5IP9G

Structure of rna polymerase ii-tfiif complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5ip9G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 5ip9G01
1XMOL 1WFQA 4GOPB 4JI3L 1IBKL 3BZCA 4OO1G 4JOIC 3HKZG 1XTDA 5H1SE 5BR8Q 4A3IH 3PIPA 1N34L 4O2DA 5JEAG 4X62Q 4QJFA 1XPOA 4DR7Q 2R7ZH 2Q2HA 2OTLA 4X65Q 4POGA 4GNXB 1X3GA 1I50H 1SMXA 5M5YH 3FKIG 2I0QA 4LFBQ 5IYBG 5C4JH 1IBLQ 3PO3H 2AWOA 4C2MH 4NB3A 1TWGH 1QVFA 2VUMH 1P16A 4BA2I 1Q82C 4NXMQ 4JI5L 2N8NA 1MIUA 1Q1EA 4JI4L 1FJGL 4DR4L 1VQBA 1VQGA 4UPAA 4BBRH 3I4NH 4YCWA 1HZCA 1E1TA 1HNXQ 1CKNA 1QZHA 3TS2A 1YI2A 5M5WH 1PH8A 1YEZA 3TQYA 3J7A5 5C3EG 5GAGC 2F4VL 4K0KL 2JQOA 1A62A 3F1ZA 3PSIA 3I7FA 1OXTA 3S24A 4IOAA 4IPGA 1CKMA 3FP9A 4JBMA 1SN8A 3PO2G 3KF8B 4DV4L 4A3CG 2BH2A 1I94L 1P8LA 4EQ5A 3HOVG 4JI1L 2QEXA 4AQYL 4JBJA 3D0FA 2L15A 5J3BA 4P73A 1JJ2A 3J80c 2UUBL 4JBKA 4GS3A 2JA7H 2DGYA 4JI8Q 1V1QA 2PQAA 5IWAQ 3UDGA 2R92G 1K0RA 2OQ0A 1YITA 4JI7L 4A3LH 4DV0Q 2JEAI 2GN5A 3CXCA 4LFAL 2NZHA 1XPUA 1GM5A 4IFDJ 5LMNQ 1SE8A 5M3MG 4X64L 3J80i 2UUAQ 1VQ9A 2UU9Q 2WP8J 4A3DG 2KBNA 4LWCA 1TWAH 2LXJA 4POFA 4DAYB 1B7YB 4DV5Q 2LSSA 3E9IA 2QA4A 1I6HH 2MFIA 3E0EA 2BA1A 4R4IA 3RR5A 1H95A 1VQCA 4DR1L 4APVA 1PH1A 2IT1A 4RMFA 4L5RC 5ELOA 1C9OA 1QVCA 2KCMA 3AQQA 3VDYA 4X6AH 1HH2P 3U4VA 2ZM6Q 2EXDA 2R7DA 2BH8A 1L0WA 1HNWL 1LUZA 3I4OA 3RN5A 2ASBA 2D62A 4QGUA 4GN4B 3U50C 3I56A 1KQSA 5IP7H 3M3YH 2Z0SA 3MEFA 1J5EQ 2JA5H 3OW2A 1B70B 1VQEA 5M3FH 2PMZE 3CC4A 4YWLA 3HOZH 5DLQE 1XNQL 3S16H 2NVYH 3BZKA 1KRSA 2XGTA 5C0XJ 2UXCL 1J6QA 2OCEA 4JI2L 1ASYA 2UXBL 1K8GA 1QZGA 1EWIA 4UP9A 4B3RQ 5IE8A 4PG3A 1VQ8A 4A3MG 4JBWA 3F2CA 3EIVA 1XJVA 2JA8G 4GKKL 2YYZA 1G291 4GOPA 2K75A 1S40A 4HIKA 1FGUA 2PNHA 4DR3L 1A0IA 1X6OA 3CCVA 4IPHA 3FKIH 1TWFH 1LYLA 2D0PA 3K7UC 3TREA 5IYBH 1VQ4A 1VQ6A 3A0JA 3T1HL 1Y1VG 5HY6A 3NBHB 4A3GG 4GOPC 4GNXA 3CCJA 1UWVA 2UXDQ 4L5QA 2E2HH 3HOWG 3G6EA 2ID0A 1E3PA 5BR8L 2JE6I 4TVAB 2YU9H 4GLXA 2NVXH 4PZ6A 4X62L 4OO1I 4DR5Q 4DR7L 1L1OA 1X3FA 1AE3A 1Z47A 3OTOQ 1N32Q 5K36G 4X65L 3K0XA 1SLJA 1LTLA 3GDEA 4LFBL 3KJPA 2FXQA 1IBLL 4ME3A 2ALYB 3M4OH 3RLNA 2N78A 2E2IH 3HFZB 1OXVA 2VQFQ 5AJ3Q 3CCEA 4YWMA 2A1AA 3HOUG 4NXML 2KENA 4A3BG 4IJHA 4LUOA 4DUZQ 3RLFA 2N49A 1Q7YC 3HOYG 1QUQB 4JOIA 2ZJRA 4HJAA 3CCLA 3HOVH 4A3CH 1AH9A 5GADC 3I4MG 1HZBA 1KRTA 4HJ9A 1R9TH 2MO0A 3CAMA 1UE1A 3H3VH 3GTQH 4KI0A 1HNXL 1IBML 3K7AH 4IPCA 3L7ZC 4KHPQ 2NZOA 2JA6G 2R92H 2RHSB 4LF9Q 4DUYQ 1FVIA 4QIWE 1PH3A 1EUJA 4GN5A 3UE0A 1Y1WG 4R4OA 1PA6A 3NENA 5M3MH 4ALPA 4JV5Q 2H5XA 2V1CC 4OWTB 5C4XG 4KHZA 4LUZA 4A3DH 3CMAA 5FJ8G 3GTKH 3J81j 2CCZA 1M1KC 1IL2A 1EYGA 4B3SQ 2IHEA 3A74A 4HIOA 4BBSG 2OQKA 1RIPA 4C3JH 4JI8L 1U0LA 3A5ZB 4P72A 1VQMA 2LXKA 4R4TA 5IWAL 2A19A 2D0OA 1VQDA 1NJIC 3H3VI 1LM0A 2MQHA 3NEMA 3TS0A 3CC2A 2K5VA 3ULJA 4DV0L 1Y14B 1Q46A 3KDFB 2HIVA 3IRBA 3CF5A 2PI2A 5LMNL 1I3QH 1SRUA 2YV5A 2UUAL 4GN3B 5E7NA 1M90C 1C0AA 3GTJH 3K81C 3M7NA 4HJ5A 3L0OA 4JCVE 4DV5L 3HKSA 2E8GA 1W2BA 3H15A 2MO1A 1KAWA 1YJNA 1Q86C 5LMUQ 4LFCQ 4H02A 3RNUA 1D8LA 4NPSA 2IY5B 4B3ML 5GQOA 2NN6G 1T9HA 4YCUA 2QGQA 2ZM6L 4A3MH 2OWOA 4IFDI 3ERSX 2JA8H 2HQLA 1YBYA 3PUXA 2E5LL 4QY7A 1NBWA 3STBD 3KOJA 4P71A 4A3KG 2F3IA 4XIGS 1J5EL 1VQJA 1U5KA 1S3OA 2CWPA 1N34Q 1JB7A 1Y1VH 4DK3C 1PH2A 1X3EA 4A3GH 1IXRA 2CQOA 4MNOA 3HOWH 2IX0A 5GAHC 4B3RL 4JI6Q 3G4SA 1BBUA 1ASZA 1NMGA 4LUVA 3S2HH 4YCVA 2WFWA 4DR2Q 1MJEA 1G51A 4UP7A 1HR0Q 1Q1BA 3CPFA 3K8AA 4QQBX 3PIOA 2VNUD 5C0XI 1PH9A 2JJQA 4NXNQ 1YHAA 3H0GG 4BXXG 1XNRQ 4HJ7A 2ZTEA 3KYHC 4X66L 2VQEL 3HOUH 3HOYH 4A3BH 4YHHQ 2UXDL 1VS0A 1XPRA 4A4IA 1HNZQ 1E24A 3GO5A 1VQIA 4OXPA 4R4CA 1TWCH 3I4MH 3S17H 3B6YA 2HHHQ 4DV1Q 2Q2IA 1VQHA 2K5HA 4J15A 1UE6A 4BA1I 5C44G 4DV6Q 3OTOL 4DR5L 1C7YA 4LF5Q 2VY3A 3GTGH 1GO3E 1N32L 4OX9Q 2EQSA 1EIFA 4JC0A 3DLLA 1VCIA 4IJLA 2Z6KC 1EIYB 3CCSA 2JA6H 3JAMc 4JI1Q 2IX1A 4JG2A 2VQFL 1KC8C 1Y1WH 5AJ3L 4OWXB 1K3RA 4DV7Q 4DV2Q 4DUZL 1CKOA 1K9MC 5C4XH 1JJCB 2Q2TA 2KHIA 3UE1A 1DGSA 2KCTA 5FJ8H 3PUVA 1GD7A 3JAMi 3L2PA 1N9WA 4DNIA 3PUZA 1YVCA 4BBSH 3OYYA 4AH6A 4KHPL 1N8RC 3PUWA 2ZJQA 4AIMA 3J81c 4LF9L 4DV3Q 3PCOB 4DUYL 2WAQE 4LF7Q 3W1GA 4EX5A 2CWAA 3Q8DA 2VZAA 4L5SA 1PFSA 1O7IA 1E7ZA 2WAQG 3G71A 3U58A 1A63A 4JV5L 3UDXA 3LGJA 1WOCA 3JC66 1VQKA 4MZ9A 4A3JG 2UUCQ 2E5LQ 5LMNW 3J81i 1HZ9A 4A76A 3CPWA 4B3SL 4OWWB 1VQNA 3PO2H 1UEBA 1MJCA 4DR6Q 3KJOA 4LF8Q 4YY3Q 1TWHH 2NVTH 4PZ7A 5FLMG 2YTXA 5GROA 4BY1G 1BBWA 4LW1A 1NY4A 2ZTDA 2ZTCA 4WJ3M 4O0AA 1WYDA 3DM3A 1YZ6A 2HIXA 4A3KH 1OXXK 1E22A 3S1RH 2GVBA 2YTVA 1YJWA 1PH7A 4OONA 4LF4Q 3S14H 1KXLA 3I55A 1OXSC 2E2JH 2JK8A 3CCQA 1CUKA 5IT9c 2K52A 4LFCL 5LMUL 3PF5A 2XTIA 3M85A 4P74A 5IYCG 1WCMG 2DUDA 4DR3Q 3BJUA 1XMQQ 4IO9A 4LF6Q 2NN6I 2ATWA 2VW9A 4A93G 2CFMA 1SROA 1N33Q 2WB1E 2I5HA 3PGZA 1VQFA 3MXNB 2AKWB 3D31A 2WB1G 3KF6B 3ULLA 4P75A 3T1YQ 3S1MH 1GVPA 4FDBA 4A3FH 3AFQA 1KD1C 2B3GA 1K83H 3ULPA 3RZDH 4HIDA 4LNQA 3GTMH 1B8AA 3H0GH 4JYAQ 2UU9L 2PI2E 2HT1A 1D7QA 1JJGA 3S15H 1V9PA 4JI6L 4R1JA 1A8VA 3W1BA 1S72A 4HIMA 4A3EG 1G6PA 4BXXH 1L2FA 4GKJQ 5IP9G 1Q12A 4GLVB 5C44H 1PH6A 5JJKA 4GLAC 4DR2L 2B63G 1IYJB 1VQLA 4BY7G 1L1OB 1HR0L 4Y52H 3EBEA 4R4QA 1N36Q 3CCRA 4WJ4A 4JI0Q 1VQ7A 2I5MX 2Q2UA 2B29A 1Q8KA 4NXNL 3PUYA 3WWVA 2IHFA 2VL6A 4PZ8A 3CC7A 1XNRL 4B3TQ 4JI4Q 2F4VQ 4YHHL 1XMOQ 1IBKQ 1IBMQ 4JI3Q 2JEBI 1HNZL 1WJJA 4MTNA 3HOXG 2AHOB 4DV1L 2HHHL 4LF5L 1JE5A 2RF4A 5M5XH 1CSPA 2RCNA 4DV6L 3CP0A 3SGIA 4AYBE 3AFPA 4A75A 1K73C 1KIXA 3AYHB 4B3MQ 4OX9L 4TQUS 1PYBA 4AYBG 2R93G 3F2BA 1SR3A 1X56A 5IYDG 2MNAA 1YHQA 1E1OA 1YNXA 2K5NA 2YTYA 3E9HA 1PH5A 3U4ZA 4DV7L 4DV2L 1X54A 4JI5Q 4A3JH 2NVQH 3S1QH 3I2ZA 4Y7NH 1BKBA 1I5FA 4A3IG 4A3FG 1PH4A 1FJGQ 4DR4Q 1YJ9A 2R7ZG 2RHQB 1Z9FA 5FLMH 1CSQA 2Z6KA 3AEVA 1VQPA 1X55A 4DV3L 4BY1H 1YIJA 1TXYA 3UDFA 4LF7L 2R6GA 3M9BA 3PF4A 1VQAA 3PO3G 3EN2A 1YHBA 1Q81C 4K0KQ 1PHJA 2A8VA 5JJIA 1QUQA 3CMEA 2VUMG 2R7FA 3J7ZC 1VQOA 4IFDG 3NELA 2UUCL 4DV4Q 1EFWA 1CKNB 4HJ8A 1PV4A 1KL9A 5GAEC 1I94Q 1RL2A 2BA0A 3BU2A 4DAMA 4AQYQ 3F8TA 1OTCA 1FL0A 3PV0A 3KFUA 4XTCS 2ES2A 4DR6L 2ZJPA 1GKHA 1NTGA 3CQZH 2AWNA 4BBRG 2UUBQ 2GVAA 4YY3L 4LF8L 5IYCH 3CCMA 3I4NG 1SFOH 1WCMH 1OXUA 3KLWA 1X9NA 2F52A 1MKHA 1EQQA 1QVGA 4JI7Q 3CD6A 3CW2C 3RLOA 3ZJYC 3M4PA 2K4KA 3M4QA 4LFAQ 3CCUA 4A93H 2CKZB 4LF4L 1KHIA 4X64Q 3UDIA 4PMWA 4IPDA 3TRZA 2PQAB 3G48A 4C3IH 2KHJA 2JA7G 3GTLH 1EQRA 4DR1Q 5FLXc 1NMFA 3KF6A 3STBC 1VQ5A 5C0XG 1XMQL 2Y0SE 1NE3A 3FHWA 3KDFA 4A3EH 4A3LG 3A5UA 2VS1A 1BVSA 5IP9H 4LF6L 1HNWQ 2Y0SG 2JA9A 1V43A 1WI5A 2C35B 3F2DA 1N33L 1UE7A 2B63H 2I5LX 4BY7H 1HZAA 4X66Q 1UE5A 2VQEQ 3GD7A 2EIFA 3W5OA 5IY0A 1X65A 3T1YL 1K8AC 2K50A 3K80C 3RN2A 3TEHB 1EOVA 4DKAC 1XNQQ 2AMCB 4IOCA 5HGQA 1HR0W 4DPGA 1PYSB 4JYAL 4GNXC 1W3SA 2UXCQ 4JI2Q 5JJLA 2UXBQ 3ICEA 3HOXH 1JT8A 5EAYA 5ELNA 4C3HH 1HJPA 3GTPH 2K14A 3S1NH 4GKJL 2N3SA 5C3EH 3S2DH 4YWKA 4GKKQ 3ER0A 1L1OC 5IP7G 4RG1A 1JMCA 3RZOH 2JA5G 1N36L 2R93H 5M3FG 5JEAJ 4JI0L 1PVOA 2OTJA 3HOZG 3T1HQ 5IYDH 4QL5A 4UY8C 1IZ6A 4DK6C 4UP8A 4L5TA 4B3TL 1AE2A 4KLKA 3HKZE 3GTOH
chains in the Genus database with same CATH superfamily
1IBKL 4IUNA 5EPKA 3VPBA 3BZCA 4OO1G 4J9OA 5F9NA 4QIWA 1XTDA 1IKLA 4A3IH 1HQRD 4O2DA 5JEAG 1E4FT 1JOKA 1XPOA 1G91A 3GIDA 4YP3A 3V96A 4QF4A 4NMZA 2EYFA 2KVMA 1TAEA 1TS4A 2IW3A 5KT4A 2AWOA 3ONAB 4ABNA 1ILPA 2NVQB 3EROA 4BA2I 2PNRC 1SAPA 2KCNA 1JB3A 2W6QA 4RUCA 1FJGL 4O4IF 4LF6H 1RK5A 3TZDA 2LKVA 1VQBA 4ID6A 4UPAA 4BY1B 1D5MC 4RAUC 4RKBA 4U673 1TIID 3TS2A 1SNQA 5M5WH 1YEZA 2VUGA 3A7LA 4K0KL 3PMFA 1A62A 3S24A 4IOAA 1MSHA 4Q45A 4HR7B 4DV4L 2BH2A 1P8LA 4PQXA 4JI1L 4AQYL 3CQZB 4J9MA 2L15A 3PW5A 1WCMB 1EY8A 1GUNA 3H4BA 1HRJA 3IAYA 2PZWA 2DGYA 4JI8Q 2FB9A 5KG0A 3J7AF 1E4GT 4QWCA 2F0VA 5IWAQ 1GJXA 2OQ0A 1V8QA 1IL8A 4JI7L 4DV0Q 4LFAL 4IFDJ 1S5DD 4XQJA 4B3TH 2W8LA 5M3MG 1EYAA 1EWCA 4C3IB 4A3DG 1TWAH 3GV3A 4QWEA 2G9HD 4TV8F 4DAYB 1KJ9A 1N34H 3GTLB 2K33A 2BA1A 3RR5A 1H95A 2N55A 4DR1L 4ECQA 5CV6A 1PH1A 2IT1A 4RMFA 2P0AA 3QIAA 1QVCA 2KCMA 3C2PA 3V6HA 3U4VA 5JPNC 5KT3A 2EXDA 5J2TF 1HTLD 3OHBA 4K5VA 1MHWC 2W9AA 4FO2A 1ILQA 5EGTA 5H80A 4DL6A 5KNBA 3I56A 4JI5H 1AW7A 4FF4A 3MEFA 1B70B 5I6YA 5M3FH 4FF1A 3L4KA 5TSSA 3C0FB 3KK7A 4DR4H 4YWLA 5DLQE 3S16H 4UCTA 3RBDA 4CDDC 2RVLA 2WIIB 1EWIA 5KYLA 4ECRA 4RNNA 2L5TA 3K5MA 1VQ8A 4Q0YA 1PFBA 5DM73 2YYZA 3RZOB 1G291 2MCTA 3S1NB 4PWQA 2K03A 2K75A 5JH7F 4HIKA 1FGUA 1RTOA 4CJ2C 3SXHA 5KG4A 3TREA 2D0PA 5FO8B 1Y1VG 3GTOB 3RUZA 3NBHB 1Z2NX 3KHLA 4J9RA 4A3GG 4GOPC 1CA5A 1EWHA 2Z4HA 4GNXA 4L5QA 4DNRB 2E2HH 4MHEA 2QK4A 2YS7A 1KNAA 2W9BA 2PZTA 1KDCA 4GLXA 4X62L 4DL7A 3D4WA 3R2TA 3EYYA 1N32Q 1AE3A 3OTOQ 3HZXA 5M5YB 3IG0A 1RF2D 3MZ5A 1SLJA 4RAZA 5L1LA 1SMYD 2YZMA 3RAQA 5KG5A 2FXQA 4C2MB 1B53A 3M4OH 2ALYB 2VUMB 3RLNA 4MA0A 4O42A 2K05A 3QWNA 3CCEA 4NXML 2KENA 3PO2H 2ZJRA 4F4ZA 5DNFA 1ML0D 4BBRB 5GADC 1HNWH 5JQWA 3ND9A 4HJ9A 1B6RA 1KNEA 1V1PB 3I3CA 3SR1A 5EWGA 4KHPQ 2IP4A 2R92H 2XGQA 4DUYQ 4QMGA 1EUJA 2CQAA 3UE0A 4R4OA 4ZLTF 2KEDA 3NENA 4JI2H 5AFWA 1V1OA 4KHZA 4Q44A 1EIGA 3D4DA 2CCZA 1E2ZA 1N48A 4GKKH 1EYGA 4B3SQ 1CT1D 4XXEA 1RIPA 2RCFA 4DR3H 3A5ZB 4P72A 3MFIA 4R4TA 1WD0A 2A19A 2D0OA 1VQDA 2RDGA 5FLXE 3NEMA 2Y0SB 1SNPA 3TS0A 1PTOD 4QWAA 1BCPF 2HQEA 2EJMA 3EJIA 3N52A 2HIVA 5LMNL 3QOLA 5E7NA 4F7XA 3Q2OA 2ALZA 1LT5D 1PRTC 3A56A 4EFBA 2JEFA 2NB0A 2YZNA 4HJ5A 1C8CA 4JCVE 2B63A 4DV5L 2QW7A 3N8DA 2MO1A 5LMUQ 2F03A 3R5XA 5IIFA 5KG6A 1BOSA 2DLNA 3FVQA 5IGFA 2DJGC 4OELB 1DM0B 2BE5C 4A3MH 2W6PA 5EDWA 3PR5B 2JA5B 5IGBA 5KFOA 2F3IA 3K5OA 3VR4A 3NTIA 1SNDA 5LL6S 3E5SA 1U5KA 1QILA 1S3OA 1E2WA 3NBIA 2EDGA 1LT4D 2KA7A 4UHVA 1STAA 4MNOA 1W6JA 3HOWH 5GAHC 1HA5A 1D5XC 1I7LA 2K6AA 4ZCKA 2A74C 1DD2A 3S2HH 2FMAA 1TWFB 1I6VC 1CQJB 1G51A 2EXZA 1VAJA 3TQ1A 3H0GA 3CPFA 3K8AA 5KGUA 2R7ZA 4QQBX 5C0XI 2D2CC 3EA6A 1I50A 5FOBB 1ULZA 4JI8H 1XNRQ 5COYA 4HJ7A 3KYHC 4A3BH 1JORA 2VQEL 5IWAH 3HOYH 2YU9B 3M9OB 2YYAA 1U4RA 1XPRA 1TWGA 3GO5A 4DV0H 3S17H 4MV7A 2EYJA 1Q81C 4J15A 4L5SA 4LF5Q 1EL0A 4O2AF 5C44G 1KLGD 4DV6Q 1C7YA 3Q8PB 2EQSA 3DLLA 4IJLA 1TS3A 2E2IB 1EIYB 3CCSA 3V6KA 4J8QA 1EQTA 2DIKA 1NUCA 3JAMc 1CM9A 2VQFL 2FLLA 3Q8SB 1TKWB 2MUYA 1QNUA 2FJZA 4DN4M 4DV2Q 1CKOA 2OXPA 5ELFA 3T5LA 2KHIA 4CKCA 1R9TB 5C5MA 2KCTA 1NNXA 1SYCA 3GTQB 3JAMi 2RDHA 3K7AB 1AUXA 5KFBA 3BQ0A 3RF2A 2HCCA 3DXJC 5EZYF 3UQ8A 1A2TA 1N8RC 1WTWA 1HXYD 3J81c 1BBXC 4LF9L 3PCOB 2JA7A 1C3OA 4K5XA 2PYKA 4NDXA 3Q8DA 2NU7B 1SSOA 3LMLA 1IHZA 1O7IA 1E7ZA 4YAKB 5T1GA 4JV5L 1JICA 3UDXA 5C1PA 5KG2A 1VQKA 1BQQT 1FGBD 1F77A 4K8IA 2E5LQ 3M7GA 5LMNW 3J81i 4K5WA 4JUZA 4IZOA 1U4MA 2KCCA 2CW8A 1PTOB 3SVMA 2XRQD 4BY1G 2OT2A 1BBWA 1A3VA 5KFDA 5DG7A 4DK0A 5JPMC 2ZTCA 4IUVA 3U9SA 2XWBB 1WTHA 3N41B 1YZ6A 1BNZA 2HIXA 1JE4A 5I2YA 1YJWA 4LF4Q 2GVBA 2YTVA 4C56C 1PH7A 4OONA 3S14H 2YL2A 3NQTA 1PDQA 3F8NA 4HMJA 5KEEA 5KFWA 3CCQA 1A6XA 2VQDA 3PIP3 1ZHQA 1N32H 5IT9c 3OTOH 2F0IA 2B2UC 1SYBA 2AQ2B 1WCMG 1W96A 1F9RA 5KKNB 1G2SA 2F0TA 3VYRA 1EZ8A 1UNSA 5C8YF 2ASJA 4GC6A 1EZ1A 1Q90A 1J8IA 5C5LA 2NN6I 2LFNA 2ATWA 1UC9A 1ET9A 3FPUB 2WB1E 2I5HA 3PGZA 1WTXA 1XYIA 3Q1KA 1RJRA 3K5NA 1RDPD 2WB1G 1X3QA 1GVPA 5L1KA 3AFQA 4C3IG 3DWPA 1LTBD 2B3GA 4YR3A 4DL5A 4IRCA 4QUCA 3OSPA 4KHPH 1ZEQX 2UU9L 1AN8A 2PI2E 2D9UA 2HT1A 3S15H 1JJGA 3MAQA 1STNA 4JI6L 1VKZA 4DUYH 5EKKA 5LL6b 2VA3A 3QFFA 4KY5A 1Z2PX 1G6PA 3WOEA 2NUCA 3H6MA 4QCLA 5IP9G 2J9GA 3K3VA 1Q12A 4GLVB 1A9XA 4O3SA 4DR2L 1VQLA 1KABA 4Y52H 2EY2A 2OLSA 5CV9A 4R4QA 5KFSA 2IBKA 2K28A 4OHJA 2I5MX 4B3SH 3HOUB 1JIHA 1Q8KA 3M9NB 3GTPA 4PZ8A 3RGZA 4JI4Q 4YHHL 1XMOQ 3G8CA 1DOLA 1WJJA 4MTNA 2WTFA 3GTGB 5D3DA 1WTPA 3MWMA 2AHOB 2HHHL 4XX0B 2RF4A 1JMCA 2RCNA 3CP0A 4AYBE 4OX9L 2JA6B 3EVQA 4J9KA 2ZXPA 1SYEA 3WDNA 4AYBG 1Y1WB 4IR9A 1SR3A 1X56A 3LNNA 5IYDG 4EVOA 4RKLA 2K5NA 5G3LD 2MNAA 5LMUH 3E9HA 4APMA 1RODA 1CZGA 4MN3A 3FDTA 4OGQC 1STHA 1KJ8A 3S1QH 2RA4A 3I2ZA 3KLSA 3GQBA 1ZQ7A 4TQSA 2PO4A 5D1OB 2QDBA 1YJ9A 5BN3A 1EY9A 3K5LA 4E4TA 2Z6KA 1X55A 4LF7L 1YIJA 1TXYA 1EU3A 3PF4A 2HD3A 4CBVA 1S9FA 2X6GA 3KHGA 1PHJA 2A8VA 2VUMG 4L1KA 1VQOA 4F4XA 1F2LA 4HEDA 1PV4A 1I94Q 1EFWA 4B3MQ 2K5QA 2I0QA 1I3QA 3NWTA 4DAMA 4QWBA 1SEIA 3GTJA 3PV0A 4ILWA 4XTCS 2NVTB 2NU9B 3CKIB 1GKHA 4BBRG 2AWNA 4WORA 1SNMA 4O1NA 4FF2A 1HFNA 5HURA 2F52A 1W6KA 1EY6A 4FNFA 3M4PA 4A93H 4MV8A 4XYLB 1XNRH 3MWEA 4X64Q 1ESFA 5K2MA 4RZQA 3S2DB 2PQAB 4LF5H 4DV6H 1PRTD 1S5FD 2FMMA 4HNVA 1Y1VA 4IUUA 3V2TA 3STBC 2VA2A 5C0XG 2Y0SE 1NE3A 3FHWA 2Z1CA 5E4WC 4A3EH 4KKTA 3A5UA 5DGAA 4LF6L 1A3UA 2JA9A 2Y0SG 4EQPA 1WI5A 2C35B 4EBCA 4RB1A 4DV2H 4LJZC 5CBEE 2BE5D 2B63H 4O4LF 1HZAA 5C5JA 2EIFA 3W5OA 1K83B 1X65A 3RZDB 3GTMB 1XNQQ 1WH2A 1FNVA 1EYCA 2ZT9C 4GNXC 2UXCQ 2W9CA 5D3IB 3NTHA 4PMBA 3HOXH 3G6XA 5EAYA 4HYKA 5FD6A 1G8ZD 3OHXC 4KKSA 1TWCA 3C1FA 4EEQA 1H9SB 5IP7G 4DNTB 2JA5G 2E5LH 4ZAIA 2NU6B 3T1HQ 4UP8A 4B3TL 2R85A 4KLKA 2C2EA 4GOPB 4NKLA 4MV1A 1JWUD 4YIJA 1HQMC 5M5XB 4O4HF 4BS9A 5H1SE 3PIPA 1N34L 3OUUA 3PR4A 4LF4H 2R7ZH 2MGSA 2OTLA 4X65Q 3L9AX 3R93A 1I50H 4LFBQ 2WAQB 2E2HA 3PO3H 3TINA 2YRXA 1WTOA 5FK9C 1JWSD 1TWGH 3D6WA 2R86A 1P16A 4JI5L 3HS0C 1Q1EA 4IFDH 4OIJA 4R8UA 2B2WA 2VR1A 2R8KA 4DR4L 2PVPA 3MFHA 3TSSA 4I50F 4B9XA 1CKNA 4K6DA 1QZHA 5EOYA 1YI2A 1PH8A 4QWDA 2QKIC 5DM63 3Q24A 2CHBD 3F1ZA 3PSIA 3WNZA 3I72A 3FP9A 1KDBA 4KD4A 3KF8B 2F1MA 1Z7TA 4I65A 4PNYA 4BWGB 2QEXA 2R92A 1S5ED 2RDIA 3J80c 4JBKA 4RCOA 2JA7H 1PXUA 1TS2A 2F3VA 3QZ7A 1NSNS 3Q23A 3CXCA 2I80A 1SBBB 1I4GA 4JI4H 1SE8A 1XMOH 3J80i 2UUAQ 2WP8J 4UCRA 2AQ4A 2KBNA 1PRTB 3K58A 3A55A 1B7YB 2FE3A 2LSSA 3E0EA 4R4IA 1A2UA 2Z9HA 1VQCA 1ZHSA 5C4ZA 3DM1A 2PPBC 1HH2P 2L1BA 2R7DA 1L0WA 2ZM6Q 1HNWL 1LUZA 3I4OA 5KFEA 1MGSA 5DLFA 1M6VA 4FBUA 2D62A 5KFMA 3U50C 4DU9A 4G7OC 3M3YH 5IOCA 2Z0SA 1J5EQ 4CKEA 2PMZE 1G2TA 3MR3A 1TS5A 4ETSA 3BZKA 1KRSA 2F0UA 5C0XJ 1RK6A 1KAAA 4JV1A 4C3HB 2OCEA 4JI2L 4Q8EA 2PCFB 1K8GA 5C3EB 4MTDA 3OWFA 4PG3A 5KFJA 4JBWA 5JAVA 5JEAH 2JA8G 4GKKL 3MXNA 1E4EB 3MXGA 3PO2B 2R93B 3M4YA 4UCUA 2RBMA 1LTSD 2PNHA 4DR3L 1I94H 1X6OA 3CCVA 2O03A 2EYPA 1RJQA 4A2AA 4QW9A 3R23A 4JV0A 2UXDQ 2B2TC 3G6EA 1EIHA 4ME5A 1FKAH 1F9QA 4PZ6A 4XT3B 1ESRA 1AUVA 1L1OA 4X64H 4NP5A 3TP6A 5K36G 2XRSD 3KBGA 5C4JB 2EOTA 2K04A 2W6MA 5KYIA 4C1NK 4K8JA 4J9LA 2BOSA 1VBHA 3GLKA 1O7ZA 1F9PA 5JOBA 3HOUG 2RDJA 1DV2A 4YQWA 4IJHA 4DUZQ 1Q7YC 3AU7A 1QUQB 4JOIA 2C5CA 1AH9A 3I4NB 1WVLA 4HCEA 1I6UA 1HZBA 4EGVA 2FPPB 2MO0A 3SE7A 3CAMA 5CV7A 3H3VH 4HR7A 1ZETA 4KI0A 4IPCA 5L1IA 3L7ZC 1HA6A 1YNNC 3CQZA 3NWSA 2JA6G 2K5DA 1WCMA 1FVIA 1XNQH 1Y1WG 5KFAA 2UXCH 1PA6A 5M3MH 1Y8NB 4ALPA 2HGSA 3NXWA 4LUZA 4A3MB 4A3DH 2A6EC 4KY6A 1SNOA 5FJ8G 1M1KC 1ENFA 3WO0A 3PN1A 2IHEA 3A74A 4R8IA 2WB1A 3JSLA 2AUKA 2OQKA 4JI8L 5IWAL 5T1IA 3V6JA 1DV1A 4DAYA 1LM0A 3G6JB 3CC2A 5KFQA 2IX3A 4DV0L 3T1HH 3GTLA 3NPPA 5KG3A 4RGOS 2PI2A 2XNAC 1I3QH 1SRUA 1U4LA 1PMRA 3JAML 4Y8VB 1M8AA 1CE8A 1C0AA 3GTJH 3M7NA 2E75C 1I6HB 3HKSA 4DF7A 2FK2A 4DK1A 1KAWA 4XYOA 4DLKA 4X65H 2TSSA 1D8LA 1S5BD 4YBZB 3EFXD 4LFBH 5IODA 1PZKD 4DXFA 2KQ3A 1U4PA 2QGQA 3NGDA 2HQLA 3PUXA 4QY7A 1NBWA 1KDAA 2LY7A 3STBD 3J81L 2KJXA 3HOZB 2NVYB 3HEJA 4XT1B 3C3LA 1TY2A 2JEIA 1JB7A 1EZ6A 1H9MA 1Y1VH 4AYBA 4A3GH 1IBMH 1IXRA 3D6CA 2FHTA 5A2QL 4Q43A 1LTTD 4FS2A 3G4SA 1BBUA 3GTOA 4ED2A 1BCPC 2IWHA 3HGBA 4QIWB 2HJWA 4ZYSA 3FKIB 4YCVA 4M8AA 1S97A 1HR0Q 1STGA 3H3VC 4FXKC 1BUVT 1PH9A 4NXNQ 1A3TA 2B39A 1CS0A 5I47A 2ZTEA 4ED8A 4L63B 4JV2A 4PDBA 2NVXB 4C2MA 4FXDA 5IT9L 2X0SA 2VUMA 1VQIA 5ELEA 2GLTA 3ORQA 1TWCH 1B04A 4DV1Q 5HV6A 1N32L 2IPKD 3OTOL 2UUAH 3JZIA 1SEBD 2VY3A 1GO3E 5DG9A 1EIFA 5IGCA 2Z6KC 3MTSA 1BGWA 2V4QA 1HFGA 4JI1Q 2IX1A 4XQQA 1KC8C 3TP7A 3HOVB 5HBRB 5LP6F 3EPIA 2K5WA 1TVXA 3UE1A 2ZM6H 3QJYA 3DUZA 1JOQA 1N9WA 4DNIA 1YVCA 1DOKA 2RKSA 4KHPL 1J5EH 3PW0A 1JXLA 2ZJQA 2JSOA 2R87A 4AIMA 3E0JA 4N9PA 5LHY1 4DV3Q 4DUYL 2WAQE 1CQFA 2O4XA 2CWAA 2VZAA 5KG1A 4EQOA 1K8MA 2AQ3B 2WAQG 4QUFA 3G71A 2UVVA 2F3WA 3LGJA 1WOCA 3GTKB 3JC66 2Y0SA 4MZ9A 2XN9C 1DONA 4RCNA 4UDUC 4C3JB 4B3SL 4OWWB 1VQNA 3JAMW 2R7MA 1UEBA 4DA2A 4DR6Q 3KJOA 4LF8Q 4H13C 2EE1A 5FLMG 2YTXA 1JDEA 2EJGC 3E6ZX 4J6HA 3CHBD 3T5KA 1JKJB 1LABA 1WYDA 2WACA 1CI3M 2EYMA 3S1RH 4X66H 1LTID 1E22A 1OXXK 1KXLA 2BQRA 3BG5A 2UXDH 4I55F 1RTNA 3I55A 2D5DA 2NUAB 4ECVA 1KEEA 3GILA 4JW0A 1CUKA 3G7LA 3NTKA 2JA5A 2EVBA 2K52A 5LMUL 3SDZA 2SNSA 3HG9A 4P74A 1E0BA 2AUJD 2F0SA 2DUDA 5KFHA 4J9QA 2F0HA 3BJUA 1X3PA 1XMQQ 4HNTA 4IO9A 1N33Q 1AEXA 4DUZH 2VPQA 5FO9B 2AKWB 3TIGA 4CC5A 3KBXA 5KFFA 1FNUA 3S1MH 1GLVA 1C48A 1Y8PB 3ULLA 2K32A 4A3FH 3ULPA 1TWFA 4HIDA 1F2ZA 4LNQA 1D7QA 2L55A 1J9OA 3VYUA 3TN2A 1MBYA 1A8VA 5KG7A 2FFKB 1K8OA 3T5JA 3RV4A 1VF5C 5D65A 3PW7A 1L2FA 1EHIA 5C44H 3J7AV 5JJKA 2W9BB 2YU9A 4GLAC 5IT9W 4IAJA 3TMEA 4WJ4A 1N36Q 3RIZA 1A15A 3S9WA 2CH4A 3LWBA 1VMCA 4CDCC 1S68A 2VL6A 1XNRL 1UAPA 2F4VQ 2E2IA 3I4MB 4JI3Q 3BA8A 4C3HG 2CQYA 2B2WC 2O5IC 4LF5L 4DV6L 4A75A 3QO2A 3Q22A 3AYHB 3KHHA 1R9TA 4ZQ3A 2R93G 3GTQA 5J39A 4LMQD 4YR0A 2I46A 4XDXA 4ECSA 1ICFB 5C4XB 1ZXTA 2O5JC 1RCVD 2F0KA 2F0GA 3IFTA 5IGGA 4ZHQF 4DV2L 4F4WA 2YS6A 1MI2A 3A54A 2B2VA 2NVQH 3O13A 3D3RA 1BKBA 1I5FA 3U9OA 2SDFA 4A3FG 3SE0A 4BBSB 2L4NA 1JR0D 3RGXA 2W7PA 4LK1C 2RHQB 4LAAA 1CSQA 3N44B 4BY1H 2VXWA 2R6GA 5KT6A 2F0DA 4O3RA 4ZUIA 1YNND 2G5DA 1PFMA 5JJIA 3QR8A 3L4JA 5CAEB 2XGPA 4HJ8A 2E5LL 2BA0A 5F2DA 1WD1A 1OTCA 3BQ2A 3F8TA 2C2DA 1FL0A 1TWHB 5D8DA 1ZYRC 2F0PA 2W71A 3CQZH 3I4NG 2UUBQ 1HHVA 1W93A 2A6ED 3V4ZA 2HDLA 5G3LF 1HR0H 1WCMH 1OXUA 1X9NA 2YRWA 2HDMA 4KK7A 3HP3A 4RH6A 2PMZA 2XCPA 3GIJA 1BNCA 1EQQA 1JX4A 2W7OA 3CD6A 4A3KB 4NXNH 3OSOA 3BVZA 2K4KA 2FLNA 2E2JB 4LF4L 4CC6A 4PMWA 3TRZA 1LACA 3A7AB 4IZ8A 4DV1H 4FS1A 2RQXA 3G48A 4C3IH 5EWEA 1N56A 1JCKB 3GTLH 4X3UA 2F0LA 4H44C 1VQ5A 3KDFA 4A3LG 4H0LC 2VS1A 5DAUA 2E76C 5IP9H 1GUWA 5GONF 4DL2A 2HVRA 3MA2B 5I4DA 3F2DA 1UE7A 2I5LX 2VQEQ 3GD7A 2JEJA 1K8AC 3SK5A 2K50A 3H0GB 3K80C 3HRZC 4DKAC 2AMCB 2EYLA 4ZK9B 3D8GA 4HTHA 3DMUA 2UXBQ 4DV3H 4UAIA 3T4AC 3J80L 5ELNA 3AMUA 2N3SA 4RGTA 3ER0A 1MZBA 4J9PA 1L1OC 1PRTF 4RG1A 2QILA 3RZOH 1BCPD 2EY5A 3N6RA 3GTGA 5CA1F 1SE2A 1MSGA 1GUGA 3E3XA 1L2ZA 2OTJA 3HOZG 5IYDH 4DR6H 4QL5A 2QEJC 4LF8H 4DK6C 2JA6A 4NB3A 5I2XA 4JI4L 3GTOH 1XMOL 3TQTA 4JOIC 3VR6A 2A6HC 5HGTA 5BR8Q 2Q8TA 4DGZA 2CW0C 1GHKA 4DR7Q 1XXGA 4I7HA 5ISRA 2Q2HA 5CC4A 4POGA 3RFCA 2WKDA 1XX8A 5M5YH 3FKIG 5IYBG 1GUOA 1SXTA 1IBLQ 1H9JA 5CV5A 1EUCB 4C2MH 4L8JA 4A3JB 2VUMH 4Y7NB 1B6SA 4IUTA 1Q82C 1XMQH 1RYRA 2DY7A 2JXMB 3N43B 1EEID 1GOZA 4HSVA 1WTVA 4OEMB 1U9RA 1B4OA 1VQGA 2KSWA 4BBRH 3IL8A 1N33H 4YCWA 1HNXQ 2XVSA 3KALA 1M4VA 4M7EA 4HN7A 3TQYA 1Q3LA 4YAJB 1SE4A 3X3MA 2M05A 1OXTA 3BDOA 2V58A 4K2KA 1KJIA 4A3CG 1I94L 4EQ5A 3HOVG 4LMYA 1R4QB 4U7CA 4JBJA 3D0FA 4L6TB 5KFRA 4ECZA 5J3BA 1SFOB 2RSOA 4P73A 1JJ2A 1BDOA 4GS3A 1ZKOA 3TZUA 1II3A 4B9WA 1SYDA 1V1QA 1N36H 2PQAA 5C0XH 3UDGA 1IKMA 1UNNC 4XQNA 1YITA 3FRPB 1CHQD 2WDTA 5CORA 1L0YB 3QB3A 2NZHA 3TDQA 2R6FA 5KFIA 2F4VH 4FXGC 4X64L 4JI3H 1QCBD 3QZ8A 3BAAA 2UU9Q 4KV6A 5EKLA 1KJJA 1EOTA 2R8HA 4RB3C 3E9IA 2QA4A 1K1QA 1M0WA 4YJ3F 1GUSA 3VA5A 3IN5A 5JUMA 3CRKC 4KTAA 4C3JG 5IGEA 3HXLA 4APVA 1SE3A 1K83A 5ELOA 3GTMA 1C9OA 2FKLA 4RFBA 3VDYA 5EPLA 1Y69U 1UC8A 4BY7B 4UFZA 2ASBA 4QGUA 1IOVA 1KQSA 3J80W 5IP7H 2OH2A 2JA5H 1VQEA 2JN4A 1F2MA 1BO0A 1XNQL 2VPSA 1F2YA 4ODGA 1LLRD 1H9SA 2UXCL 3GIPA 5CB4F 3GTPB 2R7KA 1QZGA 4UP9A 4B3RQ 1EFID 2AQ1B 2J4XA 3Q0AA 3F2CA 1XJVA 1D1IA 5C3XA 1BCPB 4GOPA 2M9VA 4EYHB 4FBTA 1A0IA 2GPSA 2NWGA 4MAMA 4IPHA 1TWFH 1ENCA 1VQ6A 3SK6A 1V51A 3RAXA 1PZJD 3T1HL 1DZ1A 4YJ2F 2Z6BA 5HY6A 3U9TA 2UUBH 3VA7A 1JOOA 2ENBA 4A3IB 2CW7A 2WAQA 2ID0A 2XSCA 4HNUA 1L0XB 1X32A 2JE6I 4DL4A 4TVAB 2YU9H 1JDBB 1PK8A 4OO1I 3MXUA 3GIQA 4DR5Q 4FP5D 1X3FA 1Z47A 4X65L 3K0XA 1LTLA 4LFBL 4GZYC 5KFLA 1STEA 4ME3A 2E2IH 2N78A 3HFZB 1RKNA 1I4HA 4RAYA 2ZXRA 4KMUC 5AJ3Q 4EFEA 5C1OA 3ERQA 2A1AA 4JK1C 4LUOA 2FJ2A 2N49A 3RLFA 2RSNA 3DWQA 4HJAA 1QG7A 2NZ1D 5BN5A 3I4MG 1KRTA 2R84A 3I12A 1R9TH 2NTTA 1M7JA 5M5WB 3GTQH 1IBML 3K7AH 2RDFA 2AGOA 5KFNA 5I6WA 3UI2A 5L1JA 1Q8IA 3MVVA 4RGMA 1PH3A 4ED1A 2B8GA 3WO1A 4ZRZA 2H5XA 2UXBH 5C4XG 4GC7A 5JVDF 4O3QA 4O2BF 2ATLA 3FDSA 3J81j 1O80A 1IL2A 3AB9A 2FINB 3CRLC 4HIOA 3MHBA 4BBSG 3RB0A 1GYFA 2LXKA 3QG1A 2UVUA 3H3VI 1ZYRD 2MQHA 1D6EC 1PTOH 2K5VA 3ULJA 1K0SA 4KY7A 3VR5A 4A3GB 1IOWA 4U6PA 1Y14B 2ZDQA 5KFCA 3IRBA 2FP4B 1I4XA 2YV5A 2UUAL 1TWAB 4GN3B 2R8IA 4Q5VA 2EJFC 5BR8H 3VR3A 3BG3A 3L0OA 4ZOLF 3C46A 1KLUD 3H15A 1GXDC 4DR7H 3BJYA 2EZVA 1YJNA 4LFCQ 1D2BA 2R82A 4H02A 1GSHA 3TIIA 1DCZA 2Z8LA 2NN6G 1IBLH 2W9CB 4YCUA 4KHVA 2ZM6L 3NHHA 3ERSX 2JA8H 4IUPA 2CVRA 5I9OA 5M3FB 4A3KG 4P71A 4ED3A 5EQ0A 4KD3A 1J5EL 3S16B 4EBEA 2J0TD 4IRDA 1SYGA 1S4ZA 4P2CB 4DK3C 1E4EA 2R93A 5CBAE 5FLXL 1PFNA 1HNXH 3EQLC 3HKZB 2DWCA 1ICWA 4DAPA 3H4DA 2CQOA 2K01A 4UCVA 3VPCA 5K36H 1MJEA 2F0WA 1FD7D 3PIOA 2VNUD 3N42B 2E2HB 1YHAA 3H0GG 2DZDA 3HOUH 5ELDA 4X66L 2UXDL 3P75A 3QOJA 1B3QA 3K3PA 1HNZQ 5EWFA 1E24A 4ME6A 1O78A 4X3TA 4OXPA 4BXXG 3B6YA 2Q2IA 3HBLA 2K5HA 3GTGH 2NTSA 4WD3A 1EY7A 1SCUB 4LSAA 3M4OB 3NE5B 2QDLA 2CW0D 2JA6H 3H40A 3F2UA 2ZDHA 3M4IA 5CA0F 2A68C 2F0OA 1Y1WH 1TY0A 3GIMA 2C28A 4OWXB 2C00A 4DV7Q 1CHPD 4DUZL 4B3MH 4TUYF 3KLRA 3I91A 2Q2TA 4RZRA 4ECXA 2C22A 5FJ8H 2GA4B 1ENAA 2XWJB 5A35A 2XIGA 3L2PA 1D5ZC 3PUZA 3W3AA 3T53B 2R92B 2QYZA 4AH6A 3FMAA 2BR0A 3PUWA 1R4PB 1LO5D 5K5PA 4RNMA 3NSWA 1A63A 3DF7A 3U58A 3KUPA 5DEHA 3NQIA 4CJ0B 4B3RH 4A3JG 2NBFA 2UUCQ 1GUTA 4B08A 1HZ9A 5DGBA 3K5IA 4HSPA 5DG8A 4YY3Q 2NVTH 1LT3D 5GROA 3RV3A 4X3SA 1TU2B 4LW1A 2HVSA 1SYXB 4IURA 4CGYB 2ZTDA 1SYFA 2JYOA 4WJ3M 3DM3A 2G9DA 4HQ6A 2K7VA 5C4HA 3T5HA 4DR5H 2KOLA 1QOHA 4KJOA 2VOBA 3M85A 5IYCG 4ED6A 2Q8IB 4TV9F 4DR3Q 1KC7A 3ETJA 3GQCA 1B2TA 2VW9A 1IYUA 1TQOA 3RTXA 2WE6A 3MXNB 2H1EA 3D31A 4KJNA 3KF6B 5BN4A 3T1YQ 1GSAA 2A69C 2MP1A 4FDBA 4OL7A 3FKIA 1K83H 2ICEC 3RZDH 3GTMH 3HOWB 2W70A 4F87A 4JYAQ 3MJFA 1V9PA 4R1JA 3P1HA 3W1BA 4K2LA 3S2HB 3OPOA 4GKJQ 2J6SA 2ASLA 4IRKA 4MA5A 3GIIA 4DL3A 5ELCA 4BY7G 2NVXA 1IYJB 1S03G 1L1OB 1HR0L 3GV5B 3RBEA 2PQEA 3EBEA 4LSXA 3CCRA 4OIKA 4JI0Q 1VQ7A 2DPJA 3URYA 2Q2UA 1IW7C 2B29A 4NXNL 4A3BB 3PUYA 3WWVA 3HOYB 3CC7A 2YCHA 1C30A 1UEAB 2GPWA 3MFYA 1IBKQ 1BF4A 3S17B 2JEBI 4R8NA 2HUGA 4H7BA 4DV1L 1PTOF 5M5XH 4L5RC 1K73C 1BR9A 2PW5A 2F0MA 3A8IE 3KLSX 4QB4A 4TQUS 1PYBA 3DHQA 3F2BA 1JC7A 3NBHA 1O7LA 1YHQA 4FU0A 4RB2C 2VB3X 2YTYA 4XYMB 4QW8A 4RWSC 5IYZF 4LFCH 4XZ3B 3U4ZA 1AP0A 5KFXA 4CDFC 1X54A 5KX5F 3PW4A 5JVG3 2KECA 4F4YA 2AGQA 4A3IG 1PH4A 1FJGQ 2VB2X 5KFZA 2V5AA 4Z9CB 3GTKA 5FLMH 2WB1B 4TRDA 3AEVA 4DV3L 1EQVA 3UDFA 1B9NA 3M9BA 4CHTB 3GV7B 3EN2A 1QWYA 5E1FA 2L12A 3IKJA 1AZQA 5LYJF 4K0KQ 5LL6X 2MPMA 3CMEA 1LV9A 4CJ1B 3J7ZC 2PN1A 4DV4Q 1XTCD 5NUCA 1KL9A 5GAEC 1RL2A 3BU2A 4AQYQ 1V1PA 2O2LD 4ULLA 4C5BA 1G6ZA 1EU4A 4WFN3 4DR6L 2ZJPA 4LF8L 5CGKA 2GVAA 2FK1A 5F9LA 4IR1A 4UCOA 4Q8FA 5FPOA 2F0NA 1D1KA 1T5XD 4RGNA 1QVGA 4JI7Q 3RLOA 3ZJYC 3S14B 4LFAQ 3M4QA 3BABA 2CKZB 1S0MA 1KHIA 4MV4A 3UDIA 3VYTA 1HNZH 2XCLA 5D14A 1QJOA 2EY6A 2Q8RE 1VDZA 3W2DA 1EYZA 2ICIA 5EPJA 3I8ZA 2BDNA 4AYBB 4DR1Q 5FLXc 1NMFA 3VPDA 1XMQL 4N8X1 2SCUB 3X3NA 3FEWX 4DV7H 3BYTB 2NYZD 1N33L 2IL8A 1H9KA 5IY0A 1I4RA 3RN2A 1EOVA 3KAJA 5CV4A 3S15B 1HR0W 5J22A 3ITPA 3JSNA 3BDCA 3TP8A 3ICEA 4F88A 3T13A 1ET6A 4C3HH 3J81W 2K14A 4I7AA 4ZUJA 1EUDB 5C3EH 4IUQA 1S5CD 2R3ZA 2DN8A 3MC0B 4N8FA 1EY5A 2R7LA 1VF7A 3RJ0A 2UUCH 1IYVA 1N36L 2R93H 5M3FG 5JEAJ 1PVOA 4A2BA 4V0BA 1OWTA 2I87A 3TBIB 5A2QW 1NAPA 4YY3H 3RUPA 2F4VL 3HKZE 3G6YA 2ZXOA 1WFQA 4JI3L 1M0TA 4RB0A 1S10A 3VR2A 3HKZG 4IN3A 4ECTA 3T56B 1FYCA 4EBDA 3BA9A 1JLLB 3I70A 4X62Q 4QJFA 4NW2A 3PQIA 4GNXB 5EBDA 1X3GA 1SMXA 2X69A 5C4JH 1WTQA 5KFVA 2F0EA 4G7ZC 4JPBW 4MV9A 1QVFA 3S1QB 3SEBA 4NXMQ 2N8NA 1MIUA 2EPBA 2A68D 1AFPA 3WOFA 2FPIB 3I4NH 1HZCA 5L9XA 1E1TA 2FLPA 2DY8A 3T1YH 1HTPA 2N88A 1TWHA 3J7A5 5C3EG 3OMGA 5GAGC 1HUNA 1CQVA 2JQOA 5LXTF 4JYAH 2I07B 3I7FA 4IPGA 1CKMA 1RJTA 4JBMA 1SN8A 3PO2G 3K57A 4IQZA 3K0YA 3J7YW 4GKJH 2CZGA 3T16A 2UUBL 4M9UA 5BMVF 3R2IA 2PBZA 4JI0H 3N6XA 2R92G 1K0RA 2SNMA 4A93B 4EYIB 3SI8A 4A3LH 2ASDA 2JEAI 2DNCA 4O3NA 2GN5A 5FKAC 2ZDGA 4RU9A 1XPUA 1GM5A 5LMNQ 4I7ZC 1IBKH 4HCSA 1VQ9A 3L3OC 3PW2A 5KFUA 4LWCA 2LXJA 4POFA 1WTRA 1XDNA 2XIWA 4DV5Q 2NU8B 1QE6A 2QCPX 2OF1A 2MFIA 1I6HH 1XWEA 4WRDA 3ETHA 1O7YA 5KFKA 3Q8RB 1HUMA 1V4YA 1OO9B 4A3EB 1K1SA 2P5ZX 3AQQA 1TT2A 4X6AH 3ZYYX 3NP8A 2BH8A 2B63B 1DIKA 3RN5A 5D1PA 1YNJC 4O3OA 3PVXA 4GN4B 5E3FA 4O3PA 2MJ8A 1QNKA 3P7JA 4IHJF 3OW2A 5KT2A 1FJGH 4EEYA 3CC4A 1TR5A 3HOZH 2NVYH 1UUPA 1GHJA 4IWXA 1EY4A 2XGTA 3HOXB 2B2YA 1J6QA 4NLGA 1ASYA 2A69D 2UXBL 1CZWA 2BCOA 5IE8A 5FO7B 4MTKA 3VYSA 4DAVA 4A3MG 2DPIA 3EIVA 4K0KH 4I4TF 4FVMA 1S40A 5T14A 4DV4H 2B2TA 3FKIH 4AQYH 4U68A 1LYLA 5IYBH 3K7UC 1VQ4A 4JI1H 3A0JA 4R9WA 2AU0A 3OOCA 3CCJA 1B3AA 1UWVA 3A8KE 1CK1A 3HOWG 4RNOA 1IW7D 2M2LA 1E3PA 4JI7H 5BR8L 1K3BC 4ZI7F 2R7ZB 2NVXH 4LFAH 2HVQA 2V4RA 1NR4A 4DR7L 1I50B 3OW7A 3SK8A 2WYOA 4YB8B 2YW2A 3PO3B 3GDEA 1S0OA 4Q0FA 3KJPA 1IBLL 2XD4A 1TWGB 2A5HA 1OXVA 2VQFQ 3KHRA 4R7RA 4DR1H 4YWMA 4A3BG 4ED7A 3HOYG 3S1NH 2R8GA 4A3CH 1PX2A 3BVGA 2PZUA 3CCLA 1HPCA 3HOVH 2XC9A 1O75A 1RHPA 3JAME 2L11A 1UE1A 4ZQIA 4EQNA 1HNXL 1Y1WA 3LWUA 1BJTA 2NZOA 1DXMA 2RHSB 4LF9Q 1SFOA 2SEBD 2PMZB 4QIWE 4CKBA 4GN5A 4TSSA 2W6ZA 4JV5Q 2V1CC 4OWTB 3RD4A 2F0QA 2W6OA 5D1OA 4KN4C 1FNWA 3CMAA 2JA8B 3J81E 4KN7C 4MTEA 3GTKH 3GIKA 2JA7B 5KFPA 2AGPA 3SHLA 5KNCA 2CH4W 4C3JH 1U0LA 1VQMA 3BZDB 2J6TA 4K6LA 2OEOA 1NJIC 1CA6A 1T94A 4J1MA 5A2QE 1Q46A 2FK3A 3KDFB 3CF5A 5L37A 5BPHA 2A73B 3MFGA 2I8CA 3UFXB 1M90C 2WKCA 3K81C 3A8JE 3MEHA 2F0FA 3LP8A 2E8GA 1W2BA 4X62H 2LS01 5C3WA 1Q86C 3V05A 2X6LA 4F50A 2LMCB 3RNUA 4NPSA 4KKUA 4B3ML 5GQOA 2IY5B 4FYDA 4WBNF 5DQGA 1T9HA 5CYUA 2OWOA 4IFDI 3RB3A 3M3YB 1YBYA 5IT9E 3IFDA 4NXMH 3KOJA 1CTMA 2KUMA 1H9RA 4XIGS 4DFAA 2H4OA 3E5NA 2HCIA 1VQJA 4WJWA 3BS1A 3PIO3 4ECUA 5JVH3 2CWPA 1PH2A 4RUAA 1X3EA 3VMMA 5JJZA 3H94A 2R61A 3BQ1A 2F0JA 4J9SA 2IX0A 4B3RL 1WR2A 4JI6Q 3NUCA 1STBA 3CU7A 1ASZA 1NMGA 4LUVA 2RGVA 2WFWA 1DJRD 4DR2Q 4E6IA 4UP7A 1Q1BA 2JEGA 3RMHA 4RHSA 2JJQA 2YZGA 4BWSC 2EY1A 3G6VA 4YHHQ 2C9OA 1VS0A 3R8BA 4A4IA 4R4CA 3I4MH 3OMCA 2HHHQ 1PZID 1VQHA 4BA1I 1UE6A 4DR5L 5LMNH 1QB5D 3K59A 1DYQA 3M9MB 4OX9Q 2ZJTA 4JC0A 1VCIA 4XYQA 4DV5H 2DNEA 2TMPA 1T3NA 2JP1A 4JG2A 5KT5A 5AJ3L 3SK4A 4EGQA 1K3RA 1EYDA 3OUZA 1K9MC 5E4XA 5C4XH 1JJCB 2W57A 1AN7A 1DGSA 3I4LA 3PUVA 1GD7A 1ONLA 4FM9A 2WV6D 4G3IA 3I73A 2E2DC 4C1NI 4MV3A 2KHSA 4BBSH 2IMWP 5LA6F 3OYYA 3I90A 5KFGA 4ZKCB 2KEEA 4LF7Q 3MWYW 2E74C 2J7ZA 3W1GA 4EX5A 5M3MB 3H20A 1PFSA 3CVZA 3JRXA 4JVZA 5J1ZA 4A3DB 3RB6A 2V4DA 2WINB 3R3OA 3ND8A 4C5CA 1SJED 4A76A 3CPWA 5M9OA 1KJQA 1B50A 4LH6A 1MJCA 1TWAA 3GV6A 1FR3A 1PLFA 1TWHH 4PZ7A 4IWYA 1NCVA 2NN6H 3FPPA 1NY4A 1I3QB 1T5EA 2FMCA 4X3KA 3JRWA 1S0NA 2RGRA 2W6NA 3NK9A 4O0AA 3GTJB 2EYHA 2UVWA 3FMCA 3KF8A 1EY0A 3OIPA 3LWEA 4A3KH 2VQEH 1MD2D 1BXRA 5DQIA 1OXSC 2E2JH 5LOVF 4ECYA 1JWMD 2JK8A 3BYYB 5DQHA 1PYWD 3MR2A 5J2UF 3OHAA 4LFCL 1VMPA 5EBCA 3PF5A 2XTIA 5JVLA 3DWAA 2BDOA 1B1ZA 4ECWA 3KAKA 1T36A 3R5HA 2VQFH 2IJ0A 4G4KA 4LF6Q 3HKZA 4A93G 2CFMA 1SROA 5DLGA 1CFMA 1VQFA 1Y1VB 2B8FA 3OSNA 3C1EA 4P75A 1YNJD 3GV8B 1SNCA 1NR2A 1KD1C 1B8AA 2EYOA 3H0GH 3V4SA 3Q8QB 3BDLA 3MR6A 2BQ3A 4LF9H 1S72A 4HIMA 4A3EG 1LT6D 4BXXH 1Z6HA 1SDFA 3MR5A 2BQUA 2C2RA 3T51B 1PH6A 3BVMA 5IGDA 4JV5H 5KT7A 2B63G 4HMIA 2PW7A 5KFTA 3GP7A 1TA8A 4G7HC 3HB9A 1WSCA 2IHFA 4B3TQ 2MHVA 4C5AA 1TWCB 1IBMQ 1E2VA 1HNZL 2SOBA 3HOXG 1SMYC 1JE5A 1N34Q 1CSPA 2L9HA 3SGIA 3AFPA 1KIXA 1Y8OB 4UCSA 3KTMA 2J6UA 3K6OA 5CV8A 2R8JA 1E1OA 1YNXA 4TQRA 1PH5A 3DEOA 3D4RA 4DV7L 4MV6A 4JI5Q 4A3JH 4Y7NH 5KRUA 2W8KA 3LX0A 4DR4Q 1I7NA 2R7ZG 3J7AK 1Z9FA 4IALA 3Q6SA 1VQPA 1AZPA 2B2VC 4RA8A 3RB4A 1VQAA 3PO3G 4R8UB 3MWDA 1YHBA 1GSOA 3MXPA 5KNDA 2A6HD 1QUQA 2QF7A 1RYSA 2UU9H 4ED0A 2R7FA 2UVRA 5EJWA 4PV1C 4F8MA 3NELA 4TKOB 2UUCL 4IFDG 4JI6H 1CKNB 4HAEA 5KFYA 3KFUA 3EPGA 1I4PA 2ES2A 2R7NA 1K28A 1B44D 1NTGA 1PTOC 4YY3L 1F9SA 5IYCH 3CCMA 4DR2H 4M1UB 1SFOH 3K5HA 3KLWA 2V59A 4ZKBB 1MKHA 4RHRA 1RJPA 4YR2A 5BPFA 4J9NA 4G57A 1I4QA 1JQYD 5I9PA 3CW2C 3TP5A 4K14A 3S1RB 5FD5A 4DXGA 2IA6A 3CCUA 3H91A 3DEPA 3R5FA 3J80E 3PZPA 4YHHH 1Z2OX 1LTAD 4OO1H 4IPDA 1C4QA 4LH7A 2HHHH 1KBLA 1CQIB 4CDEC 1EEFD 3OIQA 3N40P 4OX9H 5KIXA 2KHJA 2JA7G 1VBGA 2B2YC 1EQRA 1B33N 3KF6A 4S3SA 3P20A 1DOMA 1HCZA 1GGOA 4V190 1BVSA 1HNWQ 1V43A 1SJHD 3S1MB 1LTGD 4BY7H 2F4IA 4X66Q 1UE5A 4MIUA 5EKIA 4A3FB 3T1YL 2M00A 1LTRD 3TEHB 4IOCA 5CMDA 2B2UA 5HGQA 1B9MA 4DPGA 1PYSB 4JYAL 3ORRA 1W3SA 4JI2Q 5JJLA 4EGJA 4LF7H 5CR3A 5FPRA 5C44B 1JT8A 2L0CA 1HJPA 3GTPH 4FF3A 2V9WA 4GKJL 2DJFC 2K1BA 3S2DH 4PMCA 3H09A 2FPGB 4YWKA 4EG0A 1RD9D 4GKKQ 1BXTA 2XCAA 1KTKA 2NVYA 4JI0L 5FLXW 3OWEB 5ELBA 5C6AA 4N9TA 1STYA 4UY8C 1IZ6A 3KXYT 4L5TA 1AE2A 2Z4IA 4J0MA
chains in the Genus database with same CATH topology
1XMOL 1WFQA 4GOPB 4JI3L 1IBKL 3BZCA 4OO1G 4JOIC 3HKZG 1XTDA 5H1SE 5BR8Q 4A3IH 3PIPA 1N34L 4O2DA 5JEAG 4X62Q 4QJFA 1XPOA 4DR7Q 2R7ZH 2Q2HA 2OTLA 4X65Q 4POGA 4GNXB 1X3GA 1I50H 1SMXA 5M5YH 3FKIG 2I0QA 4LFBQ 5IYBG 5C4JH 1IBLQ 3PO3H 2AWOA 4C2MH 4NB3A 1TWGH 1QVFA 2VUMH 1P16A 4BA2I 1Q82C 4NXMQ 4JI5L 2N8NA 1MIUA 1Q1EA 4JI4L 1FJGL 4DR4L 1VQBA 1VQGA 4UPAA 4BBRH 3I4NH 4YCWA 1HZCA 1E1TA 1HNXQ 1CKNA 1QZHA 3TS2A 1YI2A 5M5WH 1PH8A 1YEZA 3TQYA 3J7A5 5C3EG 5GAGC 2F4VL 4K0KL 2JQOA 1A62A 3F1ZA 3PSIA 3I7FA 1OXTA 3S24A 4IOAA 4IPGA 1CKMA 3FP9A 4JBMA 1SN8A 3PO2G 3KF8B 4DV4L 4A3CG 2BH2A 1I94L 1P8LA 4EQ5A 3HOVG 4JI1L 2QEXA 4AQYL 4JBJA 3D0FA 2L15A 5J3BA 4P73A 1JJ2A 3J80c 2UUBL 4JBKA 4GS3A 2JA7H 2DGYA 4JI8Q 1V1QA 2PQAA 5IWAQ 3UDGA 2R92G 1K0RA 2OQ0A 1YITA 4JI7L 4A3LH 4DV0Q 2JEAI 2GN5A 3CXCA 4LFAL 2NZHA 1XPUA 1GM5A 4IFDJ 5LMNQ 1SE8A 5M3MG 4X64L 3J80i 2UUAQ 1VQ9A 2UU9Q 2WP8J 4A3DG 2KBNA 4LWCA 1TWAH 2LXJA 4POFA 4DAYB 1B7YB 4DV5Q 2LSSA 3E9IA 2QA4A 1I6HH 2MFIA 3E0EA 2BA1A 4R4IA 3RR5A 1H95A 1VQCA 4DR1L 4APVA 1PH1A 2IT1A 4RMFA 4L5RC 5ELOA 1C9OA 1QVCA 2KCMA 3AQQA 3VDYA 4X6AH 1HH2P 3U4VA 2ZM6Q 2EXDA 2R7DA 2BH8A 1L0WA 1HNWL 1LUZA 3I4OA 3RN5A 2ASBA 2D62A 4QGUA 4GN4B 3U50C 3I56A 1KQSA 5IP7H 3M3YH 2Z0SA 3MEFA 1J5EQ 2JA5H 3OW2A 1B70B 1VQEA 5M3FH 2PMZE 3CC4A 4YWLA 3HOZH 5DLQE 1XNQL 3S16H 2NVYH 3BZKA 1KRSA 2XGTA 5C0XJ 2UXCL 1J6QA 2OCEA 4JI2L 1ASYA 2UXBL 1K8GA 1QZGA 1EWIA 4UP9A 4B3RQ 5IE8A 4PG3A 1VQ8A 4A3MG 4JBWA 3F2CA 3EIVA 1XJVA 2JA8G 4GKKL 2YYZA 1G291 4GOPA 2K75A 1S40A 4HIKA 1FGUA 2PNHA 4DR3L 1A0IA 1X6OA 3CCVA 4IPHA 3FKIH 1TWFH 1LYLA 2D0PA 3K7UC 3TREA 5IYBH 1VQ4A 1VQ6A 3A0JA 3T1HL 1Y1VG 5HY6A 3NBHB 4A3GG 4GOPC 4GNXA 3CCJA 1UWVA 2UXDQ 4L5QA 2E2HH 3HOWG 3G6EA 2ID0A 1E3PA 5BR8L 2JE6I 4TVAB 2YU9H 4GLXA 2NVXH 4PZ6A 4X62L 4OO1I 4DR5Q 4DR7L 1L1OA 1X3FA 1AE3A 1Z47A 3OTOQ 1N32Q 5K36G 4X65L 3K0XA 1SLJA 1LTLA 3GDEA 4LFBL 3KJPA 2FXQA 1IBLL 4ME3A 2ALYB 3M4OH 3RLNA 2N78A 2E2IH 3HFZB 1OXVA 2VQFQ 5AJ3Q 3CCEA 4YWMA 2A1AA 3HOUG 4NXML 2KENA 4A3BG 4IJHA 4LUOA 4DUZQ 3RLFA 2N49A 1Q7YC 3HOYG 1QUQB 4JOIA 2ZJRA 4HJAA 3CCLA 3HOVH 4A3CH 1AH9A 5GADC 3I4MG 1HZBA 1KRTA 4HJ9A 1R9TH 2MO0A 3CAMA 1UE1A 3H3VH 3GTQH 4KI0A 1HNXL 1IBML 3K7AH 4IPCA 3L7ZC 4KHPQ 2NZOA 2JA6G 2R92H 2RHSB 4LF9Q 4DUYQ 1FVIA 4QIWE 1PH3A 1EUJA 4GN5A 3UE0A 1Y1WG 4R4OA 1PA6A 3NENA 5M3MH 4ALPA 4JV5Q 2H5XA 2V1CC 4OWTB 5C4XG 4KHZA 4LUZA 4A3DH 3CMAA 5FJ8G 3GTKH 3J81j 2CCZA 1M1KC 1IL2A 1EYGA 4B3SQ 2IHEA 3A74A 4HIOA 4BBSG 2OQKA 1RIPA 4C3JH 4JI8L 1U0LA 3A5ZB 4P72A 1VQMA 2LXKA 4R4TA 5IWAL 2A19A 2D0OA 1VQDA 1NJIC 3H3VI 1LM0A 2MQHA 3NEMA 3TS0A 3CC2A 2K5VA 3ULJA 4DV0L 1Y14B 1Q46A 3KDFB 2HIVA 3IRBA 3CF5A 2PI2A 5LMNL 1I3QH 1SRUA 2YV5A 2UUAL 4GN3B 5E7NA 1M90C 1C0AA 3GTJH 3K81C 3M7NA 4HJ5A 3L0OA 4JCVE 4DV5L 3HKSA 2E8GA 1W2BA 3H15A 2MO1A 1KAWA 1YJNA 1Q86C 5LMUQ 4LFCQ 4H02A 3RNUA 1D8LA 4NPSA 2IY5B 4B3ML 5GQOA 2NN6G 1T9HA 4YCUA 2QGQA 2ZM6L 4A3MH 2OWOA 4IFDI 3ERSX 2JA8H 2HQLA 1YBYA 3PUXA 2E5LL 4QY7A 1NBWA 3STBD 3KOJA 4P71A 4A3KG 2F3IA 4XIGS 1J5EL 1VQJA 1U5KA 1S3OA 2CWPA 1N34Q 1JB7A 1Y1VH 4DK3C 1PH2A 1X3EA 4A3GH 1IXRA 2CQOA 4MNOA 3HOWH 2IX0A 5GAHC 4B3RL 4JI6Q 3G4SA 1BBUA 1ASZA 1NMGA 4LUVA 3S2HH 4YCVA 2WFWA 4DR2Q 1MJEA 1G51A 4UP7A 1HR0Q 1Q1BA 3CPFA 3K8AA 4QQBX 3PIOA 2VNUD 5C0XI 1PH9A 2JJQA 4NXNQ 1YHAA 3H0GG 4BXXG 1XNRQ 4HJ7A 2ZTEA 3KYHC 4X66L 2VQEL 3HOUH 3HOYH 4A3BH 4YHHQ 2UXDL 1VS0A 1XPRA 4A4IA 1HNZQ 1E24A 3GO5A 1VQIA 4OXPA 4R4CA 1TWCH 3I4MH 3S17H 3B6YA 2HHHQ 4DV1Q 2Q2IA 1VQHA 2K5HA 4J15A 1UE6A 4BA1I 5C44G 4DV6Q 3OTOL 4DR5L 1C7YA 4LF5Q 2VY3A 3GTGH 1GO3E 1N32L 4OX9Q 2EQSA 1EIFA 4JC0A 3DLLA 1VCIA 4IJLA 2Z6KC 1EIYB 3CCSA 2JA6H 3JAMc 4JI1Q 2IX1A 4JG2A 2VQFL 1KC8C 1Y1WH 5AJ3L 4OWXB 1K3RA 4DV7Q 4DV2Q 4DUZL 1CKOA 1K9MC 5C4XH 1JJCB 2Q2TA 2KHIA 3UE1A 1DGSA 2KCTA 5FJ8H 3PUVA 1GD7A 3JAMi 3L2PA 1N9WA 4DNIA 3PUZA 1YVCA 4BBSH 3OYYA 4AH6A 4KHPL 1N8RC 3PUWA 2ZJQA 4AIMA 3J81c 4LF9L 4DV3Q 3PCOB 4DUYL 2WAQE 4LF7Q 3W1GA 4EX5A 2CWAA 3Q8DA 2VZAA 4L5SA 1PFSA 1O7IA 1E7ZA 2WAQG 3G71A 3U58A 1A63A 4JV5L 3UDXA 3LGJA 1WOCA 3JC66 1VQKA 4MZ9A 4A3JG 2UUCQ 2E5LQ 5LMNW 3J81i 1HZ9A 4A76A 3CPWA 4B3SL 4OWWB 1VQNA 3PO2H 1UEBA 1MJCA 4DR6Q 3KJOA 4LF8Q 4YY3Q 1TWHH 2NVTH 4PZ7A 5FLMG 2YTXA 5GROA 4BY1G 1BBWA 4LW1A 1NY4A 2ZTDA 2ZTCA 4WJ3M 4O0AA 1WYDA 3DM3A 1YZ6A 2HIXA 4A3KH 1OXXK 1E22A 3S1RH 2GVBA 2YTVA 1YJWA 1PH7A 4OONA 4LF4Q 3S14H 1KXLA 3I55A 1OXSC 2E2JH 2JK8A 3CCQA 1CUKA 5IT9c 2K52A 4LFCL 5LMUL 3PF5A 2XTIA 3M85A 4P74A 5IYCG 1WCMG 2DUDA 4DR3Q 3BJUA 1XMQQ 4IO9A 4LF6Q 2NN6I 2ATWA 2VW9A 4A93G 2CFMA 1SROA 1N33Q 2WB1E 2I5HA 3PGZA 1VQFA 3MXNB 2AKWB 3D31A 2WB1G 3KF6B 3ULLA 4P75A 3T1YQ 3S1MH 1GVPA 4FDBA 4A3FH 3AFQA 1KD1C 2B3GA 1K83H 3ULPA 3RZDH 4HIDA 4LNQA 3GTMH 1B8AA 3H0GH 4JYAQ 2UU9L 2PI2E 2HT1A 1D7QA 1JJGA 3S15H 1V9PA 4JI6L 4R1JA 1A8VA 3W1BA 1S72A 4HIMA 4A3EG 1G6PA 4BXXH 1L2FA 4GKJQ 5IP9G 1Q12A 4GLVB 5C44H 1PH6A 5JJKA 4GLAC 4DR2L 2B63G 1IYJB 1VQLA 4BY7G 1L1OB 1HR0L 4Y52H 3EBEA 4R4QA 1N36Q 3CCRA 4WJ4A 4JI0Q 1VQ7A 2I5MX 2Q2UA 2B29A 1Q8KA 4NXNL 3PUYA 3WWVA 2IHFA 2VL6A 4PZ8A 3CC7A 1XNRL 4B3TQ 4JI4Q 2F4VQ 4YHHL 1XMOQ 1IBKQ 1IBMQ 4JI3Q 2JEBI 1HNZL 1WJJA 4MTNA 3HOXG 2AHOB 4DV1L 2HHHL 4LF5L 1JE5A 2RF4A 5M5XH 1CSPA 2RCNA 4DV6L 3CP0A 3SGIA 4AYBE 3AFPA 4A75A 1K73C 1KIXA 3AYHB 4B3MQ 4OX9L 4TQUS 1PYBA 4AYBG 2R93G 3F2BA 1SR3A 1X56A 5IYDG 2MNAA 1YHQA 1E1OA 1YNXA 2K5NA 2YTYA 3E9HA 1PH5A 3U4ZA 4DV7L 4DV2L 1X54A 4JI5Q 4A3JH 2NVQH 3S1QH 3I2ZA 4Y7NH 1BKBA 1I5FA 4A3IG 4A3FG 1PH4A 1FJGQ 4DR4Q 1YJ9A 2R7ZG 2RHQB 1Z9FA 5FLMH 1CSQA 2Z6KA 3AEVA 1VQPA 1X55A 4DV3L 4BY1H 1YIJA 1TXYA 3UDFA 4LF7L 2R6GA 3M9BA 3PF4A 1VQAA 3PO3G 3EN2A 1YHBA 1Q81C 4K0KQ 1PHJA 2A8VA 5JJIA 1QUQA 3CMEA 2VUMG 2R7FA 3J7ZC 1VQOA 4IFDG 3NELA 2UUCL 4DV4Q 1EFWA 1CKNB 4HJ8A 1PV4A 1KL9A 5GAEC 1I94Q 1RL2A 2BA0A 3BU2A 4DAMA 4AQYQ 3F8TA 1OTCA 1FL0A 3PV0A 3KFUA 4XTCS 2ES2A 4DR6L 2ZJPA 1GKHA 1NTGA 3CQZH 2AWNA 4BBRG 2UUBQ 2GVAA 4YY3L 4LF8L 5IYCH 3CCMA 3I4NG 1SFOH 1WCMH 1OXUA 3KLWA 1X9NA 2F52A 1MKHA 1EQQA 1QVGA 4JI7Q 3CD6A 3CW2C 3RLOA 3ZJYC 3M4PA 2K4KA 3M4QA 4LFAQ 3CCUA 4A93H 2CKZB 4LF4L 1KHIA 4X64Q 3UDIA 4PMWA 4IPDA 3TRZA 2PQAB 3G48A 4C3IH 2KHJA 2JA7G 3GTLH 1EQRA 4DR1Q 5FLXc 1NMFA 3KF6A 3STBC 1VQ5A 5C0XG 1XMQL 2Y0SE 1NE3A 3FHWA 3KDFA 4A3EH 4A3LG 3A5UA 2VS1A 1BVSA 5IP9H 4LF6L 1HNWQ 2Y0SG 2JA9A 1V43A 1WI5A 2C35B 3F2DA 1N33L 1UE7A 2B63H 2I5LX 4BY7H 1HZAA 4X66Q 1UE5A 2VQEQ 3GD7A 2EIFA 3W5OA 5IY0A 1X65A 3T1YL 1K8AC 2K50A 3K80C 3RN2A 3TEHB 1EOVA 4DKAC 1XNQQ 2AMCB 4IOCA 5HGQA 1HR0W 4DPGA 1PYSB 4JYAL 4GNXC 1W3SA 2UXCQ 4JI2Q 5JJLA 2UXBQ 3ICEA 3HOXH 1JT8A 5EAYA 5ELNA 4C3HH 1HJPA 3GTPH 2K14A 3S1NH 4GKJL 2N3SA 5C3EH 3S2DH 4YWKA 4GKKQ 3ER0A 1L1OC 5IP7G 4RG1A 1JMCA 3RZOH 2JA5G 1N36L 2R93H 5M3FG 5JEAJ 4JI0L 1PVOA 2OTJA 3HOZG 3T1HQ 5IYDH 4QL5A 4UY8C 1IZ6A 4DK6C 4UP8A 4L5TA 4B3TL 1AE2A 4KLKA 3HKZE 3GTOH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMO L;  1WFQ A;  4GOP B;  4JI3 L;  1IBK L;  3BZC A;  4OO1 G;  4JOI C;  3HKZ G;  1XTD A;  5H1S E;  5BR8 Q;  4A3I H;  3PIP A;  1N34 L;  4O2D A;  5JEA G;  4X62 Q;  4QJF A;  1XPO A;  4DR7 Q;  2R7Z H;  2Q2H A;  2OTL A;  4X65 Q;  4POG A;  4GNX B;  1X3G A;  1I50 H;  1SMX A;  5M5Y H;  3FKI G;  2I0Q A;  4LFB Q;  5IYB G;  5C4J H;  1IBL Q;  3PO3 H;  2AWO A;  4C2M H;  4NB3 A;  1TWG H;  1QVF A;  2VUM H;  1P16 A;  4BA2 I;  1Q82 C;  4NXM Q;  4JI5 L;  2N8N A;  1MIU A;  1Q1E A;  4JI4 L;  1FJG L;  4DR4 L;  1VQB A;  1VQG A;  4UPA A;  4BBR H;  3I4N H;  4YCW A;  1HZC A;  1E1T A;  1HNX Q;  1CKN A;  1QZH A;  3TS2 A;  1YI2 A;  5M5W H;  1PH8 A;  1YEZ A;  3TQY A;  3J7A 5;  5C3E G;  5GAG C;  2F4V L;  4K0K L;  2JQO A;  1A62 A;  3F1Z A;  3PSI A;  3I7F A;  1OXT A;  3S24 A;  4IOA A;  4IPG A;  1CKM A;  3FP9 A;  4JBM A;  1SN8 A;  3PO2 G;  3KF8 B;  4DV4 L;  4A3C G;  2BH2 A;  1I94 L;  1P8L A;  4EQ5 A;  3HOV G;  4JI1 L;  2QEX A;  4AQY L;  4JBJ A;  3D0F A;  2L15 A;  5J3B A;  4P73 A;  1JJ2 A;  3J80 c;  2UUB L;  4JBK A;  4GS3 A;  2JA7 H;  2DGY A;  4JI8 Q;  1V1Q A;  2PQA A;  5IWA Q;  3UDG A;  2R92 G;  1K0R A;  2OQ0 A;  1YIT A;  4JI7 L;  4A3L H;  4DV0 Q;  2JEA I;  2GN5 A;  3CXC A;  4LFA L;  2NZH A;  1XPU A;  1GM5 A;  4IFD J;  5LMN Q;  1SE8 A;  5M3M G;  4X64 L;  3J80 i;  2UUA Q;  1VQ9 A;  2UU9 Q;  2WP8 J;  4A3D G;  2KBN A;  4LWC A;  1TWA H;  2LXJ A;  4POF A;  4DAY B;  1B7Y B;  4DV5 Q;  2LSS A;  3E9I A;  2QA4 A;  1I6H H;  2MFI A;  3E0E A;  2BA1 A;  4R4I A;  3RR5 A;  1H95 A;  1VQC A;  4DR1 L;  4APV A;  1PH1 A;  2IT1 A;  4RMF A;  4L5R C;  5ELO A;  1C9O A;  1QVC A;  2KCM A;  3AQQ A;  3VDY A;  4X6A H;  1HH2 P;  3U4V A;  2ZM6 Q;  2EXD A;  2R7D A;  2BH8 A;  1L0W A;  1HNW L;  1LUZ A;  3I4O A;  3RN5 A;  2ASB A;  2D62 A;  4QGU A;  4GN4 B;  3U50 C;  3I56 A;  1KQS A;  5IP7 H;  3M3Y H;  2Z0S A;  3MEF A;  1J5E Q;  2JA5 H;  3OW2 A;  1B70 B;  1VQE A;  5M3F H;  2PMZ E;  3CC4 A;  4YWL A;  3HOZ H;  5DLQ E;  1XNQ L;  3S16 H;  2NVY H;  3BZK A;  1KRS A;  2XGT A;  5C0X J;  2UXC L;  1J6Q A;  2OCE A;  4JI2 L;  1ASY A;  2UXB L;  1K8G A;  1QZG A;  1EWI A;  4UP9 A;  4B3R Q;  5IE8 A;  4PG3 A;  1VQ8 A;  4A3M G;  4JBW A;  3F2C A;  3EIV A;  1XJV A;  2JA8 G;  4GKK L;  2YYZ A;  1G29 1;  4GOP A;  2K75 A;  1S40 A;  4HIK A;  1FGU A;  2PNH A;  4DR3 L;  1A0I A;  1X6O A;  3CCV A;  4IPH A;  3FKI H;  1TWF H;  1LYL A;  2D0P A;  3K7U C;  3TRE A;  5IYB H;  1VQ4 A;  1VQ6 A;  3A0J A;  3T1H L;  1Y1V G;  5HY6 A;  3NBH B;  4A3G G;  4GOP C;  4GNX A;  3CCJ A;  1UWV A;  2UXD Q;  4L5Q A;  2E2H H;  3HOW G;  3G6E A;  2ID0 A;  1E3P A;  5BR8 L;  2JE6 I;  4TVA B;  2YU9 H;  4GLX A;  2NVX H;  4PZ6 A;  4X62 L;  4OO1 I;  4DR5 Q;  4DR7 L;  1L1O A;  1X3F A;  1AE3 A;  1Z47 A;  3OTO Q;  1N32 Q;  5K36 G;  4X65 L;  3K0X A;  1SLJ A;  1LTL A;  3GDE A;  4LFB L;  3KJP A;  2FXQ A;  1IBL L;  4ME3 A;  2ALY B;  3M4O H;  3RLN A;  2N78 A;  2E2I H;  3HFZ B;  1OXV A;  2VQF Q;  5AJ3 Q;  3CCE A;  4YWM A;  2A1A A;  3HOU G;  4NXM L;  2KEN A;  4A3B G;  4IJH A;  4LUO A;  4DUZ Q;  3RLF A;  2N49 A;  1Q7Y C;  3HOY G;  1QUQ B;  4JOI A;  2ZJR A;  4HJA A;  3CCL A;  3HOV H;  4A3C H;  1AH9 A;  5GAD C;  3I4M G;  1HZB A;  1KRT A;  4HJ9 A;  1R9T H;  2MO0 A;  3CAM A;  1UE1 A;  3H3V H;  3GTQ H;  4KI0 A;  1HNX L;  1IBM L;  3K7A H;  4IPC A;  3L7Z C;  4KHP Q;  2NZO A;  2JA6 G;  2R92 H;  2RHS B;  4LF9 Q;  4DUY Q;  1FVI A;  4QIW E;  1PH3 A;  1EUJ A;  4GN5 A;  3UE0 A;  1Y1W G;  4R4O A;  1PA6 A;  3NEN A;  5M3M H;  4ALP A;  4JV5 Q;  2H5X A;  2V1C C;  4OWT B;  5C4X G;  4KHZ A;  4LUZ A;  4A3D H;  3CMA A;  5FJ8 G;  3GTK H;  3J81 j;  2CCZ A;  1M1K C;  1IL2 A;  1EYG A;  4B3S Q;  2IHE A;  3A74 A;  4HIO A;  4BBS G;  2OQK A;  1RIP A;  4C3J H;  4JI8 L;  1U0L A;  3A5Z B;  4P72 A;  1VQM A;  2LXK A;  4R4T A;  5IWA L;  2A19 A;  2D0O A;  1VQD A;  1NJI C;  3H3V I;  1LM0 A;  2MQH A;  3NEM A;  3TS0 A;  3CC2 A;  2K5V A;  3ULJ A;  4DV0 L;  1Y14 B;  1Q46 A;  3KDF B;  2HIV A;  3IRB A;  3CF5 A;  2PI2 A;  5LMN L;  1I3Q H;  1SRU A;  2YV5 A;  2UUA L;  4GN3 B;  5E7N A;  1M90 C;  1C0A A;  3GTJ H;  3K81 C;  3M7N A;  4HJ5 A;  3L0O A;  4JCV E;  4DV5 L;  3HKS A;  2E8G A;  1W2B A;  3H15 A;  2MO1 A;  1KAW A;  1YJN A;  1Q86 C;  5LMU Q;  4LFC Q;  4H02 A;  3RNU A;  1D8L A;  4NPS A;  2IY5 B;  4B3M L;  5GQO A;  2NN6 G;  1T9H A;  4YCU A;  2QGQ A;  2ZM6 L;  4A3M H;  2OWO A;  4IFD I;  3ERS X;  2JA8 H;  2HQL A;  1YBY A;  3PUX A;  2E5L L;  4QY7 A;  1NBW A;  3STB D;  3KOJ A;  4P71 A;  4A3K G;  2F3I A;  4XIG S;  1J5E L;  1VQJ A;  1U5K A;  1S3O A;  2CWP A;  1N34 Q;  1JB7 A;  1Y1V H;  4DK3 C;  1PH2 A;  1X3E A;  4A3G H;  1IXR A;  2CQO A;  4MNO A;  3HOW H;  2IX0 A;  5GAH C;  4B3R L;  4JI6 Q;  3G4S A;  1BBU A;  1ASZ A;  1NMG A;  4LUV A;  3S2H H;  4YCV A;  2WFW A;  4DR2 Q;  1MJE A;  1G51 A;  4UP7 A;  1HR0 Q;  1Q1B A;  3CPF A;  3K8A A;  4QQB X;  3PIO A;  2VNU D;  5C0X I;  1PH9 A;  2JJQ A;  4NXN Q;  1YHA A;  3H0G G;  4BXX G;  1XNR Q;  4HJ7 A;  2ZTE A;  3KYH C;  4X66 L;  2VQE L;  3HOU H;  3HOY H;  4A3B H;  4YHH Q;  2UXD L;  1VS0 A;  1XPR A;  4A4I A;  1HNZ Q;  1E24 A;  3GO5 A;  1VQI A;  4OXP A;  4R4C A;  1TWC H;  3I4M H;  3S17 H;  3B6Y A;  2HHH Q;  4DV1 Q;  2Q2I A;  1VQH A;  2K5H A;  4J15 A;  1UE6 A;  4BA1 I;  5C44 G;  4DV6 Q;  3OTO L;  4DR5 L;  1C7Y A;  4LF5 Q;  2VY3 A;  3GTG H;  1GO3 E;  1N32 L;  4OX9 Q;  2EQS A;  1EIF A;  4JC0 A;  3DLL A;  1VCI A;  4IJL A;  2Z6K C;  1EIY B;  3CCS A;  2JA6 H;  3JAM c;  4JI1 Q;  2IX1 A;  4JG2 A;  2VQF L;  1KC8 C;  1Y1W H;  5AJ3 L;  4OWX B;  1K3R A;  4DV7 Q;  4DV2 Q;  4DUZ L;  1CKO A;  1K9M C;  5C4X H;  1JJC B;  2Q2T A;  2KHI A;  3UE1 A;  1DGS A;  2KCT A;  5FJ8 H;  3PUV A;  1GD7 A;  3JAM i;  3L2P A;  1N9W A;  4DNI A;  3PUZ A;  1YVC A;  4BBS H;  3OYY A;  4AH6 A;  4KHP L;  1N8R C;  3PUW A;  2ZJQ A;  4AIM A;  3J81 c;  4LF9 L;  4DV3 Q;  3PCO B;  4DUY L;  2WAQ E;  4LF7 Q;  3W1G A;  4EX5 A;  2CWA A;  3Q8D A;  2VZA A;  4L5S A;  1PFS A;  1O7I A;  1E7Z A;  2WAQ G;  3G71 A;  3U58 A;  1A63 A;  4JV5 L;  3UDX A;  3LGJ A;  1WOC A;  3JC6 6;  1VQK A;  4MZ9 A;  4A3J G;  2UUC Q;  2E5L Q;  5LMN W;  3J81 i;  1HZ9 A;  4A76 A;  3CPW A;  4B3S L;  4OWW B;  1VQN A;  3PO2 H;  1UEB A;  1MJC A;  4DR6 Q;  3KJO A;  4LF8 Q;  4YY3 Q;  1TWH H;  2NVT H;  4PZ7 A;  5FLM G;  2YTX A;  5GRO A;  4BY1 G;  1BBW A;  4LW1 A;  1NY4 A;  2ZTD A;  2ZTC A;  4WJ3 M;  4O0A A;  1WYD A;  3DM3 A;  1YZ6 A;  2HIX A;  4A3K H;  1OXX K;  1E22 A;  3S1R H;  2GVB A;  2YTV A;  1YJW A;  1PH7 A;  4OON A;  4LF4 Q;  3S14 H;  1KXL A;  3I55 A;  1OXS C;  2E2J H;  2JK8 A;  3CCQ A;  1CUK A;  5IT9 c;  2K52 A;  4LFC L;  5LMU L;  3PF5 A;  2XTI A;  3M85 A;  4P74 A;  5IYC G;  1WCM G;  2DUD A;  4DR3 Q;  3BJU A;  1XMQ Q;  4IO9 A;  4LF6 Q;  2NN6 I;  2ATW A;  2VW9 A;  4A93 G;  2CFM A;  1SRO A;  1N33 Q;  2WB1 E;  2I5H A;  3PGZ A;  1VQF A;  3MXN B;  2AKW B;  3D31 A;  2WB1 G;  3KF6 B;  3ULL A;  4P75 A;  3T1Y Q;  3S1M H;  1GVP A;  4FDB A;  4A3F H;  3AFQ A;  1KD1 C;  2B3G A;  1K83 H;  3ULP A;  3RZD H;  4HID A;  4LNQ A;  3GTM H;  1B8A A;  3H0G H;  4JYA Q;  2UU9 L;  2PI2 E;  2HT1 A;  1D7Q A;  1JJG A;  3S15 H;  1V9P A;  4JI6 L;  4R1J A;  1A8V A;  3W1B A;  1S72 A;  4HIM A;  4A3E G;  1G6P A;  4BXX H;  1L2F A;  4GKJ Q;  5IP9 G;  1Q12 A;  4GLV B;  5C44 H;  1PH6 A;  5JJK A;  4GLA C;  4DR2 L;  2B63 G;  1IYJ B;  1VQL A;  4BY7 G;  1L1O B;  1HR0 L;  4Y52 H;  3EBE A;  4R4Q A;  1N36 Q;  3CCR A;  4WJ4 A;  4JI0 Q;  1VQ7 A;  2I5M X;  2Q2U A;  2B29 A;  1Q8K A;  4NXN L;  3PUY A;  3WWV A;  2IHF A;  2VL6 A;  4PZ8 A;  3CC7 A;  1XNR L;  4B3T Q;  4JI4 Q;  2F4V Q;  4YHH L;  1XMO Q;  1IBK Q;  1IBM Q;  4JI3 Q;  2JEB I;  1HNZ L;  1WJJ A;  4MTN A;  3HOX G;  2AHO B;  4DV1 L;  2HHH L;  4LF5 L;  1JE5 A;  2RF4 A;  5M5X H;  1CSP A;  2RCN A;  4DV6 L;  3CP0 A;  3SGI A;  4AYB E;  3AFP A;  4A75 A;  1K73 C;  1KIX A;  3AYH B;  4B3M Q;  4OX9 L;  4TQU S;  1PYB A;  4AYB G;  2R93 G;  3F2B A;  1SR3 A;  1X56 A;  5IYD G;  2MNA A;  1YHQ A;  1E1O A;  1YNX A;  2K5N A;  2YTY A;  3E9H A;  1PH5 A;  3U4Z A;  4DV7 L;  4DV2 L;  1X54 A;  4JI5 Q;  4A3J H;  2NVQ H;  3S1Q H;  3I2Z A;  4Y7N H;  1BKB A;  1I5F A;  4A3I G;  4A3F G;  1PH4 A;  1FJG Q;  4DR4 Q;  1YJ9 A;  2R7Z G;  2RHQ B;  1Z9F A;  5FLM H;  1CSQ A;  2Z6K A;  3AEV A;  1VQP A;  1X55 A;  4DV3 L;  4BY1 H;  1YIJ A;  1TXY A;  3UDF A;  4LF7 L;  2R6G A;  3M9B A;  3PF4 A;  1VQA A;  3PO3 G;  3EN2 A;  1YHB A;  1Q81 C;  4K0K Q;  1PHJ A;  2A8V A;  5JJI A;  1QUQ A;  3CME A;  2VUM G;  2R7F A;  3J7Z C;  1VQO A;  4IFD G;  3NEL A;  2UUC L;  4DV4 Q;  1EFW A;  1CKN B;  4HJ8 A;  1PV4 A;  1KL9 A;  5GAE C;  1I94 Q;  1RL2 A;  2BA0 A;  3BU2 A;  4DAM A;  4AQY Q;  3F8T A;  1OTC A;  1FL0 A;  3PV0 A;  3KFU A;  4XTC S;  2ES2 A;  4DR6 L;  2ZJP A;  1GKH A;  1NTG A;  3CQZ H;  2AWN A;  4BBR G;  2UUB Q;  2GVA A;  4YY3 L;  4LF8 L;  5IYC H;  3CCM A;  3I4N G;  1SFO H;  1WCM H;  1OXU A;  3KLW A;  1X9N A;  2F52 A;  1MKH A;  1EQQ A;  1QVG A;  4JI7 Q;  3CD6 A;  3CW2 C;  3RLO A;  3ZJY C;  3M4P A;  2K4K A;  3M4Q A;  4LFA Q;  3CCU A;  4A93 H;  2CKZ B;  4LF4 L;  1KHI A;  4X64 Q;  3UDI A;  4PMW A;  4IPD A;  3TRZ A;  2PQA B;  3G48 A;  4C3I H;  2KHJ A;  2JA7 G;  3GTL H;  1EQR A;  4DR1 Q;  5FLX c;  1NMF A;  3KF6 A;  3STB C;  1VQ5 A;  5C0X G;  1XMQ L;  2Y0S E;  1NE3 A;  3FHW A;  3KDF A;  4A3E H;  4A3L G;  3A5U A;  2VS1 A;  1BVS A;  5IP9 H;  4LF6 L;  1HNW Q;  2Y0S G;  2JA9 A;  1V43 A;  1WI5 A;  2C35 B;  3F2D A;  1N33 L;  1UE7 A;  2B63 H;  2I5L X;  4BY7 H;  1HZA A;  4X66 Q;  1UE5 A;  2VQE Q;  3GD7 A;  2EIF A;  3W5O A;  5IY0 A;  1X65 A;  3T1Y L;  1K8A C;  2K50 A;  3K80 C;  3RN2 A;  3TEH B;  1EOV A;  4DKA C;  1XNQ Q;  2AMC B;  4IOC A;  5HGQ A;  1HR0 W;  4DPG A;  1PYS B;  4JYA L;  4GNX C;  1W3S A;  2UXC Q;  4JI2 Q;  5JJL A;  2UXB Q;  3ICE A;  3HOX H;  1JT8 A;  5EAY A;  5ELN A;  4C3H H;  1HJP A;  3GTP H;  2K14 A;  3S1N H;  4GKJ L;  2N3S A;  5C3E H;  3S2D H;  4YWK A;  4GKK Q;  3ER0 A;  1L1O C;  5IP7 G;  4RG1 A;  1JMC A;  3RZO H;  2JA5 G;  1N36 L;  2R93 H;  5M3F G;  5JEA J;  4JI0 L;  1PVO A;  2OTJ A;  3HOZ G;  3T1H Q;  5IYD H;  4QL5 A;  4UY8 C;  1IZ6 A;  4DK6 C;  4UP8 A;  4L5T A;  4B3T L;  1AE2 A;  4KLK A;  3HKZ E;  3GTO H; 
#chains in the Genus database with same CATH topology
 1IBK L;  4IUN A;  5EPK A;  3VPB A;  3BZC A;  4OO1 G;  4J9O A;  5F9N A;  4QIW A;  1XTD A;  1IKL A;  4A3I H;  1HQR D;  4O2D A;  5JEA G;  1E4F T;  1JOK A;  1XPO A;  1G91 A;  3GID A;  4YP3 A;  3V96 A;  4QF4 A;  4NMZ A;  2EYF A;  2KVM A;  1TAE A;  1TS4 A;  2IW3 A;  5KT4 A;  2AWO A;  3ONA B;  4ABN A;  1ILP A;  2NVQ B;  3ERO A;  4BA2 I;  2PNR C;  1SAP A;  2KCN A;  1JB3 A;  2W6Q A;  4RUC A;  1FJG L;  4O4I F;  4LF6 H;  1RK5 A;  3TZD A;  2LKV A;  1VQB A;  4ID6 A;  4UPA A;  4BY1 B;  1D5M C;  4RAU C;  4RKB A;  4U67 3;  1TII D;  3TS2 A;  1SNQ A;  5M5W H;  1YEZ A;  2VUG A;  3A7L A;  4K0K L;  3PMF A;  1A62 A;  3S24 A;  4IOA A;  1MSH A;  4Q45 A;  4HR7 B;  4DV4 L;  2BH2 A;  1P8L A;  4PQX A;  4JI1 L;  4AQY L;  3CQZ B;  4J9M A;  2L15 A;  3PW5 A;  1WCM B;  1EY8 A;  1GUN A;  3H4B A;  1HRJ A;  3IAY A;  2PZW A;  2DGY A;  4JI8 Q;  2FB9 A;  5KG0 A;  3J7A F;  1E4G T;  4QWC A;  2F0V A;  5IWA Q;  1GJX A;  2OQ0 A;  1V8Q A;  1IL8 A;  4JI7 L;  4DV0 Q;  4LFA L;  4IFD J;  1S5D D;  4XQJ A;  4B3T H;  2W8L A;  5M3M G;  1EYA A;  1EWC A;  4C3I B;  4A3D G;  1TWA H;  3GV3 A;  4QWE A;  2G9H D;  4TV8 F;  4DAY B;  1KJ9 A;  1N34 H;  3GTL B;  2K33 A;  2BA1 A;  3RR5 A;  1H95 A;  2N55 A;  4DR1 L;  4ECQ A;  5CV6 A;  1PH1 A;  2IT1 A;  4RMF A;  2P0A A;  3QIA A;  1QVC A;  2KCM A;  3C2P A;  3V6H A;  3U4V A;  5JPN C;  5KT3 A;  2EXD A;  5J2T F;  1HTL D;  3OHB A;  4K5V A;  1MHW C;  2W9A A;  4FO2 A;  1ILQ A;  5EGT A;  5H80 A;  4DL6 A;  5KNB A;  3I56 A;  4JI5 H;  1AW7 A;  4FF4 A;  3MEF A;  1B70 B;  5I6Y A;  5M3F H;  4FF1 A;  3L4K A;  5TSS A;  3C0F B;  3KK7 A;  4DR4 H;  4YWL A;  5DLQ E;  3S16 H;  4UCT A;  3RBD A;  4CDD C;  2RVL A;  2WII B;  1EWI A;  5KYL A;  4ECR A;  4RNN A;  2L5T A;  3K5M A;  1VQ8 A;  4Q0Y A;  1PFB A;  5DM7 3;  2YYZ A;  3RZO B;  1G29 1;  2MCT A;  3S1N B;  4PWQ A;  2K03 A;  2K75 A;  5JH7 F;  4HIK A;  1FGU A;  1RTO A;  4CJ2 C;  3SXH A;  5KG4 A;  3TRE A;  2D0P A;  5FO8 B;  1Y1V G;  3GTO B;  3RUZ A;  3NBH B;  1Z2N X;  3KHL A;  4J9R A;  4A3G G;  4GOP C;  1CA5 A;  1EWH A;  2Z4H A;  4GNX A;  4L5Q A;  4DNR B;  2E2H H;  4MHE A;  2QK4 A;  2YS7 A;  1KNA A;  2W9B A;  2PZT A;  1KDC A;  4GLX A;  4X62 L;  4DL7 A;  3D4W A;  3R2T A;  3EYY A;  1N32 Q;  1AE3 A;  3OTO Q;  3HZX A;  5M5Y B;  3IG0 A;  1RF2 D;  3MZ5 A;  1SLJ A;  4RAZ A;  5L1L A;  1SMY D;  2YZM A;  3RAQ A;  5KG5 A;  2FXQ A;  4C2M B;  1B53 A;  3M4O H;  2ALY B;  2VUM B;  3RLN A;  4MA0 A;  4O42 A;  2K05 A;  3QWN A;  3CCE A;  4NXM L;  2KEN A;  3PO2 H;  2ZJR A;  4F4Z A;  5DNF A;  1ML0 D;  4BBR B;  5GAD C;  1HNW H;  5JQW A;  3ND9 A;  4HJ9 A;  1B6R A;  1KNE A;  1V1P B;  3I3C A;  3SR1 A;  5EWG A;  4KHP Q;  2IP4 A;  2R92 H;  2XGQ A;  4DUY Q;  4QMG A;  1EUJ A;  2CQA A;  3UE0 A;  4R4O A;  4ZLT F;  2KED A;  3NEN A;  4JI2 H;  5AFW A;  1V1O A;  4KHZ A;  4Q44 A;  1EIG A;  3D4D A;  2CCZ A;  1E2Z A;  1N48 A;  4GKK H;  1EYG A;  4B3S Q;  1CT1 D;  4XXE A;  1RIP A;  2RCF A;  4DR3 H;  3A5Z B;  4P72 A;  3MFI A;  4R4T A;  1WD0 A;  2A19 A;  2D0O A;  1VQD A;  2RDG A;  5FLX E;  3NEM A;  2Y0S B;  1SNP A;  3TS0 A;  1PTO D;  4QWA A;  1BCP F;  2HQE A;  2EJM A;  3EJI A;  3N52 A;  2HIV A;  5LMN L;  3QOL A;  5E7N A;  4F7X A;  3Q2O A;  2ALZ A;  1LT5 D;  1PRT C;  3A56 A;  4EFB A;  2JEF A;  2NB0 A;  2YZN A;  4HJ5 A;  1C8C A;  4JCV E;  2B63 A;  4DV5 L;  2QW7 A;  3N8D A;  2MO1 A;  5LMU Q;  2F03 A;  3R5X A;  5IIF A;  5KG6 A;  1BOS A;  2DLN A;  3FVQ A;  5IGF A;  2DJG C;  4OEL B;  1DM0 B;  2BE5 C;  4A3M H;  2W6P A;  5EDW A;  3PR5 B;  2JA5 B;  5IGB A;  5KFO A;  2F3I A;  3K5O A;  3VR4 A;  3NTI A;  1SND A;  5LL6 S;  3E5S A;  1U5K A;  1QIL A;  1S3O A;  1E2W A;  3NBI A;  2EDG A;  1LT4 D;  2KA7 A;  4UHV A;  1STA A;  4MNO A;  1W6J A;  3HOW H;  5GAH C;  1HA5 A;  1D5X C;  1I7L A;  2K6A A;  4ZCK A;  2A74 C;  1DD2 A;  3S2H H;  2FMA A;  1TWF B;  1I6V C;  1CQJ B;  1G51 A;  2EXZ A;  1VAJ A;  3TQ1 A;  3H0G A;  3CPF A;  3K8A A;  5KGU A;  2R7Z A;  4QQB X;  5C0X I;  2D2C C;  3EA6 A;  1I50 A;  5FOB B;  1ULZ A;  4JI8 H;  1XNR Q;  5COY A;  4HJ7 A;  3KYH C;  4A3B H;  1JOR A;  2VQE L;  5IWA H;  3HOY H;  2YU9 B;  3M9O B;  2YYA A;  1U4R A;  1XPR A;  1TWG A;  3GO5 A;  4DV0 H;  3S17 H;  4MV7 A;  2EYJ A;  1Q81 C;  4J15 A;  4L5S A;  4LF5 Q;  1EL0 A;  4O2A F;  5C44 G;  1KLG D;  4DV6 Q;  1C7Y A;  3Q8P B;  2EQS A;  3DLL A;  4IJL A;  1TS3 A;  2E2I B;  1EIY B;  3CCS A;  3V6K A;  4J8Q A;  1EQT A;  2DIK A;  1NUC A;  3JAM c;  1CM9 A;  2VQF L;  2FLL A;  3Q8S B;  1TKW B;  2MUY A;  1QNU A;  2FJZ A;  4DN4 M;  4DV2 Q;  1CKO A;  2OXP A;  5ELF A;  3T5L A;  2KHI A;  4CKC A;  1R9T B;  5C5M A;  2KCT A;  1NNX A;  1SYC A;  3GTQ B;  3JAM i;  2RDH A;  3K7A B;  1AUX A;  5KFB A;  3BQ0 A;  3RF2 A;  2HCC A;  3DXJ C;  5EZY F;  3UQ8 A;  1A2T A;  1N8R C;  1WTW A;  1HXY D;  3J81 c;  1BBX C;  4LF9 L;  3PCO B;  2JA7 A;  1C3O A;  4K5X A;  2PYK A;  4NDX A;  3Q8D A;  2NU7 B;  1SSO A;  3LML A;  1IHZ A;  1O7I A;  1E7Z A;  4YAK B;  5T1G A;  4JV5 L;  1JIC A;  3UDX A;  5C1P A;  5KG2 A;  1VQK A;  1BQQ T;  1FGB D;  1F77 A;  4K8I A;  2E5L Q;  3M7G A;  5LMN W;  3J81 i;  4K5W A;  4JUZ A;  4IZO A;  1U4M A;  2KCC A;  2CW8 A;  1PTO B;  3SVM A;  2XRQ D;  4BY1 G;  2OT2 A;  1BBW A;  1A3V A;  5KFD A;  5DG7 A;  4DK0 A;  5JPM C;  2ZTC A;  4IUV A;  3U9S A;  2XWB B;  1WTH A;  3N41 B;  1YZ6 A;  1BNZ A;  2HIX A;  1JE4 A;  5I2Y A;  1YJW A;  4LF4 Q;  2GVB A;  2YTV A;  4C56 C;  1PH7 A;  4OON A;  3S14 H;  2YL2 A;  3NQT A;  1PDQ A;  3F8N A;  4HMJ A;  5KEE A;  5KFW A;  3CCQ A;  1A6X A;  2VQD A;  3PIP 3;  1ZHQ A;  1N32 H;  5IT9 c;  3OTO H;  2F0I A;  2B2U C;  1SYB A;  2AQ2 B;  1WCM G;  1W96 A;  1F9R A;  5KKN B;  1G2S A;  2F0T A;  3VYR A;  1EZ8 A;  1UNS A;  5C8Y F;  2ASJ A;  4GC6 A;  1EZ1 A;  1Q90 A;  1J8I A;  5C5L A;  2NN6 I;  2LFN A;  2ATW A;  1UC9 A;  1ET9 A;  3FPU B;  2WB1 E;  2I5H A;  3PGZ A;  1WTX A;  1XYI A;  3Q1K A;  1RJR A;  3K5N A;  1RDP D;  2WB1 G;  1X3Q A;  1GVP A;  5L1K A;  3AFQ A;  4C3I G;  3DWP A;  1LTB D;  2B3G A;  4YR3 A;  4DL5 A;  4IRC A;  4QUC A;  3OSP A;  4KHP H;  1ZEQ X;  2UU9 L;  1AN8 A;  2PI2 E;  2D9U A;  2HT1 A;  3S15 H;  1JJG A;  3MAQ A;  1STN A;  4JI6 L;  1VKZ A;  4DUY H;  5EKK A;  5LL6 b;  2VA3 A;  3QFF A;  4KY5 A;  1Z2P X;  1G6P A;  3WOE A;  2NUC A;  3H6M A;  4QCL A;  5IP9 G;  2J9G A;  3K3V A;  1Q12 A;  4GLV B;  1A9X A;  4O3S A;  4DR2 L;  1VQL A;  1KAB A;  4Y52 H;  2EY2 A;  2OLS A;  5CV9 A;  4R4Q A;  5KFS A;  2IBK A;  2K28 A;  4OHJ A;  2I5M X;  4B3S H;  3HOU B;  1JIH A;  1Q8K A;  3M9N B;  3GTP A;  4PZ8 A;  3RGZ A;  4JI4 Q;  4YHH L;  1XMO Q;  3G8C A;  1DOL A;  1WJJ A;  4MTN A;  2WTF A;  3GTG B;  5D3D A;  1WTP A;  3MWM A;  2AHO B;  2HHH L;  4XX0 B;  2RF4 A;  1JMC A;  2RCN A;  3CP0 A;  4AYB E;  4OX9 L;  2JA6 B;  3EVQ A;  4J9K A;  2ZXP A;  1SYE A;  3WDN A;  4AYB G;  1Y1W B;  4IR9 A;  1SR3 A;  1X56 A;  3LNN A;  5IYD G;  4EVO A;  4RKL A;  2K5N A;  5G3L D;  2MNA A;  5LMU H;  3E9H A;  4APM A;  1ROD A;  1CZG A;  4MN3 A;  3FDT A;  4OGQ C;  1STH A;  1KJ8 A;  3S1Q H;  2RA4 A;  3I2Z A;  3KLS A;  3GQB A;  1ZQ7 A;  4TQS A;  2PO4 A;  5D1O B;  2QDB A;  1YJ9 A;  5BN3 A;  1EY9 A;  3K5L A;  4E4T A;  2Z6K A;  1X55 A;  4LF7 L;  1YIJ A;  1TXY A;  1EU3 A;  3PF4 A;  2HD3 A;  4CBV A;  1S9F A;  2X6G A;  3KHG A;  1PHJ A;  2A8V A;  2VUM G;  4L1K A;  1VQO A;  4F4X A;  1F2L A;  4HED A;  1PV4 A;  1I94 Q;  1EFW A;  4B3M Q;  2K5Q A;  2I0Q A;  1I3Q A;  3NWT A;  4DAM A;  4QWB A;  1SEI A;  3GTJ A;  3PV0 A;  4ILW A;  4XTC S;  2NVT B;  2NU9 B;  3CKI B;  1GKH A;  4BBR G;  2AWN A;  4WOR A;  1SNM A;  4O1N A;  4FF2 A;  1HFN A;  5HUR A;  2F52 A;  1W6K A;  1EY6 A;  4FNF A;  3M4P A;  4A93 H;  4MV8 A;  4XYL B;  1XNR H;  3MWE A;  4X64 Q;  1ESF A;  5K2M A;  4RZQ A;  3S2D B;  2PQA B;  4LF5 H;  4DV6 H;  1PRT D;  1S5F D;  2FMM A;  4HNV A;  1Y1V A;  4IUU A;  3V2T A;  3STB C;  2VA2 A;  5C0X G;  2Y0S E;  1NE3 A;  3FHW A;  2Z1C A;  5E4W C;  4A3E H;  4KKT A;  3A5U A;  5DGA A;  4LF6 L;  1A3U A;  2JA9 A;  2Y0S G;  4EQP A;  1WI5 A;  2C35 B;  4EBC A;  4RB1 A;  4DV2 H;  4LJZ C;  5CBE E;  2BE5 D;  2B63 H;  4O4L F;  1HZA A;  5C5J A;  2EIF A;  3W5O A;  1K83 B;  1X65 A;  3RZD B;  3GTM B;  1XNQ Q;  1WH2 A;  1FNV A;  1EYC A;  2ZT9 C;  4GNX C;  2UXC Q;  2W9C A;  5D3I B;  3NTH A;  4PMB A;  3HOX H;  3G6X A;  5EAY A;  4HYK A;  5FD6 A;  1G8Z D;  3OHX C;  4KKS A;  1TWC A;  3C1F A;  4EEQ A;  1H9S B;  5IP7 G;  4DNT B;  2JA5 G;  2E5L H;  4ZAI A;  2NU6 B;  3T1H Q;  4UP8 A;  4B3T L;  2R85 A;  4KLK A;  2C2E A;  4GOP B;  4NKL A;  4MV1 A;  1JWU D;  4YIJ A;  1HQM C;  5M5X B;  4O4H F;  4BS9 A;  5H1S E;  3PIP A;  1N34 L;  3OUU A;  3PR4 A;  4LF4 H;  2R7Z H;  2MGS A;  2OTL A;  4X65 Q;  3L9A X;  3R93 A;  1I50 H;  4LFB Q;  2WAQ B;  2E2H A;  3PO3 H;  3TIN A;  2YRX A;  1WTO A;  5FK9 C;  1JWS D;  1TWG H;  3D6W A;  2R86 A;  1P16 A;  4JI5 L;  3HS0 C;  1Q1E A;  4IFD H;  4OIJ A;  4R8U A;  2B2W A;  2VR1 A;  2R8K A;  4DR4 L;  2PVP A;  3MFH A;  3TSS A;  4I50 F;  4B9X A;  1CKN A;  4K6D A;  1QZH A;  5EOY A;  1YI2 A;  1PH8 A;  4QWD A;  2QKI C;  5DM6 3;  3Q24 A;  2CHB D;  3F1Z A;  3PSI A;  3WNZ A;  3I72 A;  3FP9 A;  1KDB A;  4KD4 A;  3KF8 B;  2F1M A;  1Z7T A;  4I65 A;  4PNY A;  4BWG B;  2QEX A;  2R92 A;  1S5E D;  2RDI A;  3J80 c;  4JBK A;  4RCO A;  2JA7 H;  1PXU A;  1TS2 A;  2F3V A;  3QZ7 A;  1NSN S;  3Q23 A;  3CXC A;  2I80 A;  1SBB B;  1I4G A;  4JI4 H;  1SE8 A;  1XMO H;  3J80 i;  2UUA Q;  2WP8 J;  4UCR A;  2AQ4 A;  2KBN A;  1PRT B;  3K58 A;  3A55 A;  1B7Y B;  2FE3 A;  2LSS A;  3E0E A;  4R4I A;  1A2U A;  2Z9H A;  1VQC A;  1ZHS A;  5C4Z A;  3DM1 A;  2PPB C;  1HH2 P;  2L1B A;  2R7D A;  1L0W A;  2ZM6 Q;  1HNW L;  1LUZ A;  3I4O A;  5KFE A;  1MGS A;  5DLF A;  1M6V A;  4FBU A;  2D62 A;  5KFM A;  3U50 C;  4DU9 A;  4G7O C;  3M3Y H;  5IOC A;  2Z0S A;  1J5E Q;  4CKE A;  2PMZ E;  1G2T A;  3MR3 A;  1TS5 A;  4ETS A;  3BZK A;  1KRS A;  2F0U A;  5C0X J;  1RK6 A;  1KAA A;  4JV1 A;  4C3H B;  2OCE A;  4JI2 L;  4Q8E A;  2PCF B;  1K8G A;  5C3E B;  4MTD A;  3OWF A;  4PG3 A;  5KFJ A;  4JBW A;  5JAV A;  5JEA H;  2JA8 G;  4GKK L;  3MXN A;  1E4E B;  3MXG A;  3PO2 B;  2R93 B;  3M4Y A;  4UCU A;  2RBM A;  1LTS D;  2PNH A;  4DR3 L;  1I94 H;  1X6O A;  3CCV A;  2O03 A;  2EYP A;  1RJQ A;  4A2A A;  4QW9 A;  3R23 A;  4JV0 A;  2UXD Q;  2B2T C;  3G6E A;  1EIH A;  4ME5 A;  1FKA H;  1F9Q A;  4PZ6 A;  4XT3 B;  1ESR A;  1AUV A;  1L1O A;  4X64 H;  4NP5 A;  3TP6 A;  5K36 G;  2XRS D;  3KBG A;  5C4J B;  2EOT A;  2K04 A;  2W6M A;  5KYI A;  4C1N K;  4K8J A;  4J9L A;  2BOS A;  1VBH A;  3GLK A;  1O7Z A;  1F9P A;  5JOB A;  3HOU G;  2RDJ A;  1DV2 A;  4YQW A;  4IJH A;  4DUZ Q;  1Q7Y C;  3AU7 A;  1QUQ B;  4JOI A;  2C5C A;  1AH9 A;  3I4N B;  1WVL A;  4HCE A;  1I6U A;  1HZB A;  4EGV A;  2FPP B;  2MO0 A;  3SE7 A;  3CAM A;  5CV7 A;  3H3V H;  4HR7 A;  1ZET A;  4KI0 A;  4IPC A;  5L1I A;  3L7Z C;  1HA6 A;  1YNN C;  3CQZ A;  3NWS A;  2JA6 G;  2K5D A;  1WCM A;  1FVI A;  1XNQ H;  1Y1W G;  5KFA A;  2UXC H;  1PA6 A;  5M3M H;  1Y8N B;  4ALP A;  2HGS A;  3NXW A;  4LUZ A;  4A3M B;  4A3D H;  2A6E C;  4KY6 A;  1SNO A;  5FJ8 G;  1M1K C;  1ENF A;  3WO0 A;  3PN1 A;  2IHE A;  3A74 A;  4R8I A;  2WB1 A;  3JSL A;  2AUK A;  2OQK A;  4JI8 L;  5IWA L;  5T1I A;  3V6J A;  1DV1 A;  4DAY A;  1LM0 A;  3G6J B;  3CC2 A;  5KFQ A;  2IX3 A;  4DV0 L;  3T1H H;  3GTL A;  3NPP A;  5KG3 A;  4RGO S;  2PI2 A;  2XNA C;  1I3Q H;  1SRU A;  1U4L A;  1PMR A;  3JAM L;  4Y8V B;  1M8A A;  1CE8 A;  1C0A A;  3GTJ H;  3M7N A;  2E75 C;  1I6H B;  3HKS A;  4DF7 A;  2FK2 A;  4DK1 A;  1KAW A;  4XYO A;  4DLK A;  4X65 H;  2TSS A;  1D8L A;  1S5B D;  4YBZ B;  3EFX D;  4LFB H;  5IOD A;  1PZK D;  4DXF A;  2KQ3 A;  1U4P A;  2QGQ A;  3NGD A;  2HQL A;  3PUX A;  4QY7 A;  1NBW A;  1KDA A;  2LY7 A;  3STB D;  3J81 L;  2KJX A;  3HOZ B;  2NVY B;  3HEJ A;  4XT1 B;  3C3L A;  1TY2 A;  2JEI A;  1JB7 A;  1EZ6 A;  1H9M A;  1Y1V H;  4AYB A;  4A3G H;  1IBM H;  1IXR A;  3D6C A;  2FHT A;  5A2Q L;  4Q43 A;  1LTT D;  4FS2 A;  3G4S A;  1BBU A;  3GTO A;  4ED2 A;  1BCP C;  2IWH A;  3HGB A;  4QIW B;  2HJW A;  4ZYS A;  3FKI B;  4YCV A;  4M8A A;  1S97 A;  1HR0 Q;  1STG A;  3H3V C;  4FXK C;  1BUV T;  1PH9 A;  4NXN Q;  1A3T A;  2B39 A;  1CS0 A;  5I47 A;  2ZTE A;  4ED8 A;  4L63 B;  4JV2 A;  4PDB A;  2NVX B;  4C2M A;  4FXD A;  5IT9 L;  2X0S A;  2VUM A;  1VQI A;  5ELE A;  2GLT A;  3ORQ A;  1TWC H;  1B04 A;  4DV1 Q;  5HV6 A;  1N32 L;  2IPK D;  3OTO L;  2UUA H;  3JZI A;  1SEB D;  2VY3 A;  1GO3 E;  5DG9 A;  1EIF A;  5IGC A;  2Z6K C;  3MTS A;  1BGW A;  2V4Q A;  1HFG A;  4JI1 Q;  2IX1 A;  4XQQ A;  1KC8 C;  3TP7 A;  3HOV B;  5HBR B;  5LP6 F;  3EPI A;  2K5W A;  1TVX A;  3UE1 A;  2ZM6 H;  3QJY A;  3DUZ A;  1JOQ A;  1N9W A;  4DNI A;  1YVC A;  1DOK A;  2RKS A;  4KHP L;  1J5E H;  3PW0 A;  1JXL A;  2ZJQ A;  2JSO A;  2R87 A;  4AIM A;  3E0J A;  4N9P A;  5LHY 1;  4DV3 Q;  4DUY L;  2WAQ E;  1CQF A;  2O4X A;  2CWA A;  2VZA A;  5KG1 A;  4EQO A;  1K8M A;  2AQ3 B;  2WAQ G;  4QUF A;  3G71 A;  2UVV A;  2F3W A;  3LGJ A;  1WOC A;  3GTK B;  3JC6 6;  2Y0S A;  4MZ9 A;  2XN9 C;  1DON A;  4RCN A;  4UDU C;  4C3J B;  4B3S L;  4OWW B;  1VQN A;  3JAM W;  2R7M A;  1UEB A;  4DA2 A;  4DR6 Q;  3KJO A;  4LF8 Q;  4H13 C;  2EE1 A;  5FLM G;  2YTX A;  1JDE A;  2EJG C;  3E6Z X;  4J6H A;  3CHB D;  3T5K A;  1JKJ B;  1LAB A;  1WYD A;  2WAC A;  1CI3 M;  2EYM A;  3S1R H;  4X66 H;  1LTI D;  1E22 A;  1OXX K;  1KXL A;  2BQR A;  3BG5 A;  2UXD H;  4I55 F;  1RTN A;  3I55 A;  2D5D A;  2NUA B;  4ECV A;  1KEE A;  3GIL A;  4JW0 A;  1CUK A;  3G7L A;  3NTK A;  2JA5 A;  2EVB A;  2K52 A;  5LMU L;  3SDZ A;  2SNS A;  3HG9 A;  4P74 A;  1E0B A;  2AUJ D;  2F0S A;  2DUD A;  5KFH A;  4J9Q A;  2F0H A;  3BJU A;  1X3P A;  1XMQ Q;  4HNT A;  4IO9 A;  1N33 Q;  1AEX A;  4DUZ H;  2VPQ A;  5FO9 B;  2AKW B;  3TIG A;  4CC5 A;  3KBX A;  5KFF A;  1FNU A;  3S1M H;  1GLV A;  1C48 A;  1Y8P B;  3ULL A;  2K32 A;  4A3F H;  3ULP A;  1TWF A;  4HID A;  1F2Z A;  4LNQ A;  1D7Q A;  2L55 A;  1J9O A;  3VYU A;  3TN2 A;  1MBY A;  1A8V A;  5KG7 A;  2FFK B;  1K8O A;  3T5J A;  3RV4 A;  1VF5 C;  5D65 A;  3PW7 A;  1L2F A;  1EHI A;  5C44 H;  3J7A V;  5JJK A;  2W9B B;  2YU9 A;  4GLA C;  5IT9 W;  4IAJ A;  3TME A;  4WJ4 A;  1N36 Q;  3RIZ A;  1A15 A;  3S9W A;  2CH4 A;  3LWB A;  1VMC A;  4CDC C;  1S68 A;  2VL6 A;  1XNR L;  1UAP A;  2F4V Q;  2E2I A;  3I4M B;  4JI3 Q;  3BA8 A;  4C3H G;  2CQY A;  2B2W C;  2O5I C;  4LF5 L;  4DV6 L;  4A75 A;  3QO2 A;  3Q22 A;  3AYH B;  3KHH A;  1R9T A;  4ZQ3 A;  2R93 G;  3GTQ A;  5J39 A;  4LMQ D;  4YR0 A;  2I46 A;  4XDX A;  4ECS A;  1ICF B;  5C4X B;  1ZXT A;  2O5J C;  1RCV D;  2F0K A;  2F0G A;  3IFT A;  5IGG A;  4ZHQ F;  4DV2 L;  4F4W A;  2YS6 A;  1MI2 A;  3A54 A;  2B2V A;  2NVQ H;  3O13 A;  3D3R A;  1BKB A;  1I5F A;  3U9O A;  2SDF A;  4A3F G;  3SE0 A;  4BBS B;  2L4N A;  1JR0 D;  3RGX A;  2W7P A;  4LK1 C;  2RHQ B;  4LAA A;  1CSQ A;  3N44 B;  4BY1 H;  2VXW A;  2R6G A;  5KT6 A;  2F0D A;  4O3R A;  4ZUI A;  1YNN D;  2G5D A;  1PFM A;  5JJI A;  3QR8 A;  3L4J A;  5CAE B;  2XGP A;  4HJ8 A;  2E5L L;  2BA0 A;  5F2D A;  1WD1 A;  1OTC A;  3BQ2 A;  3F8T A;  2C2D A;  1FL0 A;  1TWH B;  5D8D A;  1ZYR C;  2F0P A;  2W71 A;  3CQZ H;  3I4N G;  2UUB Q;  1HHV A;  1W93 A;  2A6E D;  3V4Z A;  2HDL A;  5G3L F;  1HR0 H;  1WCM H;  1OXU A;  1X9N A;  2YRW A;  2HDM A;  4KK7 A;  3HP3 A;  4RH6 A;  2PMZ A;  2XCP A;  3GIJ A;  1BNC A;  1EQQ A;  1JX4 A;  2W7O A;  3CD6 A;  4A3K B;  4NXN H;  3OSO A;  3BVZ A;  2K4K A;  2FLN A;  2E2J B;  4LF4 L;  4CC6 A;  4PMW A;  3TRZ A;  1LAC A;  3A7A B;  4IZ8 A;  4DV1 H;  4FS1 A;  2RQX A;  3G48 A;  4C3I H;  5EWE A;  1N56 A;  1JCK B;  3GTL H;  4X3U A;  2F0L A;  4H44 C;  1VQ5 A;  3KDF A;  4A3L G;  4H0L C;  2VS1 A;  5DAU A;  2E76 C;  5IP9 H;  1GUW A;  5GON F;  4DL2 A;  2HVR A;  3MA2 B;  5I4D A;  3F2D A;  1UE7 A;  2I5L X;  2VQE Q;  3GD7 A;  2JEJ A;  1K8A C;  3SK5 A;  2K50 A;  3H0G B;  3K80 C;  3HRZ C;  4DKA C;  2AMC B;  2EYL A;  4ZK9 B;  3D8G A;  4HTH A;  3DMU A;  2UXB Q;  4DV3 H;  4UAI A;  3T4A C;  3J80 L;  5ELN A;  3AMU A;  2N3S A;  4RGT A;  3ER0 A;  1MZB A;  4J9P A;  1L1O C;  1PRT F;  4RG1 A;  2QIL A;  3RZO H;  1BCP D;  2EY5 A;  3N6R A;  3GTG A;  5CA1 F;  1SE2 A;  1MSG A;  1GUG A;  3E3X A;  1L2Z A;  2OTJ A;  3HOZ G;  5IYD H;  4DR6 H;  4QL5 A;  2QEJ C;  4LF8 H;  4DK6 C;  2JA6 A;  4NB3 A;  5I2X A;  4JI4 L;  3GTO H;  1XMO L;  3TQT A;  4JOI C;  3VR6 A;  2A6H C;  5HGT A;  5BR8 Q;  2Q8T A;  4DGZ A;  2CW0 C;  1GHK A;  4DR7 Q;  1XXG A;  4I7H A;  5ISR A;  2Q2H A;  5CC4 A;  4POG A;  3RFC A;  2WKD A;  1XX8 A;  5M5Y H;  3FKI G;  5IYB G;  1GUO A;  1SXT A;  1IBL Q;  1H9J A;  5CV5 A;  1EUC B;  4C2M H;  4L8J A;  4A3J B;  2VUM H;  4Y7N B;  1B6S A;  4IUT A;  1Q82 C;  1XMQ H;  1RYR A;  2DY7 A;  2JXM B;  3N43 B;  1EEI D;  1GOZ A;  4HSV A;  1WTV A;  4OEM B;  1U9R A;  1B4O A;  1VQG A;  2KSW A;  4BBR H;  3IL8 A;  1N33 H;  4YCW A;  1HNX Q;  2XVS A;  3KAL A;  1M4V A;  4M7E A;  4HN7 A;  3TQY A;  1Q3L A;  4YAJ B;  1SE4 A;  3X3M A;  2M05 A;  1OXT A;  3BDO A;  2V58 A;  4K2K A;  1KJI A;  4A3C G;  1I94 L;  4EQ5 A;  3HOV G;  4LMY A;  1R4Q B;  4U7C A;  4JBJ A;  3D0F A;  4L6T B;  5KFR A;  4ECZ A;  5J3B A;  1SFO B;  2RSO A;  4P73 A;  1JJ2 A;  1BDO A;  4GS3 A;  1ZKO A;  3TZU A;  1II3 A;  4B9W A;  1SYD A;  1V1Q A;  1N36 H;  2PQA A;  5C0X H;  3UDG A;  1IKM A;  1UNN C;  4XQN A;  1YIT A;  3FRP B;  1CHQ D;  2WDT A;  5COR A;  1L0Y B;  3QB3 A;  2NZH A;  3TDQ A;  2R6F A;  5KFI A;  2F4V H;  4FXG C;  4X64 L;  4JI3 H;  1QCB D;  3QZ8 A;  3BAA A;  2UU9 Q;  4KV6 A;  5EKL A;  1KJJ A;  1EOT A;  2R8H A;  4RB3 C;  3E9I A;  2QA4 A;  1K1Q A;  1M0W A;  4YJ3 F;  1GUS A;  3VA5 A;  3IN5 A;  5JUM A;  3CRK C;  4KTA A;  4C3J G;  5IGE A;  3HXL A;  4APV A;  1SE3 A;  1K83 A;  5ELO A;  3GTM A;  1C9O A;  2FKL A;  4RFB A;  3VDY A;  5EPL A;  1Y69 U;  1UC8 A;  4BY7 B;  4UFZ A;  2ASB A;  4QGU A;  1IOV A;  1KQS A;  3J80 W;  5IP7 H;  2OH2 A;  2JA5 H;  1VQE A;  2JN4 A;  1F2M A;  1BO0 A;  1XNQ L;  2VPS A;  1F2Y A;  4ODG A;  1LLR D;  1H9S A;  2UXC L;  3GIP A;  5CB4 F;  3GTP B;  2R7K A;  1QZG A;  4UP9 A;  4B3R Q;  1EFI D;  2AQ1 B;  2J4X A;  3Q0A A;  3F2C A;  1XJV A;  1D1I A;  5C3X A;  1BCP B;  4GOP A;  2M9V A;  4EYH B;  4FBT A;  1A0I A;  2GPS A;  2NWG A;  4MAM A;  4IPH A;  1TWF H;  1ENC A;  1VQ6 A;  3SK6 A;  1V51 A;  3RAX A;  1PZJ D;  3T1H L;  1DZ1 A;  4YJ2 F;  2Z6B A;  5HY6 A;  3U9T A;  2UUB H;  3VA7 A;  1JOO A;  2ENB A;  4A3I B;  2CW7 A;  2WAQ A;  2ID0 A;  2XSC A;  4HNU A;  1L0X B;  1X32 A;  2JE6 I;  4DL4 A;  4TVA B;  2YU9 H;  1JDB B;  1PK8 A;  4OO1 I;  3MXU A;  3GIQ A;  4DR5 Q;  4FP5 D;  1X3F A;  1Z47 A;  4X65 L;  3K0X A;  1LTL A;  4LFB L;  4GZY C;  5KFL A;  1STE A;  4ME3 A;  2E2I H;  2N78 A;  3HFZ B;  1RKN A;  1I4H A;  4RAY A;  2ZXR A;  4KMU C;  5AJ3 Q;  4EFE A;  5C1O A;  3ERQ A;  2A1A A;  4JK1 C;  4LUO A;  2FJ2 A;  2N49 A;  3RLF A;  2RSN A;  3DWQ A;  4HJA A;  1QG7 A;  2NZ1 D;  5BN5 A;  3I4M G;  1KRT A;  2R84 A;  3I12 A;  1R9T H;  2NTT A;  1M7J A;  5M5W B;  3GTQ H;  1IBM L;  3K7A H;  2RDF A;  2AGO A;  5KFN A;  5I6W A;  3UI2 A;  5L1J A;  1Q8I A;  3MVV A;  4RGM A;  1PH3 A;  4ED1 A;  2B8G A;  3WO1 A;  4ZRZ A;  2H5X A;  2UXB H;  5C4X G;  4GC7 A;  5JVD F;  4O3Q A;  4O2B F;  2ATL A;  3FDS A;  3J81 j;  1O80 A;  1IL2 A;  3AB9 A;  2FIN B;  3CRL C;  4HIO A;  3MHB A;  4BBS G;  3RB0 A;  1GYF A;  2LXK A;  3QG1 A;  2UVU A;  3H3V I;  1ZYR D;  2MQH A;  1D6E C;  1PTO H;  2K5V A;  3ULJ A;  1K0S A;  4KY7 A;  3VR5 A;  4A3G B;  1IOW A;  4U6P A;  1Y14 B;  2ZDQ A;  5KFC A;  3IRB A;  2FP4 B;  1I4X A;  2YV5 A;  2UUA L;  1TWA B;  4GN3 B;  2R8I A;  4Q5V A;  2EJF C;  5BR8 H;  3VR3 A;  3BG3 A;  3L0O A;  4ZOL F;  3C46 A;  1KLU D;  3H15 A;  1GXD C;  4DR7 H;  3BJY A;  2EZV A;  1YJN A;  4LFC Q;  1D2B A;  2R82 A;  4H02 A;  1GSH A;  3TII A;  1DCZ A;  2Z8L A;  2NN6 G;  1IBL H;  2W9C B;  4YCU A;  4KHV A;  2ZM6 L;  3NHH A;  3ERS X;  2JA8 H;  4IUP A;  2CVR A;  5I9O A;  5M3F B;  4A3K G;  4P71 A;  4ED3 A;  5EQ0 A;  4KD3 A;  1J5E L;  3S16 B;  4EBE A;  2J0T D;  4IRD A;  1SYG A;  1S4Z A;  4P2C B;  4DK3 C;  1E4E A;  2R93 A;  5CBA E;  5FLX L;  1PFN A;  1HNX H;  3EQL C;  3HKZ B;  2DWC A;  1ICW A;  4DAP A;  3H4D A;  2CQO A;  2K01 A;  4UCV A;  3VPC A;  5K36 H;  1MJE A;  2F0W A;  1FD7 D;  3PIO A;  2VNU D;  3N42 B;  2E2H B;  1YHA A;  3H0G G;  2DZD A;  3HOU H;  5ELD A;  4X66 L;  2UXD L;  3P75 A;  3QOJ A;  1B3Q A;  3K3P A;  1HNZ Q;  5EWF A;  1E24 A;  4ME6 A;  1O78 A;  4X3T A;  4OXP A;  4BXX G;  3B6Y A;  2Q2I A;  3HBL A;  2K5H A;  3GTG H;  2NTS A;  4WD3 A;  1EY7 A;  1SCU B;  4LSA A;  3M4O B;  3NE5 B;  2QDL A;  2CW0 D;  2JA6 H;  3H40 A;  3F2U A;  2ZDH A;  3M4I A;  5CA0 F;  2A68 C;  2F0O A;  1Y1W H;  1TY0 A;  3GIM A;  2C28 A;  4OWX B;  2C00 A;  4DV7 Q;  1CHP D;  4DUZ L;  4B3M H;  4TUY F;  3KLR A;  3I91 A;  2Q2T A;  4RZR A;  4ECX A;  2C22 A;  5FJ8 H;  2GA4 B;  1ENA A;  2XWJ B;  5A35 A;  2XIG A;  3L2P A;  1D5Z C;  3PUZ A;  3W3A A;  3T53 B;  2R92 B;  2QYZ A;  4AH6 A;  3FMA A;  2BR0 A;  3PUW A;  1R4P B;  1LO5 D;  5K5P A;  4RNM A;  3NSW A;  1A63 A;  3DF7 A;  3U58 A;  3KUP A;  5DEH A;  3NQI A;  4CJ0 B;  4B3R H;  4A3J G;  2NBF A;  2UUC Q;  1GUT A;  4B08 A;  1HZ9 A;  5DGB A;  3K5I A;  4HSP A;  5DG8 A;  4YY3 Q;  2NVT H;  1LT3 D;  5GRO A;  3RV3 A;  4X3S A;  1TU2 B;  4LW1 A;  2HVS A;  1SYX B;  4IUR A;  4CGY B;  2ZTD A;  1SYF A;  2JYO A;  4WJ3 M;  3DM3 A;  2G9D A;  4HQ6 A;  2K7V A;  5C4H A;  3T5H A;  4DR5 H;  2KOL A;  1QOH A;  4KJO A;  2VOB A;  3M85 A;  5IYC G;  4ED6 A;  2Q8I B;  4TV9 F;  4DR3 Q;  1KC7 A;  3ETJ A;  3GQC A;  1B2T A;  2VW9 A;  1IYU A;  1TQO A;  3RTX A;  2WE6 A;  3MXN B;  2H1E A;  3D31 A;  4KJN A;  3KF6 B;  5BN4 A;  3T1Y Q;  1GSA A;  2A69 C;  2MP1 A;  4FDB A;  4OL7 A;  3FKI A;  1K83 H;  2ICE C;  3RZD H;  3GTM H;  3HOW B;  2W70 A;  4F87 A;  4JYA Q;  3MJF A;  1V9P A;  4R1J A;  3P1H A;  3W1B A;  4K2L A;  3S2H B;  3OPO A;  4GKJ Q;  2J6S A;  2ASL A;  4IRK A;  4MA5 A;  3GII A;  4DL3 A;  5ELC A;  4BY7 G;  2NVX A;  1IYJ B;  1S03 G;  1L1O B;  1HR0 L;  3GV5 B;  3RBE A;  2PQE A;  3EBE A;  4LSX A;  3CCR A;  4OIK A;  4JI0 Q;  1VQ7 A;  2DPJ A;  3URY A;  2Q2U A;  1IW7 C;  2B29 A;  4NXN L;  4A3B B;  3PUY A;  3WWV A;  3HOY B;  3CC7 A;  2YCH A;  1C30 A;  1UEA B;  2GPW A;  3MFY A;  1IBK Q;  1BF4 A;  3S17 B;  2JEB I;  4R8N A;  2HUG A;  4H7B A;  4DV1 L;  1PTO F;  5M5X H;  4L5R C;  1K73 C;  1BR9 A;  2PW5 A;  2F0M A;  3A8I E;  3KLS X;  4QB4 A;  4TQU S;  1PYB A;  3DHQ A;  3F2B A;  1JC7 A;  3NBH A;  1O7L A;  1YHQ A;  4FU0 A;  4RB2 C;  2VB3 X;  2YTY A;  4XYM B;  4QW8 A;  4RWS C;  5IYZ F;  4LFC H;  4XZ3 B;  3U4Z A;  1AP0 A;  5KFX A;  4CDF C;  1X54 A;  5KX5 F;  3PW4 A;  5JVG 3;  2KEC A;  4F4Y A;  2AGQ A;  4A3I G;  1PH4 A;  1FJG Q;  2VB2 X;  5KFZ A;  2V5A A;  4Z9C B;  3GTK A;  5FLM H;  2WB1 B;  4TRD A;  3AEV A;  4DV3 L;  1EQV A;  3UDF A;  1B9N A;  3M9B A;  4CHT B;  3GV7 B;  3EN2 A;  1QWY A;  5E1F A;  2L12 A;  3IKJ A;  1AZQ A;  5LYJ F;  4K0K Q;  5LL6 X;  2MPM A;  3CME A;  1LV9 A;  4CJ1 B;  3J7Z C;  2PN1 A;  4DV4 Q;  1XTC D;  5NUC A;  1KL9 A;  5GAE C;  1RL2 A;  3BU2 A;  4AQY Q;  1V1P A;  2O2L D;  4ULL A;  4C5B A;  1G6Z A;  1EU4 A;  4WFN 3;  4DR6 L;  2ZJP A;  4LF8 L;  5CGK A;  2GVA A;  2FK1 A;  5F9L A;  4IR1 A;  4UCO A;  4Q8F A;  5FPO A;  2F0N A;  1D1K A;  1T5X D;  4RGN A;  1QVG A;  4JI7 Q;  3RLO A;  3ZJY C;  3S14 B;  4LFA Q;  3M4Q A;  3BAB A;  2CKZ B;  1S0M A;  1KHI A;  4MV4 A;  3UDI A;  3VYT A;  1HNZ H;  2XCL A;  5D14 A;  1QJO A;  2EY6 A;  2Q8R E;  1VDZ A;  3W2D A;  1EYZ A;  2ICI A;  5EPJ A;  3I8Z A;  2BDN A;  4AYB B;  4DR1 Q;  5FLX c;  1NMF A;  3VPD A;  1XMQ L;  4N8X 1;  2SCU B;  3X3N A;  3FEW X;  4DV7 H;  3BYT B;  2NYZ D;  1N33 L;  2IL8 A;  1H9K A;  5IY0 A;  1I4R A;  3RN2 A;  1EOV A;  3KAJ A;  5CV4 A;  3S15 B;  1HR0 W;  5J22 A;  3ITP A;  3JSN A;  3BDC A;  3TP8 A;  3ICE A;  4F88 A;  3T13 A;  1ET6 A;  4C3H H;  3J81 W;  2K14 A;  4I7A A;  4ZUJ A;  1EUD B;  5C3E H;  4IUQ A;  1S5C D;  2R3Z A;  2DN8 A;  3MC0 B;  4N8F A;  1EY5 A;  2R7L A;  1VF7 A;  3RJ0 A;  2UUC H;  1IYV A;  1N36 L;  2R93 H;  5M3F G;  5JEA J;  1PVO A;  4A2B A;  4V0B A;  1OWT A;  2I87 A;  3TBI B;  5A2Q W;  1NAP A;  4YY3 H;  3RUP A;  2F4V L;  3HKZ E;  3G6Y A;  2ZXO A;  1WFQ A;  4JI3 L;  1M0T A;  4RB0 A;  1S10 A;  3VR2 A;  3HKZ G;  4IN3 A;  4ECT A;  3T56 B;  1FYC A;  4EBD A;  3BA9 A;  1JLL B;  3I70 A;  4X62 Q;  4QJF A;  4NW2 A;  3PQI A;  4GNX B;  5EBD A;  1X3G A;  1SMX A;  2X69 A;  5C4J H;  1WTQ A;  5KFV A;  2F0E A;  4G7Z C;  4JPB W;  4MV9 A;  1QVF A;  3S1Q B;  3SEB A;  4NXM Q;  2N8N A;  1MIU A;  2EPB A;  2A68 D;  1AFP A;  3WOF A;  2FPI B;  3I4N H;  1HZC A;  5L9X A;  1E1T A;  2FLP A;  2DY8 A;  3T1Y H;  1HTP A;  2N88 A;  1TWH A;  3J7A 5;  5C3E G;  3OMG A;  5GAG C;  1HUN A;  1CQV A;  2JQO A;  5LXT F;  4JYA H;  2I07 B;  3I7F A;  4IPG A;  1CKM A;  1RJT A;  4JBM A;  1SN8 A;  3PO2 G;  3K57 A;  4IQZ A;  3K0Y A;  3J7Y W;  4GKJ H;  2CZG A;  3T16 A;  2UUB L;  4M9U A;  5BMV F;  3R2I A;  2PBZ A;  4JI0 H;  3N6X A;  2R92 G;  1K0R A;  2SNM A;  4A93 B;  4EYI B;  3SI8 A;  4A3L H;  2ASD A;  2JEA I;  2DNC A;  4O3N A;  2GN5 A;  5FKA C;  2ZDG A;  4RU9 A;  1XPU A;  1GM5 A;  5LMN Q;  4I7Z C;  1IBK H;  4HCS A;  1VQ9 A;  3L3O C;  3PW2 A;  5KFU A;  4LWC A;  2LXJ A;  4POF A;  1WTR A;  1XDN A;  2XIW A;  4DV5 Q;  2NU8 B;  1QE6 A;  2QCP X;  2OF1 A;  2MFI A;  1I6H H;  1XWE A;  4WRD A;  3ETH A;  1O7Y A;  5KFK A;  3Q8R B;  1HUM A;  1V4Y A;  1OO9 B;  4A3E B;  1K1S A;  2P5Z X;  3AQQ A;  1TT2 A;  4X6A H;  3ZYY X;  3NP8 A;  2BH8 A;  2B63 B;  1DIK A;  3RN5 A;  5D1P A;  1YNJ C;  4O3O A;  3PVX A;  4GN4 B;  5E3F A;  4O3P A;  2MJ8 A;  1QNK A;  3P7J A;  4IHJ F;  3OW2 A;  5KT2 A;  1FJG H;  4EEY A;  3CC4 A;  1TR5 A;  3HOZ H;  2NVY H;  1UUP A;  1GHJ A;  4IWX A;  1EY4 A;  2XGT A;  3HOX B;  2B2Y A;  1J6Q A;  4NLG A;  1ASY A;  2A69 D;  2UXB L;  1CZW A;  2BCO A;  5IE8 A;  5FO7 B;  4MTK A;  3VYS A;  4DAV A;  4A3M G;  2DPI A;  3EIV A;  4K0K H;  4I4T F;  4FVM A;  1S40 A;  5T14 A;  4DV4 H;  2B2T A;  3FKI H;  4AQY H;  4U68 A;  1LYL A;  5IYB H;  3K7U C;  1VQ4 A;  4JI1 H;  3A0J A;  4R9W A;  2AU0 A;  3OOC A;  3CCJ A;  1B3A A;  1UWV A;  3A8K E;  1CK1 A;  3HOW G;  4RNO A;  1IW7 D;  2M2L A;  1E3P A;  4JI7 H;  5BR8 L;  1K3B C;  4ZI7 F;  2R7Z B;  2NVX H;  4LFA H;  2HVQ A;  2V4R A;  1NR4 A;  4DR7 L;  1I50 B;  3OW7 A;  3SK8 A;  2WYO A;  4YB8 B;  2YW2 A;  3PO3 B;  3GDE A;  1S0O A;  4Q0F A;  3KJP A;  1IBL L;  2XD4 A;  1TWG B;  2A5H A;  1OXV A;  2VQF Q;  3KHR A;  4R7R A;  4DR1 H;  4YWM A;  4A3B G;  4ED7 A;  3HOY G;  3S1N H;  2R8G A;  4A3C H;  1PX2 A;  3BVG A;  2PZU A;  3CCL A;  1HPC A;  3HOV H;  2XC9 A;  1O75 A;  1RHP A;  3JAM E;  2L11 A;  1UE1 A;  4ZQI A;  4EQN A;  1HNX L;  1Y1W A;  3LWU A;  1BJT A;  2NZO A;  1DXM A;  2RHS B;  4LF9 Q;  1SFO A;  2SEB D;  2PMZ B;  4QIW E;  4CKB A;  4GN5 A;  4TSS A;  2W6Z A;  4JV5 Q;  2V1C C;  4OWT B;  3RD4 A;  2F0Q A;  2W6O A;  5D1O A;  4KN4 C;  1FNW A;  3CMA A;  2JA8 B;  3J81 E;  4KN7 C;  4MTE A;  3GTK H;  3GIK A;  2JA7 B;  5KFP A;  2AGP A;  3SHL A;  5KNC A;  2CH4 W;  4C3J H;  1U0L A;  1VQM A;  3BZD B;  2J6T A;  4K6L A;  2OEO A;  1NJI C;  1CA6 A;  1T94 A;  4J1M A;  5A2Q E;  1Q46 A;  2FK3 A;  3KDF B;  3CF5 A;  5L37 A;  5BPH A;  2A73 B;  3MFG A;  2I8C A;  3UFX B;  1M90 C;  2WKC A;  3K81 C;  3A8J E;  3MEH A;  2F0F A;  3LP8 A;  2E8G A;  1W2B A;  4X62 H;  2LS0 1;  5C3W A;  1Q86 C;  3V05 A;  2X6L A;  4F50 A;  2LMC B;  3RNU A;  4NPS A;  4KKU A;  4B3M L;  5GQO A;  2IY5 B;  4FYD A;  4WBN F;  5DQG A;  1T9H A;  5CYU A;  2OWO A;  4IFD I;  3RB3 A;  3M3Y B;  1YBY A;  5IT9 E;  3IFD A;  4NXM H;  3KOJ A;  1CTM A;  2KUM A;  1H9R A;  4XIG S;  4DFA A;  2H4O A;  3E5N A;  2HCI A;  1VQJ A;  4WJW A;  3BS1 A;  3PIO 3;  4ECU A;  5JVH 3;  2CWP A;  1PH2 A;  4RUA A;  1X3E A;  3VMM A;  5JJZ A;  3H94 A;  2R61 A;  3BQ1 A;  2F0J A;  4J9S A;  2IX0 A;  4B3R L;  1WR2 A;  4JI6 Q;  3NUC A;  1STB A;  3CU7 A;  1ASZ A;  1NMG A;  4LUV A;  2RGV A;  2WFW A;  1DJR D;  4DR2 Q;  4E6I A;  4UP7 A;  1Q1B A;  2JEG A;  3RMH A;  4RHS A;  2JJQ A;  2YZG A;  4BWS C;  2EY1 A;  3G6V A;  4YHH Q;  2C9O A;  1VS0 A;  3R8B A;  4A4I A;  4R4C A;  3I4M H;  3OMC A;  2HHH Q;  1PZI D;  1VQH A;  4BA1 I;  1UE6 A;  4DR5 L;  5LMN H;  1QB5 D;  3K59 A;  1DYQ A;  3M9M B;  4OX9 Q;  2ZJT A;  4JC0 A;  1VCI A;  4XYQ A;  4DV5 H;  2DNE A;  2TMP A;  1T3N A;  2JP1 A;  4JG2 A;  5KT5 A;  5AJ3 L;  3SK4 A;  4EGQ A;  1K3R A;  1EYD A;  3OUZ A;  1K9M C;  5E4X A;  5C4X H;  1JJC B;  2W57 A;  1AN7 A;  1DGS A;  3I4L A;  3PUV A;  1GD7 A;  1ONL A;  4FM9 A;  2WV6 D;  4G3I A;  3I73 A;  2E2D C;  4C1N I;  4MV3 A;  2KHS A;  4BBS H;  2IMW P;  5LA6 F;  3OYY A;  3I90 A;  5KFG A;  4ZKC B;  2KEE A;  4LF7 Q;  3MWY W;  2E74 C;  2J7Z A;  3W1G A;  4EX5 A;  5M3M B;  3H20 A;  1PFS A;  3CVZ A;  3JRX A;  4JVZ A;  5J1Z A;  4A3D B;  3RB6 A;  2V4D A;  2WIN B;  3R3O A;  3ND8 A;  4C5C A;  1SJE D;  4A76 A;  3CPW A;  5M9O A;  1KJQ A;  1B50 A;  4LH6 A;  1MJC A;  1TWA A;  3GV6 A;  1FR3 A;  1PLF A;  1TWH H;  4PZ7 A;  4IWY A;  1NCV A;  2NN6 H;  3FPP A;  1NY4 A;  1I3Q B;  1T5E A;  2FMC A;  4X3K A;  3JRW A;  1S0N A;  2RGR A;  2W6N A;  3NK9 A;  4O0A A;  3GTJ B;  2EYH A;  2UVW A;  3FMC A;  3KF8 A;  1EY0 A;  3OIP A;  3LWE A;  4A3K H;  2VQE H;  1MD2 D;  1BXR A;  5DQI A;  1OXS C;  2E2J H;  5LOV F;  4ECY A;  1JWM D;  2JK8 A;  3BYY B;  5DQH A;  1PYW D;  3MR2 A;  5J2U F;  3OHA A;  4LFC L;  1VMP A;  5EBC A;  3PF5 A;  2XTI A;  5JVL A;  3DWA A;  2BDO A;  1B1Z A;  4ECW A;  3KAK A;  1T36 A;  3R5H A;  2VQF H;  2IJ0 A;  4G4K A;  4LF6 Q;  3HKZ A;  4A93 G;  2CFM A;  1SRO A;  5DLG A;  1CFM A;  1VQF A;  1Y1V B;  2B8F A;  3OSN A;  3C1E A;  4P75 A;  1YNJ D;  3GV8 B;  1SNC A;  1NR2 A;  1KD1 C;  1B8A A;  2EYO A;  3H0G H;  3V4S A;  3Q8Q B;  3BDL A;  3MR6 A;  2BQ3 A;  4LF9 H;  1S72 A;  4HIM A;  4A3E G;  1LT6 D;  4BXX H;  1Z6H A;  1SDF A;  3MR5 A;  2BQU A;  2C2R A;  3T51 B;  1PH6 A;  3BVM A;  5IGD A;  4JV5 H;  5KT7 A;  2B63 G;  4HMI A;  2PW7 A;  5KFT A;  3GP7 A;  1TA8 A;  4G7H C;  3HB9 A;  1WSC A;  2IHF A;  4B3T Q;  2MHV A;  4C5A A;  1TWC B;  1IBM Q;  1E2V A;  1HNZ L;  2SOB A;  3HOX G;  1SMY C;  1JE5 A;  1N34 Q;  1CSP A;  2L9H A;  3SGI A;  3AFP A;  1KIX A;  1Y8O B;  4UCS A;  3KTM A;  2J6U A;  3K6O A;  5CV8 A;  2R8J A;  1E1O A;  1YNX A;  4TQR A;  1PH5 A;  3DEO A;  3D4R A;  4DV7 L;  4MV6 A;  4JI5 Q;  4A3J H;  4Y7N H;  5KRU A;  2W8K A;  3LX0 A;  4DR4 Q;  1I7N A;  2R7Z G;  3J7A K;  1Z9F A;  4IAL A;  3Q6S A;  1VQP A;  1AZP A;  2B2V C;  4RA8 A;  3RB4 A;  1VQA A;  3PO3 G;  4R8U B;  3MWD A;  1YHB A;  1GSO A;  3MXP A;  5KND A;  2A6H D;  1QUQ A;  2QF7 A;  1RYS A;  2UU9 H;  4ED0 A;  2R7F A;  2UVR A;  5EJW A;  4PV1 C;  4F8M A;  3NEL A;  4TKO B;  2UUC L;  4IFD G;  4JI6 H;  1CKN B;  4HAE A;  5KFY A;  3KFU A;  3EPG A;  1I4P A;  2ES2 A;  2R7N A;  1K28 A;  1B44 D;  1NTG A;  1PTO C;  4YY3 L;  1F9S A;  5IYC H;  3CCM A;  4DR2 H;  4M1U B;  1SFO H;  3K5H A;  3KLW A;  2V59 A;  4ZKB B;  1MKH A;  4RHR A;  1RJP A;  4YR2 A;  5BPF A;  4J9N A;  4G57 A;  1I4Q A;  1JQY D;  5I9P A;  3CW2 C;  3TP5 A;  4K14 A;  3S1R B;  5FD5 A;  4DXG A;  2IA6 A;  3CCU A;  3H91 A;  3DEP A;  3R5F A;  3J80 E;  3PZP A;  4YHH H;  1Z2O X;  1LTA D;  4OO1 H;  4IPD A;  1C4Q A;  4LH7 A;  2HHH H;  1KBL A;  1CQI B;  4CDE C;  1EEF D;  3OIQ A;  3N40 P;  4OX9 H;  5KIX A;  2KHJ A;  2JA7 G;  1VBG A;  2B2Y C;  1EQR A;  1B33 N;  3KF6 A;  4S3S A;  3P20 A;  1DOM A;  1HCZ A;  1GGO A;  4V19 0;  1BVS A;  1HNW Q;  1V43 A;  1SJH D;  3S1M B;  1LTG D;  4BY7 H;  2F4I A;  4X66 Q;  1UE5 A;  4MIU A;  5EKI A;  4A3F B;  3T1Y L;  2M00 A;  1LTR D;  3TEH B;  4IOC A;  5CMD A;  2B2U A;  5HGQ A;  1B9M A;  4DPG A;  1PYS B;  4JYA L;  3ORR A;  1W3S A;  4JI2 Q;  5JJL A;  4EGJ A;  4LF7 H;  5CR3 A;  5FPR A;  5C44 B;  1JT8 A;  2L0C A;  1HJP A;  3GTP H;  4FF3 A;  2V9W A;  4GKJ L;  2DJF C;  2K1B A;  3S2D H;  4PMC A;  3H09 A;  2FPG B;  4YWK A;  4EG0 A;  1RD9 D;  4GKK Q;  1BXT A;  2XCA A;  1KTK A;  2NVY A;  4JI0 L;  5FLX W;  3OWE B;  5ELB A;  5C6A A;  4N9T A;  1STY A;  4UY8 C;  1IZ6 A;  3KXY T;  4L5T A;  1AE2 A;  2Z4I A;  4J0M A; 
#chains in the Genus database with same CATH homology
 1XMO L;  1WFQ A;  4GOP B;  4JI3 L;  1IBK L;  3BZC A;  4OO1 G;  4JOI C;  3HKZ G;  1XTD A;  5H1S E;  5BR8 Q;  4A3I H;  3PIP A;  1N34 L;  4O2D A;  5JEA G;  4X62 Q;  4QJF A;  1XPO A;  4DR7 Q;  2R7Z H;  2Q2H A;  2OTL A;  4X65 Q;  4POG A;  4GNX B;  1X3G A;  1I50 H;  1SMX A;  5M5Y H;  3FKI G;  2I0Q A;  4LFB Q;  5IYB G;  5C4J H;  1IBL Q;  3PO3 H;  2AWO A;  4C2M H;  4NB3 A;  1TWG H;  1QVF A;  2VUM H;  1P16 A;  4BA2 I;  1Q82 C;  4NXM Q;  4JI5 L;  2N8N A;  1MIU A;  1Q1E A;  4JI4 L;  1FJG L;  4DR4 L;  1VQB A;  1VQG A;  4UPA A;  4BBR H;  3I4N H;  4YCW A;  1HZC A;  1E1T A;  1HNX Q;  1CKN A;  1QZH A;  3TS2 A;  1YI2 A;  5M5W H;  1PH8 A;  1YEZ A;  3TQY A;  3J7A 5;  5C3E G;  5GAG C;  2F4V L;  4K0K L;  2JQO A;  1A62 A;  3F1Z A;  3PSI A;  3I7F A;  1OXT A;  3S24 A;  4IOA A;  4IPG A;  1CKM A;  3FP9 A;  4JBM A;  1SN8 A;  3PO2 G;  3KF8 B;  4DV4 L;  4A3C G;  2BH2 A;  1I94 L;  1P8L A;  4EQ5 A;  3HOV G;  4JI1 L;  2QEX A;  4AQY L;  4JBJ A;  3D0F A;  2L15 A;  5J3B A;  4P73 A;  1JJ2 A;  3J80 c;  2UUB L;  4JBK A;  4GS3 A;  2JA7 H;  2DGY A;  4JI8 Q;  1V1Q A;  2PQA A;  5IWA Q;  3UDG A;  2R92 G;  1K0R A;  2OQ0 A;  1YIT A;  4JI7 L;  4A3L H;  4DV0 Q;  2JEA I;  2GN5 A;  3CXC A;  4LFA L;  2NZH A;  1XPU A;  1GM5 A;  4IFD J;  5LMN Q;  1SE8 A;  5M3M G;  4X64 L;  3J80 i;  2UUA Q;  1VQ9 A;  2UU9 Q;  2WP8 J;  4A3D G;  2KBN A;  4LWC A;  1TWA H;  2LXJ A;  4POF A;  4DAY B;  1B7Y B;  4DV5 Q;  2LSS A;  3E9I A;  2QA4 A;  1I6H H;  2MFI A;  3E0E A;  2BA1 A;  4R4I A;  3RR5 A;  1H95 A;  1VQC A;  4DR1 L;  4APV A;  1PH1 A;  2IT1 A;  4RMF A;  4L5R C;  5ELO A;  1C9O A;  1QVC A;  2KCM A;  3AQQ A;  3VDY A;  4X6A H;  1HH2 P;  3U4V A;  2ZM6 Q;  2EXD A;  2R7D A;  2BH8 A;  1L0W A;  1HNW L;  1LUZ A;  3I4O A;  3RN5 A;  2ASB A;  2D62 A;  4QGU A;  4GN4 B;  3U50 C;  3I56 A;  1KQS A;  5IP7 H;  3M3Y H;  2Z0S A;  3MEF A;  1J5E Q;  2JA5 H;  3OW2 A;  1B70 B;  1VQE A;  5M3F H;  2PMZ E;  3CC4 A;  4YWL A;  3HOZ H;  5DLQ E;  1XNQ L;  3S16 H;  2NVY H;  3BZK A;  1KRS A;  2XGT A;  5C0X J;  2UXC L;  1J6Q A;  2OCE A;  4JI2 L;  1ASY A;  2UXB L;  1K8G A;  1QZG A;  1EWI A;  4UP9 A;  4B3R Q;  5IE8 A;  4PG3 A;  1VQ8 A;  4A3M G;  4JBW A;  3F2C A;  3EIV A;  1XJV A;  2JA8 G;  4GKK L;  2YYZ A;  1G29 1;  4GOP A;  2K75 A;  1S40 A;  4HIK A;  1FGU A;  2PNH A;  4DR3 L;  1A0I A;  1X6O A;  3CCV A;  4IPH A;  3FKI H;  1TWF H;  1LYL A;  2D0P A;  3K7U C;  3TRE A;  5IYB H;  1VQ4 A;  1VQ6 A;  3A0J A;  3T1H L;  1Y1V G;  5HY6 A;  3NBH B;  4A3G G;  4GOP C;  4GNX A;  3CCJ A;  1UWV A;  2UXD Q;  4L5Q A;  2E2H H;  3HOW G;  3G6E A;  2ID0 A;  1E3P A;  5BR8 L;  2JE6 I;  4TVA B;  2YU9 H;  4GLX A;  2NVX H;  4PZ6 A;  4X62 L;  4OO1 I;  4DR5 Q;  4DR7 L;  1L1O A;  1X3F A;  1AE3 A;  1Z47 A;  3OTO Q;  1N32 Q;  5K36 G;  4X65 L;  3K0X A;  1SLJ A;  1LTL A;  3GDE A;  4LFB L;  3KJP A;  2FXQ A;  1IBL L;  4ME3 A;  2ALY B;  3M4O H;  3RLN A;  2N78 A;  2E2I H;  3HFZ B;  1OXV A;  2VQF Q;  5AJ3 Q;  3CCE A;  4YWM A;  2A1A A;  3HOU G;  4NXM L;  2KEN A;  4A3B G;  4IJH A;  4LUO A;  4DUZ Q;  3RLF A;  2N49 A;  1Q7Y C;  3HOY G;  1QUQ B;  4JOI A;  2ZJR A;  4HJA A;  3CCL A;  3HOV H;  4A3C H;  1AH9 A;  5GAD C;  3I4M G;  1HZB A;  1KRT A;  4HJ9 A;  1R9T H;  2MO0 A;  3CAM A;  1UE1 A;  3H3V H;  3GTQ H;  4KI0 A;  1HNX L;  1IBM L;  3K7A H;  4IPC A;  3L7Z C;  4KHP Q;  2NZO A;  2JA6 G;  2R92 H;  2RHS B;  4LF9 Q;  4DUY Q;  1FVI A;  4QIW E;  1PH3 A;  1EUJ A;  4GN5 A;  3UE0 A;  1Y1W G;  4R4O A;  1PA6 A;  3NEN A;  5M3M H;  4ALP A;  4JV5 Q;  2H5X A;  2V1C C;  4OWT B;  5C4X G;  4KHZ A;  4LUZ A;  4A3D H;  3CMA A;  5FJ8 G;  3GTK H;  3J81 j;  2CCZ A;  1M1K C;  1IL2 A;  1EYG A;  4B3S Q;  2IHE A;  3A74 A;  4HIO A;  4BBS G;  2OQK A;  1RIP A;  4C3J H;  4JI8 L;  1U0L A;  3A5Z B;  4P72 A;  1VQM A;  2LXK A;  4R4T A;  5IWA L;  2A19 A;  2D0O A;  1VQD A;  1NJI C;  3H3V I;  1LM0 A;  2MQH A;  3NEM A;  3TS0 A;  3CC2 A;  2K5V A;  3ULJ A;  4DV0 L;  1Y14 B;  1Q46 A;  3KDF B;  2HIV A;  3IRB A;  3CF5 A;  2PI2 A;  5LMN L;  1I3Q H;  1SRU A;  2YV5 A;  2UUA L;  4GN3 B;  5E7N A;  1M90 C;  1C0A A;  3GTJ H;  3K81 C;  3M7N A;  4HJ5 A;  3L0O A;  4JCV E;  4DV5 L;  3HKS A;  2E8G A;  1W2B A;  3H15 A;  2MO1 A;  1KAW A;  1YJN A;  1Q86 C;  5LMU Q;  4LFC Q;  4H02 A;  3RNU A;  1D8L A;  4NPS A;  2IY5 B;  4B3M L;  5GQO A;  2NN6 G;  1T9H A;  4YCU A;  2QGQ A;  2ZM6 L;  4A3M H;  2OWO A;  4IFD I;  3ERS X;  2JA8 H;  2HQL A;  1YBY A;  3PUX A;  2E5L L;  4QY7 A;  1NBW A;  3STB D;  3KOJ A;  4P71 A;  4A3K G;  2F3I A;  4XIG S;  1J5E L;  1VQJ A;  1U5K A;  1S3O A;  2CWP A;  1N34 Q;  1JB7 A;  1Y1V H;  4DK3 C;  1PH2 A;  1X3E A;  4A3G H;  1IXR A;  2CQO A;  4MNO A;  3HOW H;  2IX0 A;  5GAH C;  4B3R L;  4JI6 Q;  3G4S A;  1BBU A;  1ASZ A;  1NMG A;  4LUV A;  3S2H H;  4YCV A;  2WFW A;  4DR2 Q;  1MJE A;  1G51 A;  4UP7 A;  1HR0 Q;  1Q1B A;  3CPF A;  3K8A A;  4QQB X;  3PIO A;  2VNU D;  5C0X I;  1PH9 A;  2JJQ A;  4NXN Q;  1YHA A;  3H0G G;  4BXX G;  1XNR Q;  4HJ7 A;  2ZTE A;  3KYH C;  4X66 L;  2VQE L;  3HOU H;  3HOY H;  4A3B H;  4YHH Q;  2UXD L;  1VS0 A;  1XPR A;  4A4I A;  1HNZ Q;  1E24 A;  3GO5 A;  1VQI A;  4OXP A;  4R4C A;  1TWC H;  3I4M H;  3S17 H;  3B6Y A;  2HHH Q;  4DV1 Q;  2Q2I A;  1VQH A;  2K5H A;  4J15 A;  1UE6 A;  4BA1 I;  5C44 G;  4DV6 Q;  3OTO L;  4DR5 L;  1C7Y A;  4LF5 Q;  2VY3 A;  3GTG H;  1GO3 E;  1N32 L;  4OX9 Q;  2EQS A;  1EIF A;  4JC0 A;  3DLL A;  1VCI A;  4IJL A;  2Z6K C;  1EIY B;  3CCS A;  2JA6 H;  3JAM c;  4JI1 Q;  2IX1 A;  4JG2 A;  2VQF L;  1KC8 C;  1Y1W H;  5AJ3 L;  4OWX B;  1K3R A;  4DV7 Q;  4DV2 Q;  4DUZ L;  1CKO A;  1K9M C;  5C4X H;  1JJC B;  2Q2T A;  2KHI A;  3UE1 A;  1DGS A;  2KCT A;  5FJ8 H;  3PUV A;  1GD7 A;  3JAM i;  3L2P A;  1N9W A;  4DNI A;  3PUZ A;  1YVC A;  4BBS H;  3OYY A;  4AH6 A;  4KHP L;  1N8R C;  3PUW A;  2ZJQ A;  4AIM A;  3J81 c;  4LF9 L;  4DV3 Q;  3PCO B;  4DUY L;  2WAQ E;  4LF7 Q;  3W1G A;  4EX5 A;  2CWA A;  3Q8D A;  2VZA A;  4L5S A;  1PFS A;  1O7I A;  1E7Z A;  2WAQ G;  3G71 A;  3U58 A;  1A63 A;  4JV5 L;  3UDX A;  3LGJ A;  1WOC A;  3JC6 6;  1VQK A;  4MZ9 A;  4A3J G;  2UUC Q;  2E5L Q;  5LMN W;  3J81 i;  1HZ9 A;  4A76 A;  3CPW A;  4B3S L;  4OWW B;  1VQN A;  3PO2 H;  1UEB A;  1MJC A;  4DR6 Q;  3KJO A;  4LF8 Q;  4YY3 Q;  1TWH H;  2NVT H;  4PZ7 A;  5FLM G;  2YTX A;  5GRO A;  4BY1 G;  1BBW A;  4LW1 A;  1NY4 A;  2ZTD A;  2ZTC A;  4WJ3 M;  4O0A A;  1WYD A;  3DM3 A;  1YZ6 A;  2HIX A;  4A3K H;  1OXX K;  1E22 A;  3S1R H;  2GVB A;  2YTV A;  1YJW A;  1PH7 A;  4OON A;  4LF4 Q;  3S14 H;  1KXL A;  3I55 A;  1OXS C;  2E2J H;  2JK8 A;  3CCQ A;  1CUK A;  5IT9 c;  2K52 A;  4LFC L;  5LMU L;  3PF5 A;  2XTI A;  3M85 A;  4P74 A;  5IYC G;  1WCM G;  2DUD A;  4DR3 Q;  3BJU A;  1XMQ Q;  4IO9 A;  4LF6 Q;  2NN6 I;  2ATW A;  2VW9 A;  4A93 G;  2CFM A;  1SRO A;  1N33 Q;  2WB1 E;  2I5H A;  3PGZ A;  1VQF A;  3MXN B;  2AKW B;  3D31 A;  2WB1 G;  3KF6 B;  3ULL A;  4P75 A;  3T1Y Q;  3S1M H;  1GVP A;  4FDB A;  4A3F H;  3AFQ A;  1KD1 C;  2B3G A;  1K83 H;  3ULP A;  3RZD H;  4HID A;  4LNQ A;  3GTM H;  1B8A A;  3H0G H;  4JYA Q;  2UU9 L;  2PI2 E;  2HT1 A;  1D7Q A;  1JJG A;  3S15 H;  1V9P A;  4JI6 L;  4R1J A;  1A8V A;  3W1B A;  1S72 A;  4HIM A;  4A3E G;  1G6P A;  4BXX H;  1L2F A;  4GKJ Q;  5IP9 G;  1Q12 A;  4GLV B;  5C44 H;  1PH6 A;  5JJK A;  4GLA C;  4DR2 L;  2B63 G;  1IYJ B;  1VQL A;  4BY7 G;  1L1O B;  1HR0 L;  4Y52 H;  3EBE A;  4R4Q A;  1N36 Q;  3CCR A;  4WJ4 A;  4JI0 Q;  1VQ7 A;  2I5M X;  2Q2U A;  2B29 A;  1Q8K A;  4NXN L;  3PUY A;  3WWV A;  2IHF A;  2VL6 A;  4PZ8 A;  3CC7 A;  1XNR L;  4B3T Q;  4JI4 Q;  2F4V Q;  4YHH L;  1XMO Q;  1IBK Q;  1IBM Q;  4JI3 Q;  2JEB I;  1HNZ L;  1WJJ A;  4MTN A;  3HOX G;  2AHO B;  4DV1 L;  2HHH L;  4LF5 L;  1JE5 A;  2RF4 A;  5M5X H;  1CSP A;  2RCN A;  4DV6 L;  3CP0 A;  3SGI A;  4AYB E;  3AFP A;  4A75 A;  1K73 C;  1KIX A;  3AYH B;  4B3M Q;  4OX9 L;  4TQU S;  1PYB A;  4AYB G;  2R93 G;  3F2B A;  1SR3 A;  1X56 A;  5IYD G;  2MNA A;  1YHQ A;  1E1O A;  1YNX A;  2K5N A;  2YTY A;  3E9H A;  1PH5 A;  3U4Z A;  4DV7 L;  4DV2 L;  1X54 A;  4JI5 Q;  4A3J H;  2NVQ H;  3S1Q H;  3I2Z A;  4Y7N H;  1BKB A;  1I5F A;  4A3I G;  4A3F G;  1PH4 A;  1FJG Q;  4DR4 Q;  1YJ9 A;  2R7Z G;  2RHQ B;  1Z9F A;  5FLM H;  1CSQ A;  2Z6K A;  3AEV A;  1VQP A;  1X55 A;  4DV3 L;  4BY1 H;  1YIJ A;  1TXY A;  3UDF A;  4LF7 L;  2R6G A;  3M9B A;  3PF4 A;  1VQA A;  3PO3 G;  3EN2 A;  1YHB A;  1Q81 C;  4K0K Q;  1PHJ A;  2A8V A;  5JJI A;  1QUQ A;  3CME A;  2VUM G;  2R7F A;  3J7Z C;  1VQO A;  4IFD G;  3NEL A;  2UUC L;  4DV4 Q;  1EFW A;  1CKN B;  4HJ8 A;  1PV4 A;  1KL9 A;  5GAE C;  1I94 Q;  1RL2 A;  2BA0 A;  3BU2 A;  4DAM A;  4AQY Q;  3F8T A;  1OTC A;  1FL0 A;  3PV0 A;  3KFU A;  4XTC S;  2ES2 A;  4DR6 L;  2ZJP A;  1GKH A;  1NTG A;  3CQZ H;  2AWN A;  4BBR G;  2UUB Q;  2GVA A;  4YY3 L;  4LF8 L;  5IYC H;  3CCM A;  3I4N G;  1SFO H;  1WCM H;  1OXU A;  3KLW A;  1X9N A;  2F52 A;  1MKH A;  1EQQ A;  1QVG A;  4JI7 Q;  3CD6 A;  3CW2 C;  3RLO A;  3ZJY C;  3M4P A;  2K4K A;  3M4Q A;  4LFA Q;  3CCU A;  4A93 H;  2CKZ B;  4LF4 L;  1KHI A;  4X64 Q;  3UDI A;  4PMW A;  4IPD A;  3TRZ A;  2PQA B;  3G48 A;  4C3I H;  2KHJ A;  2JA7 G;  3GTL H;  1EQR A;  4DR1 Q;  5FLX c;  1NMF A;  3KF6 A;  3STB C;  1VQ5 A;  5C0X G;  1XMQ L;  2Y0S E;  1NE3 A;  3FHW A;  3KDF A;  4A3E H;  4A3L G;  3A5U A;  2VS1 A;  1BVS A;  5IP9 H;  4LF6 L;  1HNW Q;  2Y0S G;  2JA9 A;  1V43 A;  1WI5 A;  2C35 B;  3F2D A;  1N33 L;  1UE7 A;  2B63 H;  2I5L X;  4BY7 H;  1HZA A;  4X66 Q;  1UE5 A;  2VQE Q;  3GD7 A;  2EIF A;  3W5O A;  5IY0 A;  1X65 A;  3T1Y L;  1K8A C;  2K50 A;  3K80 C;  3RN2 A;  3TEH B;  1EOV A;  4DKA C;  1XNQ Q;  2AMC B;  4IOC A;  5HGQ A;  1HR0 W;  4DPG A;  1PYS B;  4JYA L;  4GNX C;  1W3S A;  2UXC Q;  4JI2 Q;  5JJL A;  2UXB Q;  3ICE A;  3HOX H;  1JT8 A;  5EAY A;  5ELN A;  4C3H H;  1HJP A;  3GTP H;  2K14 A;  3S1N H;  4GKJ L;  2N3S A;  5C3E H;  3S2D H;  4YWK A;  4GKK Q;  3ER0 A;  1L1O C;  5IP7 G;  4RG1 A;  1JMC A;  3RZO H;  2JA5 G;  1N36 L;  2R93 H;  5M3F G;  5JEA J;  4JI0 L;  1PVO A;  2OTJ A;  3HOZ G;  3T1H Q;  5IYD H;  4QL5 A;  4UY8 C;  1IZ6 A;  4DK6 C;  4UP8 A;  4L5T A;  4B3T L;  1AE2 A;  4KLK A;  3HKZ E;  3GTO H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...