;  1JCK B;  2X69 A;  5D1O A;  5IGD A;  1TAE A;  1NSN S;  1WJJ A;  3HKZ A;  2UXD Q;  2C22 A;  4OX9 H;  1U4L A;  4OX9 L;  4GN3 B;  3K57 A;  3QIA A;  3NWT A;  4X3S A;  3RLF A;  2VZA A;  4X62 Q;  3GQC A;  2M00 A;  2AMC B;  1G6P A;  1CA6 A;  4NB3 A;  4RHR A;  4B3S Q;  2W6M A;  4X62 H;  1LV9 A;  1I4G A;  4K5V A;  2R93 H;  1PFB A;  4X65 L;  2I80 A;  3VR6 A;  3ZYY X;  1NCV A;  1SRU A;  1QIL A;  5BR8 H;  1CM9 A;  5FOB B;  4MV3 A;  1Y8P B;  2NZO A;  1RYR A;  3PF4 A;  2D2C C;  3BYT B;  2E2I A;  2K52 A;  3TS2 A;  3TQ1 A;  4TVA B;  3KBX A;  4WOR A;  4YBZ B;  3J7A F;  1TU2 B;  4NXM H;  3OSO A;  1I94 Q;  1X9N A;  1ENC A;  1EYA A;  4IPG A;  4ZCK A;  3EFX D;  5TSS A;  3RZO H;  5KFH A;  1YJ9 A;  2HT1 A;  1QVC A;  4HIM A;  1SYD A;  2QKI C;  4C5C A;  5KFW A;  2QYZ A;  2HUG A;  1T3N A;  2OT2 A;  1M0T A;  1CKN B;  1OXU A;  2J7Z A;  1NY4 A;  1C4Q A;  3CP0 A;  4KHV A;  1PYB A;  5CYU A;  4KLK A;  4DXF A;  4XYM B;  3GTM B;  1VQ4 A;  2UVU A;  4FF3 A;  2VXW A;  4U7C A;  4EGJ A;  1KTK A;  2EDG A;  4DF7 A;  4K0K L;  2H1E A;  2YZG A;  3C46 A;  2UUA H;  1PH5 A;  2NVT B;  1LAB A;  4H7B A;  1W6K A;  5DEH A;  2UUA Q;  2JEA I;  2NZ1 D;  2RQX A;  2CWA A;  1XDN A;  2R92 B;  4B9X A;  3NQT A;  3I4N H;  1W2B A;  2A1A A;  2FJ2 A;  4EEY A;  3MXP A;  2EYO A;  3NBH B;  4OGQ C;  4C3J B;  4EQP A;  2KEC A;  3HOZ G;  5C4X G;  3FKI B;  3A8K E;  2IWH A;  2B29 A;  3CME A;  4JI6 L;  4L1K A;  4DV4 H;  1VQH A;  3RR5 A;  4K5X A;  4BBR G;  5BN3 A;  2ZXO A;  3CVZ A;  4NP5 A;  1JJG A;  3S1N B;  3GD7 A;  5L1I A;  1VQF A;  2R8H A;  4LF5 L;  3H3V I;  4JYA L;  3A55 A;  5LMU L;  4LF9 L;  1Q1B A;  2QDB A;  1WTR A;  5DQG A;  3GTO H;  4ECQ A;  2HVR A;  1G51 A;  1SYG A;  4DUY Q;  1PZJ D;  2ATL A;  1VQ8 A;  3KDF A;  1KIX A;  4K0K Q;  1QVG A;  1H9S A;  3VYT A;  2XGQ A;  1O80 A;  1YJW A;  3BQ1 A;  4QB4 A;  1TWA H;  1NR2 A;  3MJF A;  2JE6 I;  3QFF A;  1E4F T;  5LMN Q;  1SN8 A;  4MV1 A;  3AFQ A;  4MV8 A;  5IYD G;  3DUZ A;  3MR6 A;  2B39 A;  3RNU A;  1AFP A;  3GIQ A;  4GC7 A;  1PZK D;  1AZP A;  2DJF C;  4LFB Q;  2FMA A;  2GA4 B;  1PV4 A;  2I46 A;  1CHP D;  5CV5 A;  2UXB L;  4IPH A;  4C3I B;  5CV8 A;  2M05 A;  2OF1 A;  1RJP A;  2PZT A;  4XT3 B;  2ASJ A;  1I4Q A;  3G4S A;  1TWA A;  2D0P A;  2MFI A;  4DR6 L;  4NMZ A;  3J7A K;  3OTO Q;  4TV8 F;  3LWB A;  4KD3 A;  2PN1 A;  1DIK A;  3OTO H;  4QGU A;  3T5K A;  3Q2O A;  1DOM A;  1G29 1;  4AYB G;  1NJI C;  1HJP A;  2XRS D;  1DZ1 A;  4APM A;  2WV6 D;  4X6A H;  4DV0 H;  3S1R B;  1VDZ A;  1U0L A;  1WH2 A;  2NVT H;  3RAX A;  4IRD A;  4CJ0 B;  1DXM A;  3PUY A;  4C56 C;  1DD2 A;  4GLA C;  4IAL A;  2JA7 G;  4M9U A;  4GKK H;  2ICE C;  2NN6 I;  5ELD A;  2M9V A;  3GTJ A;  2B63 G;  3WOE A;  3STB C;  4DL7 A;  2VNU D;  5D65 A;  3ND8 A;  4LF4 Q;  2L12 A;  3EPI A;  4OHJ A;  4C2M B;  2C2E A;  4ECS A;  3UDF A;  2B63 A;  3BZD B;  4P71 A;  5KNC A;  1SNQ A;  2UXC H;  1DYQ A;  1ZYR D;  2ES2 A;  3HOZ H;  1EIH A;  3S24 A;  5LYJ F;  3NK9 A;  1SFO B;  1H9K A;  1JKJ B;  4EFB A;  4LFC L;  4B3T H;  4DA2 A;  5JPN C;  1KJ8 A;  5KFK A;  5IOC A;  5KT5 A;  1QCB D;  5LMU Q;  3PV0 A;  2A69 C;  3K81 C;  4AYB A;  2VQE Q;  3K0Y A;  1Z7T A;  3DF7 A;  1RYS A;  2YTX A;  1JOR A;  4IUP A;  1UE7 A;  3MWD A;  4JI6 Q;  4DFA A;  1UE1 A;  4A3B G;  1O7Y A;  3H4D A;  4U6P A;  5T14 A;  2ATW A;  3TIG A;  4KD4 A;  1N36 Q;  3VR3 A;  4DV0 Q;  2HIX A;  4F8M A;  2F4V Q;  3DWP A;  5IYB G;  4P2C B;  3TEH B;  1PRT B;  3SK5 A;  1PTO C;  2R7Z B;  4JYA H;  4DV6 H;  3MFG A;  4RUA A;  1PH1 A;  1C7Y A;  4GKK Q;  3FMC A;  2R7Z H;  2OXP A;  3HOX B;  1DV1 A;  4KHP L;  2R7Z A;  2LXJ A;  5DM7 3;  4JI1 L;  2FLL A;  2WB1 A;  4GC6 A;  4ABN A;  1K8G A;  2VW9 A;  3S1Q H;  4QWD A;  3HOU H;  3HS0 C;  4YHH H;  1FNU A;  4XQQ A;  1A62 A;  5CA0 F;  1KC8 C;  2AGQ A;  1ILQ A;  1IBK H;  1YIT A;  4DR4 Q;  3TP5 A;  5C44 B;  2FB9 A;  2DPI A;  3KAL A;  1E0B A;  5GAD C;  5FLM H;  2IW3 A;  2UXD H;  1MIU A;  4IFD H;  5M5X B;  4A3K B;  4ED7 A;  1TS3 A;  2EPB A;  3R5F A;  2JA8 B;  4YY3 H;  3CXC A;  4RGO S;  1XPR A;  3MC0 B;  1X56 A;  4GKJ Q;  3I7F A;  2K5D A;  2B2U C;  1G91 A;  2K7V A;  3L4K A;  2PPB C;  3J80 c;  5EGT A;  3TN2 A;  2W71 A;  1SYC A;  5C4J B;  5FLX E;  1NR4 A;  4HIO A;  2C00 A;  2L11 A;  4F4W A;  1QOH A;  2JJQ A;  4U67 3;  1C9O A;  4X66 Q;  1QVF A;  5IY0 A;  4UP7 A;  4HMI A;  3G71 A;  2NTT A;  2E75 C;  5KFJ A;  1Z2O X;  2E2D C;  4X3T A;  4NXM L;  1SCU B;  4KMU C;  4C3I G;  3A56 A;  2W7P A;  1HHV A;  4LJZ C;  1AW7 A;  5J1Z A;  3NE5 B;  3CW2 C;  1MHW C;  1M8A A;  5JVH 3;  2UXD L;  3M9O B;  1VQ6 A;  3KLS X;  4DR3 H;  4ECV A;  3FEW X;  4YJ2 F;  4F4Y A;  2RDI A;  4BWS C;  3S1M H;  3K7A H;  1E3P A;  4WJ4 A;  2AQ4 A;  2FK1 A;  2UUC Q;  4HAE A;  1EY8 A;  5KFY A;  1Q3L A;  1E22 A;  3S17 B;  3HOW H;  5IE8 A;  4JI0 H;  3VA7 A;  4LUZ A;  1CQJ B;  3RN2 A;  1EWI A;  1JMC A;  2L55 A;  1TWC A;  4A3I H;  2PMZ B;  3K0X A;  4AYB B;  3NEM A;  4JI7 L;  5G3L F;  2K75 A;  2BDO A;  1GSA A;  1LT5 D;  2DGY A;  3TQY A;  4I65 A;  1PH7 A;  1HR0 W;  1A15 A;  5I2Y A;  2B2W A;  5IWA L;  2JXM B;  2MPM A;  4EX5 A;  1VQE A;  4DNR B;  4CKE A;  3C3L A;  1KXL A;  4C2M A;  3P20 A;  3MFH A;  3PUX A;  1U9R A;  1V1Q A;  1K1S A;  1N32 H;  1BQQ T;  1FJG H;  4GOP A;  3ND9 A;  4A4I A;  4WBN F;  1UEB A;  3D6C A;  2K5H A;  3MVV A;  4Z9C B;  3HOY G;  2A68 C;  4MAM A;  4FS2 A;  3D8G A;  3KTM A;  1STE A;  4C2M H;  2BR0 A;  2IT1 A;  4A3J G;  2YTY A;  1PRT C;  3OPO A;  3ULJ A;  4JI8 H;  4JI0 Q;  2R86 A;  3PO3 H;  1LTA D;  2ZXR A;  4BXX H;  5LMN H;  2OEO A;  4IO9 A;  1CQI B;  3NQI A;  3KF6 A;  3X3N A;  4FM9 A;  1VQL A;  5LL6 X;  2BA0 A;  4LH7 A;  1UNS A;  4J15 A;  3I12 A;  1FR3 A;  1AUV A;  4TUY F;  2IX3 A;  1EUC B;  1QJO A;  2PQA A;  1KAA A;  3W1G A;  3BDO A;  5M5W H;  5BPH A;  5EBC A;  3QR8 A;  1MJE A;  4JOI A;  4HJA A;  2E76 C;  1S40 A;  1D2B A;  2HJW A;  1I50 A;  1E7Z A;  3SK8 A;  1KC7 A;  4PDB A;  1WCM H;  3DM1 A;  3STB D;  2KEE A;  3BYY B;  3I70 A;  1EHI A;  4ODG A;  3F2C A;  1H9J A;  3PF5 A;  3H0G H;  1R4P B;  4K6L A;  2EVB A;  3LNN A;  4KJN A;  4V19 0;  4KI0 A;  1PH8 A;  2D9U A;  2AKW B;  2GN5 A;  3J81 E;  1CHQ D;  2W6N A;  1YVC A;  2SNS A;  1CKO A;  1LT3 D;  4HED A;  4DGZ A;  4KN4 C;  3MXU A;  3K5N A;  2Y0S B;  2ZJQ A;  3GTQ B;  1IL2 A;  2CH4 A;  4RKB A;  4F4X A;  3A54 A;  4LAA A;  4IAJ A;  2K5Q A;  4JI3 L;  3FKI A;  3L3O C;  2UXB H;  1I50 B;  1Y1V G;  2DWC A;  4TQU S;  1V9P A;  5JJI A;  5BPF A;  2WKD A;  4L5Q A;  3UE1 A;  4OWW B;  4R8N A;  1Y1V A;  2K6A A;  1VQK A;  3ZJY C;  1HZ9 A;  4QWB A;  1TWH H;  2VB3 X;  5E7N A;  2CQA A;  3CCQ A;  4C5A A;  1Y14 B;  4EFE A;  3PW4 A;  5DM6 3;  2EY6 A;  1VQI A;  4DR1 Q;  4PQX A;  2KSW A;  1N36 H;  4DV1 L;  1JWU D;  1U4R A;  2BDN A;  4DK6 C;  3AQQ A;  2V4Q A;  1Q86 C;  1RJQ A;  3CCJ A;  2IMW P;  2C28 A;  4GOP B;  4FXK C;  2Z6B A;  4DV4 L;  1NMG A;  1D5M C;  4LF7 Q;  5K2M A;  4DV1 H;  2NU6 B;  1ESR A;  4Q45 A;  4KY6 A;  1HFG A;  4ID6 A;  3J81 W;  4KY5 A;  2IJ0 A;  2I5L X;  2C2R A;  2HHH H;  3Q8D A;  2GPS A;  1BOS A;  5C3X A;  2VA2 A;  3I2Z A;  3UFX B;  2R7K A;  1STA A;  1S9F A;  2N8N A;  4DV7 L;  4A76 A;  2E2I B;  4LF6 Q;  2W6Z A;  4YWM A;  2EJM A;  5IT9 E;  5J2T F;  2XIG A;  4JV0 A;  1CQF A;  3KOJ A;  3K7U C;  3WNZ A;  2R7N A;  1TWH A;  1ICW A;  3G6J B;  2I5H A;  3SVM A;  3PIO 3;  4R4T A;  1B6R A;  3OUZ A;  5ELB A;  1XNQ L;  4J0M A;  1XMQ Q;  1PFS A;  1EIF A;  3G48 A;  1T94 A;  1N34 H;  4UDU C;  4ZRZ A;  5GAH C;  2CVR A;  1DGS A;  2KCN A;  2NVY B;  2ZT9 C;  3DM3 A;  4R1J A;  4A3L H;  4I7H A;  2QGQ A;  5IYD H;  1MI2 A;  4ALP A;  1BVS A;  4C3I H;  3IN5 A;  2FHT A;  3J80 L;  1IOV A;  1HNZ L;  1VBH A;  5M5Y H;  2LY7 A;  4B3M Q;  2E5L L;  3NWS A;  4IUN A;  5KNB A;  4PWQ A;  2JA5 H;  5IGF A;  3UDI A;  2J6T A;  4JI5 H;  2Q2I A;  5E4W C;  3HOV H;  1F2Z A;  3M4O H;  5EWF A;  1EU4 A;  2ZXP A;  4PMW A;  3TZD A;  5KFV A;  2JA6 B;  3GTO A;  5JEA G;  1I3Q H;  4RNO A;  2NVX H;  4FVM A;  4K14 A;  3TP7 A;  2RDG A;  2ZJT A;  5BR8 L;  3SK6 A;  4XIG S;  1HUM A;  4YY3 Q;  1C0A A;  1VQ7 A;  4V0B A;  3D6W A;  1JOQ A;  4B08 A;  3LWU A;  2RHS B;  5LL6 S;  3C0F B;  1Z2P X;  4DV6 L;  3RB6 A;  1S4Z A;  4XXE A;  3RV4 A;  3EVQ A;  2A68 D;  4ZI7 F;  2F0O A;  5D3D A;  4RGM A;  5KYL A;  4B3T Q;  3J81 j;  3T5L A;  2IBK A;  4C3H B;  4YR0 A;  4DR7 H;  1G2S A;  1EU3 A;  1X3Q A;  2A5H A;  4DR5 H;  1EUD B;  4QWC A;  2X6L A;  4Q5V A;  3WWV A;  3IG0 A;  3GIP A;  4JOI C;  3Q24 A;  2OLS A;  1KNE A;  4LF8 H;  2C5C A;  4PZ8 A;  4DV3 Q;  4IFD G;  4O42 A;  2PNR C;  2W7O A;  2UUB L;  2AGO A;  3GIL A;  4IQZ A;  1M0W A;  4FF4 A;  3HOW B;  1AN8 A;  1V8Q A;  1NMF A;  3FVQ A;  1IBL Q;  1Q81 C;  4LK1 C;  2GVB A;  3HOV G;  4IFD I;  3VA5 A;  1N34 L;  3K3P A;  2E2J B;  2EY1 A;  4Y7N H;  1KLG D;  2VQF H;  2PW5 A;  3H3V H;  1NTG A;  1C30 A;  3R2I A;  2FPG B;  2O5I C;  1VF5 C;  2HGS A;  4XT1 B;  3FPP A;  2L9H A;  3B6Y A;  2DY8 A;  4IPD A;  3U9T A;  1CFM A;  2VUM A;  2XCP A;  1I4P A;  3SEB A;  2MCT A;  1V1O A;  5KRU A;  4YR3 A;  1DJR D;  3BZC A;  2IX0 A;  3OHX C;  4OEL B;  3V4Z A;  1EYC A;  4UAI A;  1ZQ7 A;  4PZ7 A;  1P8L A;  5KND A;  1D1I A;  1S72 A;  3I56 A;  2I0Q A;  1BUV T;  1JE4 A;  5KG5 A;  1SAP A;  1A9X A;  1SRO A;  3HOZ B;  1IL8 A;  3VR4 A;  5EPL A;  4IRC A;  4ED8 A;  4A3G H;  4X64 L;  5LXT F;  4IUT A;  2ZTD A;  5JVG 3;  3FDS A;  1J5E H;  5AJ3 L;  1NAP A;  1SYX B;  4K2K A;  2XVS A;  2F0L A;  3OW7 A;  3CCR A;  1R9T B;  1FGB D;  3H09 A;  2EYJ A;  2R7Z G;  3BA9 A;  4ZOL F;  1XMO H;  1LO5 D;  4XYQ A;  2F0G A;  3BU2 A;  2W70 A;  4DAY B;  5FLX c;  2FMM A;  1VBG A;  4LFA Q;  2OWO A;  5L9X A;  5IGB A;  1I94 H;  2MJ8 A;  1VQP A;  2NU8 B;  1IZ6 A;  1OXX K;  4O0A A;  1YNJ D;  2UXC Q;  1G2T A;  1EQV A;  2WKC A;  4LMQ D;  1EZ1 A;  1PYS B;  4I7Z C;  3EJI A;  1Y69 U;  4B3R L;  4JBJ A;  1FNW A;  4RKL A;  5FO9 B;  2AUJ D;  4CHT B;  4UCU A;  5KFZ A;  3RGZ A;  2OQ0 A;  3A0J A;  4YB8 B;  5KFB A;  5C4Z A;  4NLG A;  4IN3 A;  3UDX A;  5T1I A;  4A3M G;  4J9R A;  3A5U A;  5CC4 A;  4BA2 I;  1Z2N X;  1ONL A;  2DLN A;  4QMG A;  2O4X A;  2V59 A;  3AEV A;  1B70 B;  1L2F A;  2IX1 A;  3KYH C;  4QIW B;  3H0G B;  5DGA A;  1B4O A;  2Z8L A;  4WJW A;  3DWA A;  3RF2 A;  5BMV F;  1EY0 A;  3J80 i;  2QDL A;  1VQ5 A;  3GTM A;  2JSO A;  1J5E L;  2W8K A;  3SDZ A;  5KFP A;  1SMY C;  2XGP A;  4JG2 A;  4RA8 A;  4J1M A;  4O3R A;  1JLL B;  4O1N A;  1BJT A;  2R82 A;  4OIJ A;  4BY1 B;  1PTO D;  3GDE A;  1XMO Q;  2I8C A;  2ALZ A;  2VB2 X;  1EEF D;  3GTP B;  1RL2 A;  2E2H H;  3RB4 A;  1Q12 A;  1Q8I A;  1XXG A;  2FJZ A;  4DV5 L;  4HIK A;  2F0M A;  4M7E A;  2MNA A;  4MZ9 A;  1K9M C;  1H9S B;  1JT8 A;  4BY7 H;  2R87 A;  1KBL A;  4OWT B;  5AFW A;  3D4W A;  2JA6 H;  4FXD A;  1I6U A;  3E5N A;  4UCV A;  1JE5 A;  4UP8 A;  1WSC A;  2AWO A;  4BY1 G;  3WDN A;  5CAE B;  2UU9 L;  2VQF L;  2CH4 W;  4G7H C;  2R8K A;  1TWF B;  2K5N A;  5CV6 A;  2RSN A;  4YP3 A;  4UCR A;  4KKT A;  4DR2 Q;  1O78 A;  1GM5 A;  3N6X A;  2G9D A;  1STG A;  3U9S A;  5M3M B;  1GKH A;  2VPS A;  4K8I A;  2CW0 C;  2MHV A;  3NBH A;  4J9K A;  1YHB A;  4YCV A;  3BG5 A;  3M9N B;  1QZG A;  4Q8E A;  4NXN L;  2RVL A;  3MR2 A;  3A7L A;  4ECR A;  3PR5 B;  5FPO A;  3G6E A;  1CUK A;  3QWN A;  3H91 A;  3T1H Q;  1YHQ A;  4A3M B;  2RSO A;  4MHE A;  3BA8 A;  1TWG A;  3RZD B;  5I6W A;  2NYZ D;  2JN4 A;  1SMX A;  1F9S A;  5C3E G;  1ROD A;  5LHY 1;  1HNW L;  1KQS A;  2Q8T A;  1Y1V H;  4XQN A;  1S0O A;  4A3L G;  1ZHS A;  2IHF A;  3NXW A;  1M7J A;  4YR2 A;  3I4N B;  4CC6 A;  3LX0 A;  5FK9 C;  2Q2H A;  1PK8 A;  2JEI A;  1XNR L;  2F0T A;  1BBX C;  4UCS A;  3RMH A;  3BJY A;  1IW7 D;  1V43 A;  3I4L A;  2YYA A;  4MV9 A;  1M6V A;  1SR3 A;  1CE8 A;  3IL8 A;  1HR0 Q;  2VUM H;  3ULL A;  1B1Z A;  5IGE A;  3V4S A;  4AQY L;  4JI4 Q;  1EY4 A;  2YTV A;  4ZQ3 A;  1TKW B;  1IBK L;  5JQW A;  3HP3 A;  4ILW A;  5D8D A;  3VR5 A;  1OTC A;  3PO3 G;  4APV A;  4DR3 L;  4HJ7 A;  4A3E B;  3CC4 A;  4DR6 H;  3H0G G;  1BBW A;  1B3A A;  4IHJ F;  4H02 A;  1AH9 A;  4KHP H;  4UCO A;  3BDC A;  4QY7 A;  3S16 H;  3LGJ A;  1X6O A;  5KT6 A;  3L4J A;  1L1O A;  4WFN 3;  4PG3 A;  4FF1 A;  4A3D B;  4XYO A;  2HDL A;  1V1P A;  3RN5 A;  1D5X C;  1SE3 A;  3ULP A;  3L0O A;  1ULZ A;  1MSH A;  3PW5 A;  1UWV A;  2C2D A;  1CKM A;  2ZM6 Q;  2A74 C;  1A8V A;  2OCE A;  4CC5 A;  3I4O A;  5IGG A;  3HOU G;  3GTG B;  4DK1 A;  5KFL A;  3AB9 A;  4O4H F;  5KFM A;  1EY9 A;  3M4Q A;  4EYI B;  1UC9 A;  1TS5 A;  4X3K A;  1EYZ A;  3WOF A;  1EZ6 A;  3G6Y A;  3DEP A;  3E5S A;  4DR7 L;  1K8A C;  1KRS A;  4ZKC B;  3BAB A;  3S15 H;  4ED3 A;  1GD7 A;  2SOB A;  1FJG Q;  2YU9 H;  4DR3 Q;  5M5Y B;  4ECU A;  4DKA C;  4A2A A;  2UUB H;  1N33 L;  2BE5 C;  2Q8R E;  2XN9 C;  3EN2 A;  5IWA Q;  1N32 L;  2J9G A;  2OTJ A;  5D3I B;  3VYR A;  4HCE A;  3I3C A;  1FL0 A;  1B50 A;  2A6H C;  1A2T A;  2VUG A;  5IWA H;  2F4V H;  1VS0 A;  3CAM A;  4A3F B;  2OTL A;  4TQR A;  4JK1 C;  2KCM A;  4H0L C;  1J6Q A;  3GLK A;  3R3O A;  4OO1 G;  1M90 C;  1V51 A;  2GVA A;  4P75 A;  2AWN A;  4CKB A;  1I3Q A;  3IAY A;  1TR5 A;  3CKI B;  4CJ1 B;  1PDQ A;  4KV6 A;  2I07 B;  3W1B A;  3J7A V;  5DGB A;  2F0V A;  3EQL C;  1KDA A;  1PX2 A;  1SDF A;  3OIQ A;  4Q0Y A;  1T5X D;  1FD7 D;  5JH7 F;  2V4D A;  2E2I H;  4LF6 L;  2EYF A;  4R8I A;  2ZM6 H;  4DNI A;  3SK4 A;  1Q8K A;  4EBC A;  4CDE C;  2EYM A;  1JOK A;  1SNC A;  2ZJP A;  4FO2 A;  4DUZ L;  4B3R Q;  4DAM A;  4BS9 A;  2K14 A;  1QE6 A;  1VQC A;  2VUM G;  1PXU A;  1L2Z A;  4NXN Q;  4JI4 L;  4EQ5 A;  4IR9 A;  2UVV A;  3PO2 G;  5IT9 c;  2Z9H A;  4C3J G;  4PZ6 A;  2B2T C;  4A3D H;  4DV3 L;  2I87 A;  2PYK A;  4I55 F;  2WYO A;  2C9O A;  3JRW A;  2B8G A;  3ETJ A;  3S2H B;  1D6E C;  4CDF C;  2B2V A;  2YU9 B;  2KHS A;  4YCW A;  3MAQ A;  4U68 A;  4HR7 B;  5DLQ E;  4MTN A;  4GN5 A;  3HEJ A;  5KG1 A;  4M1U B;  3R93 A;  1B2T A;  4BBS B;  1HA5 A;  2O5J C;  4GOP C;  4Y7N B;  4YAK B;  1YNJ C;  1X3G A;  2B3G A;  3BAA A;  1ENF A;  3PZP A;  5JJL A;  3M4O B;  5C5L A;  3GTL A;  3D4R A;  3CPF A;  1XMO L;  2E8G A;  1YZ6 A;  3ICE A;  4G7O C;  1F9P A;  2PMZ E;  4EYH B;  2ZM6 L;  2D5D A;  5KFU A;  5LL6 b;  1EOT A;  1JOO A;  4RCO A;  2R61 A;  3V05 A;  3T1Y H;  4YY3 L;  1N9W A;  2NBF A;  3T51 B;  5CBE E;  5BR8 Q;  1K3R A;  4XDX A;  2R93 A;  2B2W C;  1I4H A;  3J81 c;  3RUP A;  1F9R A;  3VPC A;  2X0S A;  5KT4 A;  3H40 A;  3VR2 A;  2YZN A;  3PW0 A;  2F0K A;  4GS3 A;  3VDY A;  2W8L A;  2UU9 Q;  2F0S A;  3PO3 B;  3OHB A;  4JI1 Q;  2F52 A;  3PUZ A;  5JEA J;  5IP9 H;  3CQZ B;  3KF8 A;  3Q0A A;  2ALY B;  4XQJ A;  4GKK L;  5EDW A;  1SNM A;  1XMQ H;  5K36 H;  2HQE A;  3PMF A;  3CCE A;  4HJ9 A;  3N43 B;  1K8M A;  2WAQ A;  1KJI A;  1LTI D;  3T1Y L;  2F3V A;  4HSP A;  2FLN A;  1XTC D;  3RBD A;  3RAQ A;  1PH3 A;  4L8J A;  5KGU A;  2E5L Q;  5HBR B;  5C1O A;  3AU7 A;  1WR2 A;  3BVG A;  3OMC A;  1B33 N;  2K01 A;  1HNZ H;  5CV4 A;  3K7A B;  4BY1 H;  1UUP A;  2NU7 B;  1K1Q A;  3R2T A;  2NVY H;  5JPM C;  3PGZ A;  2VR1 A;  1S0N A;  1XTD A;  3S17 H;  1EYG A;  1YBY A;  1MSG A;  2QEX A;  3FMA A;  4QW9 A;  5EBD A;  2XNA C;  2A8V A;  3CC2 A;  3GTP A;  3OWE B;  1YNX A;  1HNW Q;  3G7L A;  3M3Y H;  3HBL A;  4DR2 H;  2F4I A;  3MXN B;  2EXD A;  3S14 H;  4EBE A;  1D5Z C;  1EY5 A;  4IZ8 A;  4K5W A;  4JI2 Q;  4UPA A;  3CCL A;  2R84 A;  5KIX A;  3T1Y Q;  2JA8 G;  1IKM A;  1EFI D;  2QEJ C;  4YQW A;  5EQ0 A;  3H20 A;  5GAE C;  2RGV A;  5C44 G;  1EUJ A;  2R7D A;  3QO2 A;  2O03 A;  4DV7 H;  1SYE A;  3E3X A;  2R7M A;  4DL3 A;  1UNN C;  5GON F;  4J9S A;  4JI3 H;  4UP9 A;  2CKZ B;  3H0G A;  3A74 A;  4QIW A;  2L0C A;  2Y0S E;  2ZDG A;  1KL9 A;  3KFU A;  3MR3 A;  2PBZ A;  5FPR A;  4YCU A;  5CGK A;  4DL2 A;  5ELN A;  1WCM A;  1PZI D;  5L37 A;  2Q2T A;  4RWS C;  1B7Y B;  1RJR A;  5A2Q L;  2K50 A;  5CA1 F;  4X65 H;  5DG7 A;  3KLR A;  4A3M H;  1STB A;  1D7Q A;  2EY5 A;  2RCN A;  1H9R A;  2YV5 A;  1A3U A;  4YWL A;  3JAM c;  2JA9 A;  4IJH A;  3PIP A;  3CCM A;  3GV7 B;  2JEJ A;  2JA7 A;  5HUR A;  4ZLT F;  4DUZ H;  5KFO A;  4ULL A;  4DR1 L;  2TSS A;  4BWG B;  1F9Q A;  3DLL A;  1MKH A;  4H44 C;  3QZ7 A;  2N78 A;  1K83 B;  4DAY A;  5AJ3 Q;  3NHH A;  1HXY D;  2B63 H;  1TT2 A;  1KDC A;  1YI2 A;  1R9T A;  5KFN A;  2BA1 A;  3RB3 A;  4QW8 A;  1CQV A;  4A3F H;  2RKS A;  4JI5 L;  2B2U A;  5NUC A;  1U4P A;  3BVM A;  3PUV A;  1MZB A;  5FD6 A;  3K5O A;  2WAQ E;  1JXL A;  3EIV A;  2HVS A;  1U4M A;  3V96 A;  4ZK9 B;  4JI3 Q;  1PHJ A;  1ZHQ A;  1VQD A;  4RG1 A;  4CKC A;  2FK2 A;  3QZ8 A;  4A3E H;  1UE6 A;  1W6J A;  4QQB X;  3UE0 A;  3PR4 A;  3J81 i;  1HUN A;  2EIF A;  1S5D D;  2L15 A;  5I9P A;  4RNN A;  1PVO A;  1WCM B;  3QOJ A;  1VF7 A;  3URY A;  5CBA E;  2VUM B;  3HOY B;  1CI3 M;  5FLM G;  2V9W A;  2HCI A;  1TWA B;  5KFD A;  2IL8 A;  2MO1 A;  4A3C H;  2B2Y A;  2CW8 A;  4IUU A;  3G8C A;  1X65 A;  4LF5 Q;  3NEN A;  1IBL H;  2PO4 A;  1DV2 A;  4A3B H;  5D14 A;  1KJJ A;  1TWC H;  3C2P A;  5KG4 A;  3HOX H;  4DR1 H;  4QWE A;  3HZX A;  4A3I B;  1QNU A;  3PIO A;  2ZDH A;  1O75 A;  1RKN A;  4YJ3 F;  2E74 C;  1SYF A;  4LNQ A;  1R4Q B;  1DM0 B;  3Q8Q B;  4AQY H;  1ASZ A;  1SLJ A;  5EKK A;  2XCA A;  2SDF A;  4DV5 Q;  4X64 Q;  1EY6 A;  4TRD A;  2NUC A;  1UC8 A;  2CQY A;  4DL6 A;  3TRZ A;  3A7A B;  2JP1 A;  1RD9 D;  4H13 C;  3TDQ A;  1I6V C;  3S16 B;  3RB0 A;  1EQQ A;  3F2B A;  3NEL A;  2DN8 A;  1SFO A;  4IRK A;  3W5O A;  2VY3 A;  4HJ8 A;  1PTO H;  5KFQ A;  5DNF A;  2DY7 A;  4R9W A;  1S5C D;  1SE8 A;  2LS0 1;  4P73 A;  3U9O A;  4R8U B;  4ECX A;  5JUM A;  4GKJ H;  5M3M H;  5E4X A;  1SNP A;  3S2D H;  4JW0 A;  4C3J H;  4DR2 L;  5T1G A;  4GNX C;  4JBK A;  2QCP X;  4K6D A;  4ED1 A;  4QF4 A;  3GTJ B;  4L5R C;  4MA0 A;  3VPD A;  3JSN A;  2ZTE A;  4I7A A;  4DU9 A;  1I5F A;  3UDG A;  1HNX H;  4IWX A;  2DPJ A;  3VMM A;  1ESF A;  1N34 Q;  4X3U A;  4RZQ A;  3WO0 A;  4HMJ A;  3FKI G;  1NE3 A;  1VQA A;  2K04 A;  5IYZ F;  1AEX A;  1DCZ A;  5EJW A;  1YNN C;  2IPK D;  5ELE A;  2UXC L;  2NB0 A;  4AQY Q;  2PCF B;  2P0A A;  1ZKO A;  3T16 A;  4JI5 Q;  4JUZ A;  1HR0 L;  5DLF A;  2XWB B;  4JI7 Q;  5K5P A;  1IHZ A;  1RCV D;  4R4Q A;  4EVO A;  1O7L A;  4ZHQ F;  4JI7 H;  2W9B A;  2SCU B;  4LF6 H;  2NVQ H;  5HV6 A;  1A0I A;  2PVP A;  2NVX A;  2YL2 A;  1TQO A;  1IBM H;  4O2A F;  1VMP A;  2R93 G;  4RB3 C;  4Y52 H;  3G6V A;  2ICI A;  4AIM A;  5ELC A;  1PH2 A;  3GTG A;  1O7I A;  1B6S A;  4O3O A;  4DLK A;  1UEA B;  5IP9 G;  5I47 A;  1KLU D;  2JA5 A;  2EJF C;  1SBB B;  3D0F A;  3GIK A;  4UCT A;  2AHO B;  4X66 H;  2EJG C;  2WFW A;  4OO1 H;  4FXG C;  3T4A C;  4IZO A;  4ED2 A;  2K4K A;  4OL7 A;  1SNO A;  4R4O A;  5KX5 F;  2AU0 A;  2MP1 A;  1L0W A;  4I4T F;  4RH6 A;  4DV4 Q;  1BXT A;  4QUF A;  1RK5 A;  5KFG A;  1EFW A;  4NXM Q;  2CW0 D;  3C1E A;  1SEB D;  3QG1 A;  4A93 G;  2F0I A;  1RIP A;  1YEZ A;  3HOV B;  4MNO A;  4P72 A;  3R5X A;  3M7G A;  5M5X H;  3GV8 B;  4DUY H;  3F1Z A;  3WO1 A;  3TP8 A;  4HNT A;  4DV3 H;  2YS6 A;  3I72 A;  3T56 B;  3GID A;  2JA5 G;  4LF7 H;  3TQT A;  1N32 Q;  1IKL A;  4JVZ A;  4ECT A;  5HY6 A;  1QG7 A;  2F0U A;  2FK3 A;  1LYL A;  2JK8 A;  5EAY A;  1BXR A;  4TV9 F;  5KKN B;  4A3J H;  1B44 D;  1HCZ A;  4J9M A;  3T53 B;  2NZH A;  4EGQ A;  2RDF A;  1C3O A;  3KHL A;  5C3E B;  1B8A A;  1GOZ A;  1S3O A;  1X3F A;  1XNQ Q;  5EOY A;  1BCP F;  1BGW A;  1YHA A;  5GQO A;  3I4N G;  4GN4 B;  3LP8 A;  5C5M A;  1BR9 A;  4RCN A;  1XNR Q;  4ETS A;  3TP6 A;  1VKZ A;  2R7L A;  4ZUI A;  4IPC A;  1E24 A;  1A6X A;  3J7Y W;  3G6X A;  1Y1V B;  2HIV A;  1AUX A;  3SXH A;  4A2B A;  1SJH D;  5KFT A;  1Y8O B;  4GNX A;  1VAJ A;  4DUZ Q;  5DQH A;  4CGY B;  2L1B A;  4DL5 A;  1FNV A;  1RTN A;  5KT3 A;  1HRJ A;  3F8N A;  2RDH A;  1EWH A;  1RDP D;  4LMY A; 
#chains in the Genus database with same CATH homology
 1CUK A;  5GAD C;  5FLM H;  3T1H Q;  1HNX L;  1YHQ A;  4BBS H;  2WP8 J;  4JBW A;  4AH6 A;  1MIU A;  4R4I A;  4JI0 L;  4DR5 L;  3S1N H;  2RF4 A;  2F4V L;  1VQM A;  4UY8 C;  3U4V A;  1KRT A;  3GTM H;  1SMX A;  1IYJ B;  4DPG A;  3CPW A;  5C3E G;  3CXC A;  1XPR A;  1HNW L;  1KD1 C;  1X56 A;  2N3S A;  3SGI A;  1KQS A;  1Y1V H;  1W3S A;  3I7F A;  4GKJ Q;  4A3L G;  2IHF A;  2I5M X;  3J80 c;  2DUD A;  2Q2H A;  1QUQ B;  2CQO A;  2VQF Q;  1XNR L;  2D0O A;  4HIO A;  4LFA L;  2JJQ A;  2IY5 B;  3PO2 H;  1V43 A;  3CF5 A;  1X55 A;  1C9O A;  1Z9F A;  4X66 Q;  1QVF A;  1SR3 A;  5IY0 A;  2F3I A;  1JB7 A;  1K73 C;  2KBN A;  4OON A;  3ULL A;  1HR0 Q;  4UP7 A;  2VUM H;  1A63 A;  3G71 A;  4AQY L;  4JI4 Q;  2YTV A;  1EOV A;  1IBK L;  4NXM L;  1FJG L;  1Q46 A;  4C3H H;  4A3G G;  4GLX A;  4A3K H;  3RZD H;  1OTC A;  3PO3 G;  3AYH B;  4APV A;  4DR3 L;  4HJ7 A;  3CC4 A;  2A19 A;  3H0G G;  3PSI A;  1HNX Q;  1BBW A;  3CW2 C;  1AE2 A;  2UXD L;  5GAG C;  2PQA B;  4H02 A;  1VQ6 A;  1AH9 A;  4QY7 A;  3S16 H;  1XMQ L;  1VQ9 A;  3LGJ A;  1X6O A;  1L1O A;  4PG3 A;  3M4P A;  2FXQ A;  3K8A A;  3KF6 B;  4WJ3 M;  3S1M H;  2R92 H;  2N49 A;  3K7A H;  3RN5 A;  1E3P A;  3ULP A;  3L0O A;  4WJ4 A;  1UWV A;  2UUC Q;  4JI8 Q;  3D31 A;  3HOX G;  1CKM A;  5IP7 H;  2ZM6 Q;  1A8V A;  2OCE A;  1N8R C;  3I4O A;  1E22 A;  4OO1 I;  3I4M G;  3HOW H;  5IE8 A;  3HOU G;  1EIY B;  1MJC A;  4LUZ A;  3TS0 A;  4LF4 L;  3RN2 A;  3M4Q A;  1EWI A;  3KF8 B;  1JMC A;  4A3I H;  3KJO A;  3K0X A;  3NEM A;  4JI2 L;  2BH2 A;  4DR7 L;  3OTO L;  4JI7 L;  1K8A C;  1KRS A;  1E1O A;  2K75 A;  1HNZ Q;  3S15 H;  1N36 L;  1GD7 A;  4DK3 C;  1FJG Q;  2DGY A;  2C35 B;  3TQY A;  4ME3 A;  1K83 H;  2CWP A;  4DR3 Q;  4A3E G;  4DKA C;  1PH7 A;  3IRB A;  1HR0 W;  4BBS G;  1N33 L;  3EN2 A;  1N32 L;  2R6G A;  2Z0S A;  3E9I A;  5IWA L;  1D8L A;  5IWA Q;  3F2D A;  2OTJ A;  4EX5 A;  1FL0 A;  1VQE A;  1VS0 A;  3CAM A;  2VQE L;  3S2H H;  2OTL A;  3HOY H;  4A3F G;  4LW1 A;  1KXL A;  1X3E A;  2KCM A;  4POF A;  3BZK A;  1J6Q A;  3GTG H;  3PUX A;  1Y1W G;  1M90 C;  4OO1 G;  1V1Q A;  2GVA A;  4P75 A;  2AWN A;  1SFO H;  1WOC A;  2RHQ B;  4GOP A;  4A4I A;  1UEB A;  2K5H A;  3W1B A;  4YHH L;  4GKJ L;  3HOY G;  2KEN A;  4NPS A;  4JI8 L;  3K80 C;  2E2I H;  3M7N A;  2VL6 A;  4LF6 L;  4C2M H;  5HGQ A;  3U4Z A;  2IT1 A;  4XTC S;  4DNI A;  4A3J G;  1Q8K A;  2YTY A;  3ULJ A;  3T1H L;  4A3K G;  4JI0 Q;  3PO3 H;  4BXX H;  2ZJP A;  2ZJR A;  4IO9 A;  3KDF B;  4DR4 L;  3KF6 A;  4DUZ L;  2HQL A;  4B3R Q;  4JC0 A;  4DAM A;  2VUM G;  2K14 A;  1VQL A;  1VQC A;  2BA0 A;  4J15 A;  1XPO A;  1WCM G;  4JI4 L;  4NXN Q;  4EQ5 A;  2Q2U A;  3CQZ H;  2PQA A;  3S1R H;  3W1G A;  3PO2 G;  1TWF H;  5IT9 c;  3H15 A;  4JV5 Q;  4KHP Q;  5M5W H;  4PZ6 A;  3F8T A;  5IP7 G;  5M3F G;  1YIJ A;  1MJE A;  3HOW G;  1CSP A;  4A3D H;  4JOI A;  4HJA A;  4BY7 G;  4DV3 L;  3FP9 A;  3U50 C;  1S40 A;  1E7Z A;  1ASY A;  1OXV A;  1WCM H;  2YU9 H;  4DV2 L;  2IHE A;  1LTL A;  3HFZ B;  3STB D;  5C3E H;  3CCU A;  1M1K C;  2R92 G;  1VCI A;  2LXK A;  4YCW A;  3F2C A;  1HZA A;  3PF5 A;  2WB1 E;  3H0G H;  5DLQ E;  4MTN A;  4BXX G;  4GN5 A;  4X65 Q;  4DV0 L;  2XGT A;  2Z6K C;  4KI0 A;  4O2D A;  1PH8 A;  2AKW B;  2GN5 A;  4HJ5 A;  4X66 L;  4DR5 Q;  1FGU A;  1VQJ A;  4GOP C;  1YVC A;  2B3G A;  1X3G A;  1XJV A;  5JJL A;  5LMN L;  1CKO A;  1K0R A;  1Q82 C;  3CPF A;  1XMO L;  2E8G A;  1YZ6 A;  3ICE A;  1X54 A;  4R4C A;  2PMZ E;  4LFC Q;  2ZM6 L;  2ZJQ A;  1IL2 A;  4LUV A;  2HHH Q;  2OQK A;  3CMA A;  4YY3 L;  1N9W A;  5BR8 Q;  1K3R A;  3CD6 A;  2PI2 E;  4QIW E;  3J81 c;  4JI3 L;  4OWX B;  4GLV B;  1Y1V G;  1WYD A;  3JAM i;  4GS3 A;  4DV6 Q;  4TQU S;  1V9P A;  3VDY A;  1Q1E A;  2CFM A;  2PNH A;  2UU9 Q;  1HZC A;  1KHI A;  4JI1 Q;  4L5Q A;  2F52 A;  3PUZ A;  5JEA J;  3UE1 A;  5IP9 H;  2QA4 A;  4OWW B;  2JA7 H;  4A93 H;  2ALY B;  4GKK L;  3CCE A;  4HJ9 A;  2KHJ A;  3U58 A;  1HH2 P;  3T1Y L;  1VQK A;  3ZJY C;  1HZ9 A;  1TWH H;  1PH3 A;  1HZB A;  2E5L Q;  5E7N A;  1GVP A;  2UUB Q;  3CCQ A;  3GTQ H;  1Y14 B;  5IYC G;  4AYB E;  1IBM L;  1VQI A;  3CC7 A;  5C0X G;  3J7Z C;  2K5V A;  4DR1 Q;  4BY1 H;  4DV1 L;  2NVY H;  4X62 L;  3PGZ A;  4A3I G;  1XTD A;  4DK6 C;  1EYG A;  1YBY A;  3AQQ A;  3PCO B;  3S17 H;  2QEX A;  1E1T A;  1Q86 C;  3OW2 A;  1XPU A;  4GNX B;  4A75 A;  1VQN A;  3GTJ H;  2KHI A;  5ELO A;  3CCJ A;  3CC2 A;  1N33 Q;  2A8V A;  1YNX A;  4YWK A;  5GRO A;  1PH9 A;  1HNW Q;  1P16 A;  2WB1 G;  4FDB A;  5J3B A;  4GOP B;  3M3Y H;  4DV4 L;  3ER0 A;  3MXN B;  2EXD A;  3S14 H;  1NMG A;  4LF7 Q;  4JBM A;  3GTL H;  2JA8 H;  4JI2 Q;  4UPA A;  3CCL A;  2LSS A;  4IJL A;  5LMN W;  3T1Y Q;  2JA8 G;  2I5L X;  3ERS X;  5GAE C;  3Q8D A;  4A3C G;  5C44 G;  1EUJ A;  3I2Z A;  5M3F H;  2R7D A;  1J5E Q;  5H1S E;  5K36 G;  3KJP A;  4UP9 A;  2CKZ B;  5C4J H;  3HKZ E;  2N8N A;  3A74 A;  3CCV A;  4DV7 L;  2PI2 A;  4A76 A;  4YHH Q;  2Y0S E;  1PA6 A;  4LF6 Q;  4YWM A;  1KL9 A;  3KFU A;  2CCZ A;  4YCU A;  1JJC B;  2KCT A;  5ELN A;  1LM0 A;  4QL5 A;  3GO5 A;  3EBE A;  3PUW A;  5FJ8 H;  1Q7Y C;  2Q2T A;  3KOJ A;  3K7U C;  2HHH L;  4QJF A;  1B7Y B;  2K50 A;  3M85 A;  2I5H A;  4A3M H;  1D7Q A;  4R4T A;  1WJJ A;  3JAM c;  2RCN A;  4YWL A;  2YV5 A;  1OXS C;  1TWG H;  2UXD Q;  2JA9 A;  4IJH A;  3PIP A;  3CCM A;  1XNQ L;  1XMQ Q;  4OX9 L;  4GN3 B;  3RLF A;  2VZA A;  1PFS A;  4X62 Q;  4DR6 Q;  2AMC B;  1EIF A;  3G48 A;  1G6P A;  5C4X H;  4NB3 A;  5GAH C;  3DM3 A;  1DGS A;  4DR1 L;  1IBK Q;  4B3S Q;  4R1J A;  4LF7 L;  3GTK H;  4A3L H;  2QGQ A;  5IYD H;  4ALP A;  1YJN A;  1BVS A;  3TRE A;  4C3I H;  1MKH A;  3DLL A;  2XTI A;  2R93 H;  3KLW A;  4X65 L;  2UXB Q;  3JC6 6;  2N78 A;  5M5Y H;  1HNZ L;  2B63 H;  5AJ3 Q;  1SRU A;  4B3M Q;  2E5L L;  2ZTC A;  1YI2 A;  2JA5 H;  1QUQ A;  2BA1 A;  2NZO A;  3UDI A;  3PF4 A;  2Q2I A;  2JEB I;  4A3F H;  2K52 A;  3HOV H;  3TS2 A;  3M4O H;  4JI5 L;  4TVA B;  2MO0 A;  5JJI A;  4PMW A;  3PUV A;  3RLN A;  4IOA A;  5JEA G;  1I3Q H;  2WAQ E;  3L2P A;  2ID0 A;  3EIV A;  1I94 Q;  1X9N A;  2E2J H;  2NVX H;  4JI3 Q;  1PHJ A;  3I4M H;  1VQD A;  3A5Z B;  4RG1 A;  4DV7 Q;  5BR8 L;  4IPG A;  4A3E H;  4XIG S;  1UE6 A;  1CKN A;  2MQH A;  4YY3 Q;  4QQB X;  1VQ7 A;  3RZO H;  1I6H H;  5IYC H;  3UE0 A;  4IFD J;  1C0A A;  3J81 i;  1YJ9 A;  4L5T A;  1QVC A;  2EIF A;  2L15 A;  2RHS B;  4HIM A;  2HT1 A;  5JJK A;  1PVO A;  4DV6 L;  1CKN B;  1OXU A;  5FLM G;  4JYA Q;  3HKZ G;  1NY4 A;  1JJ2 A;  3CP0 A;  5C44 H;  1PYB A;  2BH8 A;  2MO1 A;  4KLK A;  1I50 H;  4A3C H;  1VQ4 A;  2Z6K A;  3J81 j;  4B3T Q;  1X65 A;  4LF5 Q;  3NEN A;  3E9H A;  4K0K L;  2ASB A;  4A3B H;  1T9H A;  4IOC A;  1PH5 A;  3M9B A;  1TWC H;  3J7A 5;  3HOX H;  3WWV A;  2UUA Q;  4DV1 Q;  2JEA I;  2EQS A;  1I94 L;  2CWA A;  4JOI C;  3PIO A;  5FJ8 G;  4PZ8 A;  2JA6 G;  4DV3 Q;  4IFD G;  3I4N H;  4LNQ A;  1W2B A;  2A1A A;  4LUO A;  2UUB L;  3NBH B;  3CCS A;  5C0X I;  1IBM Q;  4JV5 L;  1NMF A;  1IBL Q;  1ASZ A;  1SLJ A;  1QZH A;  3HOZ G;  1Q81 C;  5C4X G;  2GVB A;  4LFB L;  3HOV G;  4DV5 Q;  4JI6 L;  2B29 A;  1L1O C;  4X64 Q;  3CME A;  4IFD I;  1N34 L;  1VQH A;  3RR5 A;  4BBR G;  3I55 A;  3TRZ A;  1IXR A;  1JJG A;  3GD7 A;  1VQF A;  4LF5 L;  3H3V I;  4HID A;  4JYA L;  5LMU L;  1Z47 A;  4Y7N H;  1Q1B A;  4LF9 L;  1EQQ A;  3F2B A;  3NEL A;  3GTO H;  3H3V H;  1G51 A;  1NTG A;  2V1C C;  3RLO A;  2VY3 A;  3W5O A;  4DUY Q;  4HJ8 A;  3B6Y A;  1VQ8 A;  3KDF A;  1KIX A;  1SE8 A;  4P73 A;  4K0K Q;  4IPD A;  1QVG A;  2R7F A;  5M3M H;  1R9T H;  1YJW A;  3S2D H;  4DR2 L;  4C3J H;  1TWA H;  4GNX C;  3BZC A;  4JBK A;  1BBU A;  2IX0 A;  3BJU A;  4L5R C;  4PZ7 A;  1P8L A;  3HKS A;  2JE6 I;  2ZTE A;  1S72 A;  4LF9 Q;  3I56 A;  2I0Q A;  5LMN Q;  1SN8 A;  1I5F A;  3AFQ A;  3UDG A;  5IYD G;  3RNU A;  1SRO A;  4RMF A;  1N34 Q;  4A3G H;  4X64 L;  5C0X J;  2ZTD A;  3FKI G;  1KAW A;  1NE3 A;  1VQA A;  3AFP A;  5AJ3 L;  1PV4 A;  1WFQ A;  4LFB Q;  2UXB L;  4IPH A;  4JCV E;  1PH4 A;  1WI5 A;  2UXC L;  3CCR A;  2YYZ A;  1CSQ A;  2JQO A;  3G4S A;  2D0P A;  2MFI A;  4DV2 Q;  4AQY Q;  4L5S A;  4DR6 L;  4JI5 Q;  2R7Z G;  1HR0 L;  3OTO Q;  4JI7 Q;  4R4Q A;  3BU2 A;  1VQB A;  2UUA L;  4DAY B;  5FLX c;  4LFA Q;  4QGU A;  2OWO A;  1TXY A;  2NVQ H;  1A0I A;  1G29 1;  1U5K A;  4AYB G;  1BKB A;  1HJP A;  3FHW A;  1NJI C;  4B3M L;  4X6A H;  1VQP A;  2R93 G;  4Y52 H;  1IZ6 A;  1U0L A;  1OXX K;  4O0A A;  4KHZ A;  4P74 A;  4AIM A;  2NVT H;  2UXC Q;  2NN6 G;  1PH2 A;  1PYS B;  1O7I A;  4OXP A;  4DR7 Q;  3PUY A;  4B3R L;  4JBJ A;  4LF8 Q;  4GLA C;  5IP9 G;  2JA7 G;  2OQ0 A;  3A0J A;  2NN6 I;  3D0F A;  3GTP H;  1H95 A;  3UDX A;  4A3M G;  2AHO B;  4BBR H;  2B63 G;  3A5U A;  2WFW A;  3STB C;  4BA2 I;  2VNU D;  1FVI A;  1Y1W H;  4LF4 Q;  2K4K A;  4LWC A;  1VQG A;  3UDF A;  4R4O A;  3AEV A;  1B70 B;  1L2F A;  2IX1 A;  3KYH C;  1L0W A;  4P71 A;  4DV4 Q;  4LF8 L;  1EFW A;  2ES2 A;  4NXM Q;  2UUC L;  3HOZ H;  3E0E A;  4A93 G;  1GO3 E;  3S24 A;  1RIP A;  4BA1 I;  1YEZ A;  5M3M G;  2D62 A;  4MNO A;  4P72 A;  3J80 i;  1LUZ A;  3L7Z C;  4LFC L;  1VQ5 A;  1J5E L;  1PH6 A;  5M5X H;  2H5X A;  3F1Z A;  2Y0S G;  4JG2 A;  5LMU Q;  3PV0 A;  3K81 C;  2JA5 G;  2VQE Q;  5IYB H;  1N32 Q;  3GDE A;  1XMO Q;  2VS1 A;  2YTX A;  5HY6 A;  1OXT A;  1UE7 A;  3OYY A;  4JI6 Q;  1LYL A;  2JK8 A;  5EAY A;  1RL2 A;  1UE5 A;  2E2H H;  1UE1 A;  4A3B G;  1Q12 A;  4A3J H;  1IBL L;  2ATW A;  2NZH A;  3FKI H;  4B3S L;  4DV5 L;  4HIK A;  1N36 Q;  4DV0 Q;  2HIX A;  2MNA A;  4MZ9 A;  1K9M C;  1AE3 A;  1B8A A;  1JT8 A;  4BY7 H;  4OX9 Q;  2F4V Q;  1S3O A;  1X3F A;  4OWT B;  5IYB G;  3TEH B;  1XNQ Q;  2JA6 H;  1YHA A;  2WAQ G;  5GQO A;  1JE5 A;  4UP8 A;  1NBW A;  3I4N G;  4GN4 B;  2AWO A;  4BY1 G;  1L1O B;  2UU9 L;  2VQF L;  1PH1 A;  1C7Y A;  1EQR A;  1XNR Q;  4GKK Q;  2R7Z H;  4KHP L;  2LXJ A;  2K5N A;  4JI1 L;  4IPC A;  4DR2 Q;  1E24 A;  1GM5 A;  1K8G A;  2HIV A;  2VW9 A;  3S1Q H;  1GKH A;  3HOU H;  4A3D G;  4B3T L;  4GNX A;  1YHB A;  1A62 A;  4YCV A;  1KC8 C;  1QZG A;  4DUZ Q;  4DUY L;  1VQO A;  4NXN L;  3MEF A;  1YIT A;  4DR4 Q;  4POG A;  3G6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...