5IP9G

Structure of rna polymerase ii-tfiif complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5ip9G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 5ip9G01
4LF5Q 1PH9A 1EOVA 4UY8C 1VQ7A 1M90C 2L15A 1K0RA 2R93H 5IP7G 4DK3C 2NZHA 1YZ6A 3S2HH 2JQOA 2CCZA 1LM0A 2YTXA 3K81C 4LFAQ 3J81c 3GTLH 1TWFH 4GN4B 3G6EA 3NENA 2EQSA 1KXLA 5GAGC 1L1OA 3HOZH 1Z9FA 2N49A 1IBMQ 3U4ZA 5IP9G 3JAMi 2ZJQA 1YBYA 1SR3A 3ULJA 4YWMA 5LMNL 4A3BH 4NXNL 5H1SE 2CKZB 3S24A 4DV7L 1VQFA 4JI0L 3M85A 1EYGA 4DR4L 2UXCL 1VCIA 4JBKA 5LMUL 3PSIA 5GAHC 4UP9A 1Q7YC 3PIOA 4LF8Q 4DUZL 5C4XH 3CCQA 1PH8A 3PUWA 2K14A 3AEVA 4LFBL 5M5WH 1HR0W 1VQPA 1Y1VG 4GLXA 2K52A 5LMNQ 1EQQA 4B3TQ 2UXBQ 4DV7Q 1NY4A 3ULPA 4DR5L 2UU9L 1E7ZA 2JA9A 4GN5A 1UE1A 4DV5L 3T1HL 3PO2H 3HOWH 2HIXA 2VZAA 2R92G 1X3EA 1XNRQ 3CP0A 3J80c 3H3VI 3KFUA 2QGQA 4YCVA 4DR1L 1LTLA 2K5VA 1R9TH 3L0OA 1S40A 2NN6G 4LF9L 4X62Q 1YHBA 1KRTA 4LF4L 1GO3E 3CD6A 4WJ3M 4HJ9A 1TXYA 4A3LH 4A3MH 2JA8G 4QJFA 3OTOQ 3I4NH 5DLQE 4DV5Q 2A8VA 2DUDA 1Q1BA 3CCJA 4BBSG 1X3FA 1HNWL 1IBKL 4B3MQ 1BBUA 1VQKA 1A62A 4OX9L 3L7ZC 4QL5A 3T1YQ 4QGUA 2A19A 2IX0A 2KENA 1M1KC 1FJGL 3F1ZA 3KJOA 2PQAB 4LF4Q 4DR3Q 4A3DH 3S14H 1RIPA 1VQDA 2PI2E 4X65L 2F3IA 3NEMA 4ME3A 3VDYA 1Y1WH 4L5RC 4A3GG 2Y0SE 3CPFA 4QIWE 2IT1A 3CW2C 1VS0A 1J5EL 2RCNA 1C0AA 2ZTEA 4LF7L 1IBLL 3FHWA 4OX9Q 4DKAC 4YWLA 4A3EH 4RG1A 3J7ZC 3TREA 4LF6L 4X66L 2LXJA 2KCMA 1ASZA 4X64L 3TEHB 5M3FG 1NMGA 1Q8KA 4P74A 4JI4Q 1N32L 4X65Q 4DV0L 2A1AA 4HJ7A 2F4VQ 3FKIG 2GVBA 3U50C 4YWKA 5IYCH 1Q82C 2EXDA 3S1QH 4KHPQ 1CSPA 1LUZA 4JI8L 1VQ9A 1XPUA 4QY7A 1WCMH 3KDFB 5EAYA 1XMQQ 3G4SA 2UUAQ 2PQAA 1G291 4LW1A 4X64Q 4YHHL 1HR0L 4B3RL 2K75A 4DUYL 1IYJB 3H3VH 1PFSA 2K5HA 1OXUA 1SRUA 1N34L 4DV3Q 1B7YB 5BR8L 2CWPA 4JI5L 1OXSC 1QVCA 4JI8Q 5JEAG 4AQYL 2Z6KC 1VQLA 4KI0A 3HOUG 4OWXB 4JOIA 1YI2A 2JA7H 1L0WA 3PV0A 3STBC 5HGQA 2OTJA 4YCUA 4APVA 1EQRA 3GTPH 1VQ5A 2UUBQ 1KRSA 3CCUA 2CFMA 4YHHQ 1K8GA 5IYBG 4PG3A 1YJ9A 4A3IG 2RHSB 3S2DH 1AE3A 5M3MG 3M4PA 1X54A 4DR7L 5JJKA 2JA5H 4IPHA 2HHHL 2WB1G 2E5LQ 4X6AH 4JI2L 4JI5Q 4POGA 2KHIA 2WP8J 2FXQA 1OXVA 1P8LA 2YTYA 3D31A 1VQAA 5E7NA 4GOPC 3KDFA 3UE0A 1YIJA 2GVAA 3E0EA 2NVTH 3CXCA 1JMCA 2KBNA 2VQEQ 1GKHA 1MIUA 5IYDH 4A3CH 3W1GA 1Q81C 1WJJA 5GQOA 3I7FA 3IRBA 3L2PA 3JAMc 2YTVA 4DV6L 3TS0A 1OXTA 4K0KQ 2IHEA 1I5FA 2JEBI 4L5SA 1JJGA 3M9BA 5JEAJ 3PUYA 3HOYH 3HOZG 4IFDG 3UDXA 3CCSA 1SN8A 4DV2Q 1YITA 2ZTCA 4A3BG 2R7ZG 3PF4A 4BY7H 4GNXC 3PUZA 1NMFA 4BY1H 3E9IA 2HT1A 4DV6Q 2C35B 4A93H 4J15A 2I5MX 1EUJA 2Q2IA 2WFWA 3H0GH 3NBHB 1MJEA 3M4OH 5C4XG 4H02A 4R4QA 3G71A 3NELA 4IO9A 1NBWA 3W5OA 3M7NA 3U4VA 4LUZA 2UUCL 4BA2I 4JI1L 5FJ8H 1XNQL 3S1MH 2IY5B 2NN6I 4GOPB 1XMOL 3CMEA 3I2ZA 2UXDL 1AE2A 2WAQG 3BJUA 1PHJA 3KF8B 1YHQA 1L2FA 4JOIC 4NXNQ 1W3SA 2BA1A 2OQ0A 2D0PA 4XIGS 4POFA 4A76A 4JI0Q 1CSQA 2OQKA 4DR4Q 4GKJL 4LFCL 2XTIA 1VQ6A 3ULLA 1QUQB 5IP7H 5LMUQ 4PMWA 4DV4L 3J7A5 1MKHA 4DR6L 1BVSA 3CC7A 4JI1Q 1UWVA 3AYHB 2Z6KA 2MQHA 4P72A 5AJ3L 1RL2A 4DUZQ 1I94L 4LFBQ 4IFDJ 3K0XA 4IJLA 1XMOQ 1NJIC 1VQ8A 1I6HH 1UE6A 1IZ6A 3B6YA 5IP9H 1JJCB 1WOCA 2ZJRA 1NE3A 4DR5Q 2UU9Q 4DV1L 1KHIA 3I4OA 4A75A 1HH2P 3CCVA 1PH2A 4GKJQ 3H15A 2Q2HA 2NZOA 4NXML 4GNXB 1YHAA 3T1HQ 4DR6Q 1VQHA 1KAWA 2QEXA 4A3DG 1SE8A 5IT9c 4GOPA 1MJCA 1I3QH 4JBWA 4GN3B 1Y1WG 3UDFA 4P71A 4BBRH 2AWNA 4GKKL 4DR1Q 4GS3A 3OW2A 3S15H 1Y1VH 4OXPA 4LF9Q 5IE8A 3RN5A 3AQQA 5GADC 1VQ4A 1FL0A 4A3EG 3CPWA 3RR5A 4HIMA 1GVPA 1QUQA 4PZ7A 1PV4A 1S72A 1JB7A 3ZJYC 1KL9A 4JI3L 3RLOA 1HNWQ 1IBKQ 2ALYB 1JE5A 4IJHA 2JA6H 2E2IH 2R92H 5J3BA 5C44H 3J81j 1X55A 3RZDH 2I0QA 5IYCG 5M5XH 5GROA 3BU2A 3CAMA 4A3JH 1FJGQ 4ALPA 2JE6I 4EQ5A 3CCMA 3CF5A 1A63A 3HKSA 5C3EH 1WCMG 4HIOA 4BXXH 1HZAA 2JA8H 2VNUD 4GNXA 5K36G 4BBSH 4O0AA 3PIPA 4HIKA 1XTDA 2KHJA 1J5EQ 2ASBA 4LF7Q 1IBLQ 4IOCA 1AH9A 1VQCA 1VQGA 1P16A 1W2BA 4HJ8A 3AFPA 1PH5A 4A3FH 4X66Q 4LF6Q 4A3KH 5FLMH 2EIFA 1QZGA 2CWAA 1HNXL 2YYZA 1N32Q 4DV0Q 4JI7L 4Y52H 2JJQA 1HJPA 1HZCA 3ERSX 3HOXG 2VQFL 4JYAL 4GLAC 1CUKA 3G48A 4DR2L 3Q8DA 2OCEA 2VS1A 1HZ9A 2K4KA 4NB3A 1B8AA 4HIDA 1K8AC 1CKOA 1EIYB 1S3OA 2OWOA 1V1QA 1PH3A 1X65A 3K7UC 1V9PA 1VQJA 2JA5G 2F52A 2AWOA 1ASYA 1C7YA 4R4OA 1HR0Q 4B3RQ 1XJVA 4LUVA 5HY6A 1KQSA 3PO3G 4DUYQ 3W1BA 3S1NH 2H5XA 1X9NA 1SFOH 3DLLA 2ES2A 3FKIH 1N34Q 3M3YH 3HOVG 2BH2A 1N36L 2VL6A 5BR8Q 3AFQA 2D0OA 4FDBA 3HKZG 4AQYQ 3M4QA 1HNZL 1VQOA 4IFDI 4HJAA 3I4MH 4AYBG 2VY3A 4R1JA 1YJWA 3K8AA 1U5KA 4RMFA 4OWWB 3UDIA 3TQYA 1VQIA 3EN2A 3OYYA 3PF5A 1PYBA 2IX1A 2B63H 4DR7Q 2AHOB 4YY3L 2HHHQ 4JI2Q 2R93G 1K83H 4B3SL 4WJ4A 1E3PA 4DAYB 1HNZQ 3A74A 1K9MC 1IXRA 4MTNA 3EBEA 4R4IA 2AKWB 3HOUH 1QVGA 2D62A 1T9HA 3PCOB 4KHZA 3F2DA 2ZM6L 1PH6A 2HQLA 5JJLA 1E24A 1FVIA 2VUMH 5IYBH 4A93G 1Z47A 3CCLA 5M3MH 3CC2A 4JV5L 4LF5L 4L5TA 4C2MH 1UE7A 2E8GA 3BZKA 2CQOA 4OO1G 1OTCA 4C3IH 5FLXc 4LFAL 2WB1E 1K73C 2OTLA 3FP9A 3I56A 4XTCS 3U58A 1E1OA 1WFQA 5C0XG 3A5ZB 2E2JH 1PH1A 1TWCH 2LXKA 2GN5A 2K5NA 1VQNA 4GLVB 3KJPA 1A8VA 1XPRA 2RF4A 2I5HA 1A0IA 5IWAL 3S17H 3PO2G 1E1TA 1Q1EA 4LUOA 3HOWG 1J6QA 1DGSA 1E22A 2MNAA 4LF8L 3K7AH 1NTGA 4TVAB 4KLKA 1VQMA 1K3RA 2UUCQ 1D8LA 1WYDA 2V1CC 1XNQQ 4B3TL 3GDEA 4O2DA 2R7ZH 2UXBL 1HZBA 1PH7A 4A3LG 3RN2A 4A3MG 1CKNB 1QZHA 3PUXA 2JEAI 4UP7A 3CCEA 5IWAQ 4MNOA 3I4NG 3RZOH 2UXDQ 1N8RC 1Q86C 3RNUA 2KCTA 3J81i 3HFZB 1IL2A 2AMCB 5ELNA 1XNRL 4LFCQ 4BBRG 4DV4Q 4OWTB 1BBWA 3KF6B 3SGIA 4DNIA 3A0JA 3WWVA 1KC8C 3UE1A 3F8TA 3A5UA 2Y0SG 5AJ3Q 1EIFA 4X62L 1I94Q 1OXXK 1I50H 1YEZA 4A4IA 2YV5A 1UEBA 3F2BA 2PNHA 3OTOL 1CKMA 5C0XJ 3I55A 3TRZA 1GD7A 2JA6G 3GTKH 4B3ML 3MEFA 4DV1Q 5C44G 4YCWA 4R4CA 2WAQE 2K50A 1KIXA 4JBJA 4NXMQ 1SLJA 4A3JG 3T1YL 1TWGH 3GO5A 3PGZA 3RLFA 1EFWA 4AIMA 1N9WA 2BA0A 4DK6C 3CQZH 5C3EG 4IPGA 4DR3L 3TS2A 1CKNA 1EWIA 4BXXG 1SMXA 3CCRA 1TWHH 1KD1C 4GKKQ 1C9OA 3GTJH 1QVFA 2ZTDA 3GTGH 1Q12A 4MZ9A 1FGUA 1SROA 4C3JH 4NPSA 1XPOA 1WI5A 4LWCA 5GAEC 3KF6A 2HIVA 4A3FG 4A3KG 2NVXH 4JI3Q 4C3HH 3EIVA 5FLMG 3J80i 1YNXA 1GM5A 3GTQH 1PH4A 1YVCA 4TQUS 1X56A 4JI4L 4JI6L 2F4VL 4JBMA 2UXCQ 3LGJA 3STBD 4P73A 2PI2A 1BKBA 4L5QA 4KHPL 2ID0A 5ELOA 1PVOA 2IHFA 3JC66 2RHQB 4DAMA 2JA7G 3F2CA 4UPAA 4A3GH 1L1OC 2E2HH 1PA6A 4UP8A 1U0LA 1XMQL 2UUAL 1B70B 2XGTA 4PZ6A 4JI6Q 3S1RH 1N33L 2MFIA 2B29A 2R6GA 2JK8A 3D0FA 3RLNA 3E9HA 4DV3L 2Q2TA 3S16H 1D7QA 1IBML 1HNXQ 5LMNW 5JJIA 3I4MG 5M3FH 4JI7Q 1X3GA 1VQBA 4JCVE 2VQFQ 4JYAQ 4PZ8A 1V43A 4JC0A 4IPCA 1O7IA 4HJ5A 4DR2Q 4IPDA 3PUVA 2UUBL 2ATWA 1N33Q 2B3GA 4AH6A 2B63G 5IYDG 3UDGA 4A3CG 2E5LL 4DPGA 1UE5A 1Q46A 4OONA 3K80C 5IY0A 4OO1I 2YU9H 1YJNA 1JJ2A 3CC4A 3MXNB 3HOXH 1N36Q 1G6PA 3HOYG 4R4TA 3KLWA 2VUMG 1X6OA 2Q2UA 4EX5A 2NVQH 2VQEL 2PMZE 4JG2A 4BY7G 2BH8A 4BA1I 5C0XI 3CMAA 3GTOH 4BY1G 3GD7A 4QQBX 1L1OB 2LSSA 1PYSB 4LNQA 3PO3H 4Y7NH 2N3SA 4A3IH 2MO1A 3GTMH 4IOAA 3H0GG 4K0KL 4YY3Q 3BZCA 5C4JH 2R7DA 3HOVH 4P75A 4B3SQ 1Y14B 1H95A 2QA4A 3ICEA 5M5YH 2R7FA 2N78A 2NVYH 2I5LX 3KYHC 4DV2L 2ZJPA 5FJ8G 3HKZE 1G51A 1VQEA 3DM3A 2ZM6Q 3KOJA 1TWAH 2N8NA 3ER0A 4AYBE 1LYLA 1JT8A 2MO0A 2VW9A 2Z0SA 2DGYA 4JV5Q
chains in the Genus database with same CATH superfamily
1C3OA 5EZYF 5FLXW 2L15A 5IP7G 2JQOA 2CCZA 3MHBA 2YTXA 3K81C 5ISRA 5D1PA 4JV1A 4Q0FA 3OWEB 3HOZH 4HCSA 3OMGA 3JAMi 1K3BC 3KHHA 1SR3A 3ULJA 2PZTA 1JKJB 5FPOA 5DGAA 4A3BH 4A2BA 1STHA 1QE6A 1TR5A 2CKZB 4DV7L 1WR2A 3M85A 3OIPA 1HNWH 4QW9A 2YCHA 1B3AA 3PIOA 3Q24A 3H0GA 1EY4A 4WBNF 2W9BA 5C4XH 1PH8A 3PUWA 4MV8A 1WTRA 3PZPA 4J9NA 3V6KA 1EEFD 1Y1VG 2K52A 1G2TA 5LMNQ 3J7AV 2AGQA 3H3VC 3ULPA 4DR5L 4UAIA 1E7ZA 2JA9A 1CZWA 5A2QE 5ELDA 4DV5L 4HMJA 1WVLA 5DLGA 3HOWH 2B2TA 1IBLH 2VQDA 4GZYC 1XNRQ 4QIWB 1PMRA 1PTOH 3KFUA 4YCVA 2F0LA 4DR1L 4MN3A 1ESFA 4C3JG 4MV7A 2NN6G 3CD6A 1AW7A 2V4DA 2E2IB 2Z9HA 1CS0A 4A3LH 4A3MH 3OTOQ 1FNWA 4DV3H 1S97A 2DY8A 5DLQE 2DUDA 1Q1BA 1X3FA 4ED8A 4TQRA 1ZEQX 3GV6A 4ED7A 4OX9L 2QILA 4R7RA 4QL5A 2DJFC 2WTFA 4LF4Q 2K7VA 3FMCA 4DR3Q 4EQPA 2PI2E 5A2QL 4X65L 1I3QA 2F3IA 3NEMA 1N34H 4L5RC 4F50A 5FLXL 5CBAE 4A3FB 4JI5H 2RDHA 1SNQA 3CW2C 3L9AX 5EKIA 1J5EL 2R7MA 3RB6A 4ED2A 1SYGA 2E2DC 2Y0SA 4DKAC 1UC8A 3Q8QB 4A3EH 3PR5B 3BQ2A 4LF6L 3FVQA 2JA6A 2BQUA 1N32L 4DV0L 5EDWA 5TSSA 3FKIG 3U50C 2ICIA 1EWHA 4C1NK 2EXDA 3I73A 2R85A 3EFXD 2M9VA 3BDOA 4CJ2C 4HTHA 1XPUA 2EYOA 5JUMA 5KFPA 1RCVD 3FKIB 5EKKA 1XMQQ 1LT5D 1RODA 1G291 4LW1A 5CMDA 3R5HA 4DXGA 4YHHL 4MA5A 3D6WA 4DUYL 3V2TA 1SXTA 1PFSA 4UCSA 1SRUA 2WYOA 1DIKA 3D3RA 4RNMA 1KTKA 5BR8L 2CWPA 3X3NA 1OXSC 1QVCA 4JI8Q 4EBDA 2Z6KC 3RGXA 4KJOA 1DYQA 1EWCA 3HOUG 3L4JA 5HGQA 1ZYRD 2QEJC 3KUPA 2QCPX 1RYRA 1EY9A 2CFMA 4O3QA 4PG3A 4CJ1B 1YJ9A 2RHSB 1AE3A 5M3MG 3M4PA 4ECVA 1CQJB 2A5HA 3T53B 4DR7L 5JJKA 1U4MA 2JA5H 1RJPA 4IPHA 2HHHL 1JDBB 1JLLB 4X6AH 4JI2L 4C5BA 2KHIA 4RGMA 5LYJF 2N55A 5CV6A 5E7NA 5M3MB 3GV8B 2QKIC 2LMCB 1RD9D 2EYPA 3CXCA 1O80A 4CGYB 2VQEQ 5IYDH 1CQFA 4A3CH 4TUYF 3L3OC 1Q81C 1KJJA 5GQOA 1XMOH 4F7XA 2B2UA 2F0FA 3SVMA 2WE6A 3HP3A 3TS0A 1OXTA 1KNEA 2IHEA 2W8KA 4J8QA 3HOYH 3QZ8A 1EZ6A 1PZKD 5BN3A 4DR6H 3V4SA 1J9OA 1PXUA 3SK8A 5LL6X 3K57A 3N44B 1YITA 2W9CA 4BY7H 3ERQA 4GNXC 1EZ1A 1NMFA 1ZQ7A 4BY1H 3E9IA 3KBGA 4DV6Q 3RTXA 4J15A 2I5MX 3QIAA 3NBHB 2KEDA 3J81W 3M7NA 3R2TA 3J7AK 4JI1L 1BCPB 2NN6I 3T5LA 2EVBA 1EHIA 3I2ZA 3WO0A 5FO7B 2W70A 3R5XA 2R8KA 1AE2A 1PHJA 3KF8B 5D1OB 1L2FA 4NXNQ 1W3SA 5LP6F 5C0XH 4POFA 2PN1A 4A76A 4JI0Q 1I50B 1B2TA 1JT8A 1I4RA 1NUCA 4JPBW 1RTOA 1AFPA 4JI3H 5IP7H 4ME6A 4RZRA 3A7LA 4WD3A 4LH6A 1B6RA 2Z6KA 4IRDA 4X3TA 4LFBQ 4IFDJ 5KT6A 1I6HH 3K0XA 1NJIC 1VQ8A 3TQTA 3VYUA 1IZ6A 2A6HD 2L0CA 3QFFA 1PRTF 5HV6A 2Z1CA 1H9MA 4DV1L 1KHIA 1PH2A 1LACA 3MJFA 1BXRA 2LFNA 3BA8A 1KAWA 4E4TA 4ECWA 1SE8A 3J81E 1MJCA 4JBWA 3HBLA 1Y1WG 5KG5A 4P71A 2AWNA 4GKKL 1G8ZD 1Y1VH 3DWAA 4B3RH 1CA6A 2FMAA 2VQFH 4RNNA 4J1MA 3CPWA 1JB7A 2MCTA 1QUQA 1HNWQ 3GQCA 3RLOA 1S10A 2ALYB 4AQYH 2OXPA 1DOKA 1ESRA 1T36A 5KFOA 2E2IH 4K2KA 2IW3A 1X55A 2RKSA 3RZDH 2I0QA 5GROA 2XVSA 1HA6A 4A3GB 2E74C 3CAMA 2E2HB 1FJGQ 1EQTA 4ALPA 2JE6I 2PW5A 2MPMA 4EQ5A 1RJQA 3J7AF 3RIZA 3OUUA 1WCMG 4HIOA 1HZAA 2VNUD 2F4IA 4GNXA 2DY7A 3PIPA 3S9WA 3J81L 3S16B 2FMCA 1IBLQ 3NHHA 3VYSA 1VQGA 1P16A 3BVMA 4A3FH 4F4ZA 2KUMA 2OEOA 2CWAA 4MIUA 1S5FD 2Z4HA 1GXDC 2SNSA 4RAZA 4F8MA 1CUKA 1F9RA 4J9QA 4DR2L 3Q6SA 2K4KA 4HIDA 4G7ZC 1Z2OX 4R9WA 2YU9B 4O4HF 1PH3A 1B50A 3Q8PB 3KXYT 2F52A 1T5XD 1E2WA 4G7OC 1HRJA 1K83B 1RTNA 3C46A 1SFOH 2D5DA 3DLLA 2ES2A 3FKIH 1N34Q 3NTHA 2BH2A 1RKNA 1O75A 4FP5D 2X69A 5FPRA 1JB3A 3HKZG 1LTGD 1EY8A 4Y7NB 4R1JA 1YJWA 4XDXA 3BQ0A 4RMFA 4FS1A 3TQYA 3RBEA 3OYYA 3PF5A 4L1KA 3WDNA 3UI2A 2XD4A 4ZAIA 4ZI7F 2AHOB 4FXDA 4YY3L 5JOBA 1W6KA 4B3SL 4WJ4A 1HNZQ 3A74A 2R84A 1DCZA 4CDFC 3HOUH 2RCFA 2DLNA 3K5LA 3F2DA 2ZM6L 5JJLA 2HQLA 4O42A 4O3NA 4LFCH 2PQEA 1FVIA 1NR2A 2BOSA 5LL6S 1LT3D 2NZ1D 4R8IA 3CCLA 2B2YA 1ZYRC 2DJGC 5M3MH 3MAQA 4B3TH 3JAMW 2UXBH 1KJ9A 1BO0A 3VR3A 2OLSA 1HFGA 2IX3A 1OTCA 5I6YA 3FPPA 2R8GA 5CYUA 1D5MC 4ZRZA 2WB1E 1B1ZA 1R4PB 3C2PA 4QUCA 4RU9A 2FLLA 4YBZB 3RZOB 3WOEA 2HDLA 2IL8A 3EA6A 4CDEC 4X62H 1WFQA 4ZQ3A 3TP8A 3VR5A 2LXKA 4DAYA 4GLVB 4TRDA 4U68A 1A8VA 2B8GA 3KJPA 4UCOA 5IWAL 2I5HA 1A0IA 1EFID 5M5WB 4ODGA 1GUOA 1Q1EA 2C9OA 5LXTF 4B3MH 3ORRA 4U7CA 2GLTA 3VPDA 4B08A 1TWCA 3CVZA 3GTLA 3KALA 1WYDA 5BN5A 2R61A 4J9PA 3PR4A 1HZBA 3CCEA 2F0WA 3QG1A 5JAVA 3JAME 1R9TB 5C8YF 4F4YA 2AMCB 2BDOA 4BBRG 1SNCA 1BBWA 2MUYA 3WWVA 5KFXA 2Y0SG 2V9WA 1I50H 1ILPA 1YEZA 2PO4A 5DAUA 4A4IA 2HDMA 4RZQA 3PW7A 4KHPH 1HFNA 3RB0A 2JA6G 3EJIA 4A3DB 4QWBA 2WAQE 3OUZA 1STNA 2UUAH 2PZWA 3RLFA 3TIGA 1KBLA 2L4NA 5C3EG 5CB4F 1EWIA 1SMXA 1IL8A 3BDCA 3JAML 3CCRA 1WSCA 2NU7B 1I6UA 4LSXA 1QVFA 1Q12A 1SROA 2W6NA 4NPSA 2L11A 4FNFA 2NWGA 2RSOA 2A6HC 3RD4A 2CZGA 4A3KG 4JI3Q 5DQHA 5FLMG 1YNXA 3A8JE 1YVCA 1D6EC 4KY5A 1X56A 2HJWA 4DL4A 5KG2A 5E4WC 4J9RA 4TSSA 2F4VL 4OIKA 4ECUA 2F0VA 3STBD 2YZNA 4FF1A 5ELOA 3O13A 3JC66 2RHQB 4DAMA 2JA7G 2G9DA 4A3GH 2E2HH 5KFAA 1K28A 2WIIB 1B70B 2XGTA 4RCNA 4JI6Q 1U9RA 2HQEA 2JA7B 1JR0D 3E9HA 4DV3L 3S16H 4APMA 4K0KH 1WTOA 2VQFQ 2VB3X 3P1HA 2BE5D 4IPCA 2AQ4A 3V6JA 2UVVA 5E3FA 2I8CA 1N33Q 4DN4M 4DV2H 2YZMA 4CBVA 1AUVA 5BMVF 2RGRA 1UAPA 2RVLA 2XRSD 2JEIA 2F1MA 3G6YA 4BWSC 2NVTB 2YU9H 2XN9C 4AYBB 2DPJA 1MI2A 1G6PA 5L1LA 1GSAA 1ZHSA 2Q2UA 3MR6A 1DXMA 2PMZE 3ETHA 3G6JB 3QZ7A 4JUZA 3CMAA 1KDAA 4C3IG 3GD7A 1PYSB 4Y7NH 5FO8B 5LMNH 1RHPA 4IOAA 2DIKA 2F0KA 2R7DA 4EQOA 2UVWA 4DR4H 5LMUH 2QA4A 3SE7A 4FXKC 3QJYA 5CV4A 1QNUA 5KFYA 2EY6A 2YYAA 1F9QA 2PPBC 2BDNA 3K59A 4EYHB 2EY5A 4X3UA 2SEBD 1IBML 1C8CA 2F0GA 3PN1A 1PTOF 1PH9A 4UY8C 5IGDA 1M6VA 1K8MA 3T1HH 4FBUA 1RJTA 1JWSD 4YJ3F 2DWCA 2R93A 5KG1A 4IFDH 1GUSA 1SNPA 4JVZA 5IGCA 5BPFA 1L0XB 4LF4H 4YWMA 3TSSA 5H1SE 4MV3A 1B33N 2MJ8A 2UXCL 5KFBA 4E6IA 1I7LA 1F2ZA 1HQRD 1ML0D 3FRPB 2BCOA 3PSIA 4RB3C 5EKLA 3I70A 4FF2A 1E4EA 2PCFB 4DUZL 4O1NA 2KQ3A 3KBXA 4A3MB 5M5WH 1HR0W 4HAEA 2R87A 2C28A 5EPJA 3LMLA 4B3TQ 2UXBQ 2W57A 4DV7Q 4RFBA 2UU9L 4IZOA 5KT2A 5DQIA 3S15B 4LF7H 3EPGA 2R92G 4LJZC 4FXGC 1JX4A 3H3VI 4X66H 1S4ZA 3ETJA 1LTLA 1KJQA 1R9TH 4DL6A 5I6WA 4LF9L 4X62Q 1YHBA 3E5SA 2ASJA 2R92B 1TXYA 5C44B 5CV5A 2F0PA 4C3HG 4DV5Q 1KLUD 4A3JB 4J9OA 1IBKL 4B3MQ 4JI8H 1BBUA 2MP1A 4KN7C 3M4IA 1A62A 4QWDA 3L7ZC 2WDTA 2A19A 2IX0A 2XCLA 5K2MA 3KJOA 4A3DH 4ZK9B 1VQDA 4DU9A 1UNNC 4O2BF 1SYFA 4QIWE 2IMWP 1JCKB 4LH7A 1BNZA 2KCNA 1WTVA 2ZTEA 1C0AA 4OX9Q 5KG6A 3J7ZC 3KLSX 1B6SA 3VR4A 1GHKA 5KFMA 4YR0A 1SYEA 2VOBA 4X64L 3TEHB 5M3FG 4P74A 1Q8KA 3VR6A 3KHGA 4X65Q 4PDBA 4ZUIA 5FD6A 4X3KA 2V59A 4MTKA 3TINA 4QWEA 3S1QH 4KHPQ 1CSPA 2ZXOA 1DONA 1LO5D 4IAJA 4QW8A 2XIWA 4GC6A 2L12A 3CHBD 2UUAQ 4EBEA 2PQAA 2BQRA 2OH2A 1ZHQA 1HR0L 4B3RL 1L0YB 3TQ1A 2K75A 2UVUA 2DNEA 3I4MB 2FPPB 3H3VH 2K5HA 3K5HA 4Q0YA 4DV6H 3MFHA 5JEAG 4AQYL 1IYVA 2B2TC 4KI0A 4JOIA 5C3XA 1YI2A 2JA7H 5EBCA 2EYJA 3STBC 3NE5B 2OTJA 1EYZA 4YCUA 5KFUA 4ID6A 2UUBQ 4YHHQ 1K8GA 3PW4A 3N42B 3HXLA 1E2ZA 3GIIA 5IIFA 3GIJA 3DMUA 4XXEA 1SBBB 4FS2A 1DZ1A 2VUMB 5IOCA 1P8LA 2YTYA 4GOPC 4EVOA 4NXNH 3KDFA 1HHVA 4K14A 4C2MB 4YAKB 1M7JA 2L9HA 2NVTH 4BY1B 5KFIA 2RA4A 1FR3A 3MEHA 1MIUA 4DL5A 2DN8A 2BE5C 2W8LA 3BA9A 3IRBA 5I2YA 5EWGA 2UXDH 3D4DA 3EVQA 4K0KQ 2B63A 1WTWA 3EQLC 1QG7A 1JJGA 3M9BA 4K2LA 4DAPA 3PUYA 4I4TF 4DV4H 3I90A 3GV5B 2VUGA 2EXZA 1SN8A 2WACA 4DV2Q 1JDEA 4TV9F 5CBEE 3I91A 2R7ZG 1I94H 2LY7A 1C4QA 1II3A 4RGOS 4YJ2F 5T1IA 3X3MA 2XSCA 3IFTA 1S0MA 4YQWA 3SHLA 2WFWA 3M4OH 3MWEA 2R7ZB 4H02A 1GUNA 3R3OA 4R4QA 1I6HB 4NXMH 3G71A 1NBWA 4PNYA 3IAYA 2UUCL 4BA2I 1XNQL 1ENFA 1CQVA 3U9TA 2JEJA 1EZ8A 2PYKA 2QDBA 3JZIA 1FJGH 4CHTB 4N8FA 2WINB 4K6DA 1JOKA 4N9PA 5I4DA 3P75A 1VF5C 1CTMA 1S5BD 2K04A 5A35A 4DR4Q 1AEXA 4GKJL 4LFCL 2XTIA 4DNRB 1VQ6A 3J7A5 5I47A 5LMUQ 4PMWA 1NAPA 4I7AA 1Y1VB 4JI1Q 3AYHB 5CGKA 4P72A 4M9UA 5AJ3L 1RL2A 1H95A 3C3LA 4XYQA 2NU6B 1UE6A 3B6YA 5COYA 4L8JA 3K5NA 4G3IA 1ICWA 1TWGB 4RB0A 1WOCA 2ZJRA 1NE3A 2VB2X 3RAQA 3CQZB 2ASDA 5T14A 4A75A 1HH2P 1B3QA 3RZDB 2Q2HA 1B4OA 1TWHB 1PK8A 4DK1A 3A8IE 3T1HQ 2B2VC 1H9KA 2QEXA 2Z6BA 5ELFA 4C3JB 1H9RA 3G7LA 4GOPA 4IURA 3GIKA 1KDCA 4GN3B 2B2UC 3S15H 2VA2A 5JVLA 3GTQB 4OXPA 1KLGD 5GADC 2DPIA 3WOFA 1FL0A 4PZ7A 3MXUA 1S72A 2ZJTA 3ZJYC 1KL9A 3GTKA 5HBRB 2SOBA 2R92H 4XT1B 5J3BA 5C44H 5IYCG 4A3JH 2ZDQA 2A6ED 1LTTD 3C1FA 2QF7A 3CF5A 3CCMA 3H4BA 1A63A 3HKSA 4ME5A 1LTID 4H0LC 5KG0A 2Z4IA 4HNVA 1F77A 4MTDA 2R7NA 4O0AA 3GTJA 1CFMA 4TKOB 1Y8OB 3HZXA 2W6ZA 5KX5F 1HNZH 4LF7Q 3GTGA 1KDBA 2F0DA 2E75C 1EY5A 1SFOB 3H4DA 1SSOA 4HJ8A 3TIIA 4ECXA 3MC0B 2NVXA 1BUVT 4X66Q 3SI8A 5ELEA 1WTPA 2K28A 2RDJA 1HNXL 2RQXA 2YYZA 4JI7L 2JJQA 4UCVA 1ZXTA 4GLAC 2VPSA 3Q8DA 2OCEA 4OEMB 2OWOA 1K8AC 3CRKC 2Q8IB 4OHJA 1ET6A 3H91A 4CC6A 3K7UC 1VQJA 4KMUC 3K3PA 4KJNA 4LSAA 1CT1D 4MA0A 4ZLTF 1TVXA 1XJVA 3PO3G 4KD4A 4MTEA 4JV5H 4LF5H 3K5OA 2WV6D 3HOUB 4QMGA 4Q44A 1N36L 3BYYB 2VL6A 3ND8A 2D0OA 4RKLA 2O2LD 1S5DD 4RHRA 3LWBA 3M4QA 4LFAH 2O4XA 1QNKA 3PO3B 1KEEA 3I4MH 1SEBD 5C4JB 1U5KA 3AB9A 4OWWB 3F8NA 1VQIA 1YNJD 3EN2A 2B2VA 3RUZA 1B44D 3AU7A 4M8AA 3E3XA 3CU7A 1TS5A 2SNMA 2R93G 3OSNA 1E3PA 2PZUA 5CA0F 5CORA 1A15A 5JEAH 1IXRA 4MTNA 2A68D 1Y8PB 3EBEA 3RMHA 2F0QA 3BJYA 4LF8H 1CK1A 1V1PB 5DG9A 1PH6A 4ZUJA 4NLGA 1BCPF 2VUMH 4A93G 1Z47A 2C2RA 2FHTA 3CC2A 4L5TA 1TWFB 1FNVA 4ED1A 3JSLA 4C2MH 2E8GA 3QOLA 2CQOA 2F03A 5I2XA 4OO1G 4N9TA 1JXLA 2EYHA 2CVRA 2XCPA 4QUFA 3GTMA 1K73C 1WTHA 1AN7A 4IWYA 2P0AA 4R8UA 2WB1A 2JSOA 1NSNS 3PQIA 5IGEA 1T3NA 2NVYA 1E1OA 4XZ3B 2C2DA 4K8IA 1F9PA 2E2JH 1PH1A 1TWCH 2JXMB 2GN5A 1TWAA 4C5CA 5KNDA 2RF4A 1PZJD 2DNCA 2AU0A 1E1TA 2X6LA 3RAXA 1E22A 4BS9A 2KEEA 2ZXPA 3VPBA 2J4XA 1NTGA 1RDPD 3T1YH 2KOLA 3LX0A 1IW7D 4TVAB 1IHZA 1I4PA 1D8LA 1QCBD 2R7ZH 5G3LF 5KFLA 2JEAI 4UP7A 1SMYD 5IWAQ 3I4NG 2UXDQ 5T1GA 1Q86C 1S68A 4ZCKA 5KT7A 3RNUA 2KCTA 2GA4B 3HFZB 1IL2A 4EFEA 2FPGB 1V51A 3HS0C 2NU9B 1XNRL 5D65A 3A55A 3GQBA 4DV4Q 3DM1A 3SGIA 4DNIA 3A0JA 2EOTA 3NWTA 1TY2A 1VMCA 3A5UA 3LWEA 4JI4H 4JI6H 1ONLA 2F0NA 1OXXK 3T56B 1I94Q 1Y8NB 2PNHA 3OTOL 1CKMA 5KFQA 1HTLD 1U4LA 2CQYA 4YCWA 4R4CA 1KJIA 2K50A 3I72A 4NXMQ 1D5XC 1Y1WB 1TWGH 3GO5A 1X3QA 5E4XA 3ZYYX 2WAQA 1H9SA 1N33H 2B2YC 1SYCA 4DK6C 3NWSA 3CQZH 4DR3L 1UEAB 1CKNA 3TS2A 2K01A 4BXXG 1TWHH 1S5ED 1I4HA 3M7GA 1WH2A 4MZ9A 3PIO3 1EY0A 1FGUA 3V05A 4C3JH 4U673 2NN6H 5J2TF 1WI5A 2JN4A 4LWCA 5GAEC 4RUAA 1QWYA 3KF6A 1QILA 4U6PA 1GM5A 3GTQH 1PH4A 5DLFA 4TQUS 1JOOA 2XRQD 3LWUA 2XWBB 1C30A 4K5WA 1T94A 3VMMA 5KFFA 1EUCB 2WKDA 3JSNA 4DL7A 4JBMA 1WCMB 1CI3M 4ZKCB 1D1KA 2FMMA 2ID0A 1PX2A 3F2CA 2IA6A 1L1OC 1PA6A 3NXWA 1XMQL 4ECSA 1KAAA 1LT4D 4ZQIA 5KNBA 2L55A 3EYYA 4PWQA 3OWFA 4F88A 5JH7F 3RLNA 3AMUA 3GTPB 1RJRA 1SJED 1U4PA 2I87A 4IR9A 4EEQA 1X3GA 4JYAQ 4O2AF 3KHRA 1LTRD 1EYAA 1O7IA 2A6EC 2W6PA 3PUVA 2B3GA 2Q8TA 4AH6A 2B63G 3UDGA 2QW7A 2QYZA 3RFCA 2C2EA 1A3TA 1FYCA 5KYLA 1Q46A 4OONA 4OO1I 3HKZB 3CC4A 3MXNB 4MV9A 1TT2A 4KY7A 5F2DA 4HR7A 1WTQA 1D2BA 4EX5A 5CAEB 2VQEL 4FF3A 3BG5A 4JG2A 5FO9B 1F9SA 4IUUA 3MFYA 3HG9A 1WD0A 1QOHA 4HEDA 2PMZA 4QQBX 1MZBA 3QO2A 4LNQA 3PO3H 2N3SA 1GSHA 3H0GG 4DV7H 5J22A 3N41B 3BZCA 2JA5A 4KK7A 5C4JH 3UFXB 1PRTD 3GTOA 2NUAB 2N78A 3MXPA 2I5LX 4C1NI 2IPKD 3Q22A 5FJ8G 1ULZA 4YAJB 1VQEA 3H0GB 3DM3A 3I8ZA 4YB8B 2W9BB 1BXTA 2N8NA 4AYBE 3E5NA 1GOZA 4I7HA 2VW9A 2Z0SA 4JV5Q 4LF5Q 4ZHQF 3VA5A 1ENCA 4DR5H 1VMPA 2AUJD 4P2CB 1VQ7A 3S1MB 1W6JA 4O3OA 4H7BA 1YNJC 2R93H 4DK3C 4DV5H 4LAAA 1AZQA 4LFAQ 4K5XA 1TWFH 4GN4B 3G6EA 4KV6A 1ILQA 5GAGC 2W71A 3SXHA 1RF2D 1L1OA 4DR1H 1JQYD 1JWMD 1SNDA 1Z9FA 2A68C 2N49A 3R2IA 2XWJB 1YBYA 4OL7A 5IP9G 2ZJQA 2XNAC 5KG4A 4QWCA 2IWHA 4Q8EA 4NXNL 1BR9A 3S24A 1VQFA 2Q8RE 4JI0L 1Z2PX 5KFSA 4OO1H 4JBKA 5GAHC 2EPBA 4QB4A 4LF8Q 4OX9H 3MFIA 4LFBL 3CCQA 3AEVA 3DEOA 2FJ2A 4GLXA 1EQQA 4UDUC 1NY4A 1ZKOA 4X65H 4UCUA 5KG3A 4ED3A 1I3QB 4GN5A 4CKBA 5EPKA 4BBRB 4DK0A 5KIXA 1J5EH 2W6QA 3U9SA 4QF4A 2HIXA 2VZAA 4CDCC 2Y0SB 3H40A 1SE3A 4LF6H 3CP0A 1SDFA 3J80c 2F0HA 1S9FA 4DAVA 1S40A 3L0OA 4TV8F 1N32H 2FJZA 4DV0H 2JA6B 1GO3E 4HJ9A 1ICFB 1IW7C 5M5XB 3I4NH 2A8VA 4BBSG 1HNWL 2R3ZA 3CCJA 4PQXA 1IYUA 1V1OA 1GHJA 1SMYC 5C3EB 3T1YQ 1I4GA 4QGUA 2KENA 1M1KC 2UUBH 4BBSB 1FJGL 3F1ZA 3SDZA 1SE4A 2ICEC 3S1QB 1BBXC 4YHHH 2AQ2B 4DUYH 4UCRA 2YW2A 1RIPA 4IUNA 4ME3A 3VDYA 1Y1WH 1RYSA 3CPFA 4YR2A 1XYIA 4A3KB 2IT1A 1A3UA 1PLFA 1IBLL 1SE2A 4QIWA 4YWLA 5ELBA 3TREA 2LXJA 1TU2B 1ASZA 4N8X1 3P20A 1TAEA 3N52A 3TMEA 4JI4Q 2G5DA 2R7KA 2E2IA 2A1AA 4HJ7A 2V4RA 2HHHH 1GJXA 4JI2H 2FP4B 2AGPA 1I4XA 1VQ9A 4QY7A 3K6OA 4EGVA 1WCMH 2O03A 2IP4A 4ILWA 4IHJF 5EAYA 4Q43A 1FNUA 1V4YA 4X64Q 1LTSD 4C56C 4NP5A 5KFWA 1STBA 1IYJB 1S03G 3KTMA 1N34L 1LT6D 1B7YB 4JI5L 2EZVA 3V6HA 2NBFA 2FPIB 4OWXB 4DA2A 5JVH3 4ULLA 3GTPH 1EQRA 1KRSA 4DGZA 1VF7A 4RGNA 5FKAC 3M9MB 4A3IG 3RV3A 2W9CB 3PIP3 2WB1G 2E5LQ 2O5JC 5L1IA 4WJWA 2FXQA 1M8AA 3D31A 1TQOA 1VQAA 1HTPA 4V190 3UE0A 3FKIA 1YIJA 2R86A 1MSGA 2FLNA 3I3CA 1JMCA 5DM73 2KBNA 4XYOA 4C3IB 2R8JA 4I7ZC 1GKHA 3RB4A 4JI1H 2QK4A 1WJJA 3M4OB 1SAPA 3KLSA 2W6MA 2R8HA 3V96A 3L2PA 3R23A 1F2LA 5LL6b 5DM63 2JEBI 4L5SA 4NDXA 4EBCA 4HCEA 5JEAJ 3HOZG 5AFWA 3UDXA 3T4AC 3S17B 1W96A 1STEA 2ZTCA 3OPOA 4A3BG 2RBMA 3C1EA 4JK1C 3PF4A 3PUZA 3K7AB 1K0SA 5JQWA 2HT1A 4O3RA 2B39A 1EUJA 4DV1H 3H0GH 1E0BA 3BDLA 1MJEA 5C4XG 2R8IA 2F0EA 5H80A 3NELA 2ZDGA 3W5OA 4DNTB 4K6LA 5FJ8H 1PRTC 3S1MH 2IY5B 4F4WA 1XMOL 3CMEA 4GKKH 2WAQG 1YHQA 4JOIC 3TP7A 1SYBA 3NSWA 4IQZA 4IWXA 5FOBB 2NB0A 4XIGS 1CSQA 1O7ZA 3ULLA 1QUQB 3D8GA 1DOLA 1CM9A 1NR4A 4FVMA 4DR6L 2PBZA 3DWPA 1IKMA 1UWVA 4CJ0B 3T51B 2SCUB 2JEGA 3PMFA 4IRCA 1STGA 2YS6A 1D1IA 5IP9H 1JJCB 3PW2A 3NBHA 4DR5Q 4J9KA 1STAA 4GKJQ 2K03A 2NZOA 4NW2A 3JRWA 4GNXB 5C5LA 1VQHA 1PZID 3MFGA 5KT4A 5IT9c 1Q3LA 1I3QH 2FINB 1EU4A 5KT5A 1MBYA 5C4ZA 3A56A 2NTSA 4BBRH 4DR1Q 4GS3A 4C3HB 3KF8A 1CE8A 5D1OA 1LV9A 1E2VA 4ETSA 3E0JA 5KEEA 3AQQA 2PW7A 1VQ4A 1I50A 2J6TA 4MAMA 4A3EG 5E1FA 3RR5A 1GVPA 5JVG3 4WRDA 1PV4A 3GIDA 3M9NB 4DR2H 4JI3L 1SCUB 1JE5A 4IJHA 2JA6H 3MXGA 5KG7A 1E4FT 2KJXA 3D4RA 1D5ZC 4I50F 2M05A 3J81j 5C5JA 5M5XH 4LMYA 3BU2A 2ENBA 2H1EA 4IR1A 3VA7A 1JC7A 3GIPA 4G4KA 1DV2A 5C3EH 3KAJA 4I55F 2XIGA 5DGBA 1H9JA 4BBSH 3K5IA 5J2UF 3IN5A 4HIKA 1XTDA 1J5EQ 2KSWA 3D4WA 3L4KA 2K05A 4IOCA 1VQCA 5M3FB 2A69D 1W2BA 1HCZA 1PH5A 4LF6Q 4A3KH 5FLMH 1AZPA 2EIFA 1B9NA 2FKLA 1DJRD 1N32Q 4DV0Q 5DNFA 3JRXA 1HJPA 4YY3H 3ERSX 2VQFL 3HOXG 3OHBA 3G48A 4B3SH 1PTOD 1VKZA 1HZ9A 4NB3A 4Q5VA 1B8AA 1EIYB 1V1QA 5KT3A 1F2YA 1X65A 1EY7A 1V9PA 2K5WA 2JA5G 2ZM6H 2E2HA 3HOXB 1C7YA 1UUPA 3BZDB 2H4OA 1KQSA 4ECYA 4DUYQ 3OIQA 3W1BA 2H5XA 3TP6A 4RUCA 1TS3A 1C48A 3HOVG 1X32A 5BR8Q 4EFBA 3BVGA 3MR3A 2KCCA 3HGBA 4WFN3 4HJAA 3FEWX 4V0BA 4DFAA 2BR0A 3I4LA 4HN7A 1EQVA 3NQIA 3HOVB 1IKLA 4O3SA 1PYBA 5KNCA 4DR7Q 2A74C 2HHHQ 4JI2Q 1GGOA 5IWAH 4DAYB 1K9MC 2YU9A 5BN4A 3DHQA 4YP3A 2D62A 1T9HA 3PCOB 5M9OA 4KHZA 2E2JB 4ECZA 2J6UA 1TWCB 4S3SA 1K83A 5HGTA 3S2HB 2I46A 2KA7A 4HQ6A 3HEJA 3GTLB 4ZOLF 1SNMA 1I4QA 2CW0D 3RJ0A 5DG7A 1UE7A 2EE1A 3BZKA 4DLKA 1TA8A 2F0TA 4C3IH 4J0MA 3MZ5A 5FLXc 5KKNB 3BQ1A 3RB3A 3FP9A 4XTCS 3U58A 2KVMA 1N48A 3BABA 5C0XG 5IYZF 2K5NA 1BDOA 1VQNA 1B04A 1XPRA 3SK4A 3S17H 3PO2G 1J6QA 1DGSA 5F9NA 1LABA 3K7AH 1QJOA 4JW0A 1PFMA 3K5MA 4YIJA 4KLKA 4XT3B 1VQMA 1K3RA 1VBGA 1TIID 2V1CC 1GUGA 2F0UA 2I07B 3H6MA 3PO2B 1HA5A 3GDEA 4J6HA 1BQQT 5EPLA 5CV8A 4B3TL 2UXBL 3GV7B 4ECQA 2ALZA 1XXGA 2CQAA 5EQ0A 3R5FA 3I12A 2PVPA 3R93A 1OWTA 2NU8B 5L9XA 4OWTB 1KC8C 3UE1A 3MVVA 5CA1F 1EIFA 3D6CA 4X62L 2F4VH 4J9MA 3F2BA 4MV1A 1HXYD 3FDTA 2ATLA 3TRZA 1GD7A 5FLXE 4B3ML 1EYDA 1IOWA 4DV1Q 1DD2A 1BJTA 3S14B 4KKUA 4JYAH 1SLJA 3Q23A 1EL0A 1EFWA 4AIMA 1N9WA 4OELB 2BA0A 4LMQD 3TN2A 2RGVA 4IPGA 4XQQA 5CV9A 3G6VA 4GKKQ 1UC9A 1C9OA 2ZTDA 1R9TA 1XPOA 1K1QA 1EIHA 2GPWA 1Y69U 3N6RA 3K0YA 5KFVA 5NUCA 4A3FG 1SYXB 4C3HH 3EIVA 3ND9A 3J80i 1VBHA 5KFCA 4Q45A 1O7LA 1AUXA 1EYCA 3GV3A 2G9HD 4P73A 3T13A 1BKBA 1RK6A 4HYKA 4L5QA 1X3PA 4KHPL 2IHFA 2TSSA 1PYWD 1S0OA 2B8FA 4UCTA 1DV1A 1U0LA 3GILA 2K1BA 3NP8A 2UUAL 2W6OA 3PW5A 3LP8A 5C4HA 2YRXA 4UHVA 4DL3A 2B29A 2R6GA 5CR3A 1MSHA 4ECTA 3DUZA 4OGQC 5LMNW 5M3FH 1JORA 3S2DB 4JCVE 4PZ8A 3N8DA 4JC0A 4DR2Q 3FPUB 4G7HC 2UUBL 2M00A 2ATWA 3OHAA 1ET9A 1DM0B 1XDNA 2XCAA 1G2SA 4DPGA 1UE5A 4HSVA 1IBMH 4K5VA 4ZYSA 5IY0A 2A69C 3A8KE 4IZ8A 1JJ2A 4DL2A 2L1BA 3HOXH 3PW0A 1FGBD 3NGDA 3KLWA 3KAKA 3BVZA 1R4QB 2HVSA 2R7LA 1KC7A 2JA7A 4FF4A 5L1KA 1Q90A 1PTOC 1BOSA 5C0XI 2JP1A 3GTOH 3SK5A 5IODA 2R93B 2LSSA 2F0MA 1VAJA 4FYDA 2MO1A 4K0KL 4YY3Q 2HD3A 3UQ8A 5J39A 3HOVH 4P75A 4B3SQ 2UXCH 1Y14B 5I9OA 3T5KA 3ICEA 3Q1KA 2R7FA 1M0TA 4A93B 4DV2L 1EY6A 2CH4A 3HKZE 1G51A 5DEHA 1E4EB 2ZM6Q 4DUZH 3LNNA 3ER0A 3OSOA 5I9PA 4CC5A 2MO0A 3IG0A 2DGYA 1JOQA 4AYBA 1EOVA 2UU9H 1M90C 1ZETA 1K0RA 1KJ8A 2NZHA 1YZ6A 4I65A 3S2HH 1LM0A 3J81c 3GTLH 5IGBA 3NENA 2EQSA 1KXLA 2ZDHA 1A2UA 4O4LF 4FM9A 2RDGA 3U4ZA 2AUKA 4LF9H 5LMNL 1A9XA 1SYDA 3SE0A 2R6FA 2HVRA 1EYGA 4DR4L 1VCIA 1XX8A 3FDSA 4KY6A 2ZXRA 3QB3A 5LMUL 1IBKH 4UP9A 2CW0C 3KLRA 1Q7YC 4QWAA 2K14A 4M1UB 1VQPA 3I4NB 4XYLB 1MD2D 3Q0AA 1HPCA 2EJFC 5IGGA 1L2ZA 4ABNA 1UE1A 3MWMA 2KECA 3NQTA 2AGOA 3DXJC 3T1HL 4JV0A 4Q8FA 3PO2H 3URYA 3P7JA 1B9MA 1X3EA 3VR2A 4H44C 1CZGA 2VPQA 2QGQA 2K5VA 4X64H 4NMZA 4HNTA 3M9OB 4LF4L 1KRTA 4WJ3M 2FE3A 3DF7A 5KGUA 2JA8G 4QJFA 5KFRA 1FD7D 3EROA 5KYIA 5KFTA 1Z6HA 1VQKA 4HNUA 3OSPA 1GUTA 2A73B 2F0JA 2JA8B 1SEIA 1HR0H 5KFKA 2PQAB 3MA2B 5L1JA 1ENAA 1HQMC 4IN3A 3S14H 4A3GG 3NPPA 1PRTB 2FK2A 2YS7A 2Y0SE 2E5LH 4RH6A 1VS0A 2RCNA 4LF7L 4DXFA 3FHWA 4RA8A 1STYA 4J9SA 4RG1A 1KNAA 3IFDA 5ELCA 3W2DA 4X66L 2X6GA 2KCMA 4EGQA 1EEID 1PFNA 3G6XA 1NMGA 2EYLA 2XC9A 2R92A 3GIMA 3H09A 2F4VQ 4XYMB 1AP0A 4ED0A 2GVBA 3N6XA 1BCPD 4YWKA 4RB1A 5IYCH 3HRZC 1Q82C 3RGZA 1LUZA 4FO2A 4JI8L 3H94A 1JE4A 2CH4W 3TZDA 3S1NB 2HVQA 4GC7A 5F9LA 2VA3A 3KDFB 3W3AA 5C1PA 3M3YB 3IL8A 4UFZA 5BPHA 5K5PA 3G4SA 1VDZA 5JPMC 2FK1A 4DR3H 2FLPA 3Q8RB 4ED6A 1OXUA 4EEYA 4DV3Q 4RGTA 1VQLA 2RDFA 5FD5A 2B63B 1L0WA 3PV0A 4APVA 3RUPA 1VQ5A 1LTAD 3CCUA 3RF2A 3QWNA 5IYBG 3S2DH 2K33A 1GUWA 1X54A 1MGSA 5L37A 2EJMA 4JI5Q 4POGA 1CA5A 2WP8J 1YNND 1OXVA 5G3LD 1G91A 2J7ZA 2YRWA 2GVAA 3E0EA 4OIJA 3E6ZX 2VXWA 4O4IF 2UUCH 4CKEA 1BF4A 3OHXC 1XNQH 3BYTB 3W1GA 2N88A 3ITPA 4PV1C 3BAAA 3I7FA 3JAMc 3NBIA 2YTVA 4DV6L 5EOYA 1I5FA 3VPCA 4RCOA 3CKIB 4GKJH 2Z8LA 4IFDG 1CHPD 2LKVA 4CKCA 3CCSA 3TP5A 2ASLA 1KABA 3KHLA 2FB9A 1QB5D 2C35B 1N56A 4F4XA 2P5ZX 2VUMA 5JJZA 4A93H 4M7EA 2Q2IA 3OW7A 4C2MA 3VYRA 2I80A 4IO9A 1DOMA 1JWUD 5D8DA 1SJHD 3U4VA 4LUZA 5D3IB 4PMBA 4GOPB 4KKSA 5D3DA 2UXDL 3BJUA 4IRKA 1F2MA 2OQ0A 2BA1A 2D0PA 5EBDA 5KFGA 2OQKA 2UXCQ 4DV4L 5KFNA 1MKHA 1BVSA 3CC7A 1AN8A 3GTKB 2MQHA 4DUZQ 1I94L 1XMOQ 4IJLA 1RK5A 2WKCA 5FK9C 4RAUC 2V4QA 2R7ZA 2UU9Q 2CHBD 2F0SA 3I4OA 3G8CA 3CCVA 5DG8A 3H15A 4NXML 1K8OA 5J1ZA 4DR6Q 1YHAA 4O3PA 3GTJB 2EDGA 1O7YA 3GTGB 4A3DG 3J80W 1GYFA 1Z2NX 1M0WA 3UDFA 3BS1A 2NVXB 4G57A 3OW2A 1HNXH 2F3WA 4LF9Q 4LK1C 5IE8A 3RN5A 2J6SA 4JI7H 4L63B 3SR1A 4HMIA 3C0FB 4HIMA 1Q8IA 2E76C 3NTIA 5BR8H 3GLKA 1IBKQ 1Y1VA 3TZUA 4FBTA 2NTTA 2F0IA 3A7AB 4F87A 1E4GT 1TWGA 2X0SA 2C5CA 4H13C 3FMAA 5A2QW 2EYFA 2EJGC 3CQZA 3S1RB 4DR7H 2J0TD 4KKTA 1N36H 4BXXH 1GLVA 1WTXA 2JA8H 5K36G 1TWHA 4C5AA 2K5DA 1JICA 2ASBA 2KHJA 5KFJA 2DZDA 1AH9A 1FKAH 2K6AA 4RHSA 3AFPA 3CRLC 2VR1A 1I6VC 3J80E 1BNCA 3GTQA 3N43B 3DWQA 1QZGA 1EUDB 3RBDA 4Y52H 1PDQA 1U4RA 2BQ3A 1HZCA 4JYAL 4L6TB 2UVRA 3MWYW 4RB2C 2VS1A 4A2AA 3WO1A 2JEFA 1CKOA 1S3OA 3H20A 3SEBA 4CDDC 2AWOA 1ASYA 4J9LA 4KD3A 4R4OA 2AQ1B 1W93A 5C1OA 1HR0Q 4B3RQ 4LUVA 5HY6A 2NVQB 3S1NH 3MR5A 1X9NA 3RV4A 1CQIB 3M3YH 2W9AA 2C22A 5HURA 3NK9A 1NNXA 3AFQA 2B2WC 4FDBA 3T5HA 1S0NA 4BWGB 4AQYQ 4PMCA 3GP7A 3M4YA 4XQJA 1VQOA 1HNZL 4IFDI 2YZGA 1BCPC 4IUTA 2VY3A 1EIGA 4AYBG 4A3IB 3GTMB 3K8AA 1SFOA 2EYMA 3J80L 5GONF 4R8UB 2WB1B 3UDIA 5DQGA 2IX1A 5M5YB 2NVYB 4KN4C 2B63H 2R82A 4YR3A 3HB9A 1K83H 2K5QA 1TWAB 1UNSA 4IUPA 3TDQA 2V5AA 4FU0A 2SDFA 4R4IA 2AKWB 2ZT9C 1QVGA 3N40P 5C6AA 3VYTA 1E24A 5EGTA 5IYBH 3MR2A 2HUGA 4JV5L 2FFKB 4LF5L 2EY1A 3K58A 4X3SA 2K32A 5KFDA 3HOZB 1M4VA 4RWSC 1NCVA 4LFAL 2EY2A 1A6XA 2MHVA 2OTLA 4A3BB 3U9OA 1XNRH 3I56A 1YNNC 2MGSA 4WORA 3A54A 1OO9B 3A5ZB 5KRUA 1HUNA 5C4XB 1LLRD 3OTOH 4RKBA 1A2TA 2QDLA 3HOWG 4LUOA 3F2UA 1V1PA 2MNAA 4LF8L 3BG3A 2IBKA 2KHSA 2W7PA 3K3VA 2HGSA 2UUCQ 1I7NA 4MV6A 1B53A 2WAQB 1H9SB 2HCIA 1XNQQ 3HOWB 4O2DA 1TWFA 2XGQA 3V4ZA 1PH7A 4A3LG 3RN2A 4IALA 4A3MG 1CKNB 1QZHA 3PUXA 3Q8SB 3RZOH 4MNOA 1PTOB 3TBIB 1IOVA 2RDIA 1N8RC 4HSPA 3J81i 2O5IC 5ELNA 4LFCQ 4EG0A 1Z7TA 3KF6B 1T5EA 3R8BA 2B2WA 3J7YW 3F8TA 2TMPA 5AJ3Q 4TQSA 2YV5A 1UEBA 1MHWC 2F3VA 3GIQA 3EPIA 5C0XJ 3IKJA 3I55A 2FK3A 3DEPA 3GTKH 3MEFA 3PVXA 3OMCA 2CW7A 5C44G 5EWFA 4RNOA 3MWDA 2IJ0A 4JBJA 5EJWA 1KIXA 4A3JG 3T1YL 1XMQH 4IUQA 3PGZA 5IT9W 5CV7A 1K1SA 4Y8VB 3Q2OA 2YL2A 1KD1C 4A3EB 3GTJH 1EOTA 3MTSA 3GTGH 3T16A 5CC4A 5KFZA 1A3VA 1TY0A 2HIVA 1O78A 4MHEA 5LHY1 2NVXH 1TS2A 5D14A 4JI4L 4JI6L 4K8JA 4MV4A 1IBMQ 4JV2A 5IGFA 4XQNA 3LGJA 3ORQA 2PNRC 2PI2A 1GSOA 2J9GA 4B9WA 4R8NA 2NYZD 1PVOA 2D2CC 4UPAA 2RSNA 1Y1WA 4HR7B 4KHVA 1BGWA 4UP8A 1HUMA 3OOCA 4NKLA 4PZ6A 1N33L 2VQEH 3S1RH 4QCLA 1XWEA 2W7OA 1TKWB 5IT9E 2MFIA 2Q2TA 2JK8A 2LS01 3D0FA 3NTKA 2D9UA 1D7QA 3QOJA 2PMZB 1HNXQ 1CHQD 1SNOA 5JJIA 3I4MG 4JI7Q 1VQBA 1V43A 5KFEA 2JA5B 5K36H 4HJ5A 4IPDA 1LTBD 1PFBA 5C5MA 4DF7A 4EQNA 3GTOB 3NUCA 5C3WA 5JPNC 3T5JA 3KK7A 5IYDG 2F0OA 4A3CG 4EGJA 1WCMA 2E5LL 3ONAB 3K80C 2OT2A 4RAYA 1YJNA 5LOVF 1V8QA 1N36Q 3HOYG 2L5TA 4R4TA 4ZKBB 1WD1A 2VUMG 1X6OA 2OF1A 2NVQH 1J8IA 5IT9L 2XGPA 3QR8A 5JVDF 4BY7G 4KTAA 2BH8A 2M2LA 4BA1I 3WNZA 3GTPA 4BY1G 2NUCA 3HOYB 5KFHA 2GPSA 1L1OB 2C00A 2HCCA 4A3IH 2AQ3B 3GTMH 5LA6F 4JI0H 4BY7B 1EU3A 4Z9CB 4B9XA 1TS4A 1XTCD 5M5YH 2NVYH 1S5CD 2JYOA 3SK6A 3KYHC 4IUVA 2ZJPA 1JIHA 2V58A 1G6ZA 2CW8A 4LFBH 4EYIB 4XX0B 4ECRA 3KOJA 1TWAH 5EWEA 1LYLA 3HKZA 3MXNA
chains in the Genus database with same CATH topology
4LF5Q 1PH9A 1EOVA 4UY8C 1VQ7A 1M90C 2L15A 1K0RA 2R93H 5IP7G 4DK3C 2NZHA 1YZ6A 3S2HH 2JQOA 2CCZA 1LM0A 2YTXA 3K81C 4LFAQ 3J81c 3GTLH 1TWFH 4GN4B 3G6EA 3NENA 2EQSA 1KXLA 5GAGC 1L1OA 3HOZH 1Z9FA 2N49A 1IBMQ 3U4ZA 5IP9G 3JAMi 2ZJQA 1YBYA 1SR3A 3ULJA 4YWMA 5LMNL 4A3BH 4NXNL 5H1SE 2CKZB 3S24A 4DV7L 1VQFA 4JI0L 3M85A 1EYGA 4DR4L 2UXCL 1VCIA 4JBKA 5LMUL 3PSIA 5GAHC 4UP9A 1Q7YC 3PIOA 4LF8Q 4DUZL 5C4XH 3CCQA 1PH8A 3PUWA 2K14A 3AEVA 4LFBL 5M5WH 1HR0W 1VQPA 1Y1VG 4GLXA 2K52A 5LMNQ 1EQQA 4B3TQ 2UXBQ 4DV7Q 1NY4A 3ULPA 4DR5L 2UU9L 1E7ZA 2JA9A 4GN5A 1UE1A 4DV5L 3T1HL 3PO2H 3HOWH 2HIXA 2VZAA 2R92G 1X3EA 1XNRQ 3CP0A 3J80c 3H3VI 3KFUA 2QGQA 4YCVA 4DR1L 1LTLA 2K5VA 1R9TH 3L0OA 1S40A 2NN6G 4LF9L 4X62Q 1YHBA 1KRTA 4LF4L 1GO3E 3CD6A 4WJ3M 4HJ9A 1TXYA 4A3LH 4A3MH 2JA8G 4QJFA 3OTOQ 3I4NH 5DLQE 4DV5Q 2A8VA 2DUDA 1Q1BA 3CCJA 4BBSG 1X3FA 1HNWL 1IBKL 4B3MQ 1BBUA 1VQKA 1A62A 4OX9L 3L7ZC 4QL5A 3T1YQ 4QGUA 2A19A 2IX0A 2KENA 1M1KC 1FJGL 3F1ZA 3KJOA 2PQAB 4LF4Q 4DR3Q 4A3DH 3S14H 1RIPA 1VQDA 2PI2E 4X65L 2F3IA 3NEMA 4ME3A 3VDYA 1Y1WH 4L5RC 4A3GG 2Y0SE 3CPFA 4QIWE 2IT1A 3CW2C 1VS0A 1J5EL 2RCNA 1C0AA 2ZTEA 4LF7L 1IBLL 3FHWA 4OX9Q 4DKAC 4YWLA 4A3EH 4RG1A 3J7ZC 3TREA 4LF6L 4X66L 2LXJA 2KCMA 1ASZA 4X64L 3TEHB 5M3FG 1NMGA 1Q8KA 4P74A 4JI4Q 1N32L 4X65Q 4DV0L 2A1AA 4HJ7A 2F4VQ 3FKIG 2GVBA 3U50C 4YWKA 5IYCH 1Q82C 2EXDA 3S1QH 4KHPQ 1CSPA 1LUZA 4JI8L 1VQ9A 1XPUA 4QY7A 1WCMH 3KDFB 5EAYA 1XMQQ 3G4SA 2UUAQ 2PQAA 1G291 4LW1A 4X64Q 4YHHL 1HR0L 4B3RL 2K75A 4DUYL 1IYJB 3H3VH 1PFSA 2K5HA 1OXUA 1SRUA 1N34L 4DV3Q 1B7YB 5BR8L 2CWPA 4JI5L 1OXSC 1QVCA 4JI8Q 5JEAG 4AQYL 2Z6KC 1VQLA 4KI0A 3HOUG 4OWXB 4JOIA 1YI2A 2JA7H 1L0WA 3PV0A 3STBC 5HGQA 2OTJA 4YCUA 4APVA 1EQRA 3GTPH 1VQ5A 2UUBQ 1KRSA 3CCUA 2CFMA 4YHHQ 1K8GA 5IYBG 4PG3A 1YJ9A 4A3IG 2RHSB 3S2DH 1AE3A 5M3MG 3M4PA 1X54A 4DR7L 5JJKA 2JA5H 4IPHA 2HHHL 2WB1G 2E5LQ 4X6AH 4JI2L 4JI5Q 4POGA 2KHIA 2WP8J 2FXQA 1OXVA 1P8LA 2YTYA 3D31A 1VQAA 5E7NA 4GOPC 3KDFA 3UE0A 1YIJA 2GVAA 3E0EA 2NVTH 3CXCA 1JMCA 2KBNA 2VQEQ 1GKHA 1MIUA 5IYDH 4A3CH 3W1GA 1Q81C 1WJJA 5GQOA 3I7FA 3IRBA 3L2PA 3JAMc 2YTVA 4DV6L 3TS0A 1OXTA 4K0KQ 2IHEA 1I5FA 2JEBI 4L5SA 1JJGA 3M9BA 5JEAJ 3PUYA 3HOYH 3HOZG 4IFDG 3UDXA 3CCSA 1SN8A 4DV2Q 1YITA 2ZTCA 4A3BG 2R7ZG 3PF4A 4BY7H 4GNXC 3PUZA 1NMFA 4BY1H 3E9IA 2HT1A 4DV6Q 2C35B 4A93H 4J15A 2I5MX 1EUJA 2Q2IA 2WFWA 3H0GH 3NBHB 1MJEA 3M4OH 5C4XG 4H02A 4R4QA 3G71A 3NELA 4IO9A 1NBWA 3W5OA 3M7NA 3U4VA 4LUZA 2UUCL 4BA2I 4JI1L 5FJ8H 1XNQL 3S1MH 2IY5B 2NN6I 4GOPB 1XMOL 3CMEA 3I2ZA 2UXDL 1AE2A 2WAQG 3BJUA 1PHJA 3KF8B 1YHQA 1L2FA 4JOIC 4NXNQ 1W3SA 2BA1A 2OQ0A 2D0PA 4XIGS 4POFA 4A76A 4JI0Q 1CSQA 2OQKA 4DR4Q 4GKJL 4LFCL 2XTIA 1VQ6A 3ULLA 1QUQB 5IP7H 5LMUQ 4PMWA 4DV4L 3J7A5 1MKHA 4DR6L 1BVSA 3CC7A 4JI1Q 1UWVA 3AYHB 2Z6KA 2MQHA 4P72A 5AJ3L 1RL2A 4DUZQ 1I94L 4LFBQ 4IFDJ 3K0XA 4IJLA 1XMOQ 1NJIC 1VQ8A 1I6HH 1UE6A 1IZ6A 3B6YA 5IP9H 1JJCB 1WOCA 2ZJRA 1NE3A 4DR5Q 2UU9Q 4DV1L 1KHIA 3I4OA 4A75A 1HH2P 3CCVA 1PH2A 4GKJQ 3H15A 2Q2HA 2NZOA 4NXML 4GNXB 1YHAA 3T1HQ 4DR6Q 1VQHA 1KAWA 2QEXA 4A3DG 1SE8A 5IT9c 4GOPA 1MJCA 1I3QH 4JBWA 4GN3B 1Y1WG 3UDFA 4P71A 4BBRH 2AWNA 4GKKL 4DR1Q 4GS3A 3OW2A 3S15H 1Y1VH 4OXPA 4LF9Q 5IE8A 3RN5A 3AQQA 5GADC 1VQ4A 1FL0A 4A3EG 3CPWA 3RR5A 4HIMA 1GVPA 1QUQA 4PZ7A 1PV4A 1S72A 1JB7A 3ZJYC 1KL9A 4JI3L 3RLOA 1HNWQ 1IBKQ 2ALYB 1JE5A 4IJHA 2JA6H 2E2IH 2R92H 5J3BA 5C44H 3J81j 1X55A 3RZDH 2I0QA 5IYCG 5M5XH 5GROA 3BU2A 3CAMA 4A3JH 1FJGQ 4ALPA 2JE6I 4EQ5A 3CCMA 3CF5A 1A63A 3HKSA 5C3EH 1WCMG 4HIOA 4BXXH 1HZAA 2JA8H 2VNUD 4GNXA 5K36G 4BBSH 4O0AA 3PIPA 4HIKA 1XTDA 2KHJA 1J5EQ 2ASBA 4LF7Q 1IBLQ 4IOCA 1AH9A 1VQCA 1VQGA 1P16A 1W2BA 4HJ8A 3AFPA 1PH5A 4A3FH 4X66Q 4LF6Q 4A3KH 5FLMH 2EIFA 1QZGA 2CWAA 1HNXL 2YYZA 1N32Q 4DV0Q 4JI7L 4Y52H 2JJQA 1HJPA 1HZCA 3ERSX 3HOXG 2VQFL 4JYAL 4GLAC 1CUKA 3G48A 4DR2L 3Q8DA 2OCEA 2VS1A 1HZ9A 2K4KA 4NB3A 1B8AA 4HIDA 1K8AC 1CKOA 1EIYB 1S3OA 2OWOA 1V1QA 1PH3A 1X65A 3K7UC 1V9PA 1VQJA 2JA5G 2F52A 2AWOA 1ASYA 1C7YA 4R4OA 1HR0Q 4B3RQ 1XJVA 4LUVA 5HY6A 1KQSA 3PO3G 4DUYQ 3W1BA 3S1NH 2H5XA 1X9NA 1SFOH 3DLLA 2ES2A 3FKIH 1N34Q 3M3YH 3HOVG 2BH2A 1N36L 2VL6A 5BR8Q 3AFQA 2D0OA 4FDBA 3HKZG 4AQYQ 3M4QA 1HNZL 1VQOA 4IFDI 4HJAA 3I4MH 4AYBG 2VY3A 4R1JA 1YJWA 3K8AA 1U5KA 4RMFA 4OWWB 3UDIA 3TQYA 1VQIA 3EN2A 3OYYA 3PF5A 1PYBA 2IX1A 2B63H 4DR7Q 2AHOB 4YY3L 2HHHQ 4JI2Q 2R93G 1K83H 4B3SL 4WJ4A 1E3PA 4DAYB 1HNZQ 3A74A 1K9MC 1IXRA 4MTNA 3EBEA 4R4IA 2AKWB 3HOUH 1QVGA 2D62A 1T9HA 3PCOB 4KHZA 3F2DA 2ZM6L 1PH6A 2HQLA 5JJLA 1E24A 1FVIA 2VUMH 5IYBH 4A93G 1Z47A 3CCLA 5M3MH 3CC2A 4JV5L 4LF5L 4L5TA 4C2MH 1UE7A 2E8GA 3BZKA 2CQOA 4OO1G 1OTCA 4C3IH 5FLXc 4LFAL 2WB1E 1K73C 2OTLA 3FP9A 3I56A 4XTCS 3U58A 1E1OA 1WFQA 5C0XG 3A5ZB 2E2JH 1PH1A 1TWCH 2LXKA 2GN5A 2K5NA 1VQNA 4GLVB 3KJPA 1A8VA 1XPRA 2RF4A 2I5HA 1A0IA 5IWAL 3S17H 3PO2G 1E1TA 1Q1EA 4LUOA 3HOWG 1J6QA 1DGSA 1E22A 2MNAA 4LF8L 3K7AH 1NTGA 4TVAB 4KLKA 1VQMA 1K3RA 2UUCQ 1D8LA 1WYDA 2V1CC 1XNQQ 4B3TL 3GDEA 4O2DA 2R7ZH 2UXBL 1HZBA 1PH7A 4A3LG 3RN2A 4A3MG 1CKNB 1QZHA 3PUXA 2JEAI 4UP7A 3CCEA 5IWAQ 4MNOA 3I4NG 3RZOH 2UXDQ 1N8RC 1Q86C 3RNUA 2KCTA 3J81i 3HFZB 1IL2A 2AMCB 5ELNA 1XNRL 4LFCQ 4BBRG 4DV4Q 4OWTB 1BBWA 3KF6B 3SGIA 4DNIA 3A0JA 3WWVA 1KC8C 3UE1A 3F8TA 3A5UA 2Y0SG 5AJ3Q 1EIFA 4X62L 1I94Q 1OXXK 1I50H 1YEZA 4A4IA 2YV5A 1UEBA 3F2BA 2PNHA 3OTOL 1CKMA 5C0XJ 3I55A 3TRZA 1GD7A 2JA6G 3GTKH 4B3ML 3MEFA 4DV1Q 5C44G 4YCWA 4R4CA 2WAQE 2K50A 1KIXA 4JBJA 4NXMQ 1SLJA 4A3JG 3T1YL 1TWGH 3GO5A 3PGZA 3RLFA 1EFWA 4AIMA 1N9WA 2BA0A 4DK6C 3CQZH 5C3EG 4IPGA 4DR3L 3TS2A 1CKNA 1EWIA 4BXXG 1SMXA 3CCRA 1TWHH 1KD1C 4GKKQ 1C9OA 3GTJH 1QVFA 2ZTDA 3GTGH 1Q12A 4MZ9A 1FGUA 1SROA 4C3JH 4NPSA 1XPOA 1WI5A 4LWCA 5GAEC 3KF6A 2HIVA 4A3FG 4A3KG 2NVXH 4JI3Q 4C3HH 3EIVA 5FLMG 3J80i 1YNXA 1GM5A 3GTQH 1PH4A 1YVCA 4TQUS 1X56A 4JI4L 4JI6L 2F4VL 4JBMA 2UXCQ 3LGJA 3STBD 4P73A 2PI2A 1BKBA 4L5QA 4KHPL 2ID0A 5ELOA 1PVOA 2IHFA 3JC66 2RHQB 4DAMA 2JA7G 3F2CA 4UPAA 4A3GH 1L1OC 2E2HH 1PA6A 4UP8A 1U0LA 1XMQL 2UUAL 1B70B 2XGTA 4PZ6A 4JI6Q 3S1RH 1N33L 2MFIA 2B29A 2R6GA 2JK8A 3D0FA 3RLNA 3E9HA 4DV3L 2Q2TA 3S16H 1D7QA 1IBML 1HNXQ 5LMNW 5JJIA 3I4MG 5M3FH 4JI7Q 1X3GA 1VQBA 4JCVE 2VQFQ 4JYAQ 4PZ8A 1V43A 4JC0A 4IPCA 1O7IA 4HJ5A 4DR2Q 4IPDA 3PUVA 2UUBL 2ATWA 1N33Q 2B3GA 4AH6A 2B63G 5IYDG 3UDGA 4A3CG 2E5LL 4DPGA 1UE5A 1Q46A 4OONA 3K80C 5IY0A 4OO1I 2YU9H 1YJNA 1JJ2A 3CC4A 3MXNB 3HOXH 1N36Q 1G6PA 3HOYG 4R4TA 3KLWA 2VUMG 1X6OA 2Q2UA 4EX5A 2NVQH 2VQEL 2PMZE 4JG2A 4BY7G 2BH8A 4BA1I 5C0XI 3CMAA 3GTOH 4BY1G 3GD7A 4QQBX 1L1OB 2LSSA 1PYSB 4LNQA 3PO3H 4Y7NH 2N3SA 4A3IH 2MO1A 3GTMH 4IOAA 3H0GG 4K0KL 4YY3Q 3BZCA 5C4JH 2R7DA 3HOVH 4P75A 4B3SQ 1Y14B 1H95A 2QA4A 3ICEA 5M5YH 2R7FA 2N78A 2NVYH 2I5LX 3KYHC 4DV2L 2ZJPA 5FJ8G 3HKZE 1G51A 1VQEA 3DM3A 2ZM6Q 3KOJA 1TWAH 2N8NA 3ER0A 4AYBE 1LYLA 1JT8A 2MO0A 2VW9A 2Z0SA 2DGYA 4JV5Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 Q;  1PH9 A;  1EOV A;  4UY8 C;  1VQ7 A;  1M90 C;  2L15 A;  1K0R A;  2R93 H;  5IP7 G;  4DK3 C;  2NZH A;  1YZ6 A;  3S2H H;  2JQO A;  2CCZ A;  1LM0 A;  2YTX A;  3K81 C;  4LFA Q;  3J81 c;  3GTL H;  1TWF H;  4GN4 B;  3G6E A;  3NEN A;  2EQS A;  1KXL A;  5GAG C;  1L1O A;  3HOZ H;  1Z9F A;  2N49 A;  1IBM Q;  3U4Z A;  5IP9 G;  3JAM i;  2ZJQ A;  1YBY A;  1SR3 A;  3ULJ A;  4YWM A;  5LMN L;  4A3B H;  4NXN L;  5H1S E;  2CKZ B;  3S24 A;  4DV7 L;  1VQF A;  4JI0 L;  3M85 A;  1EYG A;  4DR4 L;  2UXC L;  1VCI A;  4JBK A;  5LMU L;  3PSI A;  5GAH C;  4UP9 A;  1Q7Y C;  3PIO A;  4LF8 Q;  4DUZ L;  5C4X H;  3CCQ A;  1PH8 A;  3PUW A;  2K14 A;  3AEV A;  4LFB L;  5M5W H;  1HR0 W;  1VQP A;  1Y1V G;  4GLX A;  2K52 A;  5LMN Q;  1EQQ A;  4B3T Q;  2UXB Q;  4DV7 Q;  1NY4 A;  3ULP A;  4DR5 L;  2UU9 L;  1E7Z A;  2JA9 A;  4GN5 A;  1UE1 A;  4DV5 L;  3T1H L;  3PO2 H;  3HOW H;  2HIX A;  2VZA A;  2R92 G;  1X3E A;  1XNR Q;  3CP0 A;  3J80 c;  3H3V I;  3KFU A;  2QGQ A;  4YCV A;  4DR1 L;  1LTL A;  2K5V A;  1R9T H;  3L0O A;  1S40 A;  2NN6 G;  4LF9 L;  4X62 Q;  1YHB A;  1KRT A;  4LF4 L;  1GO3 E;  3CD6 A;  4WJ3 M;  4HJ9 A;  1TXY A;  4A3L H;  4A3M H;  2JA8 G;  4QJF A;  3OTO Q;  3I4N H;  5DLQ E;  4DV5 Q;  2A8V A;  2DUD A;  1Q1B A;  3CCJ A;  4BBS G;  1X3F A;  1HNW L;  1IBK L;  4B3M Q;  1BBU A;  1VQK A;  1A62 A;  4OX9 L;  3L7Z C;  4QL5 A;  3T1Y Q;  4QGU A;  2A19 A;  2IX0 A;  2KEN A;  1M1K C;  1FJG L;  3F1Z A;  3KJO A;  2PQA B;  4LF4 Q;  4DR3 Q;  4A3D H;  3S14 H;  1RIP A;  1VQD A;  2PI2 E;  4X65 L;  2F3I A;  3NEM A;  4ME3 A;  3VDY A;  1Y1W H;  4L5R C;  4A3G G;  2Y0S E;  3CPF A;  4QIW E;  2IT1 A;  3CW2 C;  1VS0 A;  1J5E L;  2RCN A;  1C0A A;  2ZTE A;  4LF7 L;  1IBL L;  3FHW A;  4OX9 Q;  4DKA C;  4YWL A;  4A3E H;  4RG1 A;  3J7Z C;  3TRE A;  4LF6 L;  4X66 L;  2LXJ A;  2KCM A;  1ASZ A;  4X64 L;  3TEH B;  5M3F G;  1NMG A;  1Q8K A;  4P74 A;  4JI4 Q;  1N32 L;  4X65 Q;  4DV0 L;  2A1A A;  4HJ7 A;  2F4V Q;  3FKI G;  2GVB A;  3U50 C;  4YWK A;  5IYC H;  1Q82 C;  2EXD A;  3S1Q H;  4KHP Q;  1CSP A;  1LUZ A;  4JI8 L;  1VQ9 A;  1XPU A;  4QY7 A;  1WCM H;  3KDF B;  5EAY A;  1XMQ Q;  3G4S A;  2UUA Q;  2PQA A;  1G29 1;  4LW1 A;  4X64 Q;  4YHH L;  1HR0 L;  4B3R L;  2K75 A;  4DUY L;  1IYJ B;  3H3V H;  1PFS A;  2K5H A;  1OXU A;  1SRU A;  1N34 L;  4DV3 Q;  1B7Y B;  5BR8 L;  2CWP A;  4JI5 L;  1OXS C;  1QVC A;  4JI8 Q;  5JEA G;  4AQY L;  2Z6K C;  1VQL A;  4KI0 A;  3HOU G;  4OWX B;  4JOI A;  1YI2 A;  2JA7 H;  1L0W A;  3PV0 A;  3STB C;  5HGQ A;  2OTJ A;  4YCU A;  4APV A;  1EQR A;  3GTP H;  1VQ5 A;  2UUB Q;  1KRS A;  3CCU A;  2CFM A;  4YHH Q;  1K8G A;  5IYB G;  4PG3 A;  1YJ9 A;  4A3I G;  2RHS B;  3S2D H;  1AE3 A;  5M3M G;  3M4P A;  1X54 A;  4DR7 L;  5JJK A;  2JA5 H;  4IPH A;  2HHH L;  2WB1 G;  2E5L Q;  4X6A H;  4JI2 L;  4JI5 Q;  4POG A;  2KHI A;  2WP8 J;  2FXQ A;  1OXV A;  1P8L A;  2YTY A;  3D31 A;  1VQA A;  5E7N A;  4GOP C;  3KDF A;  3UE0 A;  1YIJ A;  2GVA A;  3E0E A;  2NVT H;  3CXC A;  1JMC A;  2KBN A;  2VQE Q;  1GKH A;  1MIU A;  5IYD H;  4A3C H;  3W1G A;  1Q81 C;  1WJJ A;  5GQO A;  3I7F A;  3IRB A;  3L2P A;  3JAM c;  2YTV A;  4DV6 L;  3TS0 A;  1OXT A;  4K0K Q;  2IHE A;  1I5F A;  2JEB I;  4L5S A;  1JJG A;  3M9B A;  5JEA J;  3PUY A;  3HOY H;  3HOZ G;  4IFD G;  3UDX A;  3CCS A;  1SN8 A;  4DV2 Q;  1YIT A;  2ZTC A;  4A3B G;  2R7Z G;  3PF4 A;  4BY7 H;  4GNX C;  3PUZ A;  1NMF A;  4BY1 H;  3E9I A;  2HT1 A;  4DV6 Q;  2C35 B;  4A93 H;  4J15 A;  2I5M X;  1EUJ A;  2Q2I A;  2WFW A;  3H0G H;  3NBH B;  1MJE A;  3M4O H;  5C4X G;  4H02 A;  4R4Q A;  3G71 A;  3NEL A;  4IO9 A;  1NBW A;  3W5O A;  3M7N A;  3U4V A;  4LUZ A;  2UUC L;  4BA2 I;  4JI1 L;  5FJ8 H;  1XNQ L;  3S1M H;  2IY5 B;  2NN6 I;  4GOP B;  1XMO L;  3CME A;  3I2Z A;  2UXD L;  1AE2 A;  2WAQ G;  3BJU A;  1PHJ A;  3KF8 B;  1YHQ A;  1L2F A;  4JOI C;  4NXN Q;  1W3S A;  2BA1 A;  2OQ0 A;  2D0P A;  4XIG S;  4POF A;  4A76 A;  4JI0 Q;  1CSQ A;  2OQK A;  4DR4 Q;  4GKJ L;  4LFC L;  2XTI A;  1VQ6 A;  3ULL A;  1QUQ B;  5IP7 H;  5LMU Q;  4PMW A;  4DV4 L;  3J7A 5;  1MKH A;  4DR6 L;  1BVS A;  3CC7 A;  4JI1 Q;  1UWV A;  3AYH B;  2Z6K A;  2MQH A;  4P72 A;  5AJ3 L;  1RL2 A;  4DUZ Q;  1I94 L;  4LFB Q;  4IFD J;  3K0X A;  4IJL A;  1XMO Q;  1NJI C;  1VQ8 A;  1I6H H;  1UE6 A;  1IZ6 A;  3B6Y A;  5IP9 H;  1JJC B;  1WOC A;  2ZJR A;  1NE3 A;  4DR5 Q;  2UU9 Q;  4DV1 L;  1KHI A;  3I4O A;  4A75 A;  1HH2 P;  3CCV A;  1PH2 A;  4GKJ Q;  3H15 A;  2Q2H A;  2NZO A;  4NXM L;  4GNX B;  1YHA A;  3T1H Q;  4DR6 Q;  1VQH A;  1KAW A;  2QEX A;  4A3D G;  1SE8 A;  5IT9 c;  4GOP A;  1MJC A;  1I3Q H;  4JBW A;  4GN3 B;  1Y1W G;  3UDF A;  4P71 A;  4BBR H;  2AWN A;  4GKK L;  4DR1 Q;  4GS3 A;  3OW2 A;  3S15 H;  1Y1V H;  4OXP A;  4LF9 Q;  5IE8 A;  3RN5 A;  3AQQ A;  5GAD C;  1VQ4 A;  1FL0 A;  4A3E G;  3CPW A;  3RR5 A;  4HIM A;  1GVP A;  1QUQ A;  4PZ7 A;  1PV4 A;  1S72 A;  1JB7 A;  3ZJY C;  1KL9 A;  4JI3 L;  3RLO A;  1HNW Q;  1IBK Q;  2ALY B;  1JE5 A;  4IJH A;  2JA6 H;  2E2I H;  2R92 H;  5J3B A;  5C44 H;  3J81 j;  1X55 A;  3RZD H;  2I0Q A;  5IYC G;  5M5X H;  5GRO A;  3BU2 A;  3CAM A;  4A3J H;  1FJG Q;  4ALP A;  2JE6 I;  4EQ5 A;  3CCM A;  3CF5 A;  1A63 A;  3HKS A;  5C3E H;  1WCM G;  4HIO A;  4BXX H;  1HZA A;  2JA8 H;  2VNU D;  4GNX A;  5K36 G;  4BBS H;  4O0A A;  3PIP A;  4HIK A;  1XTD A;  2KHJ A;  1J5E Q;  2ASB A;  4LF7 Q;  1IBL Q;  4IOC A;  1AH9 A;  1VQC A;  1VQG A;  1P16 A;  1W2B A;  4HJ8 A;  3AFP A;  1PH5 A;  4A3F H;  4X66 Q;  4LF6 Q;  4A3K H;  5FLM H;  2EIF A;  1QZG A;  2CWA A;  1HNX L;  2YYZ A;  1N32 Q;  4DV0 Q;  4JI7 L;  4Y52 H;  2JJQ A;  1HJP A;  1HZC A;  3ERS X;  3HOX G;  2VQF L;  4JYA L;  4GLA C;  1CUK A;  3G48 A;  4DR2 L;  3Q8D A;  2OCE A;  2VS1 A;  1HZ9 A;  2K4K A;  4NB3 A;  1B8A A;  4HID A;  1K8A C;  1CKO A;  1EIY B;  1S3O A;  2OWO A;  1V1Q A;  1PH3 A;  1X65 A;  3K7U C;  1V9P A;  1VQJ A;  2JA5 G;  2F52 A;  2AWO A;  1ASY A;  1C7Y A;  4R4O A;  1HR0 Q;  4B3R Q;  1XJV A;  4LUV A;  5HY6 A;  1KQS A;  3PO3 G;  4DUY Q;  3W1B A;  3S1N H;  2H5X A;  1X9N A;  1SFO H;  3DLL A;  2ES2 A;  3FKI H;  1N34 Q;  3M3Y H;  3HOV G;  2BH2 A;  1N36 L;  2VL6 A;  5BR8 Q;  3AFQ A;  2D0O A;  4FDB A;  3HKZ G;  4AQY Q;  3M4Q A;  1HNZ L;  1VQO A;  4IFD I;  4HJA A;  3I4M H;  4AYB G;  2VY3 A;  4R1J A;  1YJW A;  3K8A A;  1U5K A;  4RMF A;  4OWW B;  3UDI A;  3TQY A;  1VQI A;  3EN2 A;  3OYY A;  3PF5 A;  1PYB A;  2IX1 A;  2B63 H;  4DR7 Q;  2AHO B;  4YY3 L;  2HHH Q;  4JI2 Q;  2R93 G;  1K83 H;  4B3S L;  4WJ4 A;  1E3P A;  4DAY B;  1HNZ Q;  3A74 A;  1K9M C;  1IXR A;  4MTN A;  3EBE A;  4R4I A;  2AKW B;  3HOU H;  1QVG A;  2D62 A;  1T9H A;  3PCO B;  4KHZ A;  3F2D A;  2ZM6 L;  1PH6 A;  2HQL A;  5JJL A;  1E24 A;  1FVI A;  2VUM H;  5IYB H;  4A93 G;  1Z47 A;  3CCL A;  5M3M H;  3CC2 A;  4JV5 L;  4LF5 L;  4L5T A;  4C2M H;  1UE7 A;  2E8G A;  3BZK A;  2CQO A;  4OO1 G;  1OTC A;  4C3I H;  5FLX c;  4LFA L;  2WB1 E;  1K73 C;  2OTL A;  3FP9 A;  3I56 A;  4XTC S;  3U58 A;  1E1O A;  1WFQ A;  5C0X G;  3A5Z B;  2E2J H;  1PH1 A;  1TWC H;  2LXK A;  2GN5 A;  2K5N A;  1VQN A;  4GLV B;  3KJP A;  1A8V A;  1XPR A;  2RF4 A;  2I5H A;  1A0I A;  5IWA L;  3S17 H;  3PO2 G;  1E1T A;  1Q1E A;  4LUO A;  3HOW G;  1J6Q A;  1DGS A;  1E22 A;  2MNA A;  4LF8 L;  3K7A H;  1NTG A;  4TVA B;  4KLK A;  1VQM A;  1K3R A;  2UUC Q;  1D8L A;  1WYD A;  2V1C C;  1XNQ Q;  4B3T L;  3GDE A;  4O2D A;  2R7Z H;  2UXB L;  1HZB A;  1PH7 A;  4A3L G;  3RN2 A;  4A3M G;  1CKN B;  1QZH A;  3PUX A;  2JEA I;  4UP7 A;  3CCE A;  5IWA Q;  4MNO A;  3I4N G;  3RZO H;  2UXD Q;  1N8R C;  1Q86 C;  3RNU A;  2KCT A;  3J81 i;  3HFZ B;  1IL2 A;  2AMC B;  5ELN A;  1XNR L;  4LFC Q;  4BBR G;  4DV4 Q;  4OWT B;  1BBW A;  3KF6 B;  3SGI A;  4DNI A;  3A0J A;  3WWV A;  1KC8 C;  3UE1 A;  3F8T A;  3A5U A;  2Y0S G;  5AJ3 Q;  1EIF A;  4X62 L;  1I94 Q;  1OXX K;  1I50 H;  1YEZ A;  4A4I A;  2YV5 A;  1UEB A;  3F2B A;  2PNH A;  3OTO L;  1CKM A;  5C0X J;  3I55 A;  3TRZ A;  1GD7 A;  2JA6 G;  3GTK H;  4B3M L;  3MEF A;  4DV1 Q;  5C44 G;  4YCW A;  4R4C A;  2WAQ E;  2K50 A;  1KIX A;  4JBJ A;  4NXM Q;  1SLJ A;  4A3J G;  3T1Y L;  1TWG H;  3GO5 A;  3PGZ A;  3RLF A;  1EFW A;  4AIM A;  1N9W A;  2BA0 A;  4DK6 C;  3CQZ H;  5C3E G;  4IPG A;  4DR3 L;  3TS2 A;  1CKN A;  1EWI A;  4BXX G;  1SMX A;  3CCR A;  1TWH H;  1KD1 C;  4GKK Q;  1C9O A;  3GTJ H;  1QVF A;  2ZTD A;  3GTG H;  1Q12 A;  4MZ9 A;  1FGU A;  1SRO A;  4C3J H;  4NPS A;  1XPO A;  1WI5 A;  4LWC A;  5GAE C;  3KF6 A;  2HIV A;  4A3F G;  4A3K G;  2NVX H;  4JI3 Q;  4C3H H;  3EIV A;  5FLM G;  3J80 i;  1YNX A;  1GM5 A;  3GTQ H;  1PH4 A;  1YVC A;  4TQU S;  1X56 A;  4JI4 L;  4JI6 L;  2F4V L;  4JBM A;  2UXC Q;  3LGJ A;  3STB D;  4P73 A;  2PI2 A;  1BKB A;  4L5Q A;  4KHP L;  2ID0 A;  5ELO A;  1PVO A;  2IHF A;  3JC6 6;  2RHQ B;  4DAM A;  2JA7 G;  3F2C A;  4UPA A;  4A3G H;  1L1O C;  2E2H H;  1PA6 A;  4UP8 A;  1U0L A;  1XMQ L;  2UUA L;  1B70 B;  2XGT A;  4PZ6 A;  4JI6 Q;  3S1R H;  1N33 L;  2MFI A;  2B29 A;  2R6G A;  2JK8 A;  3D0F A;  3RLN A;  3E9H A;  4DV3 L;  2Q2T A;  3S16 H;  1D7Q A;  1IBM L;  1HNX Q;  5LMN W;  5JJI A;  3I4M G;  5M3F H;  4JI7 Q;  1X3G A;  1VQB A;  4JCV E;  2VQF Q;  4JYA Q;  4PZ8 A;  1V43 A;  4JC0 A;  4IPC A;  1O7I A;  4HJ5 A;  4DR2 Q;  4IPD A;  3PUV A;  2UUB L;  2ATW A;  1N33 Q;  2B3G A;  4AH6 A;  2B63 G;  5IYD G;  3UDG A;  4A3C G;  2E5L L;  4DPG A;  1UE5 A;  1Q46 A;  4OON A;  3K80 C;  5IY0 A;  4OO1 I;  2YU9 H;  1YJN A;  1JJ2 A;  3CC4 A;  3MXN B;  3HOX H;  1N36 Q;  1G6P A;  3HOY G;  4R4T A;  3KLW A;  2VUM G;  1X6O A;  2Q2U A;  4EX5 A;  2NVQ H;  2VQE L;  2PMZ E;  4JG2 A;  4BY7 G;  2BH8 A;  4BA1 I;  5C0X I;  3CMA A;  3GTO H;  4BY1 G;  3GD7 A;  4QQB X;  1L1O B;  2LSS A;  1PYS B;  4LNQ A;  3PO3 H;  4Y7N H;  2N3S A;  4A3I H;  2MO1 A;  3GTM H;  4IOA A;  3H0G G;  4K0K L;  4YY3 Q;  3BZC A;  5C4J H;  2R7D A;  3HOV H;  4P75 A;  4B3S Q;  1Y14 B;  1H95 A;  2QA4 A;  3ICE A;  5M5Y H;  2R7F A;  2N78 A;  2NVY H;  2I5L X;  3KYH C;  4DV2 L;  2ZJP A;  5FJ8 G;  3HKZ E;  1G51 A;  1VQE A;  3DM3 A;  2ZM6 Q;  3KOJ A;  1TWA H;  2N8N A;  3ER0 A;  4AYB E;  1LYL A;  1JT8 A;  2MO0 A;  2VW9 A;  2Z0S A;  2DGY A;  4JV5 Q; 
#chains in the Genus database with same CATH topology
 1C3O A;  5EZY F;  5FLX W;  2L15 A;  5IP7 G;  2JQO A;  2CCZ A;  3MHB A;  2YTX A;  3K81 C;  5ISR A;  5D1P A;  4JV1 A;  4Q0F A;  3OWE B;  3HOZ H;  4HCS A;  3OMG A;  3JAM i;  1K3B C;  3KHH A;  1SR3 A;  3ULJ A;  2PZT A;  1JKJ B;  5FPO A;  5DGA A;  4A3B H;  4A2B A;  1STH A;  1QE6 A;  1TR5 A;  2CKZ B;  4DV7 L;  1WR2 A;  3M85 A;  3OIP A;  1HNW H;  4QW9 A;  2YCH A;  1B3A A;  3PIO A;  3Q24 A;  3H0G A;  1EY4 A;  4WBN F;  2W9B A;  5C4X H;  1PH8 A;  3PUW A;  4MV8 A;  1WTR A;  3PZP A;  4J9N A;  3V6K A;  1EEF D;  1Y1V G;  2K52 A;  1G2T A;  5LMN Q;  3J7A V;  2AGQ A;  3H3V C;  3ULP A;  4DR5 L;  4UAI A;  1E7Z A;  2JA9 A;  1CZW A;  5A2Q E;  5ELD A;  4DV5 L;  4HMJ A;  1WVL A;  5DLG A;  3HOW H;  2B2T A;  1IBL H;  2VQD A;  4GZY C;  1XNR Q;  4QIW B;  1PMR A;  1PTO H;  3KFU A;  4YCV A;  2F0L A;  4DR1 L;  4MN3 A;  1ESF A;  4C3J G;  4MV7 A;  2NN6 G;  3CD6 A;  1AW7 A;  2V4D A;  2E2I B;  2Z9H A;  1CS0 A;  4A3L H;  4A3M H;  3OTO Q;  1FNW A;  4DV3 H;  1S97 A;  2DY8 A;  5DLQ E;  2DUD A;  1Q1B A;  1X3F A;  4ED8 A;  4TQR A;  1ZEQ X;  3GV6 A;  4ED7 A;  4OX9 L;  2QIL A;  4R7R A;  4QL5 A;  2DJF C;  2WTF A;  4LF4 Q;  2K7V A;  3FMC A;  4DR3 Q;  4EQP A;  2PI2 E;  5A2Q L;  4X65 L;  1I3Q A;  2F3I A;  3NEM A;  1N34 H;  4L5R C;  4F50 A;  5FLX L;  5CBA E;  4A3F B;  4JI5 H;  2RDH A;  1SNQ A;  3CW2 C;  3L9A X;  5EKI A;  1J5E L;  2R7M A;  3RB6 A;  4ED2 A;  1SYG A;  2E2D C;  2Y0S A;  4DKA C;  1UC8 A;  3Q8Q B;  4A3E H;  3PR5 B;  3BQ2 A;  4LF6 L;  3FVQ A;  2JA6 A;  2BQU A;  1N32 L;  4DV0 L;  5EDW A;  5TSS A;  3FKI G;  3U50 C;  2ICI A;  1EWH A;  4C1N K;  2EXD A;  3I73 A;  2R85 A;  3EFX D;  2M9V A;  3BDO A;  4CJ2 C;  4HTH A;  1XPU A;  2EYO A;  5JUM A;  5KFP A;  1RCV D;  3FKI B;  5EKK A;  1XMQ Q;  1LT5 D;  1ROD A;  1G29 1;  4LW1 A;  5CMD A;  3R5H A;  4DXG A;  4YHH L;  4MA5 A;  3D6W A;  4DUY L;  3V2T A;  1SXT A;  1PFS A;  4UCS A;  1SRU A;  2WYO A;  1DIK A;  3D3R A;  4RNM A;  1KTK A;  5BR8 L;  2CWP A;  3X3N A;  1OXS C;  1QVC A;  4JI8 Q;  4EBD A;  2Z6K C;  3RGX A;  4KJO A;  1DYQ A;  1EWC A;  3HOU G;  3L4J A;  5HGQ A;  1ZYR D;  2QEJ C;  3KUP A;  2QCP X;  1RYR A;  1EY9 A;  2CFM A;  4O3Q A;  4PG3 A;  4CJ1 B;  1YJ9 A;  2RHS B;  1AE3 A;  5M3M G;  3M4P A;  4ECV A;  1CQJ B;  2A5H A;  3T53 B;  4DR7 L;  5JJK A;  1U4M A;  2JA5 H;  1RJP A;  4IPH A;  2HHH L;  1JDB B;  1JLL B;  4X6A H;  4JI2 L;  4C5B A;  2KHI A;  4RGM A;  5LYJ F;  2N55 A;  5CV6 A;  5E7N A;  5M3M B;  3GV8 B;  2QKI C;  2LMC B;  1RD9 D;  2EYP A;  3CXC A;  1O80 A;  4CGY B;  2VQE Q;  5IYD H;  1CQF A;  4A3C H;  4TUY F;  3L3O C;  1Q81 C;  1KJJ A;  5GQO A;  1XMO H;  4F7X A;  2B2U A;  2F0F A;  3SVM A;  2WE6 A;  3HP3 A;  3TS0 A;  1OXT A;  1KNE A;  2IHE A;  2W8K A;  4J8Q A;  3HOY H;  3QZ8 A;  1EZ6 A;  1PZK D;  5BN3 A;  4DR6 H;  3V4S A;  1J9O A;  1PXU A;  3SK8 A;  5LL6 X;  3K57 A;  3N44 B;  1YIT A;  2W9C A;  4BY7 H;  3ERQ A;  4GNX C;  1EZ1 A;  1NMF A;  1ZQ7 A;  4BY1 H;  3E9I A;  3KBG A;  4DV6 Q;  3RTX A;  4J15 A;  2I5M X;  3QIA A;  3NBH B;  2KED A;  3J81 W;  3M7N A;  3R2T A;  3J7A K;  4JI1 L;  1BCP B;  2NN6 I;  3T5L A;  2EVB A;  1EHI A;  3I2Z A;  3WO0 A;  5FO7 B;  2W70 A;  3R5X A;  2R8K A;  1AE2 A;  1PHJ A;  3KF8 B;  5D1O B;  1L2F A;  4NXN Q;  1W3S A;  5LP6 F;  5C0X H;  4POF A;  2PN1 A;  4A76 A;  4JI0 Q;  1I50 B;  1B2T A;  1JT8 A;  1I4R A;  1NUC A;  4JPB W;  1RTO A;  1AFP A;  4JI3 H;  5IP7 H;  4ME6 A;  4RZR A;  3A7L A;  4WD3 A;  4LH6 A;  1B6R A;  2Z6K A;  4IRD A;  4X3T A;  4LFB Q;  4IFD J;  5KT6 A;  1I6H H;  3K0X A;  1NJI C;  1VQ8 A;  3TQT A;  3VYU A;  1IZ6 A;  2A6H D;  2L0C A;  3QFF A;  1PRT F;  5HV6 A;  2Z1C A;  1H9M A;  4DV1 L;  1KHI A;  1PH2 A;  1LAC A;  3MJF A;  1BXR A;  2LFN A;  3BA8 A;  1KAW A;  4E4T A;  4ECW A;  1SE8 A;  3J81 E;  1MJC A;  4JBW A;  3HBL A;  1Y1W G;  5KG5 A;  4P71 A;  2AWN A;  4GKK L;  1G8Z D;  1Y1V H;  3DWA A;  4B3R H;  1CA6 A;  2FMA A;  2VQF H;  4RNN A;  4J1M A;  3CPW A;  1JB7 A;  2MCT A;  1QUQ A;  1HNW Q;  3GQC A;  3RLO A;  1S10 A;  2ALY B;  4AQY H;  2OXP A;  1DOK A;  1ESR A;  1T36 A;  5KFO A;  2E2I H;  4K2K A;  2IW3 A;  1X55 A;  2RKS A;  3RZD H;  2I0Q A;  5GRO A;  2XVS A;  1HA6 A;  4A3G B;  2E74 C;  3CAM A;  2E2H B;  1FJG Q;  1EQT A;  4ALP A;  2JE6 I;  2PW5 A;  2MPM A;  4EQ5 A;  1RJQ A;  3J7A F;  3RIZ A;  3OUU A;  1WCM G;  4HIO A;  1HZA A;  2VNU D;  2F4I A;  4GNX A;  2DY7 A;  3PIP A;  3S9W A;  3J81 L;  3S16 B;  2FMC A;  1IBL Q;  3NHH A;  3VYS A;  1VQG A;  1P16 A;  3BVM A;  4A3F H;  4F4Z A;  2KUM A;  2OEO A;  2CWA A;  4MIU A;  1S5F D;  2Z4H A;  1GXD C;  2SNS A;  4RAZ A;  4F8M A;  1CUK A;  1F9R A;  4J9Q A;  4DR2 L;  3Q6S A;  2K4K A;  4HID A;  4G7Z C;  1Z2O X;  4R9W A;  2YU9 B;  4O4H F;  1PH3 A;  1B50 A;  3Q8P B;  3KXY T;  2F52 A;  1T5X D;  1E2W A;  4G7O C;  1HRJ A;  1K83 B;  1RTN A;  3C46 A;  1SFO H;  2D5D A;  3DLL A;  2ES2 A;  3FKI H;  1N34 Q;  3NTH A;  2BH2 A;  1RKN A;  1O75 A;  4FP5 D;  2X69 A;  5FPR A;  1JB3 A;  3HKZ G;  1LTG D;  1EY8 A;  4Y7N B;  4R1J A;  1YJW A;  4XDX A;  3BQ0 A;  4RMF A;  4FS1 A;  3TQY A;  3RBE A;  3OYY A;  3PF5 A;  4L1K A;  3WDN A;  3UI2 A;  2XD4 A;  4ZAI A;  4ZI7 F;  2AHO B;  4FXD A;  4YY3 L;  5JOB A;  1W6K A;  4B3S L;  4WJ4 A;  1HNZ Q;  3A74 A;  2R84 A;  1DCZ A;  4CDF C;  3HOU H;  2RCF A;  2DLN A;  3K5L A;  3F2D A;  2ZM6 L;  5JJL A;  2HQL A;  4O42 A;  4O3N A;  4LFC H;  2PQE A;  1FVI A;  1NR2 A;  2BOS A;  5LL6 S;  1LT3 D;  2NZ1 D;  4R8I A;  3CCL A;  2B2Y A;  1ZYR C;  2DJG C;  5M3M H;  3MAQ A;  4B3T H;  3JAM W;  2UXB H;  1KJ9 A;  1BO0 A;  3VR3 A;  2OLS A;  1HFG A;  2IX3 A;  1OTC A;  5I6Y A;  3FPP A;  2R8G A;  5CYU A;  1D5M C;  4ZRZ A;  2WB1 E;  1B1Z A;  1R4P B;  3C2P A;  4QUC A;  4RU9 A;  2FLL A;  4YBZ B;  3RZO B;  3WOE A;  2HDL A;  2IL8 A;  3EA6 A;  4CDE C;  4X62 H;  1WFQ A;  4ZQ3 A;  3TP8 A;  3VR5 A;  2LXK A;  4DAY A;  4GLV B;  4TRD A;  4U68 A;  1A8V A;  2B8G A;  3KJP A;  4UCO A;  5IWA L;  2I5H A;  1A0I A;  1EFI D;  5M5W B;  4ODG A;  1GUO A;  1Q1E A;  2C9O A;  5LXT F;  4B3M H;  3ORR A;  4U7C A;  2GLT A;  3VPD A;  4B08 A;  1TWC A;  3CVZ A;  3GTL A;  3KAL A;  1WYD A;  5BN5 A;  2R61 A;  4J9P A;  3PR4 A;  1HZB A;  3CCE A;  2F0W A;  3QG1 A;  5JAV A;  3JAM E;  1R9T B;  5C8Y F;  4F4Y A;  2AMC B;  2BDO A;  4BBR G;  1SNC A;  1BBW A;  2MUY A;  3WWV A;  5KFX A;  2Y0S G;  2V9W A;  1I50 H;  1ILP A;  1YEZ A;  2PO4 A;  5DAU A;  4A4I A;  2HDM A;  4RZQ A;  3PW7 A;  4KHP H;  1HFN A;  3RB0 A;  2JA6 G;  3EJI A;  4A3D B;  4QWB A;  2WAQ E;  3OUZ A;  1STN A;  2UUA H;  2PZW A;  3RLF A;  3TIG A;  1KBL A;  2L4N A;  5C3E G;  5CB4 F;  1EWI A;  1SMX A;  1IL8 A;  3BDC A;  3JAM L;  3CCR A;  1WSC A;  2NU7 B;  1I6U A;  4LSX A;  1QVF A;  1Q12 A;  1SRO A;  2W6N A;  4NPS A;  2L11 A;  4FNF A;  2NWG A;  2RSO A;  2A6H C;  3RD4 A;  2CZG A;  4A3K G;  4JI3 Q;  5DQH A;  5FLM G;  1YNX A;  3A8J E;  1YVC A;  1D6E C;  4KY5 A;  1X56 A;  2HJW A;  4DL4 A;  5KG2 A;  5E4W C;  4J9R A;  4TSS A;  2F4V L;  4OIK A;  4ECU A;  2F0V A;  3STB D;  2YZN A;  4FF1 A;  5ELO A;  3O13 A;  3JC6 6;  2RHQ B;  4DAM A;  2JA7 G;  2G9D A;  4A3G H;  2E2H H;  5KFA A;  1K28 A;  2WII B;  1B70 B;  2XGT A;  4RCN A;  4JI6 Q;  1U9R A;  2HQE A;  2JA7 B;  1JR0 D;  3E9H A;  4DV3 L;  3S16 H;  4APM A;  4K0K H;  1WTO A;  2VQF Q;  2VB3 X;  3P1H A;  2BE5 D;  4IPC A;  2AQ4 A;  3V6J A;  2UVV A;  5E3F A;  2I8C A;  1N33 Q;  4DN4 M;  4DV2 H;  2YZM A;  4CBV A;  1AUV A;  5BMV F;  2RGR A;  1UAP A;  2RVL A;  2XRS D;  2JEI A;  2F1M A;  3G6Y A;  4BWS C;  2NVT B;  2YU9 H;  2XN9 C;  4AYB B;  2DPJ A;  1MI2 A;  1G6P A;  5L1L A;  1GSA A;  1ZHS A;  2Q2U A;  3MR6 A;  1DXM A;  2PMZ E;  3ETH A;  3G6J B;  3QZ7 A;  4JUZ A;  3CMA A;  1KDA A;  4C3I G;  3GD7 A;  1PYS B;  4Y7N H;  5FO8 B;  5LMN H;  1RHP A;  4IOA A;  2DIK A;  2F0K A;  2R7D A;  4EQO A;  2UVW A;  4DR4 H;  5LMU H;  2QA4 A;  3SE7 A;  4FXK C;  3QJY A;  5CV4 A;  1QNU A;  5KFY A;  2EY6 A;  2YYA A;  1F9Q A;  2PPB C;  2BDN A;  3K59 A;  4EYH B;  2EY5 A;  4X3U A;  2SEB D;  1IBM L;  1C8C A;  2F0G A;  3PN1 A;  1PTO F;  1PH9 A;  4UY8 C;  5IGD A;  1M6V A;  1K8M A;  3T1H H;  4FBU A;  1RJT A;  1JWS D;  4YJ3 F;  2DWC A;  2R93 A;  5KG1 A;  4IFD H;  1GUS A;  1SNP A;  4JVZ A;  5IGC A;  5BPF A;  1L0X B;  4LF4 H;  4YWM A;  3TSS A;  5H1S E;  4MV3 A;  1B33 N;  2MJ8 A;  2UXC L;  5KFB A;  4E6I A;  1I7L A;  1F2Z A;  1HQR D;  1ML0 D;  3FRP B;  2BCO A;  3PSI A;  4RB3 C;  5EKL A;  3I70 A;  4FF2 A;  1E4E A;  2PCF B;  4DUZ L;  4O1N A;  2KQ3 A;  3KBX A;  4A3M B;  5M5W H;  1HR0 W;  4HAE A;  2R87 A;  2C28 A;  5EPJ A;  3LML A;  4B3T Q;  2UXB Q;  2W57 A;  4DV7 Q;  4RFB A;  2UU9 L;  4IZO A;  5KT2 A;  5DQI A;  3S15 B;  4LF7 H;  3EPG A;  2R92 G;  4LJZ C;  4FXG C;  1JX4 A;  3H3V I;  4X66 H;  1S4Z A;  3ETJ A;  1LTL A;  1KJQ A;  1R9T H;  4DL6 A;  5I6W A;  4LF9 L;  4X62 Q;  1YHB A;  3E5S A;  2ASJ A;  2R92 B;  1TXY A;  5C44 B;  5CV5 A;  2F0P A;  4C3H G;  4DV5 Q;  1KLU D;  4A3J B;  4J9O A;  1IBK L;  4B3M Q;  4JI8 H;  1BBU A;  2MP1 A;  4KN7 C;  3M4I A;  1A62 A;  4QWD A;  3L7Z C;  2WDT A;  2A19 A;  2IX0 A;  2XCL A;  5K2M A;  3KJO A;  4A3D H;  4ZK9 B;  1VQD A;  4DU9 A;  1UNN C;  4O2B F;  1SYF A;  4QIW E;  2IMW P;  1JCK B;  4LH7 A;  1BNZ A;  2KCN A;  1WTV A;  2ZTE A;  1C0A A;  4OX9 Q;  5KG6 A;  3J7Z C;  3KLS X;  1B6S A;  3VR4 A;  1GHK A;  5KFM A;  4YR0 A;  1SYE A;  2VOB A;  4X64 L;  3TEH B;  5M3F G;  4P74 A;  1Q8K A;  3VR6 A;  3KHG A;  4X65 Q;  4PDB A;  4ZUI A;  5FD6 A;  4X3K A;  2V59 A;  4MTK A;  3TIN A;  4QWE A;  3S1Q H;  4KHP Q;  1CSP A;  2ZXO A;  1DON A;  1LO5 D;  4IAJ A;  4QW8 A;  2XIW A;  4GC6 A;  2L12 A;  3CHB D;  2UUA Q;  4EBE A;  2PQA A;  2BQR A;  2OH2 A;  1ZHQ A;  1HR0 L;  4B3R L;  1L0Y B;  3TQ1 A;  2K75 A;  2UVU A;  2DNE A;  3I4M B;  2FPP B;  3H3V H;  2K5H A;  3K5H A;  4Q0Y A;  4DV6 H;  3MFH A;  5JEA G;  4AQY L;  1IYV A;  2B2T C;  4KI0 A;  4JOI A;  5C3X A;  1YI2 A;  2JA7 H;  5EBC A;  2EYJ A;  3STB C;  3NE5 B;  2OTJ A;  1EYZ A;  4YCU A;  5KFU A;  4ID6 A;  2UUB Q;  4YHH Q;  1K8G A;  3PW4 A;  3N42 B;  3HXL A;  1E2Z A;  3GII A;  5IIF A;  3GIJ A;  3DMU A;  4XXE A;  1SBB B;  4FS2 A;  1DZ1 A;  2VUM B;  5IOC A;  1P8L A;  2YTY A;  4GOP C;  4EVO A;  4NXN H;  3KDF A;  1HHV A;  4K14 A;  4C2M B;  4YAK B;  1M7J A;  2L9H A;  2NVT H;  4BY1 B;  5KFI A;  2RA4 A;  1FR3 A;  3MEH A;  1MIU A;  4DL5 A;  2DN8 A;  2BE5 C;  2W8L A;  3BA9 A;  3IRB A;  5I2Y A;  5EWG A;  2UXD H;  3D4D A;  3EVQ A;  4K0K Q;  2B63 A;  1WTW A;  3EQL C;  1QG7 A;  1JJG A;  3M9B A;  4K2L A;  4DAP A;  3PUY A;  4I4T F;  4DV4 H;  3I90 A;  3GV5 B;  2VUG A;  2EXZ A;  1SN8 A;  2WAC A;  4DV2 Q;  1JDE A;  4TV9 F;  5CBE E;  3I91 A;  2R7Z G;  1I94 H;  2LY7 A;  1C4Q A;  1II3 A;  4RGO S;  4YJ2 F;  5T1I A;  3X3M A;  2XSC A;  3IFT A;  1S0M A;  4YQW A;  3SHL A;  2WFW A;  3M4O H;  3MWE A;  2R7Z B;  4H02 A;  1GUN A;  3R3O A;  4R4Q A;  1I6H B;  4NXM H;  3G71 A;  1NBW A;  4PNY A;  3IAY A;  2UUC L;  4BA2 I;  1XNQ L;  1ENF A;  1CQV A;  3U9T A;  2JEJ A;  1EZ8 A;  2PYK A;  2QDB A;  3JZI A;  1FJG H;  4CHT B;  4N8F A;  2WIN B;  4K6D A;  1JOK A;  4N9P A;  5I4D A;  3P75 A;  1VF5 C;  1CTM A;  1S5B D;  2K04 A;  5A35 A;  4DR4 Q;  1AEX A;  4GKJ L;  4LFC L;  2XTI A;  4DNR B;  1VQ6 A;  3J7A 5;  5I47 A;  5LMU Q;  4PMW A;  1NAP A;  4I7A A;  1Y1V B;  4JI1 Q;  3AYH B;  5CGK A;  4P72 A;  4M9U A;  5AJ3 L;  1RL2 A;  1H95 A;  3C3L A;  4XYQ A;  2NU6 B;  1UE6 A;  3B6Y A;  5COY A;  4L8J A;  3K5N A;  4G3I A;  1ICW A;  1TWG B;  4RB0 A;  1WOC A;  2ZJR A;  1NE3 A;  2VB2 X;  3RAQ A;  3CQZ B;  2ASD A;  5T14 A;  4A75 A;  1HH2 P;  1B3Q A;  3RZD B;  2Q2H A;  1B4O A;  1TWH B;  1PK8 A;  4DK1 A;  3A8I E;  3T1H Q;  2B2V C;  1H9K A;  2QEX A;  2Z6B A;  5ELF A;  4C3J B;  1H9R A;  3G7L A;  4GOP A;  4IUR A;  3GIK A;  1KDC A;  4GN3 B;  2B2U C;  3S15 H;  2VA2 A;  5JVL A;  3GTQ B;  4OXP A;  1KLG D;  5GAD C;  2DPI A;  3WOF A;  1FL0 A;  4PZ7 A;  3MXU A;  1S72 A;  2ZJT A;  3ZJY C;  1KL9 A;  3GTK A;  5HBR B;  2SOB A;  2R92 H;  4XT1 B;  5J3B A;  5C44 H;  5IYC G;  4A3J H;  2ZDQ A;  2A6E D;  1LTT D;  3C1F A;  2QF7 A;  3CF5 A;  3CCM A;  3H4B A;  1A63 A;  3HKS A;  4ME5 A;  1LTI D;  4H0L C;  5KG0 A;  2Z4I A;  4HNV A;  1F77 A;  4MTD A;  2R7N A;  4O0A A;  3GTJ A;  1CFM A;  4TKO B;  1Y8O B;  3HZX A;  2W6Z A;  5KX5 F;  1HNZ H;  4LF7 Q;  3GTG A;  1KDB A;  2F0D A;  2E75 C;  1EY5 A;  1SFO B;  3H4D A;  1SSO A;  4HJ8 A;  3TII A;  4ECX A;  3MC0 B;  2NVX A;  1BUV T;  4X66 Q;  3SI8 A;  5ELE A;  1WTP A;  2K28 A;  2RDJ A;  1HNX L;  2RQX A;  2YYZ A;  4JI7 L;  2JJQ A;  4UCV A;  1ZXT A;  4GLA C;  2VPS A;  3Q8D A;  2OCE A;  4OEM B;  2OWO A;  1K8A C;  3CRK C;  2Q8I B;  4OHJ A;  1ET6 A;  3H91 A;  4CC6 A;  3K7U C;  1VQJ A;  4KMU C;  3K3P A;  4KJN A;  4LSA A;  1CT1 D;  4MA0 A;  4ZLT F;  1TVX A;  1XJV A;  3PO3 G;  4KD4 A;  4MTE A;  4JV5 H;  4LF5 H;  3K5O A;  2WV6 D;  3HOU B;  4QMG A;  4Q44 A;  1N36 L;  3BYY B;  2VL6 A;  3ND8 A;  2D0O A;  4RKL A;  2O2L D;  1S5D D;  4RHR A;  3LWB A;  3M4Q A;  4LFA H;  2O4X A;  1QNK A;  3PO3 B;  1KEE A;  3I4M H;  1SEB D;  5C4J B;  1U5K A;  3AB9 A;  4OWW B;  3F8N A;  1VQI A;  1YNJ D;  3EN2 A;  2B2V A;  3RUZ A;  1B44 D;  3AU7 A;  4M8A A;  3E3X A;  3CU7 A;  1TS5 A;  2SNM A;  2R93 G;  3OSN A;  1E3P A;  2PZU A;  5CA0 F;  5COR A;  1A15 A;  5JEA H;  1IXR A;  4MTN A;  2A68 D;  1Y8P B;  3EBE A;  3RMH A;  2F0Q A;  3BJY A;  4LF8 H;  1CK1 A;  1V1P B;  5DG9 A;  1PH6 A;  4ZUJ A;  4NLG A;  1BCP F;  2VUM H;  4A93 G;  1Z47 A;  2C2R A;  2FHT A;  3CC2 A;  4L5T A;  1TWF B;  1FNV A;  4ED1 A;  3JSL A;  4C2M H;  2E8G A;  3QOL A;  2CQO A;  2F03 A;  5I2X A;  4OO1 G;  4N9T A;  1JXL A;  2EYH A;  2CVR A;  2XCP A;  4QUF A;  3GTM A;  1K73 C;  1WTH A;  1AN7 A;  4IWY A;  2P0A A;  4R8U A;  2WB1 A;  2JSO A;  1NSN S;  3PQI A;  5IGE A;  1T3N A;  2NVY A;  1E1O A;  4XZ3 B;  2C2D A;  4K8I A;  1F9P A;  2E2J H;  1PH1 A;  1TWC H;  2JXM B;  2GN5 A;  1TWA A;  4C5C A;  5KND A;  2RF4 A;  1PZJ D;  2DNC A;  2AU0 A;  1E1T A;  2X6L A;  3RAX A;  1E22 A;  4BS9 A;  2KEE A;  2ZXP A;  3VPB A;  2J4X A;  1NTG A;  1RDP D;  3T1Y H;  2KOL A;  3LX0 A;  1IW7 D;  4TVA B;  1IHZ A;  1I4P A;  1D8L A;  1QCB D;  2R7Z H;  5G3L F;  5KFL A;  2JEA I;  4UP7 A;  1SMY D;  5IWA Q;  3I4N G;  2UXD Q;  5T1G A;  1Q86 C;  1S68 A;  4ZCK A;  5KT7 A;  3RNU A;  2KCT A;  2GA4 B;  3HFZ B;  1IL2 A;  4EFE A;  2FPG B;  1V51 A;  3HS0 C;  2NU9 B;  1XNR L;  5D65 A;  3A55 A;  3GQB A;  4DV4 Q;  3DM1 A;  3SGI A;  4DNI A;  3A0J A;  2EOT A;  3NWT A;  1TY2 A;  1VMC A;  3A5U A;  3LWE A;  4JI4 H;  4JI6 H;  1ONL A;  2F0N A;  1OXX K;  3T56 B;  1I94 Q;  1Y8N B;  2PNH A;  3OTO L;  1CKM A;  5KFQ A;  1HTL D;  1U4L A;  2CQY A;  4YCW A;  4R4C A;  1KJI A;  2K50 A;  3I72 A;  4NXM Q;  1D5X C;  1Y1W B;  1TWG H;  3GO5 A;  1X3Q A;  5E4X A;  3ZYY X;  2WAQ A;  1H9S A;  1N33 H;  2B2Y C;  1SYC A;  4DK6 C;  3NWS A;  3CQZ H;  4DR3 L;  1UEA B;  1CKN A;  3TS2 A;  2K01 A;  4BXX G;  1TWH H;  1S5E D;  1I4H A;  3M7G A;  1WH2 A;  4MZ9 A;  3PIO 3;  1EY0 A;  1FGU A;  3V05 A;  4C3J H;  4U67 3;  2NN6 H;  5J2T F;  1WI5 A;  2JN4 A;  4LWC A;  5GAE C;  4RUA A;  1QWY A;  3KF6 A;  1QIL A;  4U6P A;  1GM5 A;  3GTQ H;  1PH4 A;  5DLF A;  4TQU S;  1JOO A;  2XRQ D;  3LWU A;  2XWB B;  1C30 A;  4K5W A;  1T94 A;  3VMM A;  5KFF A;  1EUC B;  2WKD A;  3JSN A;  4DL7 A;  4JBM A;  1WCM B;  1CI3 M;  4ZKC B;  1D1K A;  2FMM A;  2ID0 A;  1PX2 A;  3F2C A;  2IA6 A;  1L1O C;  1PA6 A;  3NXW A;  1XMQ L;  4ECS A;  1KAA A;  1LT4 D;  4ZQI A;  5KNB A;  2L55 A;  3EYY A;  4PWQ A;  3OWF A;  4F88 A;  5JH7 F;  3RLN A;  3AMU A;  3GTP B;  1RJR A;  1SJE D;  1U4P A;  2I87 A;  4IR9 A;  4EEQ A;  1X3G A;  4JYA Q;  4O2A F;  3KHR A;  1LTR D;  1EYA A;  1O7I A;  2A6E C;  2W6P A;  3PUV A;  2B3G A;  2Q8T A;  4AH6 A;  2B63 G;  3UDG A;  2QW7 A;  2QYZ A;  3RFC A;  2C2E A;  1A3T A;  1FYC A;  5KYL A;  1Q46 A;  4OON A;  4OO1 I;  3HKZ B;  3CC4 A;  3MXN B;  4MV9 A;  1TT2 A;  4KY7 A;  5F2D A;  4HR7 A;  1WTQ A;  1D2B A;  4EX5 A;  5CAE B;  2VQE L;  4FF3 A;  3BG5 A;  4JG2 A;  5FO9 B;  1F9S A;  4IUU A;  3MFY A;  3HG9 A;  1WD0 A;  1QOH A;  4HED A;  2PMZ A;  4QQB X;  1MZB A;  3QO2 A;  4LNQ A;  3PO3 H;  2N3S A;  1GSH A;  3H0G G;  4DV7 H;  5J22 A;  3N41 B;  3BZC A;  2JA5 A;  4KK7 A;  5C4J H;  3UFX B;  1PRT D;  3GTO A;  2NUA B;  2N78 A;  3MXP A;  2I5L X;  4C1N I;  2IPK D;  3Q22 A;  5FJ8 G;  1ULZ A;  4YAJ B;  1VQE A;  3H0G B;  3DM3 A;  3I8Z A;  4YB8 B;  2W9B B;  1BXT A;  2N8N A;  4AYB E;  3E5N A;  1GOZ A;  4I7H A;  2VW9 A;  2Z0S A;  4JV5 Q;  4LF5 Q;  4ZHQ F;  3VA5 A;  1ENC A;  4DR5 H;  1VMP A;  2AUJ D;  4P2C B;  1VQ7 A;  3S1M B;  1W6J A;  4O3O A;  4H7B A;  1YNJ C;  2R93 H;  4DK3 C;  4DV5 H;  4LAA A;  1AZQ A;  4LFA Q;  4K5X A;  1TWF H;  4GN4 B;  3G6E A;  4KV6 A;  1ILQ A;  5GAG C;  2W71 A;  3SXH A;  1RF2 D;  1L1O A;  4DR1 H;  1JQY D;  1JWM D;  1SND A;  1Z9F A;  2A68 C;  2N49 A;  3R2I A;  2XWJ B;  1YBY A;  4OL7 A;  5IP9 G;  2ZJQ A;  2XNA C;  5KG4 A;  4QWC A;  2IWH A;  4Q8E A;  4NXN L;  1BR9 A;  3S24 A;  1VQF A;  2Q8R E;  4JI0 L;  1Z2P X;  5KFS A;  4OO1 H;  4JBK A;  5GAH C;  2EPB A;  4QB4 A;  4LF8 Q;  4OX9 H;  3MFI A;  4LFB L;  3CCQ A;  3AEV A;  3DEO A;  2FJ2 A;  4GLX A;  1EQQ A;  4UDU C;  1NY4 A;  1ZKO A;  4X65 H;  4UCU A;  5KG3 A;  4ED3 A;  1I3Q B;  4GN5 A;  4CKB A;  5EPK A;  4BBR B;  4DK0 A;  5KIX A;  1J5E H;  2W6Q A;  3U9S A;  4QF4 A;  2HIX A;  2VZA A;  4CDC C;  2Y0S B;  3H40 A;  1SE3 A;  4LF6 H;  3CP0 A;  1SDF A;  3J80 c;  2F0H A;  1S9F A;  4DAV A;  1S40 A;  3L0O A;  4TV8 F;  1N32 H;  2FJZ A;  4DV0 H;  2JA6 B;  1GO3 E;  4HJ9 A;  1ICF B;  1IW7 C;  5M5X B;  3I4N H;  2A8V A;  4BBS G;  1HNW L;  2R3Z A;  3CCJ A;  4PQX A;  1IYU A;  1V1O A;  1GHJ A;  1SMY C;  5C3E B;  3T1Y Q;  1I4G A;  4QGU A;  2KEN A;  1M1K C;  2UUB H;  4BBS B;  1FJG L;  3F1Z A;  3SDZ A;  1SE4 A;  2ICE C;  3S1Q B;  1BBX C;  4YHH H;  2AQ2 B;  4DUY H;  4UCR A;  2YW2 A;  1RIP A;  4IUN A;  4ME3 A;  3VDY A;  1Y1W H;  1RYS A;  3CPF A;  4YR2 A;  1XYI A;  4A3K B;  2IT1 A;  1A3U A;  1PLF A;  1IBL L;  1SE2 A;  4QIW A;  4YWL A;  5ELB A;  3TRE A;  2LXJ A;  1TU2 B;  1ASZ A;  4N8X 1;  3P20 A;  1TAE A;  3N52 A;  3TME A;  4JI4 Q;  2G5D A;  2R7K A;  2E2I A;  2A1A A;  4HJ7 A;  2V4R A;  2HHH H;  1GJX A;  4JI2 H;  2FP4 B;  2AGP A;  1I4X A;  1VQ9 A;  4QY7 A;  3K6O A;  4EGV A;  1WCM H;  2O03 A;  2IP4 A;  4ILW A;  4IHJ F;  5EAY A;  4Q43 A;  1FNU A;  1V4Y A;  4X64 Q;  1LTS D;  4C56 C;  4NP5 A;  5KFW A;  1STB A;  1IYJ B;  1S03 G;  3KTM A;  1N34 L;  1LT6 D;  1B7Y B;  4JI5 L;  2EZV A;  3V6H A;  2NBF A;  2FPI B;  4OWX B;  4DA2 A;  5JVH 3;  4ULL A;  3GTP H;  1EQR A;  1KRS A;  4DGZ A;  1VF7 A;  4RGN A;  5FKA C;  3M9M B;  4A3I G;  3RV3 A;  2W9C B;  3PIP 3;  2WB1 G;  2E5L Q;  2O5J C;  5L1I A;  4WJW A;  2FXQ A;  1M8A A;  3D31 A;  1TQO A;  1VQA A;  1HTP A;  4V19 0;  3UE0 A;  3FKI A;  1YIJ A;  2R86 A;  1MSG A;  2FLN A;  3I3C A;  1JMC A;  5DM7 3;  2KBN A;  4XYO A;  4C3I B;  2R8J A;  4I7Z C;  1GKH A;  3RB4 A;  4JI1 H;  2QK4 A;  1WJJ A;  3M4O B;  1SAP A;  3KLS A;  2W6M A;  2R8H A;  3V96 A;  3L2P A;  3R23 A;  1F2L A;  5LL6 b;  5DM6 3;  2JEB I;  4L5S A;  4NDX A;  4EBC A;  4HCE A;  5JEA J;  3HOZ G;  5AFW A;  3UDX A;  3T4A C;  3S17 B;  1W96 A;  1STE A;  2ZTC A;  3OPO A;  4A3B G;  2RBM A;  3C1E A;  4JK1 C;  3PF4 A;  3PUZ A;  3K7A B;  1K0S A;  5JQW A;  2HT1 A;  4O3R A;  2B39 A;  1EUJ A;  4DV1 H;  3H0G H;  1E0B A;  3BDL A;  1MJE A;  5C4X G;  2R8I A;  2F0E A;  5H80 A;  3NEL A;  2ZDG A;  3W5O A;  4DNT B;  4K6L A;  5FJ8 H;  1PRT C;  3S1M H;  2IY5 B;  4F4W A;  1XMO L;  3CME A;  4GKK H;  2WAQ G;  1YHQ A;  4JOI C;  3TP7 A;  1SYB A;  3NSW A;  4IQZ A;  4IWX A;  5FOB B;  2NB0 A;  4XIG S;  1CSQ A;  1O7Z A;  3ULL A;  1QUQ B;  3D8G A;  1DOL A;  1CM9 A;  1NR4 A;  4FVM A;  4DR6 L;  2PBZ A;  3DWP A;  1IKM A;  1UWV A;  4CJ0 B;  3T51 B;  2SCU B;  2JEG A;  3PMF A;  4IRC A;  1STG A;  2YS6 A;  1D1I A;  5IP9 H;  1JJC B;  3PW2 A;  3NBH A;  4DR5 Q;  4J9K A;  1STA A;  4GKJ Q;  2K03 A;  2NZO A;  4NW2 A;  3JRW A;  4GNX B;  5C5L A;  1VQH A;  1PZI D;  3MFG A;  5KT4 A;  5IT9 c;  1Q3L A;  1I3Q H;  2FIN B;  1EU4 A;  5KT5 A;  1MBY A;  5C4Z A;  3A56 A;  2NTS A;  4BBR H;  4DR1 Q;  4GS3 A;  4C3H B;  3KF8 A;  1CE8 A;  5D1O A;  1LV9 A;  1E2V A;  4ETS A;  3E0J A;  5KEE A;  3AQQ A;  2PW7 A;  1VQ4 A;  1I50 A;  2J6T A;  4MAM A;  4A3E G;  5E1F A;  3RR5 A;  1GVP A;  5JVG 3;  4WRD A;  1PV4 A;  3GID A;  3M9N B;  4DR2 H;  4JI3 L;  1SCU B;  1JE5 A;  4IJH A;  2JA6 H;  3MXG A;  5KG7 A;  1E4F T;  2KJX A;  3D4R A;  1D5Z C;  4I50 F;  2M05 A;  3J81 j;  5C5J A;  5M5X H;  4LMY A;  3BU2 A;  2ENB A;  2H1E A;  4IR1 A;  3VA7 A;  1JC7 A;  3GIP A;  4G4K A;  1DV2 A;  5C3E H;  3KAJ A;  4I55 F;  2XIG A;  5DGB A;  1H9J A;  4BBS H;  3K5I A;  5J2U F;  3IN5 A;  4HIK A;  1XTD A;  1J5E Q;  2KSW A;  3D4W A;  3L4K A;  2K05 A;  4IOC A;  1VQC A;  5M3F B;  2A69 D;  1W2B A;  1HCZ A;  1PH5 A;  4LF6 Q;  4A3K H;  5FLM H;  1AZP A;  2EIF A;  1B9N A;  2FKL A;  1DJR D;  1N32 Q;  4DV0 Q;  5DNF A;  3JRX A;  1HJP A;  4YY3 H;  3ERS X;  2VQF L;  3HOX G;  3OHB A;  3G48 A;  4B3S H;  1PTO D;  1VKZ A;  1HZ9 A;  4NB3 A;  4Q5V A;  1B8A A;  1EIY B;  1V1Q A;  5KT3 A;  1F2Y A;  1X65 A;  1EY7 A;  1V9P A;  2K5W A;  2JA5 G;  2ZM6 H;  2E2H A;  3HOX B;  1C7Y A;  1UUP A;  3BZD B;  2H4O A;  1KQS A;  4ECY A;  4DUY Q;  3OIQ A;  3W1B A;  2H5X A;  3TP6 A;  4RUC A;  1TS3 A;  1C48 A;  3HOV G;  1X32 A;  5BR8 Q;  4EFB A;  3BVG A;  3MR3 A;  2KCC A;  3HGB A;  4WFN 3;  4HJA A;  3FEW X;  4V0B A;  4DFA A;  2BR0 A;  3I4L A;  4HN7 A;  1EQV A;  3NQI A;  3HOV B;  1IKL A;  4O3S A;  1PYB A;  5KNC A;  4DR7 Q;  2A74 C;  2HHH Q;  4JI2 Q;  1GGO A;  5IWA H;  4DAY B;  1K9M C;  2YU9 A;  5BN4 A;  3DHQ A;  4YP3 A;  2D62 A;  1T9H A;  3PCO B;  5M9O A;  4KHZ A;  2E2J B;  4ECZ A;  2J6U A;  1TWC B;  4S3S A;  1K83 A;  5HGT A;  3S2H B;  2I46 A;  2KA7 A;  4HQ6 A;  3HEJ A;  3GTL B;  4ZOL F;  1SNM A;  1I4Q A;  2CW0 D;  3RJ0 A;  5DG7 A;  1UE7 A;  2EE1 A;  3BZK A;  4DLK A;  1TA8 A;  2F0T A;  4C3I H;  4J0M A;  3MZ5 A;  5FLX c;  5KKN B;  3BQ1 A;  3RB3 A;  3FP9 A;  4XTC S;  3U58 A;  2KVM A;  1N48 A;  3BAB A;  5C0X G;  5IYZ F;  2K5N A;  1BDO A;  1VQN A;  1B04 A;  1XPR A;  3SK4 A;  3S17 H;  3PO2 G;  1J6Q A;  1DGS A;  5F9N A;  1LAB A;  3K7A H;  1QJO A;  4JW0 A;  1PFM A;  3K5M A;  4YIJ A;  4KLK A;  4XT3 B;  1VQM A;  1K3R A;  1VBG A;  1TII D;  2V1C C;  1GUG A;  2F0U A;  2I07 B;  3H6M A;  3PO2 B;  1HA5 A;  3GDE A;  4J6H A;  1BQQ T;  5EPL A;  5CV8 A;  4B3T L;  2UXB L;  3GV7 B;  4ECQ A;  2ALZ A;  1XXG A;  2CQA A;  5EQ0 A;  3R5F A;  3I12 A;  2PVP A;  3R93 A;  1OWT A;  2NU8 B;  5L9X A;  4OWT B;  1KC8 C;  3UE1 A;  3MVV A;  5CA1 F;  1EIF A;  3D6C A;  4X62 L;  2F4V H;  4J9M A;  3F2B A;  4MV1 A;  1HXY D;  3FDT A;  2ATL A;  3TRZ A;  1GD7 A;  5FLX E;  4B3M L;  1EYD A;  1IOW A;  4DV1 Q;  1DD2 A;  1BJT A;  3S14 B;  4KKU A;  4JYA H;  1SLJ A;  3Q23 A;  1EL0 A;  1EFW A;  4AIM A;  1N9W A;  4OEL B;  2BA0 A;  4LMQ D;  3TN2 A;  2RGV A;  4IPG A;  4XQQ A;  5CV9 A;  3G6V A;  4GKK Q;  1UC9 A;  1C9O A;  2ZTD A;  1R9T A;  1XPO A;  1K1Q A;  1EIH A;  2GPW A;  1Y69 U;  3N6R A;  3K0Y A;  5KFV A;  5NUC A;  4A3F G;  1SYX B;  4C3H H;  3EIV A;  3ND9 A;  3J80 i;  1VBH A;  5KFC A;  4Q45 A;  1O7L A;  1AUX A;  1EYC A;  3GV3 A;  2G9H D;  4P73 A;  3T13 A;  1BKB A;  1RK6 A;  4HYK A;  4L5Q A;  1X3P A;  4KHP L;  2IHF A;  2TSS A;  1PYW D;  1S0O A;  2B8F A;  4UCT A;  1DV1 A;  1U0L A;  3GIL A;  2K1B A;  3NP8 A;  2UUA L;  2W6O A;  3PW5 A;  3LP8 A;  5C4H A;  2YRX A;  4UHV A;  4DL3 A;  2B29 A;  2R6G A;  5CR3 A;  1MSH A;  4ECT A;  3DUZ A;  4OGQ C;  5LMN W;  5M3F H;  1JOR A;  3S2D B;  4JCV E;  4PZ8 A;  3N8D A;  4JC0 A;  4DR2 Q;  3FPU B;  4G7H C;  2UUB L;  2M00 A;  2ATW A;  3OHA A;  1ET9 A;  1DM0 B;  1XDN A;  2XCA A;  1G2S A;  4DPG A;  1UE5 A;  4HSV A;  1IBM H;  4K5V A;  4ZYS A;  5IY0 A;  2A69 C;  3A8K E;  4IZ8 A;  1JJ2 A;  4DL2 A;  2L1B A;  3HOX H;  3PW0 A;  1FGB D;  3NGD A;  3KLW A;  3KAK A;  3BVZ A;  1R4Q B;  2HVS A;  2R7L A;  1KC7 A;  2JA7 A;  4FF4 A;  5L1K A;  1Q90 A;  1PTO C;  1BOS A;  5C0X I;  2JP1 A;  3GTO H;  3SK5 A;  5IOD A;  2R93 B;  2LSS A;  2F0M A;  1VAJ A;  4FYD A;  2MO1 A;  4K0K L;  4YY3 Q;  2HD3 A;  3UQ8 A;  5J39 A;  3HOV H;  4P75 A;  4B3S Q;  2UXC H;  1Y14 B;  5I9O A;  3T5K A;  3ICE A;  3Q1K A;  2R7F A;  1M0T A;  4A93 B;  4DV2 L;  1EY6 A;  2CH4 A;  3HKZ E;  1G51 A;  5DEH A;  1E4E B;  2ZM6 Q;  4DUZ H;  3LNN A;  3ER0 A;  3OSO A;  5I9P A;  4CC5 A;  2MO0 A;  3IG0 A;  2DGY A;  1JOQ A;  4AYB A;  1EOV A;  2UU9 H;  1M90 C;  1ZET A;  1K0R A;  1KJ8 A;  2NZH A;  1YZ6 A;  4I65 A;  3S2H H;  1LM0 A;  3J81 c;  3GTL H;  5IGB A;  3NEN A;  2EQS A;  1KXL A;  2ZDH A;  1A2U A;  4O4L F;  4FM9 A;  2RDG A;  3U4Z A;  2AUK A;  4LF9 H;  5LMN L;  1A9X A;  1SYD A;  3SE0 A;  2R6F A;  2HVR A;  1EYG A;  4DR4 L;  1VCI A;  1XX8 A;  3FDS A;  4KY6 A;  2ZXR A;  3QB3 A;  5LMU L;  1IBK H;  4UP9 A;  2CW0 C;  3KLR A;  1Q7Y C;  4QWA A;  2K14 A;  4M1U B;  1VQP A;  3I4N B;  4XYL B;  1MD2 D;  3Q0A A;  1HPC A;  2EJF C;  5IGG A;  1L2Z A;  4ABN A;  1UE1 A;  3MWM A;  2KEC A;  3NQT A;  2AGO A;  3DXJ C;  3T1H L;  4JV0 A;  4Q8F A;  3PO2 H;  3URY A;  3P7J A;  1B9M A;  1X3E A;  3VR2 A;  4H44 C;  1CZG A;  2VPQ A;  2QGQ A;  2K5V A;  4X64 H;  4NMZ A;  4HNT A;  3M9O B;  4LF4 L;  1KRT A;  4WJ3 M;  2FE3 A;  3DF7 A;  5KGU A;  2JA8 G;  4QJF A;  5KFR A;  1FD7 D;  3ERO A;  5KYI A;  5KFT A;  1Z6H A;  1VQK A;  4HNU A;  3OSP A;  1GUT A;  2A73 B;  2F0J A;  2JA8 B;  1SEI A;  1HR0 H;  5KFK A;  2PQA B;  3MA2 B;  5L1J A;  1ENA A;  1HQM C;  4IN3 A;  3S14 H;  4A3G G;  3NPP A;  1PRT B;  2FK2 A;  2YS7 A;  2Y0S E;  2E5L H;  4RH6 A;  1VS0 A;  2RCN A;  4LF7 L;  4DXF A;  3FHW A;  4RA8 A;  1STY A;  4J9S A;  4RG1 A;  1KNA A;  3IFD A;  5ELC A;  3W2D A;  4X66 L;  2X6G A;  2KCM A;  4EGQ A;  1EEI D;  1PFN A;  3G6X A;  1NMG A;  2EYL A;  2XC9 A;  2R92 A;  3GIM A;  3H09 A;  2F4V Q;  4XYM B;  1AP0 A;  4ED0 A;  2GVB A;  3N6X A;  1BCP D;  4YWK A;  4RB1 A;  5IYC H;  3HRZ C;  1Q82 C;  3RGZ A;  1LUZ A;  4FO2 A;  4JI8 L;  3H94 A;  1JE4 A;  2CH4 W;  3TZD A;  3S1N B;  2HVQ A;  4GC7 A;  5F9L A;  2VA3 A;  3KDF B;  3W3A A;  5C1P A;  3M3Y B;  3IL8 A;  4UFZ A;  5BPH A;  5K5P A;  3G4S A;  1VDZ A;  5JPM C;  2FK1 A;  4DR3 H;  2FLP A;  3Q8R B;  4ED6 A;  1OXU A;  4EEY A;  4DV3 Q;  4RGT A;  1VQL A;  2RDF A;  5FD5 A;  2B63 B;  1L0W A;  3PV0 A;  4APV A;  3RUP A;  1VQ5 A;  1LTA D;  3CCU A;  3RF2 A;  3QWN A;  5IYB G;  3S2D H;  2K33 A;  1GUW A;  1X54 A;  1MGS A;  5L37 A;  2EJM A;  4JI5 Q;  4POG A;  1CA5 A;  2WP8 J;  1YNN D;  1OXV A;  5G3L D;  1G91 A;  2J7Z A;  2YRW A;  2GVA A;  3E0E A;  4OIJ A;  3E6Z X;  2VXW A;  4O4I F;  2UUC H;  4CKE A;  1BF4 A;  3OHX C;  1XNQ H;  3BYT B;  3W1G A;  2N88 A;  3ITP A;  4PV1 C;  3BAA A;  3I7F A;  3JAM c;  3NBI A;  2YTV A;  4DV6 L;  5EOY A;  1I5F A;  3VPC A;  4RCO A;  3CKI B;  4GKJ H;  2Z8L A;  4IFD G;  1CHP D;  2LKV A;  4CKC A;  3CCS A;  3TP5 A;  2ASL A;  1KAB A;  3KHL A;  2FB9 A;  1QB5 D;  2C35 B;  1N56 A;  4F4X A;  2P5Z X;  2VUM A;  5JJZ A;  4A93 H;  4M7E A;  2Q2I A;  3OW7 A;  4C2M A;  3VYR A;  2I80 A;  4IO9 A;  1DOM A;  1JWU D;  5D8D A;  1SJH D;  3U4V A;  4LUZ A;  5D3I B;  4PMB A;  4GOP B;  4KKS A;  5D3D A;  2UXD L;  3BJU A;  4IRK A;  1F2M A;  2OQ0 A;  2BA1 A;  2D0P A;  5EBD A;  5KFG A;  2OQK A;  2UXC Q;  4DV4 L;  5KFN A;  1MKH A;  1BVS A;  3CC7 A;  1AN8 A;  3GTK B;  2MQH A;  4DUZ Q;  1I94 L;  1XMO Q;  4IJL A;  1RK5 A;  2WKC A;  5FK9 C;  4RAU C;  2V4Q A;  2R7Z A;  2UU9 Q;  2CHB D;  2F0S A;  3I4O A;  3G8C A;  3CCV A;  5DG8 A;  3H15 A;  4NXM L;  1K8O A;  5J1Z A;  4DR6 Q;  1YHA A;  4O3P A;  3GTJ B;  2EDG A;  1O7Y A;  3GTG B;  4A3D G;  3J80 W;  1GYF A;  1Z2N X;  1M0W A;  3UDF A;  3BS1 A;  2NVX B;  4G57 A;  3OW2 A;  1HNX H;  2F3W A;  4LF9 Q;  4LK1 C;  5IE8 A;  3RN5 A;  2J6S A;  4JI7 H;  4L63 B;  3SR1 A;  4HMI A;  3C0F B;  4HIM A;  1Q8I A;  2E76 C;  3NTI A;  5BR8 H;  3GLK A;  1IBK Q;  1Y1V A;  3TZU A;  4FBT A;  2NTT A;  2F0I A;  3A7A B;  4F87 A;  1E4G T;  1TWG A;  2X0S A;  2C5C A;  4H13 C;  3FMA A;  5A2Q W;  2EYF A;  2EJG C;  3CQZ A;  3S1R B;  4DR7 H;  2J0T D;  4KKT A;  1N36 H;  4BXX H;  1GLV A;  1WTX A;  2JA8 H;  5K36 G;  1TWH A;  4C5A A;  2K5D A;  1JIC A;  2ASB A;  2KHJ A;  5KFJ A;  2DZD A;  1AH9 A;  1FKA H;  2K6A A;  4RHS A;  3AFP A;  3CRL C;  2VR1 A;  1I6V C;  3J80 E;  1BNC A;  3GTQ A;  3N43 B;  3DWQ A;  1QZG A;  1EUD B;  3RBD A;  4Y52 H;  1PDQ A;  1U4R A;  2BQ3 A;  1HZC A;  4JYA L;  4L6T B;  2UVR A;  3MWY W;  4RB2 C;  2VS1 A;  4A2A A;  3WO1 A;  2JEF A;  1CKO A;  1S3O A;  3H20 A;  3SEB A;  4CDD C;  2AWO A;  1ASY A;  4J9L A;  4KD3 A;  4R4O A;  2AQ1 B;  1W93 A;  5C1O A;  1HR0 Q;  4B3R Q;  4LUV A;  5HY6 A;  2NVQ B;  3S1N H;  3MR5 A;  1X9N A;  3RV4 A;  1CQI B;  3M3Y H;  2W9A A;  2C22 A;  5HUR A;  3NK9 A;  1NNX A;  3AFQ A;  2B2W C;  4FDB A;  3T5H A;  1S0N A;  4BWG B;  4AQY Q;  4PMC A;  3GP7 A;  3M4Y A;  4XQJ A;  1VQO A;  1HNZ L;  4IFD I;  2YZG A;  1BCP C;  4IUT A;  2VY3 A;  1EIG A;  4AYB G;  4A3I B;  3GTM B;  3K8A A;  1SFO A;  2EYM A;  3J80 L;  5GON F;  4R8U B;  2WB1 B;  3UDI A;  5DQG A;  2IX1 A;  5M5Y B;  2NVY B;  4KN4 C;  2B63 H;  2R82 A;  4YR3 A;  3HB9 A;  1K83 H;  2K5Q A;  1TWA B;  1UNS A;  4IUP A;  3TDQ A;  2V5A A;  4FU0 A;  2SDF A;  4R4I A;  2AKW B;  2ZT9 C;  1QVG A;  3N40 P;  5C6A A;  3VYT A;  1E24 A;  5EGT A;  5IYB H;  3MR2 A;  2HUG A;  4JV5 L;  2FFK B;  4LF5 L;  2EY1 A;  3K58 A;  4X3S A;  2K32 A;  5KFD A;  3HOZ B;  1M4V A;  4RWS C;  1NCV A;  4LFA L;  2EY2 A;  1A6X A;  2MHV A;  2OTL A;  4A3B B;  3U9O A;  1XNR H;  3I56 A;  1YNN C;  2MGS A;  4WOR A;  3A54 A;  1OO9 B;  3A5Z B;  5KRU A;  1HUN A;  5C4X B;  1LLR D;  3OTO H;  4RKB A;  1A2T A;  2QDL A;  3HOW G;  4LUO A;  3F2U A;  1V1P A;  2MNA A;  4LF8 L;  3BG3 A;  2IBK A;  2KHS A;  2W7P A;  3K3V A;  2HGS A;  2UUC Q;  1I7N A;  4MV6 A;  1B53 A;  2WAQ B;  1H9S B;  2HCI A;  1XNQ Q;  3HOW B;  4O2D A;  1TWF A;  2XGQ A;  3V4Z A;  1PH7 A;  4A3L G;  3RN2 A;  4IAL A;  4A3M G;  1CKN B;  1QZH A;  3PUX A;  3Q8S B;  3RZO H;  4MNO A;  1PTO B;  3TBI B;  1IOV A;  2RDI A;  1N8R C;  4HSP A;  3J81 i;  2O5I C;  5ELN A;  4LFC Q;  4EG0 A;  1Z7T A;  3KF6 B;  1T5E A;  3R8B A;  2B2W A;  3J7Y W;  3F8T A;  2TMP A;  5AJ3 Q;  4TQS A;  2YV5 A;  1UEB A;  1MHW C;  2F3V A;  3GIQ A;  3EPI A;  5C0X J;  3IKJ A;  3I55 A;  2FK3 A;  3DEP A;  3GTK H;  3MEF A;  3PVX A;  3OMC A;  2CW7 A;  5C44 G;  5EWF A;  4RNO A;  3MWD A;  2IJ0 A;  4JBJ A;  5EJW A;  1KIX A;  4A3J G;  3T1Y L;  1XMQ H;  4IUQ A;  3PGZ A;  5IT9 W;  5CV7 A;  1K1S A;  4Y8V B;  3Q2O A;  2YL2 A;  1KD1 C;  4A3E B;  3GTJ H;  1EOT A;  3MTS A;  3GTG H;  3T16 A;  5CC4 A;  5KFZ A;  1A3V A;  1TY0 A;  2HIV A;  1O78 A;  4MHE A;  5LHY 1;  2NVX H;  1TS2 A;  5D14 A;  4JI4 L;  4JI6 L;  4K8J A;  4MV4 A;  1IBM Q;  4JV2 A;  5IGF A;  4XQN A;  3LGJ A;  3ORQ A;  2PNR C;  2PI2 A;  1GSO A;  2J9G A;  4B9W A;  4R8N A;  2NYZ D;  1PVO A;  2D2C C;  4UPA A;  2RSN A;  1Y1W A;  4HR7 B;  4KHV A;  1BGW A;  4UP8 A;  1HUM A;  3OOC A;  4NKL A;  4PZ6 A;  1N33 L;  2VQE H;  3S1R H;  4QCL A;  1XWE A;  2W7O A;  1TKW B;  5IT9 E;  2MFI A;  2Q2T A;  2JK8 A;  2LS0 1;  3D0F A;  3NTK A;  2D9U A;  1D7Q A;  3QOJ A;  2PMZ B;  1HNX Q;  1CHQ D;  1SNO A;  5JJI A;  3I4M G;  4JI7 Q;  1VQB A;  1V43 A;  5KFE A;  2JA5 B;  5K36 H;  4HJ5 A;  4IPD A;  1LTB D;  1PFB A;  5C5M A;  4DF7 A;  4EQN A;  3GTO B;  3NUC A;  5C3W A;  5JPN C;  3T5J A;  3KK7 A;  5IYD G;  2F0O A;  4A3C G;  4EGJ A;  1WCM A;  2E5L L;  3ONA B;  3K80 C;  2OT2 A;  4RAY A;  1YJN A;  5LOV F;  1V8Q A;  1N36 Q;  3HOY G;  2L5T A;  4R4T A;  4ZKB B;  1WD1 A;  2VUM G;  1X6O A;  2OF1 A;  2NVQ H;  1J8I A;  5IT9 L;  2XGP A;  3QR8 A;  5JVD F;  4BY7 G;  4KTA A;  2BH8 A;  2M2L A;  4BA1 I;  3WNZ A;  3GTP A;  4BY1 G;  2NUC A;  3HOY B;  5KFH A;  2GPS A;  1L1O B;  2C00 A;  2HCC A;  4A3I H;  2AQ3 B;  3GTM H;  5LA6 F;  4JI0 H;  4BY7 B;  1EU3 A;  4Z9C B;  4B9X A;  1TS4 A;  1XTC D;  5M5Y H;  2NVY H;  1S5C D;  2JYO A;  3SK6 A;  3KYH C;  4IUV A;  2ZJP A;  1JIH A;  2V58 A;  1G6Z A;  2CW8 A;  4LFB H;  4EYI B;  4XX0 B;  4ECR A;  3KOJ A;  1TWA H;  5EWE A;  1LYL A;  3HKZ A;  3MXN A; 
#chains in the Genus database with same CATH homology
 4LF5 Q;  1PH9 A;  1EOV A;  4UY8 C;  1VQ7 A;  1M90 C;  2L15 A;  1K0R A;  2R93 H;  5IP7 G;  4DK3 C;  2NZH A;  1YZ6 A;  3S2H H;  2JQO A;  2CCZ A;  1LM0 A;  2YTX A;  3K81 C;  4LFA Q;  3J81 c;  3GTL H;  1TWF H;  4GN4 B;  3G6E A;  3NEN A;  2EQS A;  1KXL A;  5GAG C;  1L1O A;  3HOZ H;  1Z9F A;  2N49 A;  1IBM Q;  3U4Z A;  5IP9 G;  3JAM i;  2ZJQ A;  1YBY A;  1SR3 A;  3ULJ A;  4YWM A;  5LMN L;  4A3B H;  4NXN L;  5H1S E;  2CKZ B;  3S24 A;  4DV7 L;  1VQF A;  4JI0 L;  3M85 A;  1EYG A;  4DR4 L;  2UXC L;  1VCI A;  4JBK A;  5LMU L;  3PSI A;  5GAH C;  4UP9 A;  1Q7Y C;  3PIO A;  4LF8 Q;  4DUZ L;  5C4X H;  3CCQ A;  1PH8 A;  3PUW A;  2K14 A;  3AEV A;  4LFB L;  5M5W H;  1HR0 W;  1VQP A;  1Y1V G;  4GLX A;  2K52 A;  5LMN Q;  1EQQ A;  4B3T Q;  2UXB Q;  4DV7 Q;  1NY4 A;  3ULP A;  4DR5 L;  2UU9 L;  1E7Z A;  2JA9 A;  4GN5 A;  1UE1 A;  4DV5 L;  3T1H L;  3PO2 H;  3HOW H;  2HIX A;  2VZA A;  2R92 G;  1X3E A;  1XNR Q;  3CP0 A;  3J80 c;  3H3V I;  3KFU A;  2QGQ A;  4YCV A;  4DR1 L;  1LTL A;  2K5V A;  1R9T H;  3L0O A;  1S40 A;  2NN6 G;  4LF9 L;  4X62 Q;  1YHB A;  1KRT A;  4LF4 L;  1GO3 E;  3CD6 A;  4WJ3 M;  4HJ9 A;  1TXY A;  4A3L H;  4A3M H;  2JA8 G;  4QJF A;  3OTO Q;  3I4N H;  5DLQ E;  4DV5 Q;  2A8V A;  2DUD A;  1Q1B A;  3CCJ A;  4BBS G;  1X3F A;  1HNW L;  1IBK L;  4B3M Q;  1BBU A;  1VQK A;  1A62 A;  4OX9 L;  3L7Z C;  4QL5 A;  3T1Y Q;  4QGU A;  2A19 A;  2IX0 A;  2KEN A;  1M1K C;  1FJG L;  3F1Z A;  3KJO A;  2PQA B;  4LF4 Q;  4DR3 Q;  4A3D H;  3S14 H;  1RIP A;  1VQD A;  2PI2 E;  4X65 L;  2F3I A;  3NEM A;  4ME3 A;  3VDY A;  1Y1W H;  4L5R C;  4A3G G;  2Y0S E;  3CPF A;  4QIW E;  2IT1 A;  3CW2 C;  1VS0 A;  1J5E L;  2RCN A;  1C0A A;  2ZTE A;  4LF7 L;  1IBL L;  3FHW A;  4OX9 Q;  4DKA C;  4YWL A;  4A3E H;  4RG1 A;  3J7Z C;  3TRE A;  4LF6 L;  4X66 L;  2LXJ A;  2KCM A;  1ASZ A;  4X64 L;  3TEH B;  5M3F G;  1NMG A;  1Q8K A;  4P74 A;  4JI4 Q;  1N32 L;  4X65 Q;  4DV0 L;  2A1A A;  4HJ7 A;  2F4V Q;  3FKI G;  2GVB A;  3U50 C;  4YWK A;  5IYC H;  1Q82 C;  2EXD A;  3S1Q H;  4KHP Q;  1CSP A;  1LUZ A;  4JI8 L;  1VQ9 A;  1XPU A;  4QY7 A;  1WCM H;  3KDF B;  5EAY A;  1XMQ Q;  3G4S A;  2UUA Q;  2PQA A;  1G29 1;  4LW1 A;  4X64 Q;  4YHH L;  1HR0 L;  4B3R L;  2K75 A;  4DUY L;  1IYJ B;  3H3V H;  1PFS A;  2K5H A;  1OXU A;  1SRU A;  1N34 L;  4DV3 Q;  1B7Y B;  5BR8 L;  2CWP A;  4JI5 L;  1OXS C;  1QVC A;  4JI8 Q;  5JEA G;  4AQY L;  2Z6K C;  1VQL A;  4KI0 A;  3HOU G;  4OWX B;  4JOI A;  1YI2 A;  2JA7 H;  1L0W A;  3PV0 A;  3STB C;  5HGQ A;  2OTJ A;  4YCU A;  4APV A;  1EQR A;  3GTP H;  1VQ5 A;  2UUB Q;  1KRS A;  3CCU A;  2CFM A;  4YHH Q;  1K8G A;  5IYB G;  4PG3 A;  1YJ9 A;  4A3I G;  2RHS B;  3S2D H;  1AE3 A;  5M3M G;  3M4P A;  1X54 A;  4DR7 L;  5JJK A;  2JA5 H;  4IPH A;  2HHH L;  2WB1 G;  2E5L Q;  4X6A H;  4JI2 L;  4JI5 Q;  4POG A;  2KHI A;  2WP8 J;  2FXQ A;  1OXV A;  1P8L A;  2YTY A;  3D31 A;  1VQA A;  5E7N A;  4GOP C;  3KDF A;  3UE0 A;  1YIJ A;  2GVA A;  3E0E A;  2NVT H;  3CXC A;  1JMC A;  2KBN A;  2VQE Q;  1GKH A;  1MIU A;  5IYD H;  4A3C H;  3W1G A;  1Q81 C;  1WJJ A;  5GQO A;  3I7F A;  3IRB A;  3L2P A;  3JAM c;  2YTV A;  4DV6 L;  3TS0 A;  1OXT A;  4K0K Q;  2IHE A;  1I5F A;  2JEB I;  4L5S A;  1JJG A;  3M9B A;  5JEA J;  3PUY A;  3HOY H;  3HOZ G;  4IFD G;  3UDX A;  3CCS A;  1SN8 A;  4DV2 Q;  1YIT A;  2ZTC A;  4A3B G;  2R7Z G;  3PF4 A;  4BY7 H;  4GNX C;  3PUZ A;  1NMF A;  4BY1 H;  3E9I A;  2HT1 A;  4DV6 Q;  2C35 B;  4A93 H;  4J15 A;  2I5M X;  1EUJ A;  2Q2I A;  2WFW A;  3H0G H;  3NBH B;  1MJE A;  3M4O H;  5C4X G;  4H02 A;  4R4Q A;  3G71 A;  3NEL A;  4IO9 A;  1NBW A;  3W5O A;  3M7N A;  3U4V A;  4LUZ A;  2UUC L;  4BA2 I;  4JI1 L;  5FJ8 H;  1XNQ L;  3S1M H;  2IY5 B;  2NN6 I;  4GOP B;  1XMO L;  3CME A;  3I2Z A;  2UXD L;  1AE2 A;  2WAQ G;  3BJU A;  1PHJ A;  3KF8 B;  1YHQ A;  1L2F A;  4JOI C;  4NXN Q;  1W3S A;  2BA1 A;  2OQ0 A;  2D0P A;  4XIG S;  4POF A;  4A76 A;  4JI0 Q;  1CSQ A;  2OQK A;  4DR4 Q;  4GKJ L;  4LFC L;  2XTI A;  1VQ6 A;  3ULL A;  1QUQ B;  5IP7 H;  5LMU Q;  4PMW A;  4DV4 L;  3J7A 5;  1MKH A;  4DR6 L;  1BVS A;  3CC7 A;  4JI1 Q;  1UWV A;  3AYH B;  2Z6K A;  2MQH A;  4P72 A;  5AJ3 L;  1RL2 A;  4DUZ Q;  1I94 L;  4LFB Q;  4IFD J;  3K0X A;  4IJL A;  1XMO Q;  1NJI C;  1VQ8 A;  1I6H H;  1UE6 A;  1IZ6 A;  3B6Y A;  5IP9 H;  1JJC B;  1WOC A;  2ZJR A;  1NE3 A;  4DR5 Q;  2UU9 Q;  4DV1 L;  1KHI A;  3I4O A;  4A75 A;  1HH2 P;  3CCV A;  1PH2 A;  4GKJ Q;  3H15 A;  2Q2H A;  2NZO A;  4NXM L;  4GNX B;  1YHA A;  3T1H Q;  4DR6 Q;  1VQH A;  1KAW A;  2QEX A;  4A3D G;  1SE8 A;  5IT9 c;  4GOP A;  1MJC A;  1I3Q H;  4JBW A;  4GN3 B;  1Y1W G;  3UDF A;  4P71 A;  4BBR H;  2AWN A;  4GKK L;  4DR1 Q;  4GS3 A;  3OW2 A;  3S15 H;  1Y1V H;  4OXP A;  4LF9 Q;  5IE8 A;  3RN5 A;  3AQQ A;  5GAD C;  1VQ4 A;  1FL0 A;  4A3E G;  3CPW A;  3RR5 A;  4HIM A;  1GVP A;  1QUQ A;  4PZ7 A;  1PV4 A;  1S72 A;  1JB7 A;  3ZJY C;  1KL9 A;  4JI3 L;  3RLO A;  1HNW Q;  1IBK Q;  2ALY B;  1JE5 A;  4IJH A;  2JA6 H;  2E2I H;  2R92 H;  5J3B A;  5C44 H;  3J81 j;  1X55 A;  3RZD H;  2I0Q A;  5IYC G;  5M5X H;  5GRO A;  3BU2 A;  3CAM A;  4A3J H;  1FJG Q;  4ALP A;  2JE6 I;  4EQ5 A;  3CCM A;  3CF5 A;  1A63 A;  3HKS A;  5C3E H;  1WCM G;  4HIO A;  4BXX H;  1HZA A;  2JA8 H;  2VNU D;  4GNX A;  5K36 G;  4BBS H;  4O0A A;  3PIP A;  4HIK A;  1XTD A;  2KHJ A;  1J5E Q;  2ASB A;  4LF7 Q;  1IBL Q;  4IOC A;  1AH9 A;  1VQC A;  1VQG A;  1P16 A;  1W2B A;  4HJ8 A;  3AFP A;  1PH5 A;  4A3F H;  4X66 Q;  4LF6 Q;  4A3K H;  5FLM H;  2EIF A;  1QZG A;  2CWA A;  1HNX L;  2YYZ A;  1N32 Q;  4DV0 Q;  4JI7 L;  4Y52 H;  2JJQ A;  1HJP A;  1HZC A;  3ERS X;  3HOX G;  2VQF L;  4JYA L;  4GLA C;  1CUK A;  3G48 A;  4DR2 L;  3Q8D A;  2OCE A;  2VS1 A;  1HZ9 A;  2K4K A;  4NB3 A;  1B8A A;  4HID A;  1K8A C;  1CKO A;  1EIY B;  1S3O A;  2OWO A;  1V1Q A;  1PH3 A;  1X65 A;  3K7U C;  1V9P A;  1VQJ A;  2JA5 G;  2F52 A;  2AWO A;  1ASY A;  1C7Y A;  4R4O A;  1HR0 Q;  4B3R Q;  1XJV A;  4LUV A;  5HY6 A;  1KQS A;  3PO3 G;  4DUY Q;  3W1B A;  3S1N H;  2H5X A;  1X9N A;  1SFO H;  3DLL A;  2ES2 A;  3FKI H;  1N34 Q;  3M3Y H;  3HOV G;  2BH2 A;  1N36 L;  2VL6 A;  5BR8 Q;  3AFQ A;  2D0O A;  4FDB A;  3HKZ G;  4AQY Q;  3M4Q A;  1HNZ L;  1VQO A;  4IFD I;  4HJA A;  3I4M H;  4AYB G;  2VY3 A;  4R1J A;  1YJW A;  3K8A A;  1U5K A;  4RMF A;  4OWW B;  3UDI A;  3TQY A;  1VQI A;  3EN2 A;  3OYY A;  3PF5 A;  1PYB A;  2IX1 A;  2B63 H;  4DR7 Q;  2AHO B;  4YY3 L;  2HHH Q;  4JI2 Q;  2R93 G;  1K83 H;  4B3S L;  4WJ4 A;  1E3P A;  4DAY B;  1HNZ Q;  3A74 A;  1K9M C;  1IXR A;  4MTN A;  3EBE A;  4R4I A;  2AKW B;  3HOU H;  1QVG A;  2D62 A;  1T9H A;  3PCO B;  4KHZ A;  3F2D A;  2ZM6 L;  1PH6 A;  2HQL A;  5JJL A;  1E24 A;  1FVI A;  2VUM H;  5IYB H;  4A93 G;  1Z47 A;  3CCL A;  5M3M H;  3CC2 A;  4JV5 L;  4LF5 L;  4L5T A;  4C2M H;  1UE7 A;  2E8G A;  3BZK A;  2CQO A;  4OO1 G;  1OTC A;  4C3I H;  5FLX c;  4LFA L;  2WB1 E;  1K73 C;  2OTL A;  3FP9 A;  3I56 A;  4XTC S;  3U58 A;  1E1O A;  1WFQ A;  5C0X G;  3A5Z B;  2E2J H;  1PH1 A;  1TWC H;  2LXK A;  2GN5 A;  2K5N A;  1VQN A;  4GLV B;  3KJP A;  1A8V A;  1XPR A;  2RF4 A;  2I5H A;  1A0I A;  5IWA L;  3S17 H;  3PO2 G;  1E1T A;  1Q1E A;  4LUO A;  3HOW G;  1J6Q A;  1DGS A;  1E22 A;  2MNA A;  4LF8 L;  3K7A H;  1NTG A;  4TVA B;  4KLK A;  1VQM A;  1K3R A;  2UUC Q;  1D8L A;  1WYD A;  2V1C C;  1XNQ Q;  4B3T L;  3GDE A;  4O2D A;  2R7Z H;  2UXB L;  1HZB A;  1PH7 A;  4A3L G;  3RN2 A;  4A3M G;  1CKN B;  1QZH A;  3PUX A;  2JEA I;  4UP7 A;  3CCE A;  5IWA Q;  4MNO A;  3I4N G;  3RZO H;  2UXD Q;  1N8R C;  1Q86 C;  3RNU A;  2KCT A;  3J81 i;  3HFZ B;  1IL2 A;  2AMC B;  5ELN A;  1XNR L;  4LFC Q;  4BBR G;  4DV4 Q;  4OWT B;  1BBW A;  3KF6 B;  3SGI A;  4DNI A;  3A0J A;  3WWV A;  1KC8 C;  3UE1 A;  3F8T A;  3A5U A;  2Y0S G;  5AJ3 Q;  1EIF A;  4X62 L;  1I94 Q;  1OXX K;  1I50 H;  1YEZ A;  4A4I A;  2YV5 A;  1UEB A;  3F2B A;  2PNH A;  3OTO L;  1CKM A;  5C0X J;  3I55 A;  3TRZ A;  1GD7 A;  2JA6 G;  3GTK H;  4B3M L;  3MEF A;  4DV1 Q;  5C44 G;  4YCW A;  4R4C A;  2WAQ E;  2K50 A;  1KIX A;  4JBJ A;  4NXM Q;  1SLJ A;  4A3J G;  3T1Y L;  1TWG H;  3GO5 A;  3PGZ A;  3RLF A;  1EFW A;  4AIM A;  1N9W A;  2BA0 A;  4DK6 C;  3CQZ H;  5C3E G;  4IPG A;  4DR3 L;  3TS2 A;  1CKN A;  1EWI A;  4BXX G;  1SMX A;  3CCR A;  1TWH H;  1KD1 C;  4GKK Q;  1C9O A;  3GTJ H;  1QVF A;  2ZTD A;  3GTG H;  1Q12 A;  4MZ9 A;  1FGU A;  1SRO A;  4C3J H;  4NPS A;  1XPO A;  1WI5 A;  4LWC A;  5GAE C;  3KF6 A;  2HIV A;  4A3F G;  4A3K G;  2NVX H;  4JI3 Q;  4C3H H;  3EIV A;  5FLM G;  3J80 i;  1YNX A;  1GM5 A;  3GTQ H;  1PH4 A;  1YVC A;  4TQU S;  1X56 A;  4JI4 L;  4JI6 L;  2F4V L;  4JBM A;  2UXC Q;  3LGJ A;  3STB D;  4P73 A;  2PI2 A;  1BKB A;  4L5Q A;  4KHP L;  2ID0 A;  5ELO A;  1PVO A;  2IHF A;  3JC6 6;  2RHQ B;  4DAM A;  2JA7 G;  3F2C A;  4UPA A;  4A3G H;  1L1O C;  2E2H H;  1PA6 A;  4UP8 A;  1U0L A;  1XMQ L;  2UUA L;  1B70 B;  2XGT A;  4PZ6 A;  4JI6 Q;  3S1R H;  1N33 L;  2MFI A;  2B29 A;  2R6G A;  2JK8 A;  3D0F A;  3RLN A;  3E9H A;  4DV3 L;  2Q2T A;  3S16 H;  1D7Q A;  1IBM L;  1HNX Q;  5LMN W;  5JJI A;  3I4M G;  5M3F H;  4JI7 Q;  1X3G A;  1VQB A;  4JCV E;  2VQF Q;  4JYA Q;  4PZ8 A;  1V43 A;  4JC0 A;  4IPC A;  1O7I A;  4HJ5 A;  4DR2 Q;  4IPD A;  3PUV A;  2UUB L;  2ATW A;  1N33 Q;  2B3G A;  4AH6 A;  2B63 G;  5IYD G;  3UDG A;  4A3C G;  2E5L L;  4DPG A;  1UE5 A;  1Q46 A;  4OON A;  3K80 C;  5IY0 A;  4OO1 I;  2YU9 H;  1YJN A;  1JJ2 A;  3CC4 A;  3MXN B;  3HOX H;  1N36 Q;  1G6P A;  3HOY G;  4R4T A;  3KLW A;  2VUM G;  1X6O A;  2Q2U A;  4EX5 A;  2NVQ H;  2VQE L;  2PMZ E;  4JG2 A;  4BY7 G;  2BH8 A;  4BA1 I;  5C0X I;  3CMA A;  3GTO H;  4BY1 G;  3GD7 A;  4QQB X;  1L1O B;  2LSS A;  1PYS B;  4LNQ A;  3PO3 H;  4Y7N H;  2N3S A;  4A3I H;  2MO1 A;  3GTM H;  4IOA A;  3H0G G;  4K0K L;  4YY3 Q;  3BZC A;  5C4J H;  2R7D A;  3HOV H;  4P75 A;  4B3S Q;  1Y14 B;  1H95 A;  2QA4 A;  3ICE A;  5M5Y H;  2R7F A;  2N78 A;  2NVY H;  2I5L X;  3KYH C;  4DV2 L;  2ZJP A;  5FJ8 G;  3HKZ E;  1G51 A;  1VQE A;  3DM3 A;  2ZM6 Q;  3KOJ A;  1TWA H;  2N8N A;  3ER0 A;  4AYB E;  1LYL A;  1JT8 A;  2MO0 A;  2VW9 A;  2Z0S A;  2DGY A;  4JV5 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...