5IP9G

Structure of rna polymerase ii-tfiif complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5ip9G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 5ip9G01
3ULPA 1O7IA 4QJFA 4BBRG 2KBNA 2WAQE 1VQ5A 1HNWQ 4LF9L 2AHOB 3RZOH 1E3PA 4XIGS 3M4OH 3S1NH 4IPDA 4YCVA 2ASBA 3GTLH 5FJ8H 1A63A 1CKNB 1J6QA 1HNZQ 2ZJRA 1OTCA 4QY7A 4X66Q 3CAMA 3F1ZA 3PO3H 1CKMA 5AJ3L 3J81j 2YV5A 1VQIA 2HIVA 2D0OA 4DAMA 3FKIH 1XNRQ 1CSPA 3H3VH 3RN5A 1Q46A 3FP9A 2HHHQ 1E1TA 2BA0A 4DR6Q 2Y0SG 3KF8B 3M4PA 2B63G 4BBSH 4OWXB 1WFQA 5GQOA 2E2JH 4NXNL 5FJ8G 4A3BG 3TREA 4HJ8A 5BR8Q 1Y1WH 1KIXA 2K14A 1NBWA 3TRZA 1PYSB 1EQQA 3TS2A 1I3QH 3E0EA 2ID0A 3ICEA 5JJLA 4X66L 3PUVA 2AWNA 3PF5A 1VQPA 1VQOA 4DV1L 3GTKH 2UXBL 3CCJA 1D7QA 1QUQB 1CKNA 2CWAA 1PH8A 4C3JH 1HJPA 4A3DG 4R4QA 1JJCB 1Q1BA 1XNQL 3JC66 2IHEA 1HR0L 3G48A 2XTIA 1B70B 2NVTH 1YIJA 1NY4A 3M7NA 2VS1A 1MJEA 2HQLA 4R4CA 2F4VL 3CPFA 4P74A 4IFDI 3HKSA 1Z9FA 1BBUA 1RIPA 2VQEQ 3CCQA 1E1OA 1I5FA 2OCEA 2GN5A 4LWCA 4LF8L 5GAEC 4WJ4A 1JJ2A 4L5TA 4NXNQ 4A3BH 2JK8A 1HZAA 5BR8L 2RHQB 3TS0A 3NBHB 3JAMc 1QVCA 3U50C 1XPOA 5C0XG 3HOZH 4TQUS 4A3LG 3I2ZA 2OWOA 2IT1A 5IYBH 4A93G 5M5WH 1VQMA 1Q7YC 1H95A 3AEVA 3GDEA 4L5RC 1PH4A 4DV0L 4IPCA 4POFA 1A62A 4LF6Q 4JI3L 1LM0A 3UE1A 3BZKA 3HOWH 4A3CH 1Q12A 4OX9L 3W1BA 2R7ZH 5C0XJ 1YZ6A 2AMCB 2PQAB 1YVCA 1TWFH 4POGA 4A93H 3ERSX 2OTJA 2OQKA 1PH1A 2K52A 1K0RA 5FLMG 3S2HH 3TEHB 4B3RQ 1E7ZA 1QVFA 4C3HH 4LUVA 4R1JA 1GVPA 3VDYA 2OTLA 3Q8DA 1QZHA 2Z0SA 2WFWA 2KHJA 1CKOA 1FL0A 2PMZE 4NPSA 2BA1A 1WI5A 2H5XA 4HJ5A 4X6AH 2YYZA 1M1KC 1NJIC 2JE6I 4BBRH 4GOPA 2B3GA 2C35B 4A3JH 1IBKQ 1K3RA 1EQRA 1S72A 2XGTA 3ULJA 1EIYB 2CKZB 4UPAA 4DR5L 4JI6L 4NXML 4BA2I 4PG3A 5JJIA 3S17H 4O2DA 2RCNA 5DLQE 3HFZB 1HNWL 2DGYA 1PV4A 2F52A 3PO3G 2EQSA 4JI1L 2QA4A 4LF5Q 2HIXA 3T1YL 3OTOL 2LXJA 4A4IA 1YJ9A 4LFCQ 4IFDJ 5GADC 2UXCL 4WJ3M 3RLNA 1Q8KA 4DV5L 3RLFA 1DGSA 5IE8A 4QGUA 4FDBA 1X55A 3GO5A 4PZ8A 4HIOA 1T9HA 4LUOA 3FKIG 3GTGH 3J80c 3E9HA 3CMEA 1PH6A 4LF8Q 3UDFA 2OQ0A 4UY8C 1N36Q 4DV6Q 2JJQA 2K5HA 3MEFA 4DV7Q 1A0IA 3KF6A 3L7ZC 4A3KH 1YBYA 3JAMi 1YHBA 4GOPB 1HNZL 4BA1I 1KHIA 3HOUG 1L0WA 4GKKQ 3CC7A 1L1OA 4JBMA 4X62L 1UWVA 1VQ7A 3PUZA 5AJ3Q 3B6YA 2VUMH 1YNXA 2I5HA 3CPWA 5C44H 1XNRL 5IY0A 1UE7A 4B3SL 1YHQA 3CCMA 1X3GA 2A19A 4DUYQ 1J5EL 3S1MH 5GAHC 4JI7Q 4GNXB 2CQOA 3HOUH 3M3YH 4JI2Q 3BZCA 3J81c 4DV4Q 2ZJQA 1XJVA 1WYDA 1AH9A 1MKHA 4K0KL 3TQYA 2B29A 2EIFA 3I4NH 3KFUA 2NN6G 1XMOQ 4ALPA 1PH9A 4HJAA 2N78A 1VCIA 2Z6KC 5ELOA 3SGIA 2KCMA 5JJKA 1SLJA 3G4SA 3CCSA 2NZOA 3I56A 4AIMA 2VUMG 1FVIA 2Q2TA 4IJHA 3F2DA 3S24A 2CWPA 2Y0SE 1UE5A 3S2DH 2LXKA 1EYGA 2IX0A 4IO9A 2IX1A 1VQHA 2AKWB 2VL6A 1I94L 4IFDG 4YWKA 3BJUA 2QEXA 1MIUA 2I5LX 1QUQA 1NTGA 5IYBG 4HJ9A 4DV0Q 4A76A 1QVGA 4B3SQ 3HOYH 4RG1A 3K81C 2K5NA 1E24A 2VW9A 2JA5H 3OTOQ 1FGUA 4B3TL 2BH2A 2JQOA 1UE1A 4DR3L 4A3DH 4HIDA 4JG2A 1Z47A 2ZTEA 5E7NA 4BY7H 3RLOA 4GN5A 4LFBQ 4Y52H 4C2MH 1KL9A 4PZ6A 1U0LA 5M3MG 2VNUD 3LGJA 1N36L 3PGZA 3AYHB 1KC8C 3A5ZB 1M90C 4BY1H 3NEMA 1VQEA 2MFIA 3T1HL 2KENA 2ES2A 4LNQA 1CSQA 3IRBA 1OXVA 1OXUA 1UEBA 1N8RC 1X6OA 1B7YB 1XPRA 1VQNA 4B3TQ 4NB3A 3W5OA 1AE3A 2UUAQ 4BXXH 2RHSB 4JV5Q 1ASZA 4YCUA 5H1SE 3A74A 5IYCH 4IJLA 4DR7L 2YTVA 1GKHA 1YI2A 3E9IA 1HR0Q 1Q82C 4DR6L 3F8TA 3CW2C 3M4QA 4DR5Q 2AWOA 4KI0A 2E5LQ 5HY6A 5IYDG 1GM5A 3PUWA 1I94Q 1N32L 3W1GA 2JA8G 3GTOH 1VQFA 1IBML 4IPHA 5FLXc 2WB1G 2JA6H 2JEAI 3I4OA 3J7A5 2NVQH 3GD7A 3U58A 4YY3Q 1AE2A 4DR3Q 1HR0W 2R7ZG 3HKZG 3CC2A 4JV5L 2MO1A 2Q2HA 4QL5A 1CUKA 1I6HH 4YWLA 2R93G 2VQFQ 3NELA 1KD1C 1WCMH 2UXBQ 1UE6A 1HH2P 3RZDH 2ZTDA 3GTMH 1EFWA 4B3ML 3G71A 2K50A 3K0XA 2UUCQ 3I4NG 2F3IA 4DUZQ 4DR7Q 1IL2A 3PUYA 3U4ZA 4DV7L 1PHJA 3HKZE 4GS3A 3UDGA 5IT9c 1K9MC 4OX9Q 2F4VQ 1GD7A 2ZM6Q 1IBLL 1WJJA 3L0OA 3KYHC 3KLWA 5M5YH 3J7ZC 3FHWA 1IXRA 1PA6A 3AQQA 5C44G 1J5EQ 2JA7H 4JOIC 1WOCA 1HZCA 2YTXA 4DUYL 4L5SA 3HOVG 3PO2H 2UU9L 4A75A 4JI8L 3PF4A 1TWHH 2VZAA 4MTNA 2KHIA 1P16A 4EQ5A 1K8GA 4DV2L 4DV3Q 1Q86C 3PSIA 1PVOA 4JI0L 1G6PA 3I7FA 2R93H 1TWAH 1IBKL 3ZJYC 1X9NA 1PH5A 1N34L 2YU9H 4ME3A 4DR1L 1HZ9A 4QQBX 4DR4L 1V1QA 1X3FA 1Y1VG 5IP9G 2JA9A 4OXPA 3KF6B 2UUCL 4GN3B 4JI4Q 5M5XH 2MQHA 4A3KG 3NENA 4DPGA 3PV0A 4YHHL 3L2PA 5GROA 2EXDA 3DM3A 1SR3A 3AFQA 1D8LA 4IOAA 2B63H 3CMAA 2QGQA 4BBSG 4GKJL 4LF5L 3CQZH 3HOVH 2JEBI 1OXTA 4OONA 1JMCA 1IBMQ 1OXXK 2NN6I 3OYYA 5IYCG 4DNIA 3RN2A 3CD6A 1PYBA 5ELNA 4JI3Q 1V9PA 1EUJA 5C3EH 5J3BA 3OW2A 4LFAL 3S1RH 4JYAQ 3RNUA 3G6EA 1L1OC 3F2BA 1Y1WG 1XNQQ 1N33Q 1Q1EA 4OO1G 4DAYB 1P8LA 5EAYA 4GOPC 2JA6G 4A3GG 4GKKL 4GKJQ 3H15A 1NMGA 3I4MH 4AYBE 1TWGH 3KDFA 5IYDH 3J80i 3HOZG 2BH8A 4J15A 1X3EA 4KHPL 4A3JG 1EOVA 3HOXH 5M3FG 3T1HQ 2R6GA 4DR4Q 3S16H 2IY5B 1VQCA 2I0QA 2VY3A 2R7DA 4GLVB 4APVA 1BKBA 1LTLA 3GTPH 1YJWA 3STBC 4DV5Q 4LFBL 5C3EG 1YJNA 3M85A 4AYBG 3EN2A 5FLMH 2DUDA 3GTQH 1WCMG 4DKAC 1LUZA 2UU9Q 3F2CA 4JI8Q 1XMOL 3K7UC 1N9WA 1XMQL 4PZ7A 4HIMA 2UUBL 5LMNQ 4JI1Q 4AQYL 1FJGL 5LMUQ 4A3FG 4HJ7A 4DR2Q 2KCTA 4A3CG 2UXDL 1YHAA 1JE5A 3CCUA 2D0PA 3D31A 1ASYA 1KRTA 4X62Q 4BY7G 3ULLA 1PH7A 4PMWA 2A8VA 4H02A 1EIFA 2ATWA 2NVYH 2NVXH 3K8AA 1S40A 1VQKA 4A3GH 2R92G 3CCEA 2E5LL 4KLKA 1PH3A 4B3MQ 2IHFA 1NMFA 4DUZL 1PFSA 1QZGA 4B3RL 4YHHQ 4KHPQ 4JCVE 3K7AH 3UE0A 5LMUL 4LF7L 3CP0A 4A3MH 1OXSC 1TXYA 4YY3L 1K73C 2JA8H 3K80C 1Y1VH 5IP9H 4K0KQ 4HIKA 2V1CC 1IZ6A 5JEAJ 4DK6C 1KXLA 4BY1G 2PI2A 2CFMA 4GNXA 1VQLA 4JOIA 4RMFA 4JI6Q 1JT8A 1BVSA 4LF9Q 1HNXQ 3I55A 1TWCH 5C4XH 1XMQQ 1G51A 1C7YA 2L15A 2WP8J 4A3FH 5JEAG 2UXDQ 3ER0A 2E2IH 4LF7Q 3PUXA 2R7FA 4R4OA 5C0XI 2UUAL 1JJGA 1NE3A 2WB1E 2K5VA 1SRUA 1IBLQ 4A3EG 2Q2UA 1W2BA 2HHHL 2E8GA 3WWVA 3KJOA 4DV1Q 4X64Q 1N34Q 2Z6KA 2R92H 1IYJB 4UP7A 3CCRA 2GVAA 1A8VA 1VQ4A 1U5KA 4DV6L 1V43A 4X65L 2RF4A 3DLLA 1YITA 2A1AA 1KQSA 2E2HH 2PI2E 4L5QA 4P75A 4QIWE 4GN4B 1BBWA 4DV2Q 3T1YQ 4JI0Q 4LF4Q 2UXCQ 4LW1A 3S1QH 4UP8A 4GNXC 3I4MG 1VQGA 2N3SA 4JC0A 2PNHA 1JB7A 4R4IA 1Q81C 2UUBQ 5LMNW 4OWWB 1KAWA 3J81i 2FXQA 4JBJA 1XPUA 1B8AA 1Y14B 4LFAQ 1EWIA 4IPGA 3A0JA 4JYAL 4MZ9A 1VQ8A 2PQAA 1HZBA 1X56A 1PH2A 4JI7L 3H0GH 4OWTB 3A5UA 3CCVA 5C4XG 1SFOH 2ZJPA 4A3IG 3PIPA 5IWAL 1SE8A 4P71A 3HOXG 3UDIA 5M3FH 3PIOA 3HOYG 1L2FA 5HGQA 4A3LH 4EX5A 5K36G 1R9TH 3MXNB 4LUZA 3RR5A 4LFCL 3KJPA 2YTYA 4O0AA 4JBKA 4MNOA 1SROA 2WAQG 4JI5Q 4X65Q 2NZHA 4JI2L 1N33L 1C9OA 1VS0A 2VQFL 4OO1I 1K83H 1G291 1I50H 1X65A 3KOJA 3STBD 3U4VA 5IWAQ 4LF4L 5IP7H 1HNXL 1N32Q 2I5MX 2K75A 3AFPA 4A3IH 4YCWA 4BXXG 1GO3E 1FJGQ 1C0AA 1X54A 5LMNL 4AQYQ 4LF6L 2D62A 2Q2IA 1KRSA 1SN8A 1S3OA 1VQBA 4DR2L 2GVBA 2LSSA 4A3MG 2MO0A 1YEZA 3M9BA 3CC4A 4XTCS 1VQ9A 3KDFB 3H0GG 2MNAA 3GTJH 3BU2A 4JI5L 1VQAA 3UDXA 5C4JH 3CF5A 2ZM6L 4JI4L 4X64L 1XTDA 5M3MH 2HT1A 4GLAC 1VQDA 2N49A 5IP7G 4Y7NH 4GLXA 4NXMQ 3D0FA 3PO2G 1W3SA 3S15H 1MJCA 3EBEA 3H3VI 1VQJA 1E22A 4C3IH 4DK3C 1K8AC 1VQ6A 2ALYB 1RL2A 4DV4L 4IOCA 2CCZA 4P73A 2VQEL 4KHZA 2JA5G 3HOWG 3S14H 4P72A 3PCOB 4DV3L 2JA7G 1SMXA 2ZTCA 4R4TA 3CCLA 4TVAB 1L1OB 4JBWA 5GAGC 4YWMA 3CXCA 2N8NA 1LYLA 4AH6A 4A3EH 4UP9A 4DR1Q 3EIVA 2K4KA
chains in the Genus database with same CATH superfamily
3ULPA 3LWEA 5C44B 2KBNA 1VQ5A 1HNWQ 2NUCA 3RZOH 1LABA 1RD9D 4XIGS 3M4OH 2YZMA 4MN3A 3K7AB 3R23A 1J6QA 4IN3A 1KJIA 1IKMA 1DYQA 3PO3H 5TSSA 4C3IG 5AJ3L 2YV5A 2FPPB 5KFGA 2HIVA 1CSPA 3RN5A 2D2CC 1E1TA 3RB3A 1K8OA 2W6MA 4DR6Q 2E2IA 1K1QA 2E2JH 3BS1A 4A3BG 4DL4A 5LL6b 4KD3A 2R8KA 2G9HD 2W9BB 4JYAH 5J2TF 3TRZA 2UXCH 4QMGA 4DV5H 4XDXA 4DV1L 2NBFA 4MTKA 4CC6A 4IRKA 3CCJA 1E2ZA 3GTKB 1SAPA 1QUQB 3P20A 2L55A 2CWAA 4C3JH 4OELB 1PTOC 4ECYA 1Q1BA 2K05A 3NQTA 2I80A 3N8DA 2IHEA 5EZYF 3KHLA 1RJQA 2JA7A 1B70B 1WTQA 1BGWA 1MJEA 2HQLA 5CB4F 4OIKA 2F4VL 1QOHA 1EUDB 4IFDI 3S15B 4FF2A 1DONA 3BQ0A 1E1OA 4TKOB 2OCEA 4QB4A 4LF8L 5GAEC 3H4BA 1WH2A 4L63B 1E4EB 2ZXOA 3E5NA 1HZAA 3C0FB 1DM0B 3JAML 4IFDH 4RB3C 4TQUS 3T56B 3I2ZA 4DAPA 3G8CA 2CQYA 2F0HA 3JAME 2JA6B 4QW9A 2CH4A 3RFCA 5M5WH 3DWPA 2D5DA 3AEVA 1Y1WB 3GDEA 1Z2NX 2A5HA 1ET6A 2BQ3A 4IQZA 4LF6Q 3CQZA 1HXYD 4JI3L 1V1OA 3FDSA 4J1MA 3H20A 3BZKA 4XT3B 2WIIB 4OX9L 3W1BA 4RAZA 2XC9A 2K33A 2OH2A 4KN4C 4QWCA 1YVCA 2VUMB 2MPMA 2R8JA 3ERSX 2OTJA 1BQQT 5BPHA 2ENBA 3SK6A 2WAQA 2IMWP 4ECVA 3DHQA 5FLMG 4C5CA 4DR3H 1GVPA 4HSVA 2OTLA 2RDHA 4IURA 3DWAA 2KHJA 4NPSA 2BA1A 1F9SA 3OW7A 2XGQA 4EBEA 2ZDGA 5IGCA 1H9KA 4JW0A 4K5XA 3VR2A 1IBKQ 1PTOH 3ULJA 2QKIC 4UPAA 4ZYSA 3S17H 1SMYC 2DGYA 1VMCA 5E1FA 3CQZB 4MV7A 3T1YL 1PRTC 2L9HA 2LXJA 1JC7A 4LFCQ 4IFDJ 2E2JB 4WJ3M 1C8CA 5KFLA 4IAJA 2E74C 2F0FA 4HIOA 3T5HA 3FKIG 3J80c 4CDEC 3CMEA 4RB1A 4LFAH 4UY8C 2JJQA 3PW5A 1Z7TA 1CQVA 1STBA 3QJYA 2E75C 1KHIA 1L0WA 4Q8FA 3CC7A 2W9CA 4X62L 1UWVA 3PUZA 3B6YA 2NTTA 3KBGA 2NN6H 1LO5D 4B3SL 3RAQA 1EYDA 1J5EL 5FLXW 5HGTA 4XYOA 3JZIA 1Y8PB 2L12A 4GNXB 3X3MA 2JA8B 4ODGA 5FO7B 1MKHA 4K0KL 2EIFA 3KFUA 3A56A 1PH9A 2N78A 5KT4A 3SGIA 1G2SA 5J1ZA 2HJWA 2VUMG 1FVIA 1KEEA 4DN4M 3PW4A 2CW0D 3IG0A 2CWPA 5DQHA 5ISRA 4HMJA 1UE5A 2ASDA 4IO9A 4QWEA 4KMUC 1F9PA 2AKWB 2O5JC 4YWKA 4IR1A 2DZDA 4DR4H 5IYBG 3D4DA 4A76A 3HOYH 4EBDA 4RG1A 2K5NA 1CT1D 5I4DA 4B3TL 1EL0A 2BH2A 2JQOA 3T5KA 3RBDA 1EY0A 2ZTEA 2BCOA 3OSOA 2HGSA 4X3KA 2JEGA 5I6YA 3LGJA 5KT3A 3AYHB 1X3QA 3J80W 2KENA 2ES2A 4G7OC 1HNWH 1OXUA 1UEBA 5GONF 1X6OA 2HQEA 1SYBA 5T1GA 1SNQA 1VQNA 3GV8B 4JV5Q 4YCUA 3A74A 1GKHA 4YAJB 5D8DA 3RUZA 3M7GA 1JDEA 1HUMA 4KI0A 1GHKA 5HY6A 3SK4A 4IUVA 1GM5A 1I94Q 5JVDF 3JSLA 1VQFA 1CQIB 4IPHA 1I6UA 4DU9A 2JA6H 2P0AA 1Y8OB 1WTOA 1AE2A 5JVH3 4KKUA 2F0IA 4ZQ3A 4JV5L 3IFTA 1I6HH 2R7NA 1CUKA 5A35A 4YWLA 1S97A 1ZQ7A 3NELA 2ZTDA 3TQTA 1PTOD 4J9MA 2K50A 2F3IA 2IW3A 5C6AA 4C3IB 1D1IA 5IWAH 4RKLA 4UAIA 4F7XA 4IZOA 4ED8A 4LK1C 4GS3A 3WDNA 2WACA 2E5LH 1IBLL 1WJJA 5DGBA 2YZNA 4K14A 5M5YH 5DAUA 3J7YW 1IXRA 2EDGA 4JOIC 1WOCA 1MBYA 3PO2H 1S5ED 2XWBB 4PMBA 2RGVA 3OHAA 1QJOA 2B2UA 4CDCC 4YY3H 2KHIA 1SNOA 1K8GA 5CYUA 4NMZA 4DV3Q 3ONAB 1WTVA 3E0JA 1G6ZA 1JWMD 3BYTB 2NU8B 1IBKL 4LH7A 1X9NA 1N34L 1SEIA 1HZ9A 1LTAD 1SNMA 1SNDA 1V1QA 1SYEA 3HGBA 2EJMA 5C5JA 2J9GA 3KF6B 5FOBB 1PRTD 4GN3B 2KJXA 3V96A 3PV0A 3ORRA 1JOQA 3AFQA 4EG0A 1B9MA 3SVMA 4JV0A 3T1YH 2FJ2A 2KA7A 3QZ7A 1Y1WA 1JMCA 2PPBC 3K3VA 1OXXK 4RGOS 3OYYA 1PYBA 4JI3Q 2VUGA 4LFAL 5DG8A 4O3SA 3F2BA 1L1OC 1SE2A 4O3OA 2F0EA 2JEJA 1CQFA 4DAYB 3H91A 2JA6G 5EAYA 4Q43A 4GKKL 4QWBA 3PVXA 2NVQB 1NMGA 4AYBE 4ZOLF 1TWGH 2QK4A 2WINB 4I50F 1X3EA 1K83A 4TV9F 2R6GA 4DR4Q 1VQCA 3QWNA 4K2KA 4DGZA 1HUNA 3OHBA 5I9OA 3ND9A 4B9XA 1LTLA 3STBC 3H4DA 4GZYC 5FLMH 3EN2A 3GTQH 2DUDA 1G2TA 4K0KH 4HR7A 2R61A 1II3A 3H94A 2UU9Q 1IL8A 3F2CA 1XMOL 3ORQA 1RHPA 1N9WA 1T36A 4O4HF 1UNSA 1PLFA 1FJGL 5KG3A 2AUJD 1V8QA 2B2WA 1YHAA 4DV7H 1GGOA 3D4RA 3A8KE 4EGQA 4PMWA 4HAEA 1SBBB 2NVYH 1EZ6A 2NVXH 4YAKB 1VQKA 3N42B 3CCEA 4Y8VB 3CU7A 1PH3A 3N44B 4LF6H 1NMFA 2V59A 1PFSA 2DJGC 2E2IB 4JCVE 3K7AH 4LF7L 3CP0A 4ETSA 1ENFA 3RZOB 1MSGA 2JA8H 1KBLA 2ZM6H 2KOLA 1EOTA 4TUYF 5JEAJ 1VF5C 4DXGA 2YW2A 4MV8A 1BDOA 3VR4A 2CH4W 1VQLA 4RMFA 4JI6Q 2B2VA 2ZXPA 3D8GA 4NP5A 2ICIA 3M9MB 2B2WC 3G6JB 5C4XH 1G51A 3NXWA 5JEAG 2UXDQ 2E2IH 2RA4A 2V4RA 1SJED 2R7FA 4MV6A 5EWFA 1JJGA 1EIHA 5KFKA 2MUYA 1IBLQ 2Q2UA 2C00A 1RODA 3KJOA 4FXKC 1F2YA 5LYJF 3NUCA 3HOWB 2GVAA 2R92B 1CM9A 2O4XA 1VQ4A 5LP6F 1L0YB 2BQUA 4X65L 2A1AA 1F9RA 2K01A 1EY8A 3TZUA 1E4EA 3JSNA 1EWHA 4DV2Q 5C8YF 4JI0Q 4YP3A 2FP4B 3MJFA 4C56C 3S1QH 3S1NB 1KC7A 5KG5A 4GNXC 1IYUA 1E4GT 3GQCA 2F0DA 1UAPA 1JB7A 4Q0FA 2HVSA 3J81i 3HBLA 2FXQA 1XPUA 1Y14B 4IPGA 3A0JA 3TP7A 4QIWA 3J81W 1HZBA 1X56A 2FINB 2JYOA 3O13A 4CGYB 3CCVA 1PH2A 4JI7L 3GV3A 2HVRA 2HD3A 4A3IG 5IWAL 4CDFC 2L0CA 2AQ4A 4LFBH 5C5LA 4JI6H 1HFNA 4DV1H 4O4IF 1L2FA 4RH6A 1TY2A 4EX5A 1M8AA 3MXNB 5C1PA 2ALZA 4Q44A 3QOLA 4LFCL 4LSAA 3CRLC 1C48A 4MNOA 3OTOH 4DFAA 4X65Q 3RV4A 3VMMA 4JI2L 1VS0A 2VQFL 4OO1I 1K83H 1B53A 1G291 1I50H 2EYLA 3KOJA 3U4VA 1AUXA 3HOXB 2FK2A 1BCPB 2W7PA 5IP7H 1HNXL 1N32Q 2I5MX 2NU6B 4ED1A 3A55A 3K6OA 3A7LA 3AFPA 1BXRA 3PMFA 4J8QA 4K6DA 3NSWA 3HRZC 4AQYQ 1C0AA 5KFMA 2D62A 2Q2IA 1KRSA 2I46A 1S3OA 5DEHA 1HNZH 4G3IA 4A3MG 1YEZA 5LMUH 3H0GG 3BU2A 5C4JH 3LWBA 2E76C 1B6SA 1XTDA 4NKLA 1J9OA 3VPBA 1TVXA 3BAAA 4CJ2C 2DN8A 2GPSA 4C3IH 3MFHA 2ALYB 1RL2A 3MXNA 4IOCA 4P73A 2HVQA 3OSNA 1SYDA 3OPOA 3PCOB 4DV3L 3PW2A 2JA7G 1A6XA 1WSCA 2ZTCA 2F0LA 4KY7A 1WTWA 4A3EB 2W9CB 5GAGC 1DOKA 4A3EH 4GKKH 4DR1Q 3EIVA 1E2VA 2WB1A 3VPCA 1O7IA 2F0WA 1LTTD 5FO9B 3PZPA 1E3PA 3S1NH 4IPDA 5KG7A 1N56A 1LTRD 2ASBA 1A63A 2C5CA 3K5NA 2V9WA 5ELBA 4DV6H 4QY7A 1CTMA 2OT2A 2XVSA 4X3SA 2Q8IB 2Q8TA 3W2DA 1CKMA 1TA8A 1TKWB 4YQWA 4DAMA 1VAJA 2K5DA 5C4JB 2BA0A 2NU9B 1W6JA 3KF8B 1QILA 4BBSH 1WFQA 5GQOA 3Q1KA 4IWXA 5FJ8G 1RTOA 1GUNA 4HJ8A 5EGTA 1BNZA 1KIXA 2OF1A 1AZPA 2K14A 2GA4B 1FKAH 1PYSB 4M8AA 2QYZA 5L1LA 5IT9W 2ID0A 2VB2X 1E0BA 3PUVA 3PF5A 5EWGA 1VQPA 1VQOA 2A6ED 3EA6A 1VDZA 4DL6A 1PZJD 1V4YA 3GIJA 1RYRA 2B2VC 3GIMA 2EJGC 5DLGA 1RJTA 1EWCA 1JJCB 4DAYA 5KGUA 3NHHA 1O7ZA 3G48A 1R4QB 1N33H 3M7NA 2A68D 1V1PB 1SYCA 1ET9A 4AYBB 1S5DD 2VOBA 1BCPF 1ENAA 4FXGC 1B2TA 5ELDA 3MA2B 1BBUA 4UCUA 1S0MA 3CCQA 3IFDA 2CW0C 4LWCA 4WJ4A 1A3TA 5KFOA 2ATLA 2RCFA 1MI2A 4J0MA 2JK8A 3BVZA 3NBHB 1Z2PX 3U50C 3HOZH 1KLGD 4HR7B 4JI5H 1BUVT 5IYBH 4HCSA 4MTDA 4ECRA 2CVRA 1J8IA 1Q7YC 4OIJA 4L5RC 5CR3A 4DV0L 5JPMC 2F3VA 2NYZD 1KTKA 4KY5A 1IKLA 3MXUA 1LM0A 4E4TA 4MHEA 4A3CH 1C30A 4HN7A 1FNWA 3SE7A 2W6OA 1TWFH 5CORA 1KDAA 2IA6A 4R8NA 2F3WA 1ULZA 2K52A 5KFSA 3TEHB 1KDBA 1QVFA 1S5CD 1W96A 4R1JA 2FFKB 2SOBA 5FKAC 2WFWA 1C4QA 1CKOA 1FL0A 3QO2A 2HT1A 2W6ZA 2H5XA 3V6HA 1M1KC 3SXHA 4GOPA 2B3GA 3I72A 4EYIB 4RNMA 1WTHA 5KG0A 4KJOA 1QB5D 1S72A 4I7HA 2VA3A 2JA6A 2XGTA 4KY6A 1ILPA 1GUGA 2CKZB 3KALA 2QEJC 5KT6A 1PV4A 2F52A 4DL5A 3ITPA 2AUKA 4HNTA 5KFHA 3KLSX 3HOVB 4NXNH 2QA4A 4LF5Q 2YRWA 3OTOL 4GKJH 4DR7H 1YJ9A 2WKCA 1IOVA 1W93A 1Q8KA 1KLUD 5LL6S 5IE8A 4X66H 1X55A 2Z4HA 3ETJA 1SNPA 4LUOA 3FKIB 1PH6A 5IGEA 4K2LA 4LF8Q 4BS9A 1D2BA 3UDFA 2OQ0A 4OL7A 4MA5A 1C3OA 4DV6Q 4RCOA 3MEFA 3K58A 4DV7Q 3KF6A 3N52A 1M0WA 1DOMA 1NNXA 3I4NB 3KAJA 1VKZA 2EY6A 2PMZA 2EY1A 1L1OA 4JBMA 2W71A 1JDBB 5AJ3Q 2VUMH 1SYGA 2V4DA 5HBRB 1DXMA 3GTMB 4IWYA 2HDMA 2O5IC 1SFOA 4KHPH 3AB9A 1BR9A 5IIFA 3CCMA 1BBXC 1BCPC 2CHBD 4PQXA 4DUYQ 2WB1B 1YNJC 3VR3A 3VA5A 2CQOA 1STGA 1HTPA 3BZCA 4JI2Q 3J81c 4DV4Q 2GLTA 4CBVA 1RCVD 1SE4A 3TQYA 2B29A 3S2DB 1S03G 3I4NH 4ALPA 1ZYRC 1ZHQA 3NK9A 5ELOA 4Y7NB 5JJKA 5ELEA 2J6UA 1PFMA 3G4SA 3CCSA 2A74C 2HUGA 2NZOA 1ONLA 4YBZB 3F2DA 5JAVA 5KT5A 4QUCA 2KCCA 3EPGA 1BOSA 4OX9H 4XYLB 3S2DH 2J7ZA 4YR2A 1QWYA 1VQHA 5KFUA 1H9SA 3LP8A 4IUQA 2OLSA 5IT9E 4IHJF 4B3SQ 4HJ9A 1SFOB 4UCRA 5A2QL 1B1ZA 1T5XD 5I9PA 3OSPA 2A69C 2X6GA 1QG7A 4WFN3 4DR3L 4X3TA 4JG2A 5E7NA 3P75A 3TMEA 1A3UA 4GN5A 1BF4A 4LFBQ 4C2MH 1B3AA 3Q24A 3BJYA 1KL9A 4K8IA 4PZ6A 5M3MG 4LSXA 2VNUD 5ELFA 4NXMH 1M90C 4BY1H 3GV7B 1VQEA 5KFXA 3BA8A 4WD3A 1CSQA 2PN1A 2W6QA 3SEBA 1TU2B 1GLVA 1O75A 1XPRA 4B3TQ 1IW7D 4NB3A 1AE3A 3R3OA 4PNYA 2UUAQ 2RHSB 4BXXH 5EQ0A 5H1SE 2CW8A 4PMCA 4A3DB 4MIUA 2N88A 1IW7C 3F8TA 4DR5Q 5JPNC 2E5LQ 1RJPA 4ZCKA 3BZDB 3EYYA 3F8NA 3GTOH 5IOCA 3MC0B 5FLXc 3ERQA 2NVQH 3GD7A 4N9TA 5JEAH 1HR0W 4DR3Q 2F1MA 4I7ZC 3CC2A 3QFFA 4KHVA 2MO1A 4A3BB 2R93G 4X62H 2F0MA 5IGFA 3TQ1A 1KD1C 2UXBQ 1HH2P 3RZDH 1EFWA 5CC4A 2RDJA 3K0XA 4DUZQ 1DV1A 2WV6D 4DV0H 3U4ZA 1FNVA 1PHJA 2XIGA 3MR3A 3UDGA 5KFQA 5IT9c 2XGPA 4OX9Q 1GD7A 3WO0A 3FRPB 3J7ZC 1D6EC 1PA6A 5C44G 4DUZH 2JA7H 2A69D 4DUYL 2YTXA 1HZCA 3S16B 5CGKA 4JI8L 4LF7H 1CFMA 1PZID 4C3HB 4J9NA 1D5ZC 1FYCA 5DM63 3T5LA 2MGSA 3C1EA 3PSIA 5KFBA 3I7FA 2J6SA 2R93H 1JQYD 1PH5A 1AN8A 1WR2A 4RZRA 3PO2B 3V05A 5LMNH 2K5WA 1X3FA 1A2UA 2JA9A 4OXPA 3J81E 1AEXA 4ED6A 4JI4Q 5M5XH 3FKIA 4A3KG 3NENA 5EPJA 4DPGA 3BA9A 1HHVA 2EXDA 4K8JA 4IOAA 4BBSG 4R9WA 3CQZH 3DUZA 4ABNA 1OXTA 2R7ZA 1ZETA 2IBKA 1AZQA 1V9PA 3K3PA 5J3BA 2VQEH 2BDNA 1TIID 2VA2A 3S1RH 1EYZA 3PIP3 1M7JA 4RU9A 3G6EA 3GILA 5KFVA 3A8IE 2WAQB 1Q1EA 4WJWA 4XQQA 1N33Q 4OO1G 4A3GG 2C28A 3H15A 4ECSA 3N6RA 2RSOA 2QILA 3J80i 3NP8A 5JUMA 4J9RA 3MEHA 4KHPL 4A3JG 3HOXH 3VR5A 1E2WA 5M3FG 4OHJA 1B33N 2VY3A 2R7DA 1PRTB 3EQLC 4KKTA 5C3XA 1S10A 1BKBA 2L11A 1H9SB 3GTPH 5KRUA 3GLKA 3NTIA 5LXTF 2DPJA 4F4ZA 1D5MC 3M85A 1NR2A 3BDCA 4JV5H 3RIZA 4IALA 3R5FA 1T94A 2Z6BA 2G5DA 4QIWB 3R5XA 4EBCA 2N55A 5E3FA 5C0XH 3LX0A 4AQYL 4FU0A 4HNVA 4DR2Q 3CCUA 4CJ0B 1ASYA 4BY7G 2D9UA 2VQFH 3C3LA 4XZ3B 2Z8LA 1JCKB 2A8VA 3GTOA 2XCAA 4EGJA 5L1KA 3GV6A 1DJRD 4ZUJA 2H1EA 3TZDA 1S0OA 4EQNA 2PNRC 4FF4A 2IHFA 2PW7A 3Q2OA 1D5XC 2F0KA 4ED7A 1QZGA 1LT3D 4B3RL 1LTSD 2PZUA 2B2YA 2DY7A 4A3MH 2B63B 1TXYA 2PMZB 2W6PA 4K0KQ 1HR0H 1Y1VH 5IP9H 4JI4H 4HIKA 2V1CC 4DK6C 1KXLA 4BY1G 4RHSA 4FO2A 3U9SA 4O3NA 4DV2H 5KYLA 4CC5A 1Z6HA 2XNAC 2QDBA 1UC8A 2CFMA 4GNXA 4JOIA 1IBKH 2RDIA 4LF9Q 5I2XA 1HNXQ 4HTHA 2JEIA 3I55A 1S9FA 5DG7A 2RSNA 2VXWA 2L15A 2WP8J 1C7YA 4G57A 3JRXA 4FM9A 3PUXA 4R4OA 1PDQA 2UUAL 1NE3A 1NUCA 2RKSA 1WD1A 2K5VA 4LF5H 4XQNA 4H13C 1L0XB 2Z6KA 4O3QA 2QCPX 2R92H 1IYJB 3Q0AA 4JI3H 2JA5B 1SDFA 2FPGB 3L4JA 2RDFA 4DV6L 3TDQA 2W7OA 3L4KA 4I7AA 1KQSA 5EKLA 4R8UA 5LOVF 4P75A 4QIWE 1B9NA 1I4RA 3N6XA 2MHVA 3T1YQ 4RUCA 1BCPD 1LTID 4A3FB 4RGMA 4LF4Q 4ZHQF 3I4MG 3KAKA 2N3SA 4R4IA 1Q81C 2UUBQ 4OWWB 2ZT9C 1KAWA 4JBJA 4DF7A 1WCMB 4LFAQ 2J4XA 1EWIA 1JLLB 3I12A 1QNKA 1U4PA 1VQ8A 5C3EB 5C4XG 3H0GH 4MAMA 1XXGA 3R93A 1S0NA 1QE6A 3G6VA 1SE8A 3UDIA 2DNEA 3HOYG 1PYWD 5JVLA 2F0PA 4ZUIA 2SNMA 3HOZB 3K5HA 3HG9A 2TSSA 3K5MA 4DUYH 1RDPD 3KJPA 5G3LF 4JBKA 4ECQA 2LMCB 3GTJB 3NWSA 2SEBD 1HA6A 4R8UB 2EYHA 3S9WA 3HOYB 3LNNA 4KTAA 5CMDA 2KVMA 3KUPA 2PBZA 4RNNA 3GIPA 3TIGA 2I87A 3FMCA 5C4XB 4UFZA 4QWDA 1GO3E 1VMPA 1X54A 4QF4A 4LF6L 5KT7A 4XX0B 3ZYYX 4DR2L 1WCMA 2AQ3B 5BR8H 3CVZA 2GVBA 4KV6A 2LSSA 3M9BA 4AYBA 2YS7A 3RJ0A 3GTJH 3CF5A 1QCBD 2M05A 1M6VA 2ZM6L 4X64L 4ZKBB 2UVWA 4GLXA 1GUOA 4NXMQ 3OIQA 3FVQA 2Z1CA 2YRXA 5C3WA 1MJCA 3Q8PB 4J9QA 1E22A 2FE3A 4QWAA 1GXDC 4O1NA 3MAQA 2CCZA 4UCTA 2JA5G 1MHWC 2F0NA 4DLKA 5ELCA 3I70A 2VPSA 1ESFA 2NVYB 2NVXB 1L1OB 3CXCA 4PDBA 3QIAA 2IPKD 4EGVA 5D3DA 4BBRG 4MV1A 5J2UF 4LF9L 5D3IB 3BYYB 4ME6A 2NZ1D 3GTLH 2FK1A 4BWGB 5FJ8H 5KT2A 2M00A 1CKNB 3J80E 3FEWX 1WTPA 2K32A 2ZJRA 1KNAA 2F0GA 2RBMA 4RNOA 3IN5A 1EZ8A 1I4QA 3J81j 1VQIA 3H3VH 2C2EA 2HHHQ 3GV5B 4FS1A 2Y0SG 5KX5F 4XYMB 2B63A 4X3UA 1STAA 2SCUB 3MXGA 1CHPD 5CV6A 3GIIA 4RZQA 4NXNL 4ED2A 5BR8Q 1NBWA 4JI7H 1MD2D 1EQQA 1I3QH 3E0EA 1I4HA 5JJLA 4X66L 2AWNA 4ED3A 2R8IA 4RB2C 2EOTA 5HV6A 2XCPA 4CDDC 4BY7B 1D7QA 1R4PB 2BR0A 1EY7A 4JVZA 1PH8A 2IX3A 4B3RH 4ME5A 5IODA 4IR9A 1XNQL 4CHTB 3K5OA 4O2AF 1STNA 4ZAIA 1HR0L 2M9VA 1CQJB 3KBXA 2VS1A 3V4SA 4R4CA 4QCLA 1N32H 4LF4H 1X3PA 3TN2A 2CW7A 2CQAA 5JJZA 4Q5VA 1I5FA 3A8JE 2GN5A 2F0OA 5KEEA 3N40P 3GTPB 4L5TA 2ICEC 4A3JB 4NXNQ 1MGSA 4LMYA 4F4YA 3TS0A 1QVCA 1XPOA 2W6NA 5C0XG 3QR8A 3I90A 4A3LG 2OWOA 2YZGA 2XD4A 4A93G 5KFNA 1K3BC 2EYOA 3NWTA 3OOCA 1CI3M 1PH4A 2XWJB 1A62A 4POFA 1WTXA 1TS2A 2KEEA 1HQRD 1Q12A 1TR5A 2F0UA 5C0XJ 1V1PA 1GYFA 4DV3H 2AMCB 5DGAA 4A93H 2PZWA 2OQKA 1PH1A 3GIKA 4B08A 1GUTA 1K0RA 2Z9HA 4B3RQ 1FNUA 3GTJA 4A3KB 2R85A 4LUVA 4MV4A 3VDYA 2PMZE 1WI5A 4ZKCB 1HRJA 4BBRH 3QZ8A 2C35B 2W9AA 1I6HB 2SNSA 3HKZA 1EIYB 4NXML 4BA2I 1N34H 1JOKA 4PG3A 2RCNA 5DLQE 3HFZB 4I4TF 3VR6A 1GUSA 5KFCA 2V4QA 3I73A 3PO3G 2EQSA 1SE3A 1NR4A 4MA0A 3HOUB 1M4VA 4EEYA 1ZXTA 1NSNS 3SK5A 3RLNA 3WOFA 4DR6H 3RLFA 1DGSA 1KDCA 4FDBA 3GTLA 1EZ1A 5DLFA 4KKSA 1PMRA 3GTGH 3PW0A 2FLNA 3J80L 1N36Q 3RMHA 2NVYA 2K5HA 1EEID 4EFEA 2NVXA 3L7ZC 2M2LA 1H9RA 4DR2H 3V6KA 1YBYA 3JAMi 1YHBA 1A15A 4GOPB 3OHXC 4BA1I 3NTKA 5T14A 4DK0A 3JAMW 1TWFB 2EY5A 4Q45A 3HP3A 5C44H 1XNRL 4F8MA 5IY0A 3H40A 4DXFA 2KECA 2R7ZB 1YHQA 3TP5A 1X3GA 2A19A 5KFFA 4M7EA 3S1MH 2K28A 5FO8B 4DV4H 3HOUH 2PYKA 3GP7A 3NE5B 2W8LA 2C22A 4J9LA 1U4RA 1WYDA 1AH9A 3EJIA 5L1IA 2EE1A 2NN6G 3D3RA 1XMOH 3GIDA 1JICA 2Z6KC 1XMQH 3RV3A 4JI8H 1I50A 4LF9H 3I56A 1DD2A 2Q2TA 1VBGA 4ILWA 1JWUD 4F4XA 3CRKC 3S24A 1I4GA 1GOZA 2Y0SE 4L8JA 5K5PA 4XQJA 4JI0H 4EFBA 3KK7A 3S14B 1MZBA 3PN1A 2LXKA 1EYGA 2IX0A 2IX1A 4J9KA 4N8FA 1RYSA 1TWGB 2X6LA 4RKBA 3T5JA 2AGPA 2VL6A 1I94L 4IFDG 4DR1H 3BJUA 3URYA 2QEXA 2WE6A 3Q8QB 2I5LX 1QVGA 1JOOA 3IAYA 4A93B 5EKKA 2EYMA 2F0VA 2EVBA 1FGUA 1B50A 1Y69U 1PK8A 4A3DH 2B2UC 2XIWA 5EPKA 3T4AC 4HIDA 4A2AA 3NPPA 2ZJTA 3RLOA 3G7LA 2OXPA 2A73B 3I91A 1TS3A 1V51A 1QNUA 5C5MA 3GTPA 4RFBA 4I55F 3PGZA 1KC8C 4KN7C 2XRSD 3NEMA 1RJRA 2MFIA 1O78A 4LNQA 2Y0SA 5D1OA 2JEFA 1OXVA 1I50B 1G91A 5KFPA 1ASZA 4DR7L 1UEAB 2YTVA 1YI2A 2WTFA 3E9IA 2KHSA 5KFAA 3UQ8A 1ZEQX 3M4QA 5EWEA 2AWOA 4IUTA 2O2LD 3M4IA 2EY2A 5IYDG 1N32L 3W1GA 5IYZF 5FLXL 4TQSA 1I7LA 4RAYA 2WB1G 4X65H 2JEAI 3C2PA 3U9OA 3J7A5 2J6TA 2IP4A 2I07B 4YY3Q 3U58A 2R7ZG 1AUVA 2B39A 3HKZG 3G6YA 3EPIA 1SXTA 2Q2HA 1IYVA 2P5ZX 1PFBA 3GTMH 3L9AX 1Y1VA 4B3ML 3G71A 2GPWA 3MR2A 3I4NG 1STHA 2DPIA 5I6WA 2H4OA 5LHY1 3KTMA 2DY8A 4H44C 5JH7F 1I3QB 4EEQA 3RGXA 3RD4A 4J9OA 2WYOA 1CZGA 2F4VQ 1CHQD 4UCSA 3EROA 4ECZA 2ZDQA 3KLWA 3FHWA 5C4HA 3WOEA 3AQQA 4BBRB 2AGOA 2YS6A 1PRTF 2UU9L 4A75A 3PO3B 1KJQA 1TWHH 4YB8B 3OWFA 4DV2L 2HDLA 1Q86C 2WKDA 1S5BD 1HTLD 1PVOA 3M4OB 4EQOA 3KLSA 3NBIA 5FLXE 3ZJYC 2NB0A 2XN9C 4ME3A 5EBCA 4O4LF 3KHGA 1Y1VG 2MJ8A 3BG3A 2IWHA 1W6KA 5IP9G 1EYAA 1Z2OX 2UUCL 2E2DC 4XYQA 2MQHA 4WORA 3I4LA 5E4XA 4YHHL 5GROA 1SR3A 4O3RA 4C3JG 3CMAA 4U7CA 4LF5L 4G7ZC 3HOVH 2B2TC 3CHBD 4V0BA 4LAAA 2V5AA 4OONA 1IBMQ 2NN6I 1EU3A 4DNIA 4RGNA 5CBAE 3RN2A 1N36H 2FLLA 3OW2A 1EUJA 4HYKA 1M0TA 2R7MA 3PR4A 3RNUA 4RCNA 5CV8A 1R9TA 3QB3A 3G6XA 1B4OA 1U9RA 5NUCA 4GOPC 4YR3A 2JA5A 1EU4A 2BOSA 1XNRH 5IYDH 3HOZG 2K1BA 2BH8A 2C9OA 3M3YB 5JVG3 4DNTB 4RWSC 1CK1A 1LTGD 3GTQB 2I0QA 4APVA 5M5YB 4IUUA 5L1JA 3KHHA 5D65A 4DV5Q 4FBUA 1K8MA 4M1UB 4DKAC 3S1QB 3DMUA 5KNCA 3X3NA 4JI8Q 3K7UC 1HFGA 1XMQL 4L6TB 4PZ7A 2UUBL 5T1IA 4JI1Q 5LMNQ 4U6PA 5LMUQ 4A3FG 4HJ7A 3H3VC 2KCTA 2UXDL 1GSAA 1JE5A 1Q8IA 3D31A 3MFYA 1AW7A 5DM73 4ZLTF 3ULLA 1O80A 5M5XB 1PH7A 1CS0A 4ECTA 4U673 1EIFA 1TS5A 2ATWA 2AQ2B 1S40A 3SE0A 5IGDA 1JWSD 5J39A 4KLKA 4ZK9B 1EY6A 4DUZL 2VUMA 4YHHQ 4XXEA 5JOBA 4DAVA 1ZYRD 1K73C 3GTMA 2Y0SB 5D1OB 4QW8A 1F9QA 1IZ6A 2EXZA 3OUZA 4R7RA 3BDLA 3HEJA 3OIPA 3M4YA 1D1KA 1ZKOA 1BVSA 4YR0A 1TWCH 3TP6A 1IOWA 3RF2A 4N9PA 4A3FH 1KAAA 4KJNA 3ER0A 3GTOB 3SK8A 4JUZA 5KNBA 2CZGA 3F2UA 2WB1E 1SRUA 3Q8RB 4A3EG 4FNFA 1W2BA 4DV1Q 4X64Q 4C1NI 1N34Q 1I3QA 4UP7A 2O03A 5KFDA 3RTXA 3HS0C 2ASLA 1U5KA 1ML0D 1V43A 2EYJA 2RF4A 1YITA 2E2HH 4GN4B 1L2ZA 3HB9A 4IZ8A 2UXCQ 4LW1A 2J0TD 2NUAB 2PNHA 2QDLA 3H0GB 5LMNW 1FGBD 4N8X1 4EYHB 3VYTA 1BXTA 2XRQD 3NTHA 4JYAL 4MZ9A 2PQAA 3A7AB 3A5UA 4MV9A 1SFOH 5KG1A 2FMAA 4PWQA 3PIPA 2LFNA 4F50A 4HNUA 3PIOA 5KIXA 5M3FB 2R6FA 1IBLH 5K36G 1EHIA 1R9TH 3DF7A 1ZHSA 4LUZA 4DL7A 3S1MB 4R8IA 3OMGA 4A3GB 5LL6X 5JQWA 1A9XA 2YTYA 2B2YC 3KLRA 4O0AA 1F77A 4UCOA 2WAQG 4CKEA 5IT9L 2NZHA 1H9JA 3PIO3 1C9OA 4J9SA 4ECXA 2R7KA 4JV2A 1JXLA 1X65A 1RF2D 4RA8A 4LF4L 4A3IB 4A3IH 3JRWA 1FJGQ 3H6MA 4HCEA 5KFYA 1LT6D 4NW2A 4C3JB 2MO0A 3K5LA 5CV9A 3CC4A 4XTCS 4BBSB 4TV8F 4YHHH 2B2TA 4JI4L 1VQAA 3UDXA 4GLAC 2N49A 4Y7NH 1Y1VB 2LY7A 3D0FA 2G9DA 1W3SA 3S15H 4DA2A 3EBEA 1VQJA 1G6PA 4C2MA 2W70A 3N41B 5I2YA 1TWHB 2R8GA 3HOWG 3S14H 4P72A 5C1OA 1AN7A 5HURA 1PTOB 1KNEA 5BN3A 3J7AV 2ASJA 4OEMB 4BWSC 4TVAB 2N8NA 2UUAH 4GC7A 4AH6A 1ENCA 2A6HD 3S1RB 3GTKH 2YU9B 1DIKA 2HHHH 4QJFA 2WAQE 4RHRA 2SDFA 2AHOB 1TAEA 1RK6A 1S5FD 4NDXA 4YCVA 3LMLA 4E6IA 3GTGA 1HNZQ 3GIQA 1OTCA 4H0LC 3D6WA 4X66Q 3CAMA 3F1ZA 2NTSA 1GSHA 4RB0A 2D0OA 4DR7Q 1EQTA 3FKIH 1TQOA 1XNRQ 1Q46A 3FP9A 1B44D 3I3CA 3M4PA 2XSCA 4ZI7F 2B63G 1STYA 4OWXB 3KXYT 1YNNC 2R93B 3TREA 2UUBH 2KEDA 4IUNA 1Y1WH 2R8HA 3HKZB 4OGQC 4FBTA 3TS2A 3ICEA 2NU7B 4C1NK 3AMUA 3J7AK 4P2CB 3RBEA 1B04A 1TWCB 4KK7A 2VR1A 2FMCA 1LACA 3NGDA 2E2HA 5M9OA 1SNCA 3RZDB 2UXBL 4UCVA 3T1HH 1F2LA 2KUMA 1PZKD 4MTEA 1CKNA 1EQVA 2FLPA 1NAPA 1HJPA 1BO0A 4R4QA 3VA7A 4A3DG 2B8GA 1R9TB 3JC66 3P1HA 2FKLA 2XTIA 2NVTH 1YIJA 1NY4A 3J7AF 4J6HA 2WDTA 3CPFA 3S2HB 4P74A 3VYSA 3HKSA 3SHLA 1Z9FA 1RIPA 5J22A 2VQEQ 3S17B 2R7LA 3UI2A 5EJWA 5M3MB 4F87A 3GTQA 1FD7D 2MCTA 2BDOA 3KHRA 1JJ2A 4A3BH 4B9WA 2R93A 5BR8L 2RHQB 1SYFA 3JAMc 4A2BA 1EY5A 5FK9C 2F0TA 4X64H 2IT1A 1VQMA 1H95A 2NVTB 1EYCA 3Q23A 1F2MA 4IPCA 2E2HB 1Q3LA 3QOJA 1DV2A 3UE1A 3HOWH 4EVOA 3K59A 2R7ZH 5F9NA 3P7JA 5C4ZA 2V58A 1YZ6A 3GQBA 1UUPA 2PQAB 3L3OC 2FHTA 1I94H 4UDUC 4POGA 4DL2A 5COYA 1X32A 2KQ3A 2JSOA 2PCFB 3DM1A 3FPUB 3S2HH 2W8KA 1E7ZA 2TMPA 4C3HH 3TSSA 1K0SA 3Q8DA 1QZHA 4FF3A 2Z0SA 1Q90A 4HJ5A 1TWGA 4X6AH 1K83B 2L1BA 2YYZA 4Q8EA 3WO1A 1NJIC 2JE6I 4A3JH 3MWMA 3RB4A 1K3RA 1EQRA 5CAEB 3C46A 2AGQA 1B3QA 4MV3A 3R2IA 4ULLA 4DR5L 4JI6L 5DQGA 5L9XA 1I6VC 2BQRA 5JJIA 5CV7A 4O2DA 1HNWL 3W3AA 5G3LD 1KJJA 5FD5A 1WTRA 2A6HC 4JI1L 2AU0A 5F9LA 3GTKA 2HIXA 1VF7A 1S4ZA 1AFPA 4A4IA 2BE5D 5GADC 4H7BA 2UXCL 3MZ5A 4HMIA 4DV5L 1K28A 2IJ0A 4QGUA 2RQXA 3TIIA 2K03A 3GO5A 3K0YA 4PZ8A 1EY4A 1T9HA 1JB3A 1U4MA 2F0JA 3E9HA 1HNXH 1DCZA 1GUWA 3EFXD 2HCIA 2DIKA 5FD6A 3BQ1A 4APMA 1A0IA 3E6ZX 5L37A 4A3KH 5K2MA 3T53B 1HNZL 3MFGA 3HOUG 1VBHA 4GKKQ 2R87A 1VQ7A 5IGGA 3MHBA 1TWHA 1YNXA 2YL2A 2I5HA 4RAUC 3H09A 3CPWA 2K04A 3MR6A 3BABA 1UE7A 3H0GA 1N48A 1XDNA 1NCVA 4B3MH 4CKCA 5E4WC 4O3PA 1MSHA 1I4XA 2PW5A 5GAHC 4JI7Q 5BN4A 1KJ8A 1GJXA 4CKBA 3M3YH 2ZJQA 1XJVA 1XX8A 1BJTA 3OMCA 3VPDA 3HZXA 4PV1C 3GTLB 1XMOQ 3FDTA 4HJAA 4V190 1VCIA 1WD0A 4ED0A 2KCMA 1SLJA 4AQYH 5IGBA 4AIMA 3FMAA 3MFIA 3PW7A 4IJHA 2YYAA 3R2TA 4RGTA 3SI8A 4Q0YA 2R92A 2W57A 4TSSA 2DWCA 3WNZA 2C2DA 2OEOA 2B8FA 4IRDA 3DWQA 3R5HA 1PTOF 1MIUA 1YNND 1QUQA 1NTGA 1UNNC 2YCHA 1DOLA 4DV0Q 2UUCH 3K81C 1E24A 2VW9A 2JA5H 3PR5B 3OTOQ 3MWYW 2UVVA 1UE1A 1Z47A 4BY7H 4DNRB 3I8ZA 3MR5A 5KFZA 2NWGA 3M9NB 4Y52H 2A6EC 4CJ1B 1U0LA 1ICFB 3D6CA 1N36L 3A5ZB 3N43B 4K6LA 3UFXB 3T1HL 3VYRA 1RK5A 3IRBA 4JV1A 2L4NA 5CV4A 1N8RC 1B7YB 3W5OA 1PX2A 5BMVF 3RB6A 2UVUA 3T51B 3DXJC 5IYCH 4IJLA 1SMYD 4ZRZA 2X0SA 5CA0F 3J81L 1HR0Q 1Q82C 4DR6L 3CW2C 4U68A 3V2TA 3PUWA 2JA8G 2AQ1B 3LWUA 3QG1A 1IBML 5FPRA 5KFJA 3MWDA 1LTBD 3I4OA 3BG5A 1EIGA 3IL8A 2R3ZA 2K5QA 3V4ZA 4Z9CB 3RUPA 4ZQIA 1RTNA 4L1KA 1EUCB 4C5AA 4QL5A 2EYFA 5KFRA 2VQFQ 2FPIB 5DQIA 1WCMH 1UE6A 1LT5D 2UVRA 2R82A 1FJGH 5CV5A 2UUCQ 1J5EH 4IRCA 2UXDH 1IL2A 3PUYA 4DV7L 3RB0A 3HKZE 3A54A 3Q6SA 1YNJD 4K5VA 4TRDA 1K9MC 1TWCA 5D14A 4FXDA 2ZM6Q 1JORA 1T5EA 3L0OA 3MWEA 3KYHC 4JK1C 1J5EQ 4HQ6A 2A68C 1KJ9A 5I47A 1SSOA 4L5SA 3HOVG 4QUFA 4RUAA 1I4PA 3PF4A 1O7YA 4FP5D 4YJ2F 2VZAA 4MTNA 4F4WA 1P16A 4EQ5A 5EBDA 1ILQA 4DK1A 1CZWA 4JI0L 4HEDA 1BNCA 1TWAH 1OWTA 2JN4A 4QQBX 1LLRD 2XCLA 2YU9H 3D4WA 4DR1L 4DR5H 1CE8A 1ESRA 3VYUA 4DR4L 5KFEA 2FK3A 3T16A 2I8CA 3L2PA 4B3TH 2DJFC 1SYXB 4JI1H 3DM3A 3Q22A 1D8LA 4A3MB 1HCZA 2QGQA 2B63H 4GKJL 1HPCA 3ETHA 2JEBI 2Z4IA 5IYCG 5DG9A 3CD6A 1DZ1A 5ELNA 5C3EH 2DLNA 2FB9A 2EZVA 1WVLA 1XWEA 1UC9A 4JYAQ 3MXPA 1Y1WG 1XNQQ 5EDWA 5D1PA 2R84A 1P8LA 1G8ZD 4XT1B 5EKIA 4GKJQ 4FF1A 3I4MH 5A2QE 3KDFA 1SEBD 4TQRA 4J15A 1AP0A 1EOVA 2JP1A 3T1HQ 1GHJA 3S16H 2IY5B 4C2MB 2PQEA 4GLVB 4J9PA 1YJWA 2JXMB 3BVGA 4LFBL 1OO9B 5C3EG 1YJNA 4AYBG 4YJ3F 4NLGA 1TT2A 1WCMG 4GC6A 2KCNA 1LUZA 5KG2A 3NBHA 4WRDA 5FPOA 5M5WB 3K5IA 3I4MB 4HIMA 4LFCH 5A2QW 5CBEE 3C1FA 4O2BF 4A3CG 3IKJA 4JI2H 2D0PA 3MTSA 1KRTA 3T13A 1KABA 4X62Q 3GTGB 1S68A 4H02A 5LA6F 2DNCA 2ZDHA 3K8AA 2HCCA 1CA5A 4A3GH 2R92G 1FR3A 1B6RA 1E4FT 2E5LL 1TY0A 4B3MQ 3E5SA 2F4IA 2W9BA 2FJZA 1F2ZA 1H9MA 4KHPQ 3CKIB 3BDOA 3UE0A 3V6JA 1TWFA 2UU9H 1XNQH 5LMUL 1OXSC 4YY3L 3K80C 1JKJB 2F4VH 1T3NA 2KSWA 1CA6A 1HA5A 2PI2A 3BQ2A 2F0SA 1JT8A 2ZXRA 4LF8H 3DEOA 4LMQD 1XMQQ 2LKVA 4BY1B 1XYIA 1U4LA 4F88A 3RGZA 3R8BA 5BPFA 4LF7Q 4ID6A 5C0XI 3AU7A 2Q8RE 3E3XA 1TS4A 2HHHL 1STEA 2E8GA 3WWVA 2VB3X 2JA7B 4M9UA 3CCRA 1A8VA 5DNFA 5BN5A 1IBMH 5KFIA 2IL8A 3DLLA 1TWAA 2PI2E 2EYPA 4L5QA 2VPQA 1PXUA 2YU9A 1BBWA 1XTCD 1GSOA 3TP8A 1A2TA 4UP8A 1VQGA 4JC0A 5KFWA 4FS2A 3PQIA 1A3VA 1EY9A 3NQIA 1EEFD 5KKNB 1RKNA 1B8AA 4LJZC 1PFNA 1JR0D 1ICWA 2R86A 4OWTB 4HSPA 3TBIB 2ZJPA 4G7HC 4FYDA 2C2RA 5CA1F 4P71A 1Y8NB 3HOXG 5M3FH 2RDGA 5KFTA 3SDZA 1K1SA 3TINA 2RGRA 4DL3A 5EPLA 2LS01 2UXBH 5HGQA 4A3LH 4YIJA 5F2DA 1JE4A 1IHZA 4G4KA 1EFID 3RR5A 3OWEB 1O7LA 1SROA 2MP1A 4JI5Q 2EJFC 2PVPA 4C5BA 1N33L 4ECUA 1LT4D 5H80A 1TWAB 5KNDA 4ECWA 3OUUA 4I65A 3K57A 5IWAQ 3STBD 4UHVA 2RVLA 3SR1A 4S3SA 1HQMC 1JX4A 2K7VA 2F03A 5KYIA 5K36H 2K75A 2QW7A 5AFWA 4YCWA 4BXXG 2BE5C 2PO4A 4WBNF 2L5TA 2QF7A 5LMNL 1SN8A 1VQBA 4FVMA 3DEPA 3BVMA 4O42A 3KDFB 2MNAA 1VQ9A 4JI5L 1JIHA 3ND8A 4EQPA 5EOYA 3Q8SB 5M3MH 4B3SH 1VQDA 5IP7G 1I7NA 4K5WA 3FPPA 1SJHD 2PZTA 4KD4A 3PO2G 5KG6A 1SCUB 3EVQA 3H3VI 3KF8A 4DK3C 1K8AC 1VQ6A 4DV4L 4OO1H 4JPBW 2VQEL 4LH6A 5KG4A 4KHZA 2EPBA 1LV9A 2K6AA 3RAXA 3U9TA 1SMXA 4C3HG 2VQDA 4R4TA 3CCLA 3HXLA 3M9OB 2F0QA 4JBWA 4YWMA 3MVVA 2X69A 1LYLA 4UP9A 2FMMA 4IUPA 2K4KA
chains in the Genus database with same CATH topology
3ULPA 1O7IA 4QJFA 4BBRG 2KBNA 2WAQE 1VQ5A 1HNWQ 4LF9L 2AHOB 3RZOH 1E3PA 4XIGS 3M4OH 3S1NH 4IPDA 4YCVA 2ASBA 3GTLH 5FJ8H 1A63A 1CKNB 1J6QA 1HNZQ 2ZJRA 1OTCA 4QY7A 4X66Q 3CAMA 3F1ZA 3PO3H 1CKMA 5AJ3L 3J81j 2YV5A 1VQIA 2HIVA 2D0OA 4DAMA 3FKIH 1XNRQ 1CSPA 3H3VH 3RN5A 1Q46A 3FP9A 2HHHQ 1E1TA 2BA0A 4DR6Q 2Y0SG 3KF8B 3M4PA 2B63G 4BBSH 4OWXB 1WFQA 5GQOA 2E2JH 4NXNL 5FJ8G 4A3BG 3TREA 4HJ8A 5BR8Q 1Y1WH 1KIXA 2K14A 1NBWA 3TRZA 1PYSB 1EQQA 3TS2A 1I3QH 3E0EA 2ID0A 3ICEA 5JJLA 4X66L 3PUVA 2AWNA 3PF5A 1VQPA 1VQOA 4DV1L 3GTKH 2UXBL 3CCJA 1D7QA 1QUQB 1CKNA 2CWAA 1PH8A 4C3JH 1HJPA 4A3DG 4R4QA 1JJCB 1Q1BA 1XNQL 3JC66 2IHEA 1HR0L 3G48A 2XTIA 1B70B 2NVTH 1YIJA 1NY4A 3M7NA 2VS1A 1MJEA 2HQLA 4R4CA 2F4VL 3CPFA 4P74A 4IFDI 3HKSA 1Z9FA 1BBUA 1RIPA 2VQEQ 3CCQA 1E1OA 1I5FA 2OCEA 2GN5A 4LWCA 4LF8L 5GAEC 4WJ4A 1JJ2A 4L5TA 4NXNQ 4A3BH 2JK8A 1HZAA 5BR8L 2RHQB 3TS0A 3NBHB 3JAMc 1QVCA 3U50C 1XPOA 5C0XG 3HOZH 4TQUS 4A3LG 3I2ZA 2OWOA 2IT1A 5IYBH 4A93G 5M5WH 1VQMA 1Q7YC 1H95A 3AEVA 3GDEA 4L5RC 1PH4A 4DV0L 4IPCA 4POFA 1A62A 4LF6Q 4JI3L 1LM0A 3UE1A 3BZKA 3HOWH 4A3CH 1Q12A 4OX9L 3W1BA 2R7ZH 5C0XJ 1YZ6A 2AMCB 2PQAB 1YVCA 1TWFH 4POGA 4A93H 3ERSX 2OTJA 2OQKA 1PH1A 2K52A 1K0RA 5FLMG 3S2HH 3TEHB 4B3RQ 1E7ZA 1QVFA 4C3HH 4LUVA 4R1JA 1GVPA 3VDYA 2OTLA 3Q8DA 1QZHA 2Z0SA 2WFWA 2KHJA 1CKOA 1FL0A 2PMZE 4NPSA 2BA1A 1WI5A 2H5XA 4HJ5A 4X6AH 2YYZA 1M1KC 1NJIC 2JE6I 4BBRH 4GOPA 2B3GA 2C35B 4A3JH 1IBKQ 1K3RA 1EQRA 1S72A 2XGTA 3ULJA 1EIYB 2CKZB 4UPAA 4DR5L 4JI6L 4NXML 4BA2I 4PG3A 5JJIA 3S17H 4O2DA 2RCNA 5DLQE 3HFZB 1HNWL 2DGYA 1PV4A 2F52A 3PO3G 2EQSA 4JI1L 2QA4A 4LF5Q 2HIXA 3T1YL 3OTOL 2LXJA 4A4IA 1YJ9A 4LFCQ 4IFDJ 5GADC 2UXCL 4WJ3M 3RLNA 1Q8KA 4DV5L 3RLFA 1DGSA 5IE8A 4QGUA 4FDBA 1X55A 3GO5A 4PZ8A 4HIOA 1T9HA 4LUOA 3FKIG 3GTGH 3J80c 3E9HA 3CMEA 1PH6A 4LF8Q 3UDFA 2OQ0A 4UY8C 1N36Q 4DV6Q 2JJQA 2K5HA 3MEFA 4DV7Q 1A0IA 3KF6A 3L7ZC 4A3KH 1YBYA 3JAMi 1YHBA 4GOPB 1HNZL 4BA1I 1KHIA 3HOUG 1L0WA 4GKKQ 3CC7A 1L1OA 4JBMA 4X62L 1UWVA 1VQ7A 3PUZA 5AJ3Q 3B6YA 2VUMH 1YNXA 2I5HA 3CPWA 5C44H 1XNRL 5IY0A 1UE7A 4B3SL 1YHQA 3CCMA 1X3GA 2A19A 4DUYQ 1J5EL 3S1MH 5GAHC 4JI7Q 4GNXB 2CQOA 3HOUH 3M3YH 4JI2Q 3BZCA 3J81c 4DV4Q 2ZJQA 1XJVA 1WYDA 1AH9A 1MKHA 4K0KL 3TQYA 2B29A 2EIFA 3I4NH 3KFUA 2NN6G 1XMOQ 4ALPA 1PH9A 4HJAA 2N78A 1VCIA 2Z6KC 5ELOA 3SGIA 2KCMA 5JJKA 1SLJA 3G4SA 3CCSA 2NZOA 3I56A 4AIMA 2VUMG 1FVIA 2Q2TA 4IJHA 3F2DA 3S24A 2CWPA 2Y0SE 1UE5A 3S2DH 2LXKA 1EYGA 2IX0A 4IO9A 2IX1A 1VQHA 2AKWB 2VL6A 1I94L 4IFDG 4YWKA 3BJUA 2QEXA 1MIUA 2I5LX 1QUQA 1NTGA 5IYBG 4HJ9A 4DV0Q 4A76A 1QVGA 4B3SQ 3HOYH 4RG1A 3K81C 2K5NA 1E24A 2VW9A 2JA5H 3OTOQ 1FGUA 4B3TL 2BH2A 2JQOA 1UE1A 4DR3L 4A3DH 4HIDA 4JG2A 1Z47A 2ZTEA 5E7NA 4BY7H 3RLOA 4GN5A 4LFBQ 4Y52H 4C2MH 1KL9A 4PZ6A 1U0LA 5M3MG 2VNUD 3LGJA 1N36L 3PGZA 3AYHB 1KC8C 3A5ZB 1M90C 4BY1H 3NEMA 1VQEA 2MFIA 3T1HL 2KENA 2ES2A 4LNQA 1CSQA 3IRBA 1OXVA 1OXUA 1UEBA 1N8RC 1X6OA 1B7YB 1XPRA 1VQNA 4B3TQ 4NB3A 3W5OA 1AE3A 2UUAQ 4BXXH 2RHSB 4JV5Q 1ASZA 4YCUA 5H1SE 3A74A 5IYCH 4IJLA 4DR7L 2YTVA 1GKHA 1YI2A 3E9IA 1HR0Q 1Q82C 4DR6L 3F8TA 3CW2C 3M4QA 4DR5Q 2AWOA 4KI0A 2E5LQ 5HY6A 5IYDG 1GM5A 3PUWA 1I94Q 1N32L 3W1GA 2JA8G 3GTOH 1VQFA 1IBML 4IPHA 5FLXc 2WB1G 2JA6H 2JEAI 3I4OA 3J7A5 2NVQH 3GD7A 3U58A 4YY3Q 1AE2A 4DR3Q 1HR0W 2R7ZG 3HKZG 3CC2A 4JV5L 2MO1A 2Q2HA 4QL5A 1CUKA 1I6HH 4YWLA 2R93G 2VQFQ 3NELA 1KD1C 1WCMH 2UXBQ 1UE6A 1HH2P 3RZDH 2ZTDA 3GTMH 1EFWA 4B3ML 3G71A 2K50A 3K0XA 2UUCQ 3I4NG 2F3IA 4DUZQ 4DR7Q 1IL2A 3PUYA 3U4ZA 4DV7L 1PHJA 3HKZE 4GS3A 3UDGA 5IT9c 1K9MC 4OX9Q 2F4VQ 1GD7A 2ZM6Q 1IBLL 1WJJA 3L0OA 3KYHC 3KLWA 5M5YH 3J7ZC 3FHWA 1IXRA 1PA6A 3AQQA 5C44G 1J5EQ 2JA7H 4JOIC 1WOCA 1HZCA 2YTXA 4DUYL 4L5SA 3HOVG 3PO2H 2UU9L 4A75A 4JI8L 3PF4A 1TWHH 2VZAA 4MTNA 2KHIA 1P16A 4EQ5A 1K8GA 4DV2L 4DV3Q 1Q86C 3PSIA 1PVOA 4JI0L 1G6PA 3I7FA 2R93H 1TWAH 1IBKL 3ZJYC 1X9NA 1PH5A 1N34L 2YU9H 4ME3A 4DR1L 1HZ9A 4QQBX 4DR4L 1V1QA 1X3FA 1Y1VG 5IP9G 2JA9A 4OXPA 3KF6B 2UUCL 4GN3B 4JI4Q 5M5XH 2MQHA 4A3KG 3NENA 4DPGA 3PV0A 4YHHL 3L2PA 5GROA 2EXDA 3DM3A 1SR3A 3AFQA 1D8LA 4IOAA 2B63H 3CMAA 2QGQA 4BBSG 4GKJL 4LF5L 3CQZH 3HOVH 2JEBI 1OXTA 4OONA 1JMCA 1IBMQ 1OXXK 2NN6I 3OYYA 5IYCG 4DNIA 3RN2A 3CD6A 1PYBA 5ELNA 4JI3Q 1V9PA 1EUJA 5C3EH 5J3BA 3OW2A 4LFAL 3S1RH 4JYAQ 3RNUA 3G6EA 1L1OC 3F2BA 1Y1WG 1XNQQ 1N33Q 1Q1EA 4OO1G 4DAYB 1P8LA 5EAYA 4GOPC 2JA6G 4A3GG 4GKKL 4GKJQ 3H15A 1NMGA 3I4MH 4AYBE 1TWGH 3KDFA 5IYDH 3J80i 3HOZG 2BH8A 4J15A 1X3EA 4KHPL 4A3JG 1EOVA 3HOXH 5M3FG 3T1HQ 2R6GA 4DR4Q 3S16H 2IY5B 1VQCA 2I0QA 2VY3A 2R7DA 4GLVB 4APVA 1BKBA 1LTLA 3GTPH 1YJWA 3STBC 4DV5Q 4LFBL 5C3EG 1YJNA 3M85A 4AYBG 3EN2A 5FLMH 2DUDA 3GTQH 1WCMG 4DKAC 1LUZA 2UU9Q 3F2CA 4JI8Q 1XMOL 3K7UC 1N9WA 1XMQL 4PZ7A 4HIMA 2UUBL 5LMNQ 4JI1Q 4AQYL 1FJGL 5LMUQ 4A3FG 4HJ7A 4DR2Q 2KCTA 4A3CG 2UXDL 1YHAA 1JE5A 3CCUA 2D0PA 3D31A 1ASYA 1KRTA 4X62Q 4BY7G 3ULLA 1PH7A 4PMWA 2A8VA 4H02A 1EIFA 2ATWA 2NVYH 2NVXH 3K8AA 1S40A 1VQKA 4A3GH 2R92G 3CCEA 2E5LL 4KLKA 1PH3A 4B3MQ 2IHFA 1NMFA 4DUZL 1PFSA 1QZGA 4B3RL 4YHHQ 4KHPQ 4JCVE 3K7AH 3UE0A 5LMUL 4LF7L 3CP0A 4A3MH 1OXSC 1TXYA 4YY3L 1K73C 2JA8H 3K80C 1Y1VH 5IP9H 4K0KQ 4HIKA 2V1CC 1IZ6A 5JEAJ 4DK6C 1KXLA 4BY1G 2PI2A 2CFMA 4GNXA 1VQLA 4JOIA 4RMFA 4JI6Q 1JT8A 1BVSA 4LF9Q 1HNXQ 3I55A 1TWCH 5C4XH 1XMQQ 1G51A 1C7YA 2L15A 2WP8J 4A3FH 5JEAG 2UXDQ 3ER0A 2E2IH 4LF7Q 3PUXA 2R7FA 4R4OA 5C0XI 2UUAL 1JJGA 1NE3A 2WB1E 2K5VA 1SRUA 1IBLQ 4A3EG 2Q2UA 1W2BA 2HHHL 2E8GA 3WWVA 3KJOA 4DV1Q 4X64Q 1N34Q 2Z6KA 2R92H 1IYJB 4UP7A 3CCRA 2GVAA 1A8VA 1VQ4A 1U5KA 4DV6L 1V43A 4X65L 2RF4A 3DLLA 1YITA 2A1AA 1KQSA 2E2HH 2PI2E 4L5QA 4P75A 4QIWE 4GN4B 1BBWA 4DV2Q 3T1YQ 4JI0Q 4LF4Q 2UXCQ 4LW1A 3S1QH 4UP8A 4GNXC 3I4MG 1VQGA 2N3SA 4JC0A 2PNHA 1JB7A 4R4IA 1Q81C 2UUBQ 5LMNW 4OWWB 1KAWA 3J81i 2FXQA 4JBJA 1XPUA 1B8AA 1Y14B 4LFAQ 1EWIA 4IPGA 3A0JA 4JYAL 4MZ9A 1VQ8A 2PQAA 1HZBA 1X56A 1PH2A 4JI7L 3H0GH 4OWTB 3A5UA 3CCVA 5C4XG 1SFOH 2ZJPA 4A3IG 3PIPA 5IWAL 1SE8A 4P71A 3HOXG 3UDIA 5M3FH 3PIOA 3HOYG 1L2FA 5HGQA 4A3LH 4EX5A 5K36G 1R9TH 3MXNB 4LUZA 3RR5A 4LFCL 3KJPA 2YTYA 4O0AA 4JBKA 4MNOA 1SROA 2WAQG 4JI5Q 4X65Q 2NZHA 4JI2L 1N33L 1C9OA 1VS0A 2VQFL 4OO1I 1K83H 1G291 1I50H 1X65A 3KOJA 3STBD 3U4VA 5IWAQ 4LF4L 5IP7H 1HNXL 1N32Q 2I5MX 2K75A 3AFPA 4A3IH 4YCWA 4BXXG 1GO3E 1FJGQ 1C0AA 1X54A 5LMNL 4AQYQ 4LF6L 2D62A 2Q2IA 1KRSA 1SN8A 1S3OA 1VQBA 4DR2L 2GVBA 2LSSA 4A3MG 2MO0A 1YEZA 3M9BA 3CC4A 4XTCS 1VQ9A 3KDFB 3H0GG 2MNAA 3GTJH 3BU2A 4JI5L 1VQAA 3UDXA 5C4JH 3CF5A 2ZM6L 4JI4L 4X64L 1XTDA 5M3MH 2HT1A 4GLAC 1VQDA 2N49A 5IP7G 4Y7NH 4GLXA 4NXMQ 3D0FA 3PO2G 1W3SA 3S15H 1MJCA 3EBEA 3H3VI 1VQJA 1E22A 4C3IH 4DK3C 1K8AC 1VQ6A 2ALYB 1RL2A 4DV4L 4IOCA 2CCZA 4P73A 2VQEL 4KHZA 2JA5G 3HOWG 3S14H 4P72A 3PCOB 4DV3L 2JA7G 1SMXA 2ZTCA 4R4TA 3CCLA 4TVAB 1L1OB 4JBWA 5GAGC 4YWMA 3CXCA 2N8NA 1LYLA 4AH6A 4A3EH 4UP9A 4DR1Q 3EIVA 2K4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULP A;  1O7I A;  4QJF A;  4BBR G;  2KBN A;  2WAQ E;  1VQ5 A;  1HNW Q;  4LF9 L;  2AHO B;  3RZO H;  1E3P A;  4XIG S;  3M4O H;  3S1N H;  4IPD A;  4YCV A;  2ASB A;  3GTL H;  5FJ8 H;  1A63 A;  1CKN B;  1J6Q A;  1HNZ Q;  2ZJR A;  1OTC A;  4QY7 A;  4X66 Q;  3CAM A;  3F1Z A;  3PO3 H;  1CKM A;  5AJ3 L;  3J81 j;  2YV5 A;  1VQI A;  2HIV A;  2D0O A;  4DAM A;  3FKI H;  1XNR Q;  1CSP A;  3H3V H;  3RN5 A;  1Q46 A;  3FP9 A;  2HHH Q;  1E1T A;  2BA0 A;  4DR6 Q;  2Y0S G;  3KF8 B;  3M4P A;  2B63 G;  4BBS H;  4OWX B;  1WFQ A;  5GQO A;  2E2J H;  4NXN L;  5FJ8 G;  4A3B G;  3TRE A;  4HJ8 A;  5BR8 Q;  1Y1W H;  1KIX A;  2K14 A;  1NBW A;  3TRZ A;  1PYS B;  1EQQ A;  3TS2 A;  1I3Q H;  3E0E A;  2ID0 A;  3ICE A;  5JJL A;  4X66 L;  3PUV A;  2AWN A;  3PF5 A;  1VQP A;  1VQO A;  4DV1 L;  3GTK H;  2UXB L;  3CCJ A;  1D7Q A;  1QUQ B;  1CKN A;  2CWA A;  1PH8 A;  4C3J H;  1HJP A;  4A3D G;  4R4Q A;  1JJC B;  1Q1B A;  1XNQ L;  3JC6 6;  2IHE A;  1HR0 L;  3G48 A;  2XTI A;  1B70 B;  2NVT H;  1YIJ A;  1NY4 A;  3M7N A;  2VS1 A;  1MJE A;  2HQL A;  4R4C A;  2F4V L;  3CPF A;  4P74 A;  4IFD I;  3HKS A;  1Z9F A;  1BBU A;  1RIP A;  2VQE Q;  3CCQ A;  1E1O A;  1I5F A;  2OCE A;  2GN5 A;  4LWC A;  4LF8 L;  5GAE C;  4WJ4 A;  1JJ2 A;  4L5T A;  4NXN Q;  4A3B H;  2JK8 A;  1HZA A;  5BR8 L;  2RHQ B;  3TS0 A;  3NBH B;  3JAM c;  1QVC A;  3U50 C;  1XPO A;  5C0X G;  3HOZ H;  4TQU S;  4A3L G;  3I2Z A;  2OWO A;  2IT1 A;  5IYB H;  4A93 G;  5M5W H;  1VQM A;  1Q7Y C;  1H95 A;  3AEV A;  3GDE A;  4L5R C;  1PH4 A;  4DV0 L;  4IPC A;  4POF A;  1A62 A;  4LF6 Q;  4JI3 L;  1LM0 A;  3UE1 A;  3BZK A;  3HOW H;  4A3C H;  1Q12 A;  4OX9 L;  3W1B A;  2R7Z H;  5C0X J;  1YZ6 A;  2AMC B;  2PQA B;  1YVC A;  1TWF H;  4POG A;  4A93 H;  3ERS X;  2OTJ A;  2OQK A;  1PH1 A;  2K52 A;  1K0R A;  5FLM G;  3S2H H;  3TEH B;  4B3R Q;  1E7Z A;  1QVF A;  4C3H H;  4LUV A;  4R1J A;  1GVP A;  3VDY A;  2OTL A;  3Q8D A;  1QZH A;  2Z0S A;  2WFW A;  2KHJ A;  1CKO A;  1FL0 A;  2PMZ E;  4NPS A;  2BA1 A;  1WI5 A;  2H5X A;  4HJ5 A;  4X6A H;  2YYZ A;  1M1K C;  1NJI C;  2JE6 I;  4BBR H;  4GOP A;  2B3G A;  2C35 B;  4A3J H;  1IBK Q;  1K3R A;  1EQR A;  1S72 A;  2XGT A;  3ULJ A;  1EIY B;  2CKZ B;  4UPA A;  4DR5 L;  4JI6 L;  4NXM L;  4BA2 I;  4PG3 A;  5JJI A;  3S17 H;  4O2D A;  2RCN A;  5DLQ E;  3HFZ B;  1HNW L;  2DGY A;  1PV4 A;  2F52 A;  3PO3 G;  2EQS A;  4JI1 L;  2QA4 A;  4LF5 Q;  2HIX A;  3T1Y L;  3OTO L;  2LXJ A;  4A4I A;  1YJ9 A;  4LFC Q;  4IFD J;  5GAD C;  2UXC L;  4WJ3 M;  3RLN A;  1Q8K A;  4DV5 L;  3RLF A;  1DGS A;  5IE8 A;  4QGU A;  4FDB A;  1X55 A;  3GO5 A;  4PZ8 A;  4HIO A;  1T9H A;  4LUO A;  3FKI G;  3GTG H;  3J80 c;  3E9H A;  3CME A;  1PH6 A;  4LF8 Q;  3UDF A;  2OQ0 A;  4UY8 C;  1N36 Q;  4DV6 Q;  2JJQ A;  2K5H A;  3MEF A;  4DV7 Q;  1A0I A;  3KF6 A;  3L7Z C;  4A3K H;  1YBY A;  3JAM i;  1YHB A;  4GOP B;  1HNZ L;  4BA1 I;  1KHI A;  3HOU G;  1L0W A;  4GKK Q;  3CC7 A;  1L1O A;  4JBM A;  4X62 L;  1UWV A;  1VQ7 A;  3PUZ A;  5AJ3 Q;  3B6Y A;  2VUM H;  1YNX A;  2I5H A;  3CPW A;  5C44 H;  1XNR L;  5IY0 A;  1UE7 A;  4B3S L;  1YHQ A;  3CCM A;  1X3G A;  2A19 A;  4DUY Q;  1J5E L;  3S1M H;  5GAH C;  4JI7 Q;  4GNX B;  2CQO A;  3HOU H;  3M3Y H;  4JI2 Q;  3BZC A;  3J81 c;  4DV4 Q;  2ZJQ A;  1XJV A;  1WYD A;  1AH9 A;  1MKH A;  4K0K L;  3TQY A;  2B29 A;  2EIF A;  3I4N H;  3KFU A;  2NN6 G;  1XMO Q;  4ALP A;  1PH9 A;  4HJA A;  2N78 A;  1VCI A;  2Z6K C;  5ELO A;  3SGI A;  2KCM A;  5JJK A;  1SLJ A;  3G4S A;  3CCS A;  2NZO A;  3I56 A;  4AIM A;  2VUM G;  1FVI A;  2Q2T A;  4IJH A;  3F2D A;  3S24 A;  2CWP A;  2Y0S E;  1UE5 A;  3S2D H;  2LXK A;  1EYG A;  2IX0 A;  4IO9 A;  2IX1 A;  1VQH A;  2AKW B;  2VL6 A;  1I94 L;  4IFD G;  4YWK A;  3BJU A;  2QEX A;  1MIU A;  2I5L X;  1QUQ A;  1NTG A;  5IYB G;  4HJ9 A;  4DV0 Q;  4A76 A;  1QVG A;  4B3S Q;  3HOY H;  4RG1 A;  3K81 C;  2K5N A;  1E24 A;  2VW9 A;  2JA5 H;  3OTO Q;  1FGU A;  4B3T L;  2BH2 A;  2JQO A;  1UE1 A;  4DR3 L;  4A3D H;  4HID A;  4JG2 A;  1Z47 A;  2ZTE A;  5E7N A;  4BY7 H;  3RLO A;  4GN5 A;  4LFB Q;  4Y52 H;  4C2M H;  1KL9 A;  4PZ6 A;  1U0L A;  5M3M G;  2VNU D;  3LGJ A;  1N36 L;  3PGZ A;  3AYH B;  1KC8 C;  3A5Z B;  1M90 C;  4BY1 H;  3NEM A;  1VQE A;  2MFI A;  3T1H L;  2KEN A;  2ES2 A;  4LNQ A;  1CSQ A;  3IRB A;  1OXV A;  1OXU A;  1UEB A;  1N8R C;  1X6O A;  1B7Y B;  1XPR A;  1VQN A;  4B3T Q;  4NB3 A;  3W5O A;  1AE3 A;  2UUA Q;  4BXX H;  2RHS B;  4JV5 Q;  1ASZ A;  4YCU A;  5H1S E;  3A74 A;  5IYC H;  4IJL A;  4DR7 L;  2YTV A;  1GKH A;  1YI2 A;  3E9I A;  1HR0 Q;  1Q82 C;  4DR6 L;  3F8T A;  3CW2 C;  3M4Q A;  4DR5 Q;  2AWO A;  4KI0 A;  2E5L Q;  5HY6 A;  5IYD G;  1GM5 A;  3PUW A;  1I94 Q;  1N32 L;  3W1G A;  2JA8 G;  3GTO H;  1VQF A;  1IBM L;  4IPH A;  5FLX c;  2WB1 G;  2JA6 H;  2JEA I;  3I4O A;  3J7A 5;  2NVQ H;  3GD7 A;  3U58 A;  4YY3 Q;  1AE2 A;  4DR3 Q;  1HR0 W;  2R7Z G;  3HKZ G;  3CC2 A;  4JV5 L;  2MO1 A;  2Q2H A;  4QL5 A;  1CUK A;  1I6H H;  4YWL A;  2R93 G;  2VQF Q;  3NEL A;  1KD1 C;  1WCM H;  2UXB Q;  1UE6 A;  1HH2 P;  3RZD H;  2ZTD A;  3GTM H;  1EFW A;  4B3M L;  3G71 A;  2K50 A;  3K0X A;  2UUC Q;  3I4N G;  2F3I A;  4DUZ Q;  4DR7 Q;  1IL2 A;  3PUY A;  3U4Z A;  4DV7 L;  1PHJ A;  3HKZ E;  4GS3 A;  3UDG A;  5IT9 c;  1K9M C;  4OX9 Q;  2F4V Q;  1GD7 A;  2ZM6 Q;  1IBL L;  1WJJ A;  3L0O A;  3KYH C;  3KLW A;  5M5Y H;  3J7Z C;  3FHW A;  1IXR A;  1PA6 A;  3AQQ A;  5C44 G;  1J5E Q;  2JA7 H;  4JOI C;  1WOC A;  1HZC A;  2YTX A;  4DUY L;  4L5S A;  3HOV G;  3PO2 H;  2UU9 L;  4A75 A;  4JI8 L;  3PF4 A;  1TWH H;  2VZA A;  4MTN A;  2KHI A;  1P16 A;  4EQ5 A;  1K8G A;  4DV2 L;  4DV3 Q;  1Q86 C;  3PSI A;  1PVO A;  4JI0 L;  1G6P A;  3I7F A;  2R93 H;  1TWA H;  1IBK L;  3ZJY C;  1X9N A;  1PH5 A;  1N34 L;  2YU9 H;  4ME3 A;  4DR1 L;  1HZ9 A;  4QQB X;  4DR4 L;  1V1Q A;  1X3F A;  1Y1V G;  5IP9 G;  2JA9 A;  4OXP A;  3KF6 B;  2UUC L;  4GN3 B;  4JI4 Q;  5M5X H;  2MQH A;  4A3K G;  3NEN A;  4DPG A;  3PV0 A;  4YHH L;  3L2P A;  5GRO A;  2EXD A;  3DM3 A;  1SR3 A;  3AFQ A;  1D8L A;  4IOA A;  2B63 H;  3CMA A;  2QGQ A;  4BBS G;  4GKJ L;  4LF5 L;  3CQZ H;  3HOV H;  2JEB I;  1OXT A;  4OON A;  1JMC A;  1IBM Q;  1OXX K;  2NN6 I;  3OYY A;  5IYC G;  4DNI A;  3RN2 A;  3CD6 A;  1PYB A;  5ELN A;  4JI3 Q;  1V9P A;  1EUJ A;  5C3E H;  5J3B A;  3OW2 A;  4LFA L;  3S1R H;  4JYA Q;  3RNU A;  3G6E A;  1L1O C;  3F2B A;  1Y1W G;  1XNQ Q;  1N33 Q;  1Q1E A;  4OO1 G;  4DAY B;  1P8L A;  5EAY A;  4GOP C;  2JA6 G;  4A3G G;  4GKK L;  4GKJ Q;  3H15 A;  1NMG A;  3I4M H;  4AYB E;  1TWG H;  3KDF A;  5IYD H;  3J80 i;  3HOZ G;  2BH8 A;  4J15 A;  1X3E A;  4KHP L;  4A3J G;  1EOV A;  3HOX H;  5M3F G;  3T1H Q;  2R6G A;  4DR4 Q;  3S16 H;  2IY5 B;  1VQC A;  2I0Q A;  2VY3 A;  2R7D A;  4GLV B;  4APV A;  1BKB A;  1LTL A;  3GTP H;  1YJW A;  3STB C;  4DV5 Q;  4LFB L;  5C3E G;  1YJN A;  3M85 A;  4AYB G;  3EN2 A;  5FLM H;  2DUD A;  3GTQ H;  1WCM G;  4DKA C;  1LUZ A;  2UU9 Q;  3F2C A;  4JI8 Q;  1XMO L;  3K7U C;  1N9W A;  1XMQ L;  4PZ7 A;  4HIM A;  2UUB L;  5LMN Q;  4JI1 Q;  4AQY L;  1FJG L;  5LMU Q;  4A3F G;  4HJ7 A;  4DR2 Q;  2KCT A;  4A3C G;  2UXD L;  1YHA A;  1JE5 A;  3CCU A;  2D0P A;  3D31 A;  1ASY A;  1KRT A;  4X62 Q;  4BY7 G;  3ULL A;  1PH7 A;  4PMW A;  2A8V A;  4H02 A;  1EIF A;  2ATW A;  2NVY H;  2NVX H;  3K8A A;  1S40 A;  1VQK A;  4A3G H;  2R92 G;  3CCE A;  2E5L L;  4KLK A;  1PH3 A;  4B3M Q;  2IHF A;  1NMF A;  4DUZ L;  1PFS A;  1QZG A;  4B3R L;  4YHH Q;  4KHP Q;  4JCV E;  3K7A H;  3UE0 A;  5LMU L;  4LF7 L;  3CP0 A;  4A3M H;  1OXS C;  1TXY A;  4YY3 L;  1K73 C;  2JA8 H;  3K80 C;  1Y1V H;  5IP9 H;  4K0K Q;  4HIK A;  2V1C C;  1IZ6 A;  5JEA J;  4DK6 C;  1KXL A;  4BY1 G;  2PI2 A;  2CFM A;  4GNX A;  1VQL A;  4JOI A;  4RMF A;  4JI6 Q;  1JT8 A;  1BVS A;  4LF9 Q;  1HNX Q;  3I55 A;  1TWC H;  5C4X H;  1XMQ Q;  1G51 A;  1C7Y A;  2L15 A;  2WP8 J;  4A3F H;  5JEA G;  2UXD Q;  3ER0 A;  2E2I H;  4LF7 Q;  3PUX A;  2R7F A;  4R4O A;  5C0X I;  2UUA L;  1JJG A;  1NE3 A;  2WB1 E;  2K5V A;  1SRU A;  1IBL Q;  4A3E G;  2Q2U A;  1W2B A;  2HHH L;  2E8G A;  3WWV A;  3KJO A;  4DV1 Q;  4X64 Q;  1N34 Q;  2Z6K A;  2R92 H;  1IYJ B;  4UP7 A;  3CCR A;  2GVA A;  1A8V A;  1VQ4 A;  1U5K A;  4DV6 L;  1V43 A;  4X65 L;  2RF4 A;  3DLL A;  1YIT A;  2A1A A;  1KQS A;  2E2H H;  2PI2 E;  4L5Q A;  4P75 A;  4QIW E;  4GN4 B;  1BBW A;  4DV2 Q;  3T1Y Q;  4JI0 Q;  4LF4 Q;  2UXC Q;  4LW1 A;  3S1Q H;  4UP8 A;  4GNX C;  3I4M G;  1VQG A;  2N3S A;  4JC0 A;  2PNH A;  1JB7 A;  4R4I A;  1Q81 C;  2UUB Q;  5LMN W;  4OWW B;  1KAW A;  3J81 i;  2FXQ A;  4JBJ A;  1XPU A;  1B8A A;  1Y14 B;  4LFA Q;  1EWI A;  4IPG A;  3A0J A;  4JYA L;  4MZ9 A;  1VQ8 A;  2PQA A;  1HZB A;  1X56 A;  1PH2 A;  4JI7 L;  3H0G H;  4OWT B;  3A5U A;  3CCV A;  5C4X G;  1SFO H;  2ZJP A;  4A3I G;  3PIP A;  5IWA L;  1SE8 A;  4P71 A;  3HOX G;  3UDI A;  5M3F H;  3PIO A;  3HOY G;  1L2F A;  5HGQ A;  4A3L H;  4EX5 A;  5K36 G;  1R9T H;  3MXN B;  4LUZ A;  3RR5 A;  4LFC L;  3KJP A;  2YTY A;  4O0A A;  4JBK A;  4MNO A;  1SRO A;  2WAQ G;  4JI5 Q;  4X65 Q;  2NZH A;  4JI2 L;  1N33 L;  1C9O A;  1VS0 A;  2VQF L;  4OO1 I;  1K83 H;  1G29 1;  1I50 H;  1X65 A;  3KOJ A;  3STB D;  3U4V A;  5IWA Q;  4LF4 L;  5IP7 H;  1HNX L;  1N32 Q;  2I5M X;  2K75 A;  3AFP A;  4A3I H;  4YCW A;  4BXX G;  1GO3 E;  1FJG Q;  1C0A A;  1X54 A;  5LMN L;  4AQY Q;  4LF6 L;  2D62 A;  2Q2I A;  1KRS A;  1SN8 A;  1S3O A;  1VQB A;  4DR2 L;  2GVB A;  2LSS A;  4A3M G;  2MO0 A;  1YEZ A;  3M9B A;  3CC4 A;  4XTC S;  1VQ9 A;  3KDF B;  3H0G G;  2MNA A;  3GTJ H;  3BU2 A;  4JI5 L;  1VQA A;  3UDX A;  5C4J H;  3CF5 A;  2ZM6 L;  4JI4 L;  4X64 L;  1XTD A;  5M3M H;  2HT1 A;  4GLA C;  1VQD A;  2N49 A;  5IP7 G;  4Y7N H;  4GLX A;  4NXM Q;  3D0F A;  3PO2 G;  1W3S A;  3S15 H;  1MJC A;  3EBE A;  3H3V I;  1VQJ A;  1E22 A;  4C3I H;  4DK3 C;  1K8A C;  1VQ6 A;  2ALY B;  1RL2 A;  4DV4 L;  4IOC A;  2CCZ A;  4P73 A;  2VQE L;  4KHZ A;  2JA5 G;  3HOW G;  3S14 H;  4P72 A;  3PCO B;  4DV3 L;  2JA7 G;  1SMX A;  2ZTC A;  4R4T A;  3CCL A;  4TVA B;  1L1O B;  4JBW A;  5GAG C;  4YWM A;  3CXC A;  2N8N A;  1LYL A;  4AH6 A;  4A3E H;  4UP9 A;  4DR1 Q;  3EIV A;  2K4K A; 
#chains in the Genus database with same CATH topology
 3ULP A;  3LWE A;  5C44 B;  2KBN A;  1VQ5 A;  1HNW Q;  2NUC A;  3RZO H;  1LAB A;  1RD9 D;  4XIG S;  3M4O H;  2YZM A;  4MN3 A;  3K7A B;  3R23 A;  1J6Q A;  4IN3 A;  1KJI A;  1IKM A;  1DYQ A;  3PO3 H;  5TSS A;  4C3I G;  5AJ3 L;  2YV5 A;  2FPP B;  5KFG A;  2HIV A;  1CSP A;  3RN5 A;  2D2C C;  1E1T A;  3RB3 A;  1K8O A;  2W6M A;  4DR6 Q;  2E2I A;  1K1Q A;  2E2J H;  3BS1 A;  4A3B G;  4DL4 A;  5LL6 b;  4KD3 A;  2R8K A;  2G9H D;  2W9B B;  4JYA H;  5J2T F;  3TRZ A;  2UXC H;  4QMG A;  4DV5 H;  4XDX A;  4DV1 L;  2NBF A;  4MTK A;  4CC6 A;  4IRK A;  3CCJ A;  1E2Z A;  3GTK B;  1SAP A;  1QUQ B;  3P20 A;  2L55 A;  2CWA A;  4C3J H;  4OEL B;  1PTO C;  4ECY A;  1Q1B A;  2K05 A;  3NQT A;  2I80 A;  3N8D A;  2IHE A;  5EZY F;  3KHL A;  1RJQ A;  2JA7 A;  1B70 B;  1WTQ A;  1BGW A;  1MJE A;  2HQL A;  5CB4 F;  4OIK A;  2F4V L;  1QOH A;  1EUD B;  4IFD I;  3S15 B;  4FF2 A;  1DON A;  3BQ0 A;  1E1O A;  4TKO B;  2OCE A;  4QB4 A;  4LF8 L;  5GAE C;  3H4B A;  1WH2 A;  4L63 B;  1E4E B;  2ZXO A;  3E5N A;  1HZA A;  3C0F B;  1DM0 B;  3JAM L;  4IFD H;  4RB3 C;  4TQU S;  3T56 B;  3I2Z A;  4DAP A;  3G8C A;  2CQY A;  2F0H A;  3JAM E;  2JA6 B;  4QW9 A;  2CH4 A;  3RFC A;  5M5W H;  3DWP A;  2D5D A;  3AEV A;  1Y1W B;  3GDE A;  1Z2N X;  2A5H A;  1ET6 A;  2BQ3 A;  4IQZ A;  4LF6 Q;  3CQZ A;  1HXY D;  4JI3 L;  1V1O A;  3FDS A;  4J1M A;  3H20 A;  3BZK A;  4XT3 B;  2WII B;  4OX9 L;  3W1B A;  4RAZ A;  2XC9 A;  2K33 A;  2OH2 A;  4KN4 C;  4QWC A;  1YVC A;  2VUM B;  2MPM A;  2R8J A;  3ERS X;  2OTJ A;  1BQQ T;  5BPH A;  2ENB A;  3SK6 A;  2WAQ A;  2IMW P;  4ECV A;  3DHQ A;  5FLM G;  4C5C A;  4DR3 H;  1GVP A;  4HSV A;  2OTL A;  2RDH A;  4IUR A;  3DWA A;  2KHJ A;  4NPS A;  2BA1 A;  1F9S A;  3OW7 A;  2XGQ A;  4EBE A;  2ZDG A;  5IGC A;  1H9K A;  4JW0 A;  4K5X A;  3VR2 A;  1IBK Q;  1PTO H;  3ULJ A;  2QKI C;  4UPA A;  4ZYS A;  3S17 H;  1SMY C;  2DGY A;  1VMC A;  5E1F A;  3CQZ B;  4MV7 A;  3T1Y L;  1PRT C;  2L9H A;  2LXJ A;  1JC7 A;  4LFC Q;  4IFD J;  2E2J B;  4WJ3 M;  1C8C A;  5KFL A;  4IAJ A;  2E74 C;  2F0F A;  4HIO A;  3T5H A;  3FKI G;  3J80 c;  4CDE C;  3CME A;  4RB1 A;  4LFA H;  4UY8 C;  2JJQ A;  3PW5 A;  1Z7T A;  1CQV A;  1STB A;  3QJY A;  2E75 C;  1KHI A;  1L0W A;  4Q8F A;  3CC7 A;  2W9C A;  4X62 L;  1UWV A;  3PUZ A;  3B6Y A;  2NTT A;  3KBG A;  2NN6 H;  1LO5 D;  4B3S L;  3RAQ A;  1EYD A;  1J5E L;  5FLX W;  5HGT A;  4XYO A;  3JZI A;  1Y8P B;  2L12 A;  4GNX B;  3X3M A;  2JA8 B;  4ODG A;  5FO7 B;  1MKH A;  4K0K L;  2EIF A;  3KFU A;  3A56 A;  1PH9 A;  2N78 A;  5KT4 A;  3SGI A;  1G2S A;  5J1Z A;  2HJW A;  2VUM G;  1FVI A;  1KEE A;  4DN4 M;  3PW4 A;  2CW0 D;  3IG0 A;  2CWP A;  5DQH A;  5ISR A;  4HMJ A;  1UE5 A;  2ASD A;  4IO9 A;  4QWE A;  4KMU C;  1F9P A;  2AKW B;  2O5J C;  4YWK A;  4IR1 A;  2DZD A;  4DR4 H;  5IYB G;  3D4D A;  4A76 A;  3HOY H;  4EBD A;  4RG1 A;  2K5N A;  1CT1 D;  5I4D A;  4B3T L;  1EL0 A;  2BH2 A;  2JQO A;  3T5K A;  3RBD A;  1EY0 A;  2ZTE A;  2BCO A;  3OSO A;  2HGS A;  4X3K A;  2JEG A;  5I6Y A;  3LGJ A;  5KT3 A;  3AYH B;  1X3Q A;  3J80 W;  2KEN A;  2ES2 A;  4G7O C;  1HNW H;  1OXU A;  1UEB A;  5GON F;  1X6O A;  2HQE A;  1SYB A;  5T1G A;  1SNQ A;  1VQN A;  3GV8 B;  4JV5 Q;  4YCU A;  3A74 A;  1GKH A;  4YAJ B;  5D8D A;  3RUZ A;  3M7G A;  1JDE A;  1HUM A;  4KI0 A;  1GHK A;  5HY6 A;  3SK4 A;  4IUV A;  1GM5 A;  1I94 Q;  5JVD F;  3JSL A;  1VQF A;  1CQI B;  4IPH A;  1I6U A;  4DU9 A;  2JA6 H;  2P0A A;  1Y8O B;  1WTO A;  1AE2 A;  5JVH 3;  4KKU A;  2F0I A;  4ZQ3 A;  4JV5 L;  3IFT A;  1I6H H;  2R7N A;  1CUK A;  5A35 A;  4YWL A;  1S97 A;  1ZQ7 A;  3NEL A;  2ZTD A;  3TQT A;  1PTO D;  4J9M A;  2K50 A;  2F3I A;  2IW3 A;  5C6A A;  4C3I B;  1D1I A;  5IWA H;  4RKL A;  4UAI A;  4F7X A;  4IZO A;  4ED8 A;  4LK1 C;  4GS3 A;  3WDN A;  2WAC A;  2E5L H;  1IBL L;  1WJJ A;  5DGB A;  2YZN A;  4K14 A;  5M5Y H;  5DAU A;  3J7Y W;  1IXR A;  2EDG A;  4JOI C;  1WOC A;  1MBY A;  3PO2 H;  1S5E D;  2XWB B;  4PMB A;  2RGV A;  3OHA A;  1QJO A;  2B2U A;  4CDC C;  4YY3 H;  2KHI A;  1SNO A;  1K8G A;  5CYU A;  4NMZ A;  4DV3 Q;  3ONA B;  1WTV A;  3E0J A;  1G6Z A;  1JWM D;  3BYT B;  2NU8 B;  1IBK L;  4LH7 A;  1X9N A;  1N34 L;  1SEI A;  1HZ9 A;  1LTA D;  1SNM A;  1SND A;  1V1Q A;  1SYE A;  3HGB A;  2EJM A;  5C5J A;  2J9G A;  3KF6 B;  5FOB B;  1PRT D;  4GN3 B;  2KJX A;  3V96 A;  3PV0 A;  3ORR A;  1JOQ A;  3AFQ A;  4EG0 A;  1B9M A;  3SVM A;  4JV0 A;  3T1Y H;  2FJ2 A;  2KA7 A;  3QZ7 A;  1Y1W A;  1JMC A;  2PPB C;  3K3V A;  1OXX K;  4RGO S;  3OYY A;  1PYB A;  4JI3 Q;  2VUG A;  4LFA L;  5DG8 A;  4O3S A;  3F2B A;  1L1O C;  1SE2 A;  4O3O A;  2F0E A;  2JEJ A;  1CQF A;  4DAY B;  3H91 A;  2JA6 G;  5EAY A;  4Q43 A;  4GKK L;  4QWB A;  3PVX A;  2NVQ B;  1NMG A;  4AYB E;  4ZOL F;  1TWG H;  2QK4 A;  2WIN B;  4I50 F;  1X3E A;  1K83 A;  4TV9 F;  2R6G A;  4DR4 Q;  1VQC A;  3QWN A;  4K2K A;  4DGZ A;  1HUN A;  3OHB A;  5I9O A;  3ND9 A;  4B9X A;  1LTL A;  3STB C;  3H4D A;  4GZY C;  5FLM H;  3EN2 A;  3GTQ H;  2DUD A;  1G2T A;  4K0K H;  4HR7 A;  2R61 A;  1II3 A;  3H94 A;  2UU9 Q;  1IL8 A;  3F2C A;  1XMO L;  3ORQ A;  1RHP A;  1N9W A;  1T36 A;  4O4H F;  1UNS A;  1PLF A;  1FJG L;  5KG3 A;  2AUJ D;  1V8Q A;  2B2W A;  1YHA A;  4DV7 H;  1GGO A;  3D4R A;  3A8K E;  4EGQ A;  4PMW A;  4HAE A;  1SBB B;  2NVY H;  1EZ6 A;  2NVX H;  4YAK B;  1VQK A;  3N42 B;  3CCE A;  4Y8V B;  3CU7 A;  1PH3 A;  3N44 B;  4LF6 H;  1NMF A;  2V59 A;  1PFS A;  2DJG C;  2E2I B;  4JCV E;  3K7A H;  4LF7 L;  3CP0 A;  4ETS A;  1ENF A;  3RZO B;  1MSG A;  2JA8 H;  1KBL A;  2ZM6 H;  2KOL A;  1EOT A;  4TUY F;  5JEA J;  1VF5 C;  4DXG A;  2YW2 A;  4MV8 A;  1BDO A;  3VR4 A;  2CH4 W;  1VQL A;  4RMF A;  4JI6 Q;  2B2V A;  2ZXP A;  3D8G A;  4NP5 A;  2ICI A;  3M9M B;  2B2W C;  3G6J B;  5C4X H;  1G51 A;  3NXW A;  5JEA G;  2UXD Q;  2E2I H;  2RA4 A;  2V4R A;  1SJE D;  2R7F A;  4MV6 A;  5EWF A;  1JJG A;  1EIH A;  5KFK A;  2MUY A;  1IBL Q;  2Q2U A;  2C00 A;  1ROD A;  3KJO A;  4FXK C;  1F2Y A;  5LYJ F;  3NUC A;  3HOW B;  2GVA A;  2R92 B;  1CM9 A;  2O4X A;  1VQ4 A;  5LP6 F;  1L0Y B;  2BQU A;  4X65 L;  2A1A A;  1F9R A;  2K01 A;  1EY8 A;  3TZU A;  1E4E A;  3JSN A;  1EWH A;  4DV2 Q;  5C8Y F;  4JI0 Q;  4YP3 A;  2FP4 B;  3MJF A;  4C56 C;  3S1Q H;  3S1N B;  1KC7 A;  5KG5 A;  4GNX C;  1IYU A;  1E4G T;  3GQC A;  2F0D A;  1UAP A;  1JB7 A;  4Q0F A;  2HVS A;  3J81 i;  3HBL A;  2FXQ A;  1XPU A;  1Y14 B;  4IPG A;  3A0J A;  3TP7 A;  4QIW A;  3J81 W;  1HZB A;  1X56 A;  2FIN B;  2JYO A;  3O13 A;  4CGY B;  3CCV A;  1PH2 A;  4JI7 L;  3GV3 A;  2HVR A;  2HD3 A;  4A3I G;  5IWA L;  4CDF C;  2L0C A;  2AQ4 A;  4LFB H;  5C5L A;  4JI6 H;  1HFN A;  4DV1 H;  4O4I F;  1L2F A;  4RH6 A;  1TY2 A;  4EX5 A;  1M8A A;  3MXN B;  5C1P A;  2ALZ A;  4Q44 A;  3QOL A;  4LFC L;  4LSA A;  3CRL C;  1C48 A;  4MNO A;  3OTO H;  4DFA A;  4X65 Q;  3RV4 A;  3VMM A;  4JI2 L;  1VS0 A;  2VQF L;  4OO1 I;  1K83 H;  1B53 A;  1G29 1;  1I50 H;  2EYL A;  3KOJ A;  3U4V A;  1AUX A;  3HOX B;  2FK2 A;  1BCP B;  2W7P A;  5IP7 H;  1HNX L;  1N32 Q;  2I5M X;  2NU6 B;  4ED1 A;  3A55 A;  3K6O A;  3A7L A;  3AFP A;  1BXR A;  3PMF A;  4J8Q A;  4K6D A;  3NSW A;  3HRZ C;  4AQY Q;  1C0A A;  5KFM A;  2D62 A;  2Q2I A;  1KRS A;  2I46 A;  1S3O A;  5DEH A;  1HNZ H;  4G3I A;  4A3M G;  1YEZ A;  5LMU H;  3H0G G;  3BU2 A;  5C4J H;  3LWB A;  2E76 C;  1B6S A;  1XTD A;  4NKL A;  1J9O A;  3VPB A;  1TVX A;  3BAA A;  4CJ2 C;  2DN8 A;  2GPS A;  4C3I H;  3MFH A;  2ALY B;  1RL2 A;  3MXN A;  4IOC A;  4P73 A;  2HVQ A;  3OSN A;  1SYD A;  3OPO A;  3PCO B;  4DV3 L;  3PW2 A;  2JA7 G;  1A6X A;  1WSC A;  2ZTC A;  2F0L A;  4KY7 A;  1WTW A;  4A3E B;  2W9C B;  5GAG C;  1DOK A;  4A3E H;  4GKK H;  4DR1 Q;  3EIV A;  1E2V A;  2WB1 A;  3VPC A;  1O7I A;  2F0W A;  1LTT D;  5FO9 B;  3PZP A;  1E3P A;  3S1N H;  4IPD A;  5KG7 A;  1N56 A;  1LTR D;  2ASB A;  1A63 A;  2C5C A;  3K5N A;  2V9W A;  5ELB A;  4DV6 H;  4QY7 A;  1CTM A;  2OT2 A;  2XVS A;  4X3S A;  2Q8I B;  2Q8T A;  3W2D A;  1CKM A;  1TA8 A;  1TKW B;  4YQW A;  4DAM A;  1VAJ A;  2K5D A;  5C4J B;  2BA0 A;  2NU9 B;  1W6J A;  3KF8 B;  1QIL A;  4BBS H;  1WFQ A;  5GQO A;  3Q1K A;  4IWX A;  5FJ8 G;  1RTO A;  1GUN A;  4HJ8 A;  5EGT A;  1BNZ A;  1KIX A;  2OF1 A;  1AZP A;  2K14 A;  2GA4 B;  1FKA H;  1PYS B;  4M8A A;  2QYZ A;  5L1L A;  5IT9 W;  2ID0 A;  2VB2 X;  1E0B A;  3PUV A;  3PF5 A;  5EWG A;  1VQP A;  1VQO A;  2A6E D;  3EA6 A;  1VDZ A;  4DL6 A;  1PZJ D;  1V4Y A;  3GIJ A;  1RYR A;  2B2V C;  3GIM A;  2EJG C;  5DLG A;  1RJT A;  1EWC A;  1JJC B;  4DAY A;  5KGU A;  3NHH A;  1O7Z A;  3G48 A;  1R4Q B;  1N33 H;  3M7N A;  2A68 D;  1V1P B;  1SYC A;  1ET9 A;  4AYB B;  1S5D D;  2VOB A;  1BCP F;  1ENA A;  4FXG C;  1B2T A;  5ELD A;  3MA2 B;  1BBU A;  4UCU A;  1S0M A;  3CCQ A;  3IFD A;  2CW0 C;  4LWC A;  4WJ4 A;  1A3T A;  5KFO A;  2ATL A;  2RCF A;  1MI2 A;  4J0M A;  2JK8 A;  3BVZ A;  3NBH B;  1Z2P X;  3U50 C;  3HOZ H;  1KLG D;  4HR7 B;  4JI5 H;  1BUV T;  5IYB H;  4HCS A;  4MTD A;  4ECR A;  2CVR A;  1J8I A;  1Q7Y C;  4OIJ A;  4L5R C;  5CR3 A;  4DV0 L;  5JPM C;  2F3V A;  2NYZ D;  1KTK A;  4KY5 A;  1IKL A;  3MXU A;  1LM0 A;  4E4T A;  4MHE A;  4A3C H;  1C30 A;  4HN7 A;  1FNW A;  3SE7 A;  2W6O A;  1TWF H;  5COR A;  1KDA A;  2IA6 A;  4R8N A;  2F3W A;  1ULZ A;  2K52 A;  5KFS A;  3TEH B;  1KDB A;  1QVF A;  1S5C D;  1W96 A;  4R1J A;  2FFK B;  2SOB A;  5FKA C;  2WFW A;  1C4Q A;  1CKO A;  1FL0 A;  3QO2 A;  2HT1 A;  2W6Z A;  2H5X A;  3V6H A;  1M1K C;  3SXH A;  4GOP A;  2B3G A;  3I72 A;  4EYI B;  4RNM A;  1WTH A;  5KG0 A;  4KJO A;  1QB5 D;  1S72 A;  4I7H A;  2VA3 A;  2JA6 A;  2XGT A;  4KY6 A;  1ILP A;  1GUG A;  2CKZ B;  3KAL A;  2QEJ C;  5KT6 A;  1PV4 A;  2F52 A;  4DL5 A;  3ITP A;  2AUK A;  4HNT A;  5KFH A;  3KLS X;  3HOV B;  4NXN H;  2QA4 A;  4LF5 Q;  2YRW A;  3OTO L;  4GKJ H;  4DR7 H;  1YJ9 A;  2WKC A;  1IOV A;  1W93 A;  1Q8K A;  1KLU D;  5LL6 S;  5IE8 A;  4X66 H;  1X55 A;  2Z4H A;  3ETJ A;  1SNP A;  4LUO A;  3FKI B;  1PH6 A;  5IGE A;  4K2L A;  4LF8 Q;  4BS9 A;  1D2B A;  3UDF A;  2OQ0 A;  4OL7 A;  4MA5 A;  1C3O A;  4DV6 Q;  4RCO A;  3MEF A;  3K58 A;  4DV7 Q;  3KF6 A;  3N52 A;  1M0W A;  1DOM A;  1NNX A;  3I4N B;  3KAJ A;  1VKZ A;  2EY6 A;  2PMZ A;  2EY1 A;  1L1O A;  4JBM A;  2W71 A;  1JDB B;  5AJ3 Q;  2VUM H;  1SYG A;  2V4D A;  5HBR B;  1DXM A;  3GTM B;  4IWY A;  2HDM A;  2O5I C;  1SFO A;  4KHP H;  3AB9 A;  1BR9 A;  5IIF A;  3CCM A;  1BBX C;  1BCP C;  2CHB D;  4PQX A;  4DUY Q;  2WB1 B;  1YNJ C;  3VR3 A;  3VA5 A;  2CQO A;  1STG A;  1HTP A;  3BZC A;  4JI2 Q;  3J81 c;  4DV4 Q;  2GLT A;  4CBV A;  1RCV D;  1SE4 A;  3TQY A;  2B29 A;  3S2D B;  1S03 G;  3I4N H;  4ALP A;  1ZYR C;  1ZHQ A;  3NK9 A;  5ELO A;  4Y7N B;  5JJK A;  5ELE A;  2J6U A;  1PFM A;  3G4S A;  3CCS A;  2A74 C;  2HUG A;  2NZO A;  1ONL A;  4YBZ B;  3F2D A;  5JAV A;  5KT5 A;  4QUC A;  2KCC A;  3EPG A;  1BOS A;  4OX9 H;  4XYL B;  3S2D H;  2J7Z A;  4YR2 A;  1QWY A;  1VQH A;  5KFU A;  1H9S A;  3LP8 A;  4IUQ A;  2OLS A;  5IT9 E;  4IHJ F;  4B3S Q;  4HJ9 A;  1SFO B;  4UCR A;  5A2Q L;  1B1Z A;  1T5X D;  5I9P A;  3OSP A;  2A69 C;  2X6G A;  1QG7 A;  4WFN 3;  4DR3 L;  4X3T A;  4JG2 A;  5E7N A;  3P75 A;  3TME A;  1A3U A;  4GN5 A;  1BF4 A;  4LFB Q;  4C2M H;  1B3A A;  3Q24 A;  3BJY A;  1KL9 A;  4K8I A;  4PZ6 A;  5M3M G;  4LSX A;  2VNU D;  5ELF A;  4NXM H;  1M90 C;  4BY1 H;  3GV7 B;  1VQE A;  5KFX A;  3BA8 A;  4WD3 A;  1CSQ A;  2PN1 A;  2W6Q A;  3SEB A;  1TU2 B;  1GLV A;  1O75 A;  1XPR A;  4B3T Q;  1IW7 D;  4NB3 A;  1AE3 A;  3R3O A;  4PNY A;  2UUA Q;  2RHS B;  4BXX H;  5EQ0 A;  5H1S E;  2CW8 A;  4PMC A;  4A3D B;  4MIU A;  2N88 A;  1IW7 C;  3F8T A;  4DR5 Q;  5JPN C;  2E5L Q;  1RJP A;  4ZCK A;  3BZD B;  3EYY A;  3F8N A;  3GTO H;  5IOC A;  3MC0 B;  5FLX c;  3ERQ A;  2NVQ H;  3GD7 A;  4N9T A;  5JEA H;  1HR0 W;  4DR3 Q;  2F1M A;  4I7Z C;  3CC2 A;  3QFF A;  4KHV A;  2MO1 A;  4A3B B;  2R93 G;  4X62 H;  2F0M A;  5IGF A;  3TQ1 A;  1KD1 C;  2UXB Q;  1HH2 P;  3RZD H;  1EFW A;  5CC4 A;  2RDJ A;  3K0X A;  4DUZ Q;  1DV1 A;  2WV6 D;  4DV0 H;  3U4Z A;  1FNV A;  1PHJ A;  2XIG A;  3MR3 A;  3UDG A;  5KFQ A;  5IT9 c;  2XGP A;  4OX9 Q;  1GD7 A;  3WO0 A;  3FRP B;  3J7Z C;  1D6E C;  1PA6 A;  5C44 G;  4DUZ H;  2JA7 H;  2A69 D;  4DUY L;  2YTX A;  1HZC A;  3S16 B;  5CGK A;  4JI8 L;  4LF7 H;  1CFM A;  1PZI D;  4C3H B;  4J9N A;  1D5Z C;  1FYC A;  5DM6 3;  3T5L A;  2MGS A;  3C1E A;  3PSI A;  5KFB A;  3I7F A;  2J6S A;  2R93 H;  1JQY D;  1PH5 A;  1AN8 A;  1WR2 A;  4RZR A;  3PO2 B;  3V05 A;  5LMN H;  2K5W A;  1X3F A;  1A2U A;  2JA9 A;  4OXP A;  3J81 E;  1AEX A;  4ED6 A;  4JI4 Q;  5M5X H;  3FKI A;  4A3K G;  3NEN A;  5EPJ A;  4DPG A;  3BA9 A;  1HHV A;  2EXD A;  4K8J A;  4IOA A;  4BBS G;  4R9W A;  3CQZ H;  3DUZ A;  4ABN A;  1OXT A;  2R7Z A;  1ZET A;  2IBK A;  1AZQ A;  1V9P A;  3K3P A;  5J3B A;  2VQE H;  2BDN A;  1TII D;  2VA2 A;  3S1R H;  1EYZ A;  3PIP 3;  1M7J A;  4RU9 A;  3G6E A;  3GIL A;  5KFV A;  3A8I E;  2WAQ B;  1Q1E A;  4WJW A;  4XQQ A;  1N33 Q;  4OO1 G;  4A3G G;  2C28 A;  3H15 A;  4ECS A;  3N6R A;  2RSO A;  2QIL A;  3J80 i;  3NP8 A;  5JUM A;  4J9R A;  3MEH A;  4KHP L;  4A3J G;  3HOX H;  3VR5 A;  1E2W A;  5M3F G;  4OHJ A;  1B33 N;  2VY3 A;  2R7D A;  1PRT B;  3EQL C;  4KKT A;  5C3X A;  1S10 A;  1BKB A;  2L11 A;  1H9S B;  3GTP H;  5KRU A;  3GLK A;  3NTI A;  5LXT F;  2DPJ A;  4F4Z A;  1D5M C;  3M85 A;  1NR2 A;  3BDC A;  4JV5 H;  3RIZ A;  4IAL A;  3R5F A;  1T94 A;  2Z6B A;  2G5D A;  4QIW B;  3R5X A;  4EBC A;  2N55 A;  5E3F A;  5C0X H;  3LX0 A;  4AQY L;  4FU0 A;  4HNV A;  4DR2 Q;  3CCU A;  4CJ0 B;  1ASY A;  4BY7 G;  2D9U A;  2VQF H;  3C3L A;  4XZ3 B;  2Z8L A;  1JCK B;  2A8V A;  3GTO A;  2XCA A;  4EGJ A;  5L1K A;  3GV6 A;  1DJR D;  4ZUJ A;  2H1E A;  3TZD A;  1S0O A;  4EQN A;  2PNR C;  4FF4 A;  2IHF A;  2PW7 A;  3Q2O A;  1D5X C;  2F0K A;  4ED7 A;  1QZG A;  1LT3 D;  4B3R L;  1LTS D;  2PZU A;  2B2Y A;  2DY7 A;  4A3M H;  2B63 B;  1TXY A;  2PMZ B;  2W6P A;  4K0K Q;  1HR0 H;  1Y1V H;  5IP9 H;  4JI4 H;  4HIK A;  2V1C C;  4DK6 C;  1KXL A;  4BY1 G;  4RHS A;  4FO2 A;  3U9S A;  4O3N A;  4DV2 H;  5KYL A;  4CC5 A;  1Z6H A;  2XNA C;  2QDB A;  1UC8 A;  2CFM A;  4GNX A;  4JOI A;  1IBK H;  2RDI A;  4LF9 Q;  5I2X A;  1HNX Q;  4HTH A;  2JEI A;  3I55 A;  1S9F A;  5DG7 A;  2RSN A;  2VXW A;  2L15 A;  2WP8 J;  1C7Y A;  4G57 A;  3JRX A;  4FM9 A;  3PUX A;  4R4O A;  1PDQ A;  2UUA L;  1NE3 A;  1NUC A;  2RKS A;  1WD1 A;  2K5V A;  4LF5 H;  4XQN A;  4H13 C;  1L0X B;  2Z6K A;  4O3Q A;  2QCP X;  2R92 H;  1IYJ B;  3Q0A A;  4JI3 H;  2JA5 B;  1SDF A;  2FPG B;  3L4J A;  2RDF A;  4DV6 L;  3TDQ A;  2W7O A;  3L4K A;  4I7A A;  1KQS A;  5EKL A;  4R8U A;  5LOV F;  4P75 A;  4QIW E;  1B9N A;  1I4R A;  3N6X A;  2MHV A;  3T1Y Q;  4RUC A;  1BCP D;  1LTI D;  4A3F B;  4RGM A;  4LF4 Q;  4ZHQ F;  3I4M G;  3KAK A;  2N3S A;  4R4I A;  1Q81 C;  2UUB Q;  4OWW B;  2ZT9 C;  1KAW A;  4JBJ A;  4DF7 A;  1WCM B;  4LFA Q;  2J4X A;  1EWI A;  1JLL B;  3I12 A;  1QNK A;  1U4P A;  1VQ8 A;  5C3E B;  5C4X G;  3H0G H;  4MAM A;  1XXG A;  3R93 A;  1S0N A;  1QE6 A;  3G6V A;  1SE8 A;  3UDI A;  2DNE A;  3HOY G;  1PYW D;  5JVL A;  2F0P A;  4ZUI A;  2SNM A;  3HOZ B;  3K5H A;  3HG9 A;  2TSS A;  3K5M A;  4DUY H;  1RDP D;  3KJP A;  5G3L F;  4JBK A;  4ECQ A;  2LMC B;  3GTJ B;  3NWS A;  2SEB D;  1HA6 A;  4R8U B;  2EYH A;  3S9W A;  3HOY B;  3LNN A;  4KTA A;  5CMD A;  2KVM A;  3KUP A;  2PBZ A;  4RNN A;  3GIP A;  3TIG A;  2I87 A;  3FMC A;  5C4X B;  4UFZ A;  4QWD A;  1GO3 E;  1VMP A;  1X54 A;  4QF4 A;  4LF6 L;  5KT7 A;  4XX0 B;  3ZYY X;  4DR2 L;  1WCM A;  2AQ3 B;  5BR8 H;  3CVZ A;  2GVB A;  4KV6 A;  2LSS A;  3M9B A;  4AYB A;  2YS7 A;  3RJ0 A;  3GTJ H;  3CF5 A;  1QCB D;  2M05 A;  1M6V A;  2ZM6 L;  4X64 L;  4ZKB B;  2UVW A;  4GLX A;  1GUO A;  4NXM Q;  3OIQ A;  3FVQ A;  2Z1C A;  2YRX A;  5C3W A;  1MJC A;  3Q8P B;  4J9Q A;  1E22 A;  2FE3 A;  4QWA A;  1GXD C;  4O1N A;  3MAQ A;  2CCZ A;  4UCT A;  2JA5 G;  1MHW C;  2F0N A;  4DLK A;  5ELC A;  3I70 A;  2VPS A;  1ESF A;  2NVY B;  2NVX B;  1L1O B;  3CXC A;  4PDB A;  3QIA A;  2IPK D;  4EGV A;  5D3D A;  4BBR G;  4MV1 A;  5J2U F;  4LF9 L;  5D3I B;  3BYY B;  4ME6 A;  2NZ1 D;  3GTL H;  2FK1 A;  4BWG B;  5FJ8 H;  5KT2 A;  2M00 A;  1CKN B;  3J80 E;  3FEW X;  1WTP A;  2K32 A;  2ZJR A;  1KNA A;  2F0G A;  2RBM A;  4RNO A;  3IN5 A;  1EZ8 A;  1I4Q A;  3J81 j;  1VQI A;  3H3V H;  2C2E A;  2HHH Q;  3GV5 B;  4FS1 A;  2Y0S G;  5KX5 F;  4XYM B;  2B63 A;  4X3U A;  1STA A;  2SCU B;  3MXG A;  1CHP D;  5CV6 A;  3GII A;  4RZQ A;  4NXN L;  4ED2 A;  5BR8 Q;  1NBW A;  4JI7 H;  1MD2 D;  1EQQ A;  1I3Q H;  3E0E A;  1I4H A;  5JJL A;  4X66 L;  2AWN A;  4ED3 A;  2R8I A;  4RB2 C;  2EOT A;  5HV6 A;  2XCP A;  4CDD C;  4BY7 B;  1D7Q A;  1R4P B;  2BR0 A;  1EY7 A;  4JVZ A;  1PH8 A;  2IX3 A;  4B3R H;  4ME5 A;  5IOD A;  4IR9 A;  1XNQ L;  4CHT B;  3K5O A;  4O2A F;  1STN A;  4ZAI A;  1HR0 L;  2M9V A;  1CQJ B;  3KBX A;  2VS1 A;  3V4S A;  4R4C A;  4QCL A;  1N32 H;  4LF4 H;  1X3P A;  3TN2 A;  2CW7 A;  2CQA A;  5JJZ A;  4Q5V A;  1I5F A;  3A8J E;  2GN5 A;  2F0O A;  5KEE A;  3N40 P;  3GTP B;  4L5T A;  2ICE C;  4A3J B;  4NXN Q;  1MGS A;  4LMY A;  4F4Y A;  3TS0 A;  1QVC A;  1XPO A;  2W6N A;  5C0X G;  3QR8 A;  3I90 A;  4A3L G;  2OWO A;  2YZG A;  2XD4 A;  4A93 G;  5KFN A;  1K3B C;  2EYO A;  3NWT A;  3OOC A;  1CI3 M;  1PH4 A;  2XWJ B;  1A62 A;  4POF A;  1WTX A;  1TS2 A;  2KEE A;  1HQR D;  1Q12 A;  1TR5 A;  2F0U A;  5C0X J;  1V1P A;  1GYF A;  4DV3 H;  2AMC B;  5DGA A;  4A93 H;  2PZW A;  2OQK A;  1PH1 A;  3GIK A;  4B08 A;  1GUT A;  1K0R A;  2Z9H A;  4B3R Q;  1FNU A;  3GTJ A;  4A3K B;  2R85 A;  4LUV A;  4MV4 A;  3VDY A;  2PMZ E;  1WI5 A;  4ZKC B;  1HRJ A;  4BBR H;  3QZ8 A;  2C35 B;  2W9A A;  1I6H B;  2SNS A;  3HKZ A;  1EIY B;  4NXM L;  4BA2 I;  1N34 H;  1JOK A;  4PG3 A;  2RCN A;  5DLQ E;  3HFZ B;  4I4T F;  3VR6 A;  1GUS A;  5KFC A;  2V4Q A;  3I73 A;  3PO3 G;  2EQS A;  1SE3 A;  1NR4 A;  4MA0 A;  3HOU B;  1M4V A;  4EEY A;  1ZXT A;  1NSN S;  3SK5 A;  3RLN A;  3WOF A;  4DR6 H;  3RLF A;  1DGS A;  1KDC A;  4FDB A;  3GTL A;  1EZ1 A;  5DLF A;  4KKS A;  1PMR A;  3GTG H;  3PW0 A;  2FLN A;  3J80 L;  1N36 Q;  3RMH A;  2NVY A;  2K5H A;  1EEI D;  4EFE A;  2NVX A;  3L7Z C;  2M2L A;  1H9R A;  4DR2 H;  3V6K A;  1YBY A;  3JAM i;  1YHB A;  1A15 A;  4GOP B;  3OHX C;  4BA1 I;  3NTK A;  5T14 A;  4DK0 A;  3JAM W;  1TWF B;  2EY5 A;  4Q45 A;  3HP3 A;  5C44 H;  1XNR L;  4F8M A;  5IY0 A;  3H40 A;  4DXF A;  2KEC A;  2R7Z B;  1YHQ A;  3TP5 A;  1X3G A;  2A19 A;  5KFF A;  4M7E A;  3S1M H;  2K28 A;  5FO8 B;  4DV4 H;  3HOU H;  2PYK A;  3GP7 A;  3NE5 B;  2W8L A;  2C22 A;  4J9L A;  1U4R A;  1WYD A;  1AH9 A;  3EJI A;  5L1I A;  2EE1 A;  2NN6 G;  3D3R A;  1XMO H;  3GID A;  1JIC A;  2Z6K C;  1XMQ H;  3RV3 A;  4JI8 H;  1I50 A;  4LF9 H;  3I56 A;  1DD2 A;  2Q2T A;  1VBG A;  4ILW A;  1JWU D;  4F4X A;  3CRK C;  3S24 A;  1I4G A;  1GOZ A;  2Y0S E;  4L8J A;  5K5P A;  4XQJ A;  4JI0 H;  4EFB A;  3KK7 A;  3S14 B;  1MZB A;  3PN1 A;  2LXK A;  1EYG A;  2IX0 A;  2IX1 A;  4J9K A;  4N8F A;  1RYS A;  1TWG B;  2X6L A;  4RKB A;  3T5J A;  2AGP A;  2VL6 A;  1I94 L;  4IFD G;  4DR1 H;  3BJU A;  3URY A;  2QEX A;  2WE6 A;  3Q8Q B;  2I5L X;  1QVG A;  1JOO A;  3IAY A;  4A93 B;  5EKK A;  2EYM A;  2F0V A;  2EVB A;  1FGU A;  1B50 A;  1Y69 U;  1PK8 A;  4A3D H;  2B2U C;  2XIW A;  5EPK A;  3T4A C;  4HID A;  4A2A A;  3NPP A;  2ZJT A;  3RLO A;  3G7L A;  2OXP A;  2A73 B;  3I91 A;  1TS3 A;  1V51 A;  1QNU A;  5C5M A;  3GTP A;  4RFB A;  4I55 F;  3PGZ A;  1KC8 C;  4KN7 C;  2XRS D;  3NEM A;  1RJR A;  2MFI A;  1O78 A;  4LNQ A;  2Y0S A;  5D1O A;  2JEF A;  1OXV A;  1I50 B;  1G91 A;  5KFP A;  1ASZ A;  4DR7 L;  1UEA B;  2YTV A;  1YI2 A;  2WTF A;  3E9I A;  2KHS A;  5KFA A;  3UQ8 A;  1ZEQ X;  3M4Q A;  5EWE A;  2AWO A;  4IUT A;  2O2L D;  3M4I A;  2EY2 A;  5IYD G;  1N32 L;  3W1G A;  5IYZ F;  5FLX L;  4TQS A;  1I7L A;  4RAY A;  2WB1 G;  4X65 H;  2JEA I;  3C2P A;  3U9O A;  3J7A 5;  2J6T A;  2IP4 A;  2I07 B;  4YY3 Q;  3U58 A;  2R7Z G;  1AUV A;  2B39 A;  3HKZ G;  3G6Y A;  3EPI A;  1SXT A;  2Q2H A;  1IYV A;  2P5Z X;  1PFB A;  3GTM H;  3L9A X;  1Y1V A;  4B3M L;  3G71 A;  2GPW A;  3MR2 A;  3I4N G;  1STH A;  2DPI A;  5I6W A;  2H4O A;  5LHY 1;  3KTM A;  2DY8 A;  4H44 C;  5JH7 F;  1I3Q B;  4EEQ A;  3RGX A;  3RD4 A;  4J9O A;  2WYO A;  1CZG A;  2F4V Q;  1CHQ D;  4UCS A;  3ERO A;  4ECZ A;  2ZDQ A;  3KLW A;  3FHW A;  5C4H A;  3WOE A;  3AQQ A;  4BBR B;  2AGO A;  2YS6 A;  1PRT F;  2UU9 L;  4A75 A;  3PO3 B;  1KJQ A;  1TWH H;  4YB8 B;  3OWF A;  4DV2 L;  2HDL A;  1Q86 C;  2WKD A;  1S5B D;  1HTL D;  1PVO A;  3M4O B;  4EQO A;  3KLS A;  3NBI A;  5FLX E;  3ZJY C;  2NB0 A;  2XN9 C;  4ME3 A;  5EBC A;  4O4L F;  3KHG A;  1Y1V G;  2MJ8 A;  3BG3 A;  2IWH A;  1W6K A;  5IP9 G;  1EYA A;  1Z2O X;  2UUC L;  2E2D C;  4XYQ A;  2MQH A;  4WOR A;  3I4L A;  5E4X A;  4YHH L;  5GRO A;  1SR3 A;  4O3R A;  4C3J G;  3CMA A;  4U7C A;  4LF5 L;  4G7Z C;  3HOV H;  2B2T C;  3CHB D;  4V0B A;  4LAA A;  2V5A A;  4OON A;  1IBM Q;  2NN6 I;  1EU3 A;  4DNI A;  4RGN A;  5CBA E;  3RN2 A;  1N36 H;  2FLL A;  3OW2 A;  1EUJ A;  4HYK A;  1M0T A;  2R7M A;  3PR4 A;  3RNU A;  4RCN A;  5CV8 A;  1R9T A;  3QB3 A;  3G6X A;  1B4O A;  1U9R A;  5NUC A;  4GOP C;  4YR3 A;  2JA5 A;  1EU4 A;  2BOS A;  1XNR H;  5IYD H;  3HOZ G;  2K1B A;  2BH8 A;  2C9O A;  3M3Y B;  5JVG 3;  4DNT B;  4RWS C;  1CK1 A;  1LTG D;  3GTQ B;  2I0Q A;  4APV A;  5M5Y B;  4IUU A;  5L1J A;  3KHH A;  5D65 A;  4DV5 Q;  4FBU A;  1K8M A;  4M1U B;  4DKA C;  3S1Q B;  3DMU A;  5KNC A;  3X3N A;  4JI8 Q;  3K7U C;  1HFG A;  1XMQ L;  4L6T B;  4PZ7 A;  2UUB L;  5T1I A;  4JI1 Q;  5LMN Q;  4U6P A;  5LMU Q;  4A3F G;  4HJ7 A;  3H3V C;  2KCT A;  2UXD L;  1GSA A;  1JE5 A;  1Q8I A;  3D31 A;  3MFY A;  1AW7 A;  5DM7 3;  4ZLT F;  3ULL A;  1O80 A;  5M5X B;  1PH7 A;  1CS0 A;  4ECT A;  4U67 3;  1EIF A;  1TS5 A;  2ATW A;  2AQ2 B;  1S40 A;  3SE0 A;  5IGD A;  1JWS D;  5J39 A;  4KLK A;  4ZK9 B;  1EY6 A;  4DUZ L;  2VUM A;  4YHH Q;  4XXE A;  5JOB A;  4DAV A;  1ZYR D;  1K73 C;  3GTM A;  2Y0S B;  5D1O B;  4QW8 A;  1F9Q A;  1IZ6 A;  2EXZ A;  3OUZ A;  4R7R A;  3BDL A;  3HEJ A;  3OIP A;  3M4Y A;  1D1K A;  1ZKO A;  1BVS A;  4YR0 A;  1TWC H;  3TP6 A;  1IOW A;  3RF2 A;  4N9P A;  4A3F H;  1KAA A;  4KJN A;  3ER0 A;  3GTO B;  3SK8 A;  4JUZ A;  5KNB A;  2CZG A;  3F2U A;  2WB1 E;  1SRU A;  3Q8R B;  4A3E G;  4FNF A;  1W2B A;  4DV1 Q;  4X64 Q;  4C1N I;  1N34 Q;  1I3Q A;  4UP7 A;  2O03 A;  5KFD A;  3RTX A;  3HS0 C;  2ASL A;  1U5K A;  1ML0 D;  1V43 A;  2EYJ A;  2RF4 A;  1YIT A;  2E2H H;  4GN4 B;  1L2Z A;  3HB9 A;  4IZ8 A;  2UXC Q;  4LW1 A;  2J0T D;  2NUA B;  2PNH A;  2QDL A;  3H0G B;  5LMN W;  1FGB D;  4N8X 1;  4EYH B;  3VYT A;  1BXT A;  2XRQ D;  3NTH A;  4JYA L;  4MZ9 A;  2PQA A;  3A7A B;  3A5U A;  4MV9 A;  1SFO H;  5KG1 A;  2FMA A;  4PWQ A;  3PIP A;  2LFN A;  4F50 A;  4HNU A;  3PIO A;  5KIX A;  5M3F B;  2R6F A;  1IBL H;  5K36 G;  1EHI A;  1R9T H;  3DF7 A;  1ZHS A;  4LUZ A;  4DL7 A;  3S1M B;  4R8I A;  3OMG A;  4A3G B;  5LL6 X;  5JQW A;  1A9X A;  2YTY A;  2B2Y C;  3KLR A;  4O0A A;  1F77 A;  4UCO A;  2WAQ G;  4CKE A;  5IT9 L;  2NZH A;  1H9J A;  3PIO 3;  1C9O A;  4J9S A;  4ECX A;  2R7K A;  4JV2 A;  1JXL A;  1X65 A;  1RF2 D;  4RA8 A;  4LF4 L;  4A3I B;  4A3I H;  3JRW A;  1FJG Q;  3H6M A;  4HCE A;  5KFY A;  1LT6 D;  4NW2 A;  4C3J B;  2MO0 A;  3K5L A;  5CV9 A;  3CC4 A;  4XTC S;  4BBS B;  4TV8 F;  4YHH H;  2B2T A;  4JI4 L;  1VQA A;  3UDX A;  4GLA C;  2N49 A;  4Y7N H;  1Y1V B;  2LY7 A;  3D0F A;  2G9D A;  1W3S A;  3S15 H;  4DA2 A;  3EBE A;  1VQJ A;  1G6P A;  4C2M A;  2W70 A;  3N41 B;  5I2Y A;  1TWH B;  2R8G A;  3HOW G;  3S14 H;  4P72 A;  5C1O A;  1AN7 A;  5HUR A;  1PTO B;  1KNE A;  5BN3 A;  3J7A V;  2ASJ A;  4OEM B;  4BWS C;  4TVA B;  2N8N A;  2UUA H;  4GC7 A;  4AH6 A;  1ENC A;  2A6H D;  3S1R B;  3GTK H;  2YU9 B;  1DIK A;  2HHH H;  4QJF A;  2WAQ E;  4RHR A;  2SDF A;  2AHO B;  1TAE A;  1RK6 A;  1S5F D;  4NDX A;  4YCV A;  3LML A;  4E6I A;  3GTG A;  1HNZ Q;  3GIQ A;  1OTC A;  4H0L C;  3D6W A;  4X66 Q;  3CAM A;  3F1Z A;  2NTS A;  1GSH A;  4RB0 A;  2D0O A;  4DR7 Q;  1EQT A;  3FKI H;  1TQO A;  1XNR Q;  1Q46 A;  3FP9 A;  1B44 D;  3I3C A;  3M4P A;  2XSC A;  4ZI7 F;  2B63 G;  1STY A;  4OWX B;  3KXY T;  1YNN C;  2R93 B;  3TRE A;  2UUB H;  2KED A;  4IUN A;  1Y1W H;  2R8H A;  3HKZ B;  4OGQ C;  4FBT A;  3TS2 A;  3ICE A;  2NU7 B;  4C1N K;  3AMU A;  3J7A K;  4P2C B;  3RBE A;  1B04 A;  1TWC B;  4KK7 A;  2VR1 A;  2FMC A;  1LAC A;  3NGD A;  2E2H A;  5M9O A;  1SNC A;  3RZD B;  2UXB L;  4UCV A;  3T1H H;  1F2L A;  2KUM A;  1PZK D;  4MTE A;  1CKN A;  1EQV A;  2FLP A;  1NAP A;  1HJP A;  1BO0 A;  4R4Q A;  3VA7 A;  4A3D G;  2B8G A;  1R9T B;  3JC6 6;  3P1H A;  2FKL A;  2XTI A;  2NVT H;  1YIJ A;  1NY4 A;  3J7A F;  4J6H A;  2WDT A;  3CPF A;  3S2H B;  4P74 A;  3VYS A;  3HKS A;  3SHL A;  1Z9F A;  1RIP A;  5J22 A;  2VQE Q;  3S17 B;  2R7L A;  3UI2 A;  5EJW A;  5M3M B;  4F87 A;  3GTQ A;  1FD7 D;  2MCT A;  2BDO A;  3KHR A;  1JJ2 A;  4A3B H;  4B9W A;  2R93 A;  5BR8 L;  2RHQ B;  1SYF A;  3JAM c;  4A2B A;  1EY5 A;  5FK9 C;  2F0T A;  4X64 H;  2IT1 A;  1VQM A;  1H95 A;  2NVT B;  1EYC A;  3Q23 A;  1F2M A;  4IPC A;  2E2H B;  1Q3L A;  3QOJ A;  1DV2 A;  3UE1 A;  3HOW H;  4EVO A;  3K59 A;  2R7Z H;  5F9N A;  3P7J A;  5C4Z A;  2V58 A;  1YZ6 A;  3GQB A;  1UUP A;  2PQA B;  3L3O C;  2FHT A;  1I94 H;  4UDU C;  4POG A;  4DL2 A;  5COY A;  1X32 A;  2KQ3 A;  2JSO A;  2PCF B;  3DM1 A;  3FPU B;  3S2H H;  2W8K A;  1E7Z A;  2TMP A;  4C3H H;  3TSS A;  1K0S A;  3Q8D A;  1QZH A;  4FF3 A;  2Z0S A;  1Q90 A;  4HJ5 A;  1TWG A;  4X6A H;  1K83 B;  2L1B A;  2YYZ A;  4Q8E A;  3WO1 A;  1NJI C;  2JE6 I;  4A3J H;  3MWM A;  3RB4 A;  1K3R A;  1EQR A;  5CAE B;  3C46 A;  2AGQ A;  1B3Q A;  4MV3 A;  3R2I A;  4ULL A;  4DR5 L;  4JI6 L;  5DQG A;  5L9X A;  1I6V C;  2BQR A;  5JJI A;  5CV7 A;  4O2D A;  1HNW L;  3W3A A;  5G3L D;  1KJJ A;  5FD5 A;  1WTR A;  2A6H C;  4JI1 L;  2AU0 A;  5F9L A;  3GTK A;  2HIX A;  1VF7 A;  1S4Z A;  1AFP A;  4A4I A;  2BE5 D;  5GAD C;  4H7B A;  2UXC L;  3MZ5 A;  4HMI A;  4DV5 L;  1K28 A;  2IJ0 A;  4QGU A;  2RQX A;  3TII A;  2K03 A;  3GO5 A;  3K0Y A;  4PZ8 A;  1EY4 A;  1T9H A;  1JB3 A;  1U4M A;  2F0J A;  3E9H A;  1HNX H;  1DCZ A;  1GUW A;  3EFX D;  2HCI A;  2DIK A;  5FD6 A;  3BQ1 A;  4APM A;  1A0I A;  3E6Z X;  5L37 A;  4A3K H;  5K2M A;  3T53 B;  1HNZ L;  3MFG A;  3HOU G;  1VBH A;  4GKK Q;  2R87 A;  1VQ7 A;  5IGG A;  3MHB A;  1TWH A;  1YNX A;  2YL2 A;  2I5H A;  4RAU C;  3H09 A;  3CPW A;  2K04 A;  3MR6 A;  3BAB A;  1UE7 A;  3H0G A;  1N48 A;  1XDN A;  1NCV A;  4B3M H;  4CKC A;  5E4W C;  4O3P A;  1MSH A;  1I4X A;  2PW5 A;  5GAH C;  4JI7 Q;  5BN4 A;  1KJ8 A;  1GJX A;  4CKB A;  3M3Y H;  2ZJQ A;  1XJV A;  1XX8 A;  1BJT A;  3OMC A;  3VPD A;  3HZX A;  4PV1 C;  3GTL B;  1XMO Q;  3FDT A;  4HJA A;  4V19 0;  1VCI A;  1WD0 A;  4ED0 A;  2KCM A;  1SLJ A;  4AQY H;  5IGB A;  4AIM A;  3FMA A;  3MFI A;  3PW7 A;  4IJH A;  2YYA A;  3R2T A;  4RGT A;  3SI8 A;  4Q0Y A;  2R92 A;  2W57 A;  4TSS A;  2DWC A;  3WNZ A;  2C2D A;  2OEO A;  2B8F A;  4IRD A;  3DWQ A;  3R5H A;  1PTO F;  1MIU A;  1YNN D;  1QUQ A;  1NTG A;  1UNN C;  2YCH A;  1DOL A;  4DV0 Q;  2UUC H;  3K81 C;  1E24 A;  2VW9 A;  2JA5 H;  3PR5 B;  3OTO Q;  3MWY W;  2UVV A;  1UE1 A;  1Z47 A;  4BY7 H;  4DNR B;  3I8Z A;  3MR5 A;  5KFZ A;  2NWG A;  3M9N B;  4Y52 H;  2A6E C;  4CJ1 B;  1U0L A;  1ICF B;  3D6C A;  1N36 L;  3A5Z B;  3N43 B;  4K6L A;  3UFX B;  3T1H L;  3VYR A;  1RK5 A;  3IRB A;  4JV1 A;  2L4N A;  5CV4 A;  1N8R C;  1B7Y B;  3W5O A;  1PX2 A;  5BMV F;  3RB6 A;  2UVU A;  3T51 B;  3DXJ C;  5IYC H;  4IJL A;  1SMY D;  4ZRZ A;  2X0S A;  5CA0 F;  3J81 L;  1HR0 Q;  1Q82 C;  4DR6 L;  3CW2 C;  4U68 A;  3V2T A;  3PUW A;  2JA8 G;  2AQ1 B;  3LWU A;  3QG1 A;  1IBM L;  5FPR A;  5KFJ A;  3MWD A;  1LTB D;  3I4O A;  3BG5 A;  1EIG A;  3IL8 A;  2R3Z A;  2K5Q A;  3V4Z A;  4Z9C B;  3RUP A;  4ZQI A;  1RTN A;  4L1K A;  1EUC B;  4C5A A;  4QL5 A;  2EYF A;  5KFR A;  2VQF Q;  2FPI B;  5DQI A;  1WCM H;  1UE6 A;  1LT5 D;  2UVR A;  2R82 A;  1FJG H;  5CV5 A;  2UUC Q;  1J5E H;  4IRC A;  2UXD H;  1IL2 A;  3PUY A;  4DV7 L;  3RB0 A;  3HKZ E;  3A54 A;  3Q6S A;  1YNJ D;  4K5V A;  4TRD A;  1K9M C;  1TWC A;  5D14 A;  4FXD A;  2ZM6 Q;  1JOR A;  1T5E A;  3L0O A;  3MWE A;  3KYH C;  4JK1 C;  1J5E Q;  4HQ6 A;  2A68 C;  1KJ9 A;  5I47 A;  1SSO A;  4L5S A;  3HOV G;  4QUF A;  4RUA A;  1I4P A;  3PF4 A;  1O7Y A;  4FP5 D;  4YJ2 F;  2VZA A;  4MTN A;  4F4W A;  1P16 A;  4EQ5 A;  5EBD A;  1ILQ A;  4DK1 A;  1CZW A;  4JI0 L;  4HED A;  1BNC A;  1TWA H;  1OWT A;  2JN4 A;  4QQB X;  1LLR D;  2XCL A;  2YU9 H;  3D4W A;  4DR1 L;  4DR5 H;  1CE8 A;  1ESR A;  3VYU A;  4DR4 L;  5KFE A;  2FK3 A;  3T16 A;  2I8C A;  3L2P A;  4B3T H;  2DJF C;  1SYX B;  4JI1 H;  3DM3 A;  3Q22 A;  1D8L A;  4A3M B;  1HCZ A;  2QGQ A;  2B63 H;  4GKJ L;  1HPC A;  3ETH A;  2JEB I;  2Z4I A;  5IYC G;  5DG9 A;  3CD6 A;  1DZ1 A;  5ELN A;  5C3E H;  2DLN A;  2FB9 A;  2EZV A;  1WVL A;  1XWE A;  1UC9 A;  4JYA Q;  3MXP A;  1Y1W G;  1XNQ Q;  5EDW A;  5D1P A;  2R84 A;  1P8L A;  1G8Z D;  4XT1 B;  5EKI A;  4GKJ Q;  4FF1 A;  3I4M H;  5A2Q E;  3KDF A;  1SEB D;  4TQR A;  4J15 A;  1AP0 A;  1EOV A;  2JP1 A;  3T1H Q;  1GHJ A;  3S16 H;  2IY5 B;  4C2M B;  2PQE A;  4GLV B;  4J9P A;  1YJW A;  2JXM B;  3BVG A;  4LFB L;  1OO9 B;  5C3E G;  1YJN A;  4AYB G;  4YJ3 F;  4NLG A;  1TT2 A;  1WCM G;  4GC6 A;  2KCN A;  1LUZ A;  5KG2 A;  3NBH A;  4WRD A;  5FPO A;  5M5W B;  3K5I A;  3I4M B;  4HIM A;  4LFC H;  5A2Q W;  5CBE E;  3C1F A;  4O2B F;  4A3C G;  3IKJ A;  4JI2 H;  2D0P A;  3MTS A;  1KRT A;  3T13 A;  1KAB A;  4X62 Q;  3GTG B;  1S68 A;  4H02 A;  5LA6 F;  2DNC A;  2ZDH A;  3K8A A;  2HCC A;  1CA5 A;  4A3G H;  2R92 G;  1FR3 A;  1B6R A;  1E4F T;  2E5L L;  1TY0 A;  4B3M Q;  3E5S A;  2F4I A;  2W9B A;  2FJZ A;  1F2Z A;  1H9M A;  4KHP Q;  3CKI B;  3BDO A;  3UE0 A;  3V6J A;  1TWF A;  2UU9 H;  1XNQ H;  5LMU L;  1OXS C;  4YY3 L;  3K80 C;  1JKJ B;  2F4V H;  1T3N A;  2KSW A;  1CA6 A;  1HA5 A;  2PI2 A;  3BQ2 A;  2F0S A;  1JT8 A;  2ZXR A;  4LF8 H;  3DEO A;  4LMQ D;  1XMQ Q;  2LKV A;  4BY1 B;  1XYI A;  1U4L A;  4F88 A;  3RGZ A;  3R8B A;  5BPF A;  4LF7 Q;  4ID6 A;  5C0X I;  3AU7 A;  2Q8R E;  3E3X A;  1TS4 A;  2HHH L;  1STE A;  2E8G A;  3WWV A;  2VB3 X;  2JA7 B;  4M9U A;  3CCR A;  1A8V A;  5DNF A;  5BN5 A;  1IBM H;  5KFI A;  2IL8 A;  3DLL A;  1TWA A;  2PI2 E;  2EYP A;  4L5Q A;  2VPQ A;  1PXU A;  2YU9 A;  1BBW A;  1XTC D;  1GSO A;  3TP8 A;  1A2T A;  4UP8 A;  1VQG A;  4JC0 A;  5KFW A;  4FS2 A;  3PQI A;  1A3V A;  1EY9 A;  3NQI A;  1EEF D;  5KKN B;  1RKN A;  1B8A A;  4LJZ C;  1PFN A;  1JR0 D;  1ICW A;  2R86 A;  4OWT B;  4HSP A;  3TBI B;  2ZJP A;  4G7H C;  4FYD A;  2C2R A;  5CA1 F;  4P71 A;  1Y8N B;  3HOX G;  5M3F H;  2RDG A;  5KFT A;  3SDZ A;  1K1S A;  3TIN A;  2RGR A;  4DL3 A;  5EPL A;  2LS0 1;  2UXB H;  5HGQ A;  4A3L H;  4YIJ A;  5F2D A;  1JE4 A;  1IHZ A;  4G4K A;  1EFI D;  3RR5 A;  3OWE B;  1O7L A;  1SRO A;  2MP1 A;  4JI5 Q;  2EJF C;  2PVP A;  4C5B A;  1N33 L;  4ECU A;  1LT4 D;  5H80 A;  1TWA B;  5KND A;  4ECW A;  3OUU A;  4I65 A;  3K57 A;  5IWA Q;  3STB D;  4UHV A;  2RVL A;  3SR1 A;  4S3S A;  1HQM C;  1JX4 A;  2K7V A;  2F03 A;  5KYI A;  5K36 H;  2K75 A;  2QW7 A;  5AFW A;  4YCW A;  4BXX G;  2BE5 C;  2PO4 A;  4WBN F;  2L5T A;  2QF7 A;  5LMN L;  1SN8 A;  1VQB A;  4FVM A;  3DEP A;  3BVM A;  4O42 A;  3KDF B;  2MNA A;  1VQ9 A;  4JI5 L;  1JIH A;  3ND8 A;  4EQP A;  5EOY A;  3Q8S B;  5M3M H;  4B3S H;  1VQD A;  5IP7 G;  1I7N A;  4K5W A;  3FPP A;  1SJH D;  2PZT A;  4KD4 A;  3PO2 G;  5KG6 A;  1SCU B;  3EVQ A;  3H3V I;  3KF8 A;  4DK3 C;  1K8A C;  1VQ6 A;  4DV4 L;  4OO1 H;  4JPB W;  2VQE L;  4LH6 A;  5KG4 A;  4KHZ A;  2EPB A;  1LV9 A;  2K6A A;  3RAX A;  3U9T A;  1SMX A;  4C3H G;  2VQD A;  4R4T A;  3CCL A;  3HXL A;  3M9O B;  2F0Q A;  4JBW A;  4YWM A;  3MVV A;  2X69 A;  1LYL A;  4UP9 A;  2FMM A;  4IUP A;  2K4K A; 
#chains in the Genus database with same CATH homology
 3ULP A;  1O7I A;  4QJF A;  4BBR G;  2KBN A;  2WAQ E;  1VQ5 A;  1HNW Q;  4LF9 L;  2AHO B;  3RZO H;  1E3P A;  4XIG S;  3M4O H;  3S1N H;  4IPD A;  4YCV A;  2ASB A;  3GTL H;  5FJ8 H;  1A63 A;  1CKN B;  1J6Q A;  1HNZ Q;  2ZJR A;  1OTC A;  4QY7 A;  4X66 Q;  3CAM A;  3F1Z A;  3PO3 H;  1CKM A;  5AJ3 L;  3J81 j;  2YV5 A;  1VQI A;  2HIV A;  2D0O A;  4DAM A;  3FKI H;  1XNR Q;  1CSP A;  3H3V H;  3RN5 A;  1Q46 A;  3FP9 A;  2HHH Q;  1E1T A;  2BA0 A;  4DR6 Q;  2Y0S G;  3KF8 B;  3M4P A;  2B63 G;  4BBS H;  4OWX B;  1WFQ A;  5GQO A;  2E2J H;  4NXN L;  5FJ8 G;  4A3B G;  3TRE A;  4HJ8 A;  5BR8 Q;  1Y1W H;  1KIX A;  2K14 A;  1NBW A;  3TRZ A;  1PYS B;  1EQQ A;  3TS2 A;  1I3Q H;  3E0E A;  2ID0 A;  3ICE A;  5JJL A;  4X66 L;  3PUV A;  2AWN A;  3PF5 A;  1VQP A;  1VQO A;  4DV1 L;  3GTK H;  2UXB L;  3CCJ A;  1D7Q A;  1QUQ B;  1CKN A;  2CWA A;  1PH8 A;  4C3J H;  1HJP A;  4A3D G;  4R4Q A;  1JJC B;  1Q1B A;  1XNQ L;  3JC6 6;  2IHE A;  1HR0 L;  3G48 A;  2XTI A;  1B70 B;  2NVT H;  1YIJ A;  1NY4 A;  3M7N A;  2VS1 A;  1MJE A;  2HQL A;  4R4C A;  2F4V L;  3CPF A;  4P74 A;  4IFD I;  3HKS A;  1Z9F A;  1BBU A;  1RIP A;  2VQE Q;  3CCQ A;  1E1O A;  1I5F A;  2OCE A;  2GN5 A;  4LWC A;  4LF8 L;  5GAE C;  4WJ4 A;  1JJ2 A;  4L5T A;  4NXN Q;  4A3B H;  2JK8 A;  1HZA A;  5BR8 L;  2RHQ B;  3TS0 A;  3NBH B;  3JAM c;  1QVC A;  3U50 C;  1XPO A;  5C0X G;  3HOZ H;  4TQU S;  4A3L G;  3I2Z A;  2OWO A;  2IT1 A;  5IYB H;  4A93 G;  5M5W H;  1VQM A;  1Q7Y C;  1H95 A;  3AEV A;  3GDE A;  4L5R C;  1PH4 A;  4DV0 L;  4IPC A;  4POF A;  1A62 A;  4LF6 Q;  4JI3 L;  1LM0 A;  3UE1 A;  3BZK A;  3HOW H;  4A3C H;  1Q12 A;  4OX9 L;  3W1B A;  2R7Z H;  5C0X J;  1YZ6 A;  2AMC B;  2PQA B;  1YVC A;  1TWF H;  4POG A;  4A93 H;  3ERS X;  2OTJ A;  2OQK A;  1PH1 A;  2K52 A;  1K0R A;  5FLM G;  3S2H H;  3TEH B;  4B3R Q;  1E7Z A;  1QVF A;  4C3H H;  4LUV A;  4R1J A;  1GVP A;  3VDY A;  2OTL A;  3Q8D A;  1QZH A;  2Z0S A;  2WFW A;  2KHJ A;  1CKO A;  1FL0 A;  2PMZ E;  4NPS A;  2BA1 A;  1WI5 A;  2H5X A;  4HJ5 A;  4X6A H;  2YYZ A;  1M1K C;  1NJI C;  2JE6 I;  4BBR H;  4GOP A;  2B3G A;  2C35 B;  4A3J H;  1IBK Q;  1K3R A;  1EQR A;  1S72 A;  2XGT A;  3ULJ A;  1EIY B;  2CKZ B;  4UPA A;  4DR5 L;  4JI6 L;  4NXM L;  4BA2 I;  4PG3 A;  5JJI A;  3S17 H;  4O2D A;  2RCN A;  5DLQ E;  3HFZ B;  1HNW L;  2DGY A;  1PV4 A;  2F52 A;  3PO3 G;  2EQS A;  4JI1 L;  2QA4 A;  4LF5 Q;  2HIX A;  3T1Y L;  3OTO L;  2LXJ A;  4A4I A;  1YJ9 A;  4LFC Q;  4IFD J;  5GAD C;  2UXC L;  4WJ3 M;  3RLN A;  1Q8K A;  4DV5 L;  3RLF A;  1DGS A;  5IE8 A;  4QGU A;  4FDB A;  1X55 A;  3GO5 A;  4PZ8 A;  4HIO A;  1T9H A;  4LUO A;  3FKI G;  3GTG H;  3J80 c;  3E9H A;  3CME A;  1PH6 A;  4LF8 Q;  3UDF A;  2OQ0 A;  4UY8 C;  1N36 Q;  4DV6 Q;  2JJQ A;  2K5H A;  3MEF A;  4DV7 Q;  1A0I A;  3KF6 A;  3L7Z C;  4A3K H;  1YBY A;  3JAM i;  1YHB A;  4GOP B;  1HNZ L;  4BA1 I;  1KHI A;  3HOU G;  1L0W A;  4GKK Q;  3CC7 A;  1L1O A;  4JBM A;  4X62 L;  1UWV A;  1VQ7 A;  3PUZ A;  5AJ3 Q;  3B6Y A;  2VUM H;  1YNX A;  2I5H A;  3CPW A;  5C44 H;  1XNR L;  5IY0 A;  1UE7 A;  4B3S L;  1YHQ A;  3CCM A;  1X3G A;  2A19 A;  4DUY Q;  1J5E L;  3S1M H;  5GAH C;  4JI7 Q;  4GNX B;  2CQO A;  3HOU H;  3M3Y H;  4JI2 Q;  3BZC A;  3J81 c;  4DV4 Q;  2ZJQ A;  1XJV A;  1WYD A;  1AH9 A;  1MKH A;  4K0K L;  3TQY A;  2B29 A;  2EIF A;  3I4N H;  3KFU A;  2NN6 G;  1XMO Q;  4ALP A;  1PH9 A;  4HJA A;  2N78 A;  1VCI A;  2Z6K C;  5ELO A;  3SGI A;  2KCM A;  5JJK A;  1SLJ A;  3G4S A;  3CCS A;  2NZO A;  3I56 A;  4AIM A;  2VUM G;  1FVI A;  2Q2T A;  4IJH A;  3F2D A;  3S24 A;  2CWP A;  2Y0S E;  1UE5 A;  3S2D H;  2LXK A;  1EYG A;  2IX0 A;  4IO9 A;  2IX1 A;  1VQH A;  2AKW B;  2VL6 A;  1I94 L;  4IFD G;  4YWK A;  3BJU A;  2QEX A;  1MIU A;  2I5L X;  1QUQ A;  1NTG A;  5IYB G;  4HJ9 A;  4DV0 Q;  4A76 A;  1QVG A;  4B3S Q;  3HOY H;  4RG1 A;  3K81 C;  2K5N A;  1E24 A;  2VW9 A;  2JA5 H;  3OTO Q;  1FGU A;  4B3T L;  2BH2 A;  2JQO A;  1UE1 A;  4DR3 L;  4A3D H;  4HID A;  4JG2 A;  1Z47 A;  2ZTE A;  5E7N A;  4BY7 H;  3RLO A;  4GN5 A;  4LFB Q;  4Y52 H;  4C2M H;  1KL9 A;  4PZ6 A;  1U0L A;  5M3M G;  2VNU D;  3LGJ A;  1N36 L;  3PGZ A;  3AYH B;  1KC8 C;  3A5Z B;  1M90 C;  4BY1 H;  3NEM A;  1VQE A;  2MFI A;  3T1H L;  2KEN A;  2ES2 A;  4LNQ A;  1CSQ A;  3IRB A;  1OXV A;  1OXU A;  1UEB A;  1N8R C;  1X6O A;  1B7Y B;  1XPR A;  1VQN A;  4B3T Q;  4NB3 A;  3W5O A;  1AE3 A;  2UUA Q;  4BXX H;  2RHS B;  4JV5 Q;  1ASZ A;  4YCU A;  5H1S E;  3A74 A;  5IYC H;  4IJL A;  4DR7 L;  2YTV A;  1GKH A;  1YI2 A;  3E9I A;  1HR0 Q;  1Q82 C;  4DR6 L;  3F8T A;  3CW2 C;  3M4Q A;  4DR5 Q;  2AWO A;  4KI0 A;  2E5L Q;  5HY6 A;  5IYD G;  1GM5 A;  3PUW A;  1I94 Q;  1N32 L;  3W1G A;  2JA8 G;  3GTO H;  1VQF A;  1IBM L;  4IPH A;  5FLX c;  2WB1 G;  2JA6 H;  2JEA I;  3I4O A;  3J7A 5;  2NVQ H;  3GD7 A;  3U58 A;  4YY3 Q;  1AE2 A;  4DR3 Q;  1HR0 W;  2R7Z G;  3HKZ G;  3CC2 A;  4JV5 L;  2MO1 A;  2Q2H A;  4QL5 A;  1CUK A;  1I6H H;  4YWL A;  2R93 G;  2VQF Q;  3NEL A;  1KD1 C;  1WCM H;  2UXB Q;  1UE6 A;  1HH2 P;  3RZD H;  2ZTD A;  3GTM H;  1EFW A;  4B3M L;  3G71 A;  2K50 A;  3K0X A;  2UUC Q;  3I4N G;  2F3I A;  4DUZ Q;  4DR7 Q;  1IL2 A;  3PUY A;  3U4Z A;  4DV7 L;  1PHJ A;  3HKZ E;  4GS3 A;  3UDG A;  5IT9 c;  1K9M C;  4OX9 Q;  2F4V Q;  1GD7 A;  2ZM6 Q;  1IBL L;  1WJJ A;  3L0O A;  3KYH C;  3KLW A;  5M5Y H;  3J7Z C;  3FHW A;  1IXR A;  1PA6 A;  3AQQ A;  5C44 G;  1J5E Q;  2JA7 H;  4JOI C;  1WOC A;  1HZC A;  2YTX A;  4DUY L;  4L5S A;  3HOV G;  3PO2 H;  2UU9 L;  4A75 A;  4JI8 L;  3PF4 A;  1TWH H;  2VZA A;  4MTN A;  2KHI A;  1P16 A;  4EQ5 A;  1K8G A;  4DV2 L;  4DV3 Q;  1Q86 C;  3PSI A;  1PVO A;  4JI0 L;  1G6P A;  3I7F A;  2R93 H;  1TWA H;  1IBK L;  3ZJY C;  1X9N A;  1PH5 A;  1N34 L;  2YU9 H;  4ME3 A;  4DR1 L;  1HZ9 A;  4QQB X;  4DR4 L;  1V1Q A;  1X3F A;  1Y1V G;  5IP9 G;  2JA9 A;  4OXP A;  3KF6 B;  2UUC L;  4GN3 B;  4JI4 Q;  5M5X H;  2MQH A;  4A3K G;  3NEN A;  4DPG A;  3PV0 A;  4YHH L;  3L2P A;  5GRO A;  2EXD A;  3DM3 A;  1SR3 A;  3AFQ A;  1D8L A;  4IOA A;  2B63 H;  3CMA A;  2QGQ A;  4BBS G;  4GKJ L;  4LF5 L;  3CQZ H;  3HOV H;  2JEB I;  1OXT A;  4OON A;  1JMC A;  1IBM Q;  1OXX K;  2NN6 I;  3OYY A;  5IYC G;  4DNI A;  3RN2 A;  3CD6 A;  1PYB A;  5ELN A;  4JI3 Q;  1V9P A;  1EUJ A;  5C3E H;  5J3B A;  3OW2 A;  4LFA L;  3S1R H;  4JYA Q;  3RNU A;  3G6E A;  1L1O C;  3F2B A;  1Y1W G;  1XNQ Q;  1N33 Q;  1Q1E A;  4OO1 G;  4DAY B;  1P8L A;  5EAY A;  4GOP C;  2JA6 G;  4A3G G;  4GKK L;  4GKJ Q;  3H15 A;  1NMG A;  3I4M H;  4AYB E;  1TWG H;  3KDF A;  5IYD H;  3J80 i;  3HOZ G;  2BH8 A;  4J15 A;  1X3E A;  4KHP L;  4A3J G;  1EOV A;  3HOX H;  5M3F G;  3T1H Q;  2R6G A;  4DR4 Q;  3S16 H;  2IY5 B;  1VQC A;  2I0Q A;  2VY3 A;  2R7D A;  4GLV B;  4APV A;  1BKB A;  1LTL A;  3GTP H;  1YJW A;  3STB C;  4DV5 Q;  4LFB L;  5C3E G;  1YJN A;  3M85 A;  4AYB G;  3EN2 A;  5FLM H;  2DUD A;  3GTQ H;  1WCM G;  4DKA C;  1LUZ A;  2UU9 Q;  3F2C A;  4JI8 Q;  1XMO L;  3K7U C;  1N9W A;  1XMQ L;  4PZ7 A;  4HIM A;  2UUB L;  5LMN Q;  4JI1 Q;  4AQY L;  1FJG L;  5LMU Q;  4A3F G;  4HJ7 A;  4DR2 Q;  2KCT A;  4A3C G;  2UXD L;  1YHA A;  1JE5 A;  3CCU A;  2D0P A;  3D31 A;  1ASY A;  1KRT A;  4X62 Q;  4BY7 G;  3ULL A;  1PH7 A;  4PMW A;  2A8V A;  4H02 A;  1EIF A;  2ATW A;  2NVY H;  2NVX H;  3K8A A;  1S40 A;  1VQK A;  4A3G H;  2R92 G;  3CCE A;  2E5L L;  4KLK A;  1PH3 A;  4B3M Q;  2IHF A;  1NMF A;  4DUZ L;  1PFS A;  1QZG A;  4B3R L;  4YHH Q;  4KHP Q;  4JCV E;  3K7A H;  3UE0 A;  5LMU L;  4LF7 L;  3CP0 A;  4A3M H;  1OXS C;  1TXY A;  4YY3 L;  1K73 C;  2JA8 H;  3K80 C;  1Y1V H;  5IP9 H;  4K0K Q;  4HIK A;  2V1C C;  1IZ6 A;  5JEA J;  4DK6 C;  1KXL A;  4BY1 G;  2PI2 A;  2CFM A;  4GNX A;  1VQL A;  4JOI A;  4RMF A;  4JI6 Q;  1JT8 A;  1BVS A;  4LF9 Q;  1HNX Q;  3I55 A;  1TWC H;  5C4X H;  1XMQ Q;  1G51 A;  1C7Y A;  2L15 A;  2WP8 J;  4A3F H;  5JEA G;  2UXD Q;  3ER0 A;  2E2I H;  4LF7 Q;  3PUX A;  2R7F A;  4R4O A;  5C0X I;  2UUA L;  1JJG A;  1NE3 A;  2WB1 E;  2K5V A;  1SRU A;  1IBL Q;  4A3E G;  2Q2U A;  1W2B A;  2HHH L;  2E8G A;  3WWV A;  3KJO A;  4DV1 Q;  4X64 Q;  1N34 Q;  2Z6K A;  2R92 H;  1IYJ B;  4UP7 A;  3CCR A;  2GVA A;  1A8V A;  1VQ4 A;  1U5K A;  4DV6 L;  1V43 A;  4X65 L;  2RF4 A;  3DLL A;  1YIT A;  2A1A A;  1KQS A;  2E2H H;  2PI2 E;  4L5Q A;  4P75 A;  4QIW E;  4GN4 B;  1BBW A;  4DV2 Q;  3T1Y Q;  4JI0 Q;  4LF4 Q;  2UXC Q;  4LW1 A;  3S1Q H;  4UP8 A;  4GNX C;  3I4M G;  1VQG A;  2N3S A;  4JC0 A;  2PNH A;  1JB7 A;  4R4I A;  1Q81 C;  2UUB Q;  5LMN W;  4OWW B;  1KAW A;  3J81 i;  2FXQ A;  4JBJ A;  1XPU A;  1B8A A;  1Y14 B;  4LFA Q;  1EWI A;  4IPG A;  3A0J A;  4JYA L;  4MZ9 A;  1VQ8 A;  2PQA A;  1HZB A;  1X56 A;  1PH2 A;  4JI7 L;  3H0G H;  4OWT B;  3A5U A;  3CCV A;  5C4X G;  1SFO H;  2ZJP A;  4A3I G;  3PIP A;  5IWA L;  1SE8 A;  4P71 A;  3HOX G;  3UDI A;  5M3F H;  3PIO A;  3HOY G;  1L2F A;  5HGQ A;  4A3L H;  4EX5 A;  5K36 G;  1R9T H;  3MXN B;  4LUZ A;  3RR5 A;  4LFC L;  3KJP A;  2YTY A;  4O0A A;  4JBK A;  4MNO A;  1SRO A;  2WAQ G;  4JI5 Q;  4X65 Q;  2NZH A;  4JI2 L;  1N33 L;  1C9O A;  1VS0 A;  2VQF L;  4OO1 I;  1K83 H;  1G29 1;  1I50 H;  1X65 A;  3KOJ A;  3STB D;  3U4V A;  5IWA Q;  4LF4 L;  5IP7 H;  1HNX L;  1N32 Q;  2I5M X;  2K75 A;  3AFP A;  4A3I H;  4YCW A;  4BXX G;  1GO3 E;  1FJG Q;  1C0A A;  1X54 A;  5LMN L;  4AQY Q;  4LF6 L;  2D62 A;  2Q2I A;  1KRS A;  1SN8 A;  1S3O A;  1VQB A;  4DR2 L;  2GVB A;  2LSS A;  4A3M G;  2MO0 A;  1YEZ A;  3M9B A;  3CC4 A;  4XTC S;  1VQ9 A;  3KDF B;  3H0G G;  2MNA A;  3GTJ H;  3BU2 A;  4JI5 L;  1VQA A;  3UDX A;  5C4J H;  3CF5 A;  2ZM6 L;  4JI4 L;  4X64 L;  1XTD A;  5M3M H;  2HT1 A;  4GLA C;  1VQD A;  2N49 A;  5IP7 G;  4Y7N H;  4GLX A;  4NXM Q;  3D0F A;  3PO2 G;  1W3S A;  3S15 H;  1MJC A;  3EBE A;  3H3V I;  1VQJ A;  1E22 A;  4C3I H;  4DK3 C;  1K8A C;  1VQ6 A;  2ALY B;  1RL2 A;  4DV4 L;  4IOC A;  2CCZ A;  4P73 A;  2VQE L;  4KHZ A;  2JA5 G;  3HOW G;  3S14 H;  4P72 A;  3PCO B;  4DV3 L;  2JA7 G;  1SMX A;  2ZTC A;  4R4T A;  3CCL A;  4TVA B;  1L1O B;  4JBW A;  5GAG C;  4YWM A;  3CXC A;  2N8N A;  1LYL A;  4AH6 A;  4A3E H;  4UP9 A;  4DR1 Q;  3EIV A;  2K4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...