5IP9G

Structure of rna polymerase ii-tfiif complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5ip9G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 5ip9G01
3HOVH 1BKBA 1NY4A 3I4OA 4LW1A 4B3ML 1E22A 1EWIA 2B29A 2YV5A 3D31A 4IJLA 1KRSA 1WI5A 1K3RA 1Q82C 4A3MG 1KC8C 4JYAQ 3NELA 2B63H 4GKKQ 4LF9Q 4LUZA 1TWCH 2UXBQ 4DR1L 1VQFA 1N32L 1OXUA 1QUQB 4P75A 4POGA 2R7ZH 1NMFA 4XTCS 1X54A 2YYZA 4A3FG 5C0XG 3K81C 1N36Q 3CP0A 3HKSA 4DAMA 1ASYA 2RHQB 3KF6B 5BR8L 3S15H 1HR0L 2MQHA 3K0XA 3BJUA 1R9TH 3GO5A 1YNXA 4P74A 1XPRA 4C3IH 2UUBQ 3M7NA 2ATWA 4IO9A 3PUYA 5M5XH 1V1QA 3PUWA 1WCMG 5H1SE 2ES2A 1L0WA 4A3FH 3PSIA 1X3GA 5JJIA 4DR5L 5IYDG 3PF5A 2HHHQ 1PHJA 4A3CG 1NBWA 1UE6A 1KIXA 4B3TQ 1AH9A 1QZGA 4JI3Q 5LMUQ 2IX0A 3K8AA 4MNOA 4PG3A 4DKAC 4X6AH 3GTKH 3MEFA 1NE3A 5GADC 4OXPA 3PIOA 2HT1A 2MO1A 2VQEL 4A3IG 4IFDJ 3JAMc 1VQEA 3I7FA 4NXNQ 2B3GA 3Q8DA 5M5YH 5ELNA 2K14A 4A3CH 2RHSB 3FHWA 1OXSC 2ZTDA 1HZBA 4DV4L 2F3IA 4A3EG 2BA1A 4JI0L 3W1GA 4LFBQ 1X6OA 1A62A 1U0LA 1TXYA 4YHHL 4DUYL 1PH2A 2JA7G 1LYLA 2F4VL 3CPFA 2V1CC 5JJKA 1PH6A 2OTLA 4JOIC 2E5LL 4A3IH 1C0AA 2PI2E 2JA5G 4JI4Q 3CW2C 3S1NH 4GNXA 4X65L 2UUCL 3UE0A 4RMFA 4JI8L 5IP9G 4DV7Q 2VUMG 2UUAQ 5C44G 4A3KG 4AIMA 4DV5Q 4A3EH 1PYSB 4EQ5A 4X62L 1N34Q 4LF5Q 1RIPA 4OX9L 1SR3A 4LF6Q 4JI2Q 2DUDA 4QJFA 2VQFQ 3PUZA 4GN5A 3SGIA 4LFAQ 2JA5H 1XJVA 1QVCA 2BA0A 4JI5L 3RN2A 1O7IA 5FJ8G 2H5XA 1PFSA 5HGQA 1Q81C 2Z0SA 5IP9H 4JG2A 4DR2Q 1VQNA 4BY7G 3M3YH 4DV3Q 1IBLL 2VUMH 1UE7A 4JV5L 4JI6L 4A3KH 2IHFA 1VQCA 3HOXH 3PO3G 4AQYQ 2UU9L 2VY3A 2CWPA 2JEAI 4DR7L 4QQBX 3F8TA 1HJPA 4R4QA 3L2PA 4ME3A 4LNQA 1IBKQ 2KBNA 4JBWA 4UP8A 3H0GG 4DV2L 1L1OC 3PUXA 5FJ8H 4LUOA 4BY7H 2AWOA 2AKWB 1CKNB 5GAEC 4GOPB 1QZHA 4A93G 4DV0Q 2ID0A 1PH4A 3WWVA 4DV1Q 4OO1I 3ULLA 3PO3H 4B3RL 1XPOA 2Z6KA 1VQMA 3A5ZB 1PH9A 3HOUG 2Q2HA 3HOZG 4A4IA 1PYBA 4A3BG 5M3FH 2ZM6L 4GOPC 3H3VI 2YTYA 3H0GH 2UXDL 1Y14B 3KF6A 4LFCL 3UE1A 3S1MH 5DLQE 1EFWA 4A93H 4X64L 1HNWL 2VNUD 4P72A 2LXJA 1G51A 5GAGC 1C9OA 4B3SQ 4LF7Q 1UE1A 1D8LA 1IZ6A 4QY7A 3A74A 2Q2UA 3HOUH 1G6PA 3HOZH 3I55A 3RR5A 4O2DA 3KJPA 4DR4L 1N9WA 4R1JA 4BA2I 2HQLA 4JCVE 1FL0A 2JQOA 3KYHC 3PGZA 1I94Q 2I5LX 1EIFA 4IJHA 3MXNB 3UDFA 1K83H 1YITA 2ZJQA 4FDBA 4AH6A 3G48A 1KD1C 2NN6I 3TRZA 1MKHA 4WJ3M 5JJLA 3S17H 3EBEA 2GVAA 5C0XJ 2RCNA 3NEMA 3FP9A 5IY0A 5LMNQ 3AFQA 3T1HQ 3M85A 1FGUA 1NMGA 1LM0A 1WFQA 2IY5B 2XTIA 3GDEA 3I2ZA 4B3MQ 1V43A 1YHBA 2VS1A 5FLMG 4HJ5A 1SRUA 2PQAB 3H15A 3KDFB 1CKMA 4KLKA 1GVPA 3OTOL 1RL2A 1FJGL 1PH5A 4A3LG 2UXCL 4BY1G 3F2CA 4GKJL 3S2DH 4DR1Q 1HZCA 1Q1EA 4L5QA 1K9MC 2ASBA 2CFMA 3G4SA 1N32Q 1YJ9A 1PV4A 2N3SA 3RLFA 5C0XI 2KCMA 3HFZB 4HIKA 4K0KL 1PH3A 4YY3L 4PZ6A 1GM5A 1OXTA 3UDGA 1XNRL 5FLMH 1EOVA 4DV6L 2NVQH 5BR8Q 3CMEA 1XMOL 1QVFA 1I5FA 3RLOA 4DK3C 3PF4A 1E1TA 4A3LH 4J15A 1Y1WG 1VQ4A 4H02A 1QVGA 1SMXA 4BA1I 4BY1H 4LF4L 1XNQL 3E9HA 4IPCA 1J5EL 1WJJA 2QGQA 1E24A 3CC4A 3M4OH 1TWHH 1VS0A 4OONA 3I56A 3K7AH 1YJWA 2EXDA 4DR6L 3CCJA 5JEAJ 4DR5Q 3ER0A 1X65A 4KHZA 4APVA 2C35B 1YIJA 3GTLH 4YWLA 3GTGH 2WAQG 1VQOA 3K80C 1Q1BA 2QA4A 4UY8C 5GROA 1DGSA 3PCOB 1E1OA 1Y1WH 1TWFH 4MZ9A 3S14H 3TS2A 2N49A 3F2BA 5IT9c 1CKNA 2VQEQ 1EIYB 1GO3E 2I0QA 2YU9H 3ULPA 1VQBA 3GTOH 5M5WH 2WAQE 5J3BA 2VW9A 1AE3A 4JI7L 4YWKA 4DV4Q 4JI0Q 2E2HH 2AMCB 1P16A 2VZAA 3CQZH 4YHHQ 4DUYQ 1WYDA 4EX5A 2E2IH 4IFDI 1SROA 4C2MH 2F4VQ 2BH8A 3RLNA 3HOXG 1CUKA 4Y52H 1MJCA 1BBWA 2BH2A 2I5HA 2K5VA 1Q8KA 2K75A 4PMWA 5AJ3Q 4IOCA 3CCEA 2GN5A 2JK8A 1L2FA 2MO0A 4X65Q 2UUCQ 2OWOA 4JI8Q 1T9HA 4RG1A 4X66L 4LF8L 2KENA 3CMAA 1Q7YC 4X62Q 2K4KA 1W2BA 4L5SA 4OWWB 4HJAA 3TEHB 1LUZA 4OX9Q 1B8AA 3B6YA 1L1OB 4GLXA 3CXCA 2JE6I 1CSQA 2ALYB 4LWCA 2N8NA 2K52A 3F1ZA 4JI5Q 3U50C 2NVYH 3KFUA 3S2HH 5IP7G 5M3MG 1IBLQ 1HNXL 1EUJA 2WB1G 1K8GA 4JI6Q 5M3FG 4BBRG 4NXML 4JV5Q 4YWMA 4DR2L 1A8VA 2OQKA 4LUVA 3VDYA 4HIOA 2AWNA 5IWAQ 2UU9Q 2IX1A 3I4MG 1EQRA 2HIXA 4DR7Q 1YEZA 2F52A 1J6QA 1VQPA 4A3DH 4IPGA 4HIDA 5HY6A 3U4VA 1JE5A 2OTJA 3CCVA 3T1YL 1XTDA 1JMCA 3GD7A 2ZTEA 2WB1E 1FVIA 2JJQA 1QUQA 2NVTH 5IP7H 5IE8A 5M3MH 3EN2A 4IOAA 2R6GA 4BBRH 4DUZL 1K0RA 4WJ4A 4YCWA 1VQKA 2XGTA 1W3SA 2A1AA 2VL6A 4ALPA 3I4MH 4B3RQ 4BBSG 3F2DA 1HNZL 2E8GA 4TQUS 2KHJA 3STBC 4A75A 1VQJA 2R7ZG 2OQ0A 4JBJA 1ASZA 2ZM6Q 2DGYA 3CC7A 2UXDQ 1HZ9A 1I6HH 4R4CA 4LFCQ 1XMQL 1HNWQ 3S24A 4X64Q 5GQOA 3ULJA 1IBML 1OXXK 3GTPH 4BBSH 4JI1Q 1N33L 5IYCH 4GNXB 4HJ9A 4YCVA 4DR3L 1VQ6A 2B63G 1D7QA 3RZDH 4DR4Q 1VQLA 1PH8A 1B7YB 2JA8G 1P8LA 3RN5A 3E9IA 3BZKA 4HJ7A 1I94L 3M4PA 2ZJPA 3H3VH 4OWXB 4R4IA 4UPAA 1EQQA 4GNXC 2E2JH 3RZOH 1X3FA 3OYYA 4QIWE 4KHPL 1UEBA 2IHEA 4YCUA 1VQAA 4JC0A 1HH2P 3CCUA 1NJIC 1SLJA 3CD6A 3ICEA 1V9PA 3J81i 2NN6G 3KLWA 4NB3A 2JA8H 1H95A 1YI2A 1K8AC 4DAYB 1M1KC 1YBYA 4JYAL 3S1RH 4IPDA 1EYGA 1YVCA 4GN4B 2FXQA 3T1HL 4GKKL 4L5RC 4A76A 4PZ8A 4LF9L 4XIGS 2YTVA 3J7ZC 2UXBL 1KRTA 3OTOQ 1VCIA 1FJGQ 3CAMA 2UXCQ 1A63A 1TWGH 1A0IA 4NPSA 3LGJA 4GKJQ 1KAWA 1GKHA 3E0EA 1HR0Q 1N36L 1GD7A 2LXKA 2QEXA 2R7FA 4HIMA 3J81j 3KJOA 4K0KQ 2WFWA 3ZJYC 4YY3Q 2MNAA 1XNRQ 2CWAA 2MFIA 4DV6Q 2UUBL 1L1OA 4PZ7A 1XMOQ 1YHQA 4GS3A 4POFA 1VQIA 2IT1A 1C7YA 2ZTCA 3KF8B 4MTNA 4A3MH 1KQSA 1VQ5A 4LF4Q 3S1QH 4KI0A 1MIUA 2LSSA 1XNQQ 2HIVA 2K5HA 3RNUA 3S16H 1I3QH 2Z6KC 1J5EQ 2KHIA 2HHHL 3ERSX 4JBMA 3GTMH 3DM3A 4DR6Q 3BU2A 4P73A 3U4ZA 4QL5A 4JI3L 5LMUL 1IYJB 1PA6A 3OW2A 3GTJH 4GOPA 2NZOA 1KHIA 4TVAB 3CCQA 3CCLA 4BXXG 3EIVA 3NBHB 5IYBG 3HOYG 4R4TA 3TREA 3PUVA 1PVOA 1I50H 3D0FA 3CF5A 5C4XG 2PI2A 1BVSA 4NXNL 3JAMi 2D62A 1VQ9A 1Z9FA 1JJCB 2Y0SG 3M9BA 3AYHB 4GN3B 1CSPA 2Q2IA 4C3HH 1MJEA 2R7DA 3K7UC 1WCMH 4LFBL 2E5LQ 4JI7Q 4BXXH 1U5KA 2JA9A 5IYBH 1IL2A 1TWAH 2D0PA 1XPUA 3HOYH 5IYDH 1AE2A 5C4JH 2Y0SE 5C4XH 4JI4L 1Q46A 3GTQH 2ZJRA 1BBUA 3CCRA 2WP8J 3BZCA 2R92G 1E3PA 1SN8A 5EAYA 5JEAG 2N78A 4DV7L 2UUAL 1YJNA 4DV5L 1YHAA 2D0OA 1X3EA 4IFDG 5FLXc 1N34L 4A3DG 5AJ3L 4LF8Q 4LF5L 2AHOB 2NZHA 4X66Q 2CQOA 4LF6L 1B70B 5GAHC 4JI2L 4DNIA 4O0AA 2VQFL 1HZAA 4QGUA 3M4QA 4LFAL 4R4OA 5LMNW 4IPHA 3PIPA 4B3TL 1N8RC 1X55A 2JA7H 2R92H 2YTXA 3FKIG 3G6EA 1JB7A 3TQYA 3JC66 3UDIA 4DV3L 2EQSA 1S40A 2EIFA 3I4NG 1VQGA 2K5NA 3W5OA 4AQYL 1K73C 1UWVA 2R93H 1HNXQ 4OWTB 4NXMQ 3CCSA 1S3OA 4A3JG 4DV2Q 4DK6C 2CCZA 1PH1A 4P71A 1PH7A 5C44H 1IBKL 1Q12A 2PQAA 3AEVA 3KDFA 3G71A 3HOWG 3KOJA 5IWAL 3J80i 3AFPA 3FKIH 4DV0L 1YZ6A 2KCTA 1SFOH 3T1YQ 3I4NH 1SE8A 4DV1L 5IYCG 3L7ZC 3DLLA 1HR0W 4OO1G 1KL9A 4DUZQ 2K50A 3A0JA 3J80c 4A3JH 4L5TA 1Y1VG 1UE5A 1VQHA 4GLAC 1VQDA 1HNZQ 3HOWH 1KXLA 4UP9A 3J7A5 4A3GG 5K36G 1NTGA 2PNHA 3CPWA 4UP7A 1JT8A 4DPGA 3AQQA 1WOCA 3TS0A 4B3SL 1XMQQ 4LF7L 2PMZE 1X56A 1M90C 1IBMQ 3U58A 1OXVA 1E7ZA 1VQ8A 1JJGA 5C3EG 1Y1VH 3NENA 1N33Q 2JA6G 3IRBA 3A5UA 1S72A 2A19A 2OCEA 3CCMA 3CC2A 4JOIA 3PO2G 3PV0A 4DR3Q 4AYBG 4A3GH 4JI1L 3HOVG 4Y7NH 3HKZG 2A8VA 2CKZB 1IXRA 2R93G 4A3BH 2JEBI 2Q2TA 4GLVB 3UDXA 3L0OA 5E7NA 1LTLA 5ELOA 2RF4A 2GVBA 1G291 3W1BA 1X9NA 1OTCA 2NVXH 2I5MX 4C3JH 5C3EH 4JBKA 4KHPQ 1Q86C 2JA6H 4AYBE 4HJ8A 1CKOA 1JJ2A 5LMNL 3PO2H 3HKZE 1VQ7A 1Z47A 2L15A 3STBD 3J81c
chains in the Genus database with same CATH superfamily
2F0GA 3SXHA 1BKBA 3JAMW 1IOVA 2B29A 4IJLA 4K14A 1SMYD 1WI5A 1X3PA 3NTIA 2A5HA 2QF7A 1J9OA 5KG5A 5IT9W 1ILPA 1LO5D 1TWCH 1W6JA 5CV5A 3L3OC 2KCNA 2JXMB 1QUQB 4P75A 1QILA 3PR5B 2WYOA 3I4LA 5EPKA 2EYMA 4J9OA 3CP0A 4RFBA 4EQNA 1ASYA 3MR6A 2AGQA 4ZUJA 4A3GB 3GV5B 3RB3A 5T14A 3Q0AA 5M5XH 4HR7A 5H1SE 1B4OA 3P1HA 2NU9B 2ZXOA 1B3QA 4CDFC 1V1OA 4IUQA 3T13A 3QZ7A 3GTOA 2DJFC 2Q8TA 1BBXC 2HHHQ 4A3CG 3QOLA 1AH9A 3RGZA 4JI3Q 4PG3A 3HKZB 3GTKH 1NR4A 4DXGA 3TSSA 2OF1A 4OXPA 3MFHA 2ZDGA 4ME6A 2VQEL 2M00A 3PW0A 1SE2A 2UXCH 1E4EA 4TV9F 1I6VC 3JAMc 4LH6A 3Q8DA 4CC6A 3X3MA 1HR0H 1TWCB 3D4DA 2ZTDA 4JI0L 3BYYB 2BA1A 4FXGC 4K0KH 1EU3A 1U0LA 1TXYA 5JUMA 4DV6H 1HCZA 1RTNA 3CPFA 2V1CC 2QDBA 1E2VA 3BAAA 3NHHA 4A3IH 1C0AA 1KNEA 4ECXA 4NDXA 1KC7A 2B2UA 2FK3A 2UUCL 5IP9G 4JI8L 1O7LA 2L4NA 3MZ5A 4OGQC 3JAML 1BGWA 2K33A 1J5EH 5M5XB 2UUAQ 4DV5Q 4A3EH 1PK8A 2FHTA 2QDLA 4LF6Q 2A6EC 4QJFA 2X0SA 3PUZA 1XWEA 4QWEA 2JA5H 1QVCA 1VMPA 1W96A 5FJ8G 2H5XA 3GV7B 2K5DA 2Z0SA 5CR3A 4JG2A 4KMUC 3GTKB 3M3YH 4DV3Q 4JI6L 4C5CA 3BDOA 2F0LA 3D4WA 3DWAA 2E5LH 3OOCA 5KFQA 1WTVA 3URYA 1I7LA 2W9CB 3D6WA 5C4XB 2KBNA 4IUUA 1DOMA 4MN3A 4DV2L 1L1OC 1LTAD 4LUOA 3RF2A 5GAEC 1CKNB 2VR1A 4DV0Q 2EJMA 1E4FT 2B8FA 2RDIA 1PH4A 5HV6A 3GTPA 5C3WA 4A3IB 4OO1I 4B3RL 1HHVA 4LF8H 4RU9A 5JPMC 4RHSA 1BO0A 2EZVA 3A8IE 1V4YA 3RB6A 4A4IA 4A3EB 5M3FH 4GOPC 2YTYA 3H0GH 5ELDA 5I6WA 5KFNA 1SE3A 3R3OA 1DV2A 2JA7B 1LV9A 3RBDA 3KF6A 4LFCL 5KFFA 1LACA 3BABA 2WE6A 1SE4A 2X69A 2VNUD 3Q2OA 1S9FA 5GAGC 2JA5B 4MV4A 4B3SQ 4LF7Q 2XCPA 1D8LA 1JOOA 4QY7A 1LLRD 2Q2UA 3E0JA 2VB3X 3M4IA 3M3YB 3I55A 1B53A 1CZWA 2R7LA 3GIQA 1N9WA 4BWSC 3MXNB 3I72A 1YITA 4BS9A 4CDCC 3WO1A 4ODGA 1UC8A 4FU0A 2HDMA 1FD7D 4O4IF 2YYAA 4JW0A 4YR2A 2W6NA 1TWGA 2PW7A 4IRCA 4EBCA 1HNZH 4ED2A 3R23A 2O5IC 1QWYA 2IL8A 3T1HQ 2IY5B 3I8ZA 1IYVA 1YHBA 1SBBB 1SNQA 1STNA 3H0GB 4O3PA 1T3NA 2PMZB 1IBMH 1LTBD 2UXCL 4BY1G 4GKJL 1N33H 1QG7A 1Q1EA 4L5QA 1K9MC 2DJGC 1PV4A 1CZGA 5C0XI 2KCMA 3HFZB 2C22A 3GTJA 5HURA 4K0KL 1CQIB 4PZ6A 1D2BA 2FFKB 3NXWA 4DV6L 1ZYRC 2NVQH 2A74C 1QVFA 1I5FA 3RLOA 1Y1WG 1H9JA 1Q90A 4G7ZC 1QVGA 4BA1I 5KT7A 2NYZD 1J5EL 3LWUA 1WJJA 5H80A 4DL5A 1STEA 1VS0A 4OONA 2R93B 3CCJA 2IBKA 4DR5Q 5LA6F 4TQRA 2QEJC 1YIJA 2IJ0A 5IGBA 4UY8C 1W6KA 2K01A 3WOEA 2MP1A 5LOVF 3V2TA 3MWEA 2N49A 4RKBA 4B9WA 4CJ2C 2NZ1D 4F4ZA 2QK4A 4N8FA 2B2YC 2I0QA 3E5NA 3GTOH 4MTDA 5M5WH 5J3BA 4KD3A 4DV4Q 4YJ3F 1P16A 2VZAA 5ELBA 1WYDA 1I4GA 4EX5A 2F4VQ 1S0MA 2R92A 3HOXG 1CUKA 1MJCA 1BBWA 2BH2A 2K75A 3G8CA 2R84A 2EYLA 4APMA 1EIHA 2E75C 1JB3A 2JK8A 2HHHH 4LF8L 1BF4A 4G3IA 4JI3H 1JIHA 1EY8A 3IL8A 1W2BA 1S0NA 1GUTA 4OX9Q 1UNNC 4A2AA 4GLXA 4FBUA 2ZXPA 5FD6A 1PTOF 3SR1A 5E4WC 4FF3A 3BG5A 1CSQA 4LWCA 5KEEA 1HQRD 2N8NA 4JI5Q 3U50C 1QCBD 1TY2A 1IBLQ 2EJFC 1S68A 4QCLA 5M9OA 4YWMA 1A8VA 4HR7B 2IX1A 1M7JA 1PRTB 4HYKA 4CKBA 5M5WB 2F52A 1VQPA 1V1PA 4RAYA 4HIDA 5HY6A 1A3VA 5KKNB 3K6OA 2CQYA 2ZTEA 1XTCD 3T53B 5M3MH 3EN2A 3TDQA 2UUAH 4DV5H 1K0RA 5CYUA 2XGTA 1D6EC 2EOTA 1Y1VA 2C2DA 2OH2A 1HNZL 4RNNA 2KHJA 4LF6H 3PW7A 2F0FA 2A6ED 4QB4A 5G3LD 2UXDQ 2OEOA 1I6HH 4NXMH 4R4CA 3M9MB 3H4BA 1HNWQ 2XSCA 4DV3H 4G4KA 4YP3A 1IBML 4M7EA 3GTPH 2JA6A 1N33L 1B2TA 2LS01 5IYCH 5K5PA 2NU7B 4HJ9A 2Q8RE 2L55A 2BQUA 1VQLA 1IHZA 4MV8A 1B7YB 1BQQT 1EZ8A 3QIAA 1B6RA 5KG2A 4DV0H 4HJ7A 4R8UA 4U7CA 4U6PA 2ZJPA 4OWXB 4R4IA 4UPAA 1EQQA 3RZOH 2ASLA 1X3FA 4QWDA 1UEBA 2IHEA 4YCUA 4JUZA 5M3MB 2IP4A 1Q8IA 5FPRA 3KLSA 3MFGA 4HTHA 4IPDA 1YVCA 3H4DA 2KCCA 3AB9A 2L9HA 2K04A 3IFTA 1STAA 4B3SH 4LF7H 2YTVA 3J7ZC 1I6HB 1D5MC 2GLTA 4I7HA 3J80E 1FJGQ 2MJ8A 1TWGH 2NN6H 3LP8A 3GTPB 3G6VA 5HGTA 2Z8LA 3SK5A 5CBAE 4F4WA 2WFWA 1YNNC 2HVQA 4YY3Q 5D65A 2MNAA 2MFIA 1L1OA 4K8IA 4PZ7A 1O78A 4GS3A 1RD9D 2V4DA 2IT1A 4RGMA 1KQSA 3M4OH 1RYRA 1BNZA 1XNQQ 5I9PA 1ICFB 2A73B 2HJWA 2HHHL 3ERSX 3T1HH 4DR6Q 4P73A 4JI3L 1IYJB 3K5LA 3TQTA 3GTJH 2FJ2A 3CCQA 4KV6A 4GOPA 1F2ZA 1VAJA 3EJIA 3PUVA 2V59A 2UVUA 2BOSA 5D3DA 2D62A 4ZCKA 1Y8NB 3TQ1A 3M9BA 2RBMA 3EYYA 4DU9A 1CI3M 1MJEA 2EXZA 2R7DA 3J81E 1TWGB 2QW7A 5T1GA 4BXXH 1D1KA 2EY1A 4NMZA 2WINB 1IL2A 2D0PA 1ONLA 2EYFA 2Z4HA 1AE2A 1ZYRD 5L9XA 3J80W 3QJYA 1FGBD 2JEJA 2XC9A 5KYLA 2CZGA 1PFBA 1TWHB 1SN8A 5JEAG 5I9OA 3M4OB 2UUAL 3RBEA 4DV5L 1JWMD 2D0OA 3BQ1A 4DR5H 3EPGA 4X66Q 3RFCA 4DL3A 4LF6L 4DLKA 4CHTB 3G7LA 2VOBA 2CW0D 1A3UA 3GQBA 2XGQA 1O7ZA 5KG3A 5C1OA 3FEWX 3GTJB 1QB5D 1SNCA 3R5HA 2R92H 3FKIG 1PXUA 1JB7A 3TQYA 4DV3L 1CS0A 4IN3A 2CQAA 4Q0YA 4C1NI 1VQGA 1RDPD 3W5OA 5C1PA 3BVZA 1UWVA 5EBCA 1AN8A 3QR8A 3QWNA 4OWTB 2NTTA 4DAVA 2R87A 4DV4H 1HFGA 2XRQD 4DV2Q 4DK6C 1PH1A 2WTFA 2ZXRA 1PH7A 4H0LC 3AEVA 2PQAA 3G71A 4PMCA 2F4VH 3KXYT 1B04A 5JJZA 1YZ6A 4DV0L 1II3A 4J9LA 2MHVA 3LMLA 3O13A 1K28A 2BQ3A 3BZDB 3DLLA 4DUZQ 2K50A 3J80c 1Q3LA 2ZJTA 3QOJA 1UE5A 3PQIA 1HA5A 1CA6A 4BWGB 3RTXA 3T5LA 1QNKA 3RV3A 4A3GG 1MHWC 3CPWA 4JI5H 2EE1A 2E2DC 5EWEA 3TS0A 3NSWA 1XMQQ 4B3SL 1TY0A 1PTOC 4LF7L 5JVLA 1DZ1A 1IBLH 1M90C 3U58A 2R92B 3MJFA 1VQ8A 1Y1VH 1JOQA 3NENA 3J80L 1GUNA 4IWXA 1LABA 2KEDA 3CCMA 2XIGA 4AYBG 5K36H 4JI1L 5L1IA 4F4XA 1GYFA 4Y7NH 3HKZG 2XGPA 4F4YA 1CHQD 1EY0A 4M9UA 5LP6F 1LTLA 1C4QA 2GVBA 2AUJD 5C3EH 1XYIA 2PZWA 2F0TA 1PYWD 2PYKA 2JA6H 2UVVA 5KX5F 2FMCA 1G8ZD 5EKLA 1MD2D 4B9XA 2GA4B 4L63B 3J81c 3HOVH 2F3VA 3JRXA 3I4OA 1NY4A 1RF2D 4LW1A 1E22A 1EWIA 2YV5A 4IUTA 1Q82C 3HB9A 2XRSD 2UXDH 3R8BA 4JYAQ 5KFTA 3GIIA 1HNWH 3M4YA 5KFSA 1EUCB 1V1PB 4O3SA 5IGGA 1AFPA 3HG9A 4L8JA 2XN9C 3C0FB 4FM9A 2UXBQ 1VQFA 1OXUA 2K32A 3GIDA 5KT6A 2NUCA 1X54A 2F0KA 3T5KA 1N36Q 3HKSA 1S5BD 4DAMA 4ZLTF 2BQRA 2HD3A 3S15H 2RSNA 3A54A 3MVVA 4KTAA 1A2UA 5C4ZA 2R3ZA 3GO5A 4Y7NB 2E2JB 1TWFA 4C3IH 3M7NA 3ETJA 4IO9A 4QIWB 1V1QA 5FO7B 2QCPX 5CV4A 1ESRA 5G3LF 1L0WA 5CMDA 3J7AF 1B9NA 1X3GA 5C3EB 4DR5L 5JJIA 3OSOA 2JA6B 1NBWA 1UE6A 2WAQA 1YNJC 2BCOA 1QZGA 3CQZA 2C2EA 1HRJA 4MNOA 2ENBA 3HOVB 4X6AH 1EEFD 4QWCA 5F9LA 3MEFA 5DM73 2SCUB 5JPNC 2DPJA 1GUWA 4A3IG 4IFDJ 1FJGH 1VQEA 3I7FA 4R8UB 3KTMA 3FMCA 5ELNA 2K14A 3VMMA 4O3OA 1OXSC 4DV4L 4A3EG 2F3IA 3I70A 4RCNA 4YY3H 2HCCA 2JA7G 4O3RA 1I4PA 1YNND 1EY6A 2F4VL 1RYSA 4A3MB 1WTQA 2K28A 3S15B 2JA5G 1JKJB 4JI4Q 1RJPA 2NVYA 4HNTA 3RMHA 3GIPA 4C3IB 5BPHA 2MPMA 4DR6H 2EPBA 4AIMA 4DN4M 3K57A 4EQ5A 3NK9A 4LF5Q 4OX9L 4QWAA 1DM0B 4JI2Q 2VQFQ 1DIKA 3OMCA 5KFWA 4LFAQ 1VMCA 4JI5L 2KJXA 4B3TQ 1EZ1A 1G2TA 4MTKA 4IALA 5ELFA 1IBLL 1K8OA 1UE7A 2EY6A 4HCEA 2J6SA 1WCMB 2IHFA 4ZHQF 2R82A 1WTPA 3VR2A 4ZOLF 4A2BA 1STBA 2VY3A 4M1UB 5FO9B 1HUNA 3H91A 1HJPA 3GV8B 3D3RA 1G2SA 2UUCH 1IBKQ 5BN3A 4NLGA 1G6ZA 4UP8A 4DAPA 3H0GG 3PUXA 1JLLB 2AWOA 4GOPB 5IT9E 4FS2A 2AGOA 2ID0A 5FKAC 3H40A 1I7NA 3WWVA 4DV1Q 3ULLA 3PO3H 3CRKC 3Q8SB 1XPOA 3NUCA 4EFBA 2JEFA 4XYMB 1M6VA 4RB3C 4X66H 4YB8B 1D5ZC 3OW7A 1EYCA 2F0QA 2K5QA 2Q2HA 2X6LA 1PYBA 2H1EA 4CBVA 2L11A 1WTOA 2PPBC 2FP4B 3V4ZA 4K6DA 2UXDL 4GC7A 3S1MH 1HNWL 1EFWA 3PN1A 4QF4A 5A2QW 1GUGA 1AW7A 2LXJA 1G51A 4TRDA 3OSNA 4ZRZA 3A74A 4X3SA 4XT1B 4DV2H 5C44B 3HOZH 3RR5A 3KJPA 4CKCA 3NBHA 4R1JA 1JDEA 2HQLA 5KT3A 1FL0A 4IJHA 2V58A 4I7AA 1JWSD 2ZJQA 4FDBA 1KD1C 3Q24A 4MV6A 2NN6I 3TRZA 1CFMA 1EY4A 4WJ3M 3PVXA 3N41B 3S17H 3EBEA 4I4TF 1Z2OX 4Q44A 2GVAA 3PO3B 4LFCH 3NEMA 5IY0A 2RVLA 4LMQD 2LY7A 4HSVA 2XD4A 5EGTA 1FGUA 4HMIA 4IR1A 3ONAB 3I2ZA 2FPIB 2VS1A 1XMQH 2PQAB 4F88A 3H15A 1CKMA 3GIKA 4KLKA 2W7PA 1PTOD 2ICIA 1S5CD 3S1MB 1A2TA 1FJGL 1KJJA 4DXFA 3F2CA 1I3QA 4K2LA 4DR1Q 1HZCA 4HMJA 3SK6A 4XQQA 1WD0A 4ED6A 3MWDA 2HGSA 3RLFA 2D9UA 1SXTA 4RZRA 2R8GA 4HIKA 3HOZB 2L0CA 4A3BB 1T5EA 1WTHA 4YY3L 1GM5A 1GHKA 3UDGA 1JX4A 1EOVA 5BR8Q 2C28A 1I50A 1ZQ7A 2OT2A 3PF4A 2I87A 2ALZA 1XNQL 1U4RA 4UCRA 4AYBB 3CC4A 2EDGA 1YJWA 4DR6L 2EXDA 2M05A 1K8MA 2IPKD 3ER0A 5A2QL 3OUZA 4LMYA 4ED3A 4KHZA 4JYAH 4APVA 4YWLA 2F0NA 3K80C 1VQOA 4GKJH 1DGSA 5JVH3 3ERQA 1TWFH 5IT9c 4MHEA 4N9PA 1SEBD 3HXLA 4R7RA 1XXGA 1T5XD 2WAQE 2VW9A 1N36H 1HQMC 1PZJD 2AMCB 2YS7A 3CQZH 2NWGA 4YHHQ 4DUYQ 1EYDA 5FOBB 4KKTA 3QZ8A 1SCUB 1JR0D 4IRKA 4Y52H 3SE7A 1NSNS 4FO2A 1STYA 3QG1A 2AU0A 2G9HD 1S03G 5IT9L 2GN5A 4U68A 5E1FA 4X65Q 4QMGA 4FYDA 4X66L 3BVGA 3H20A 1YNJD 4X62Q 2K4KA 4OWWB 4RKLA 2XCLA 1GUSA 3B6YA 4KJOA 3MHBA 2W8LA 1ET9A 4DK1A 3F1ZA 2NVYH 5JVDF 3UFXB 5EKKA 5J2UF 1TWFB 3S2HH 5M3MG 2YRWA 4DA2A 1K8GA 4JV0A 4ULLA 2E74C 4DR2L 2OQKA 1U9RA 3VDYA 3L4JA 2AQ2B 3K58A 4I50F 2RCFA 1CQJB 4A3DH 4B08A 4XQJA 2EYOA 2WAQB 4V0BA 3JSNA 3CQZB 1BXRA 1JMCA 1XTDA 1L0XB 4JI4H 1FVIA 3W3AA 5IE8A 4YIJA 1ZKOA 5F9NA 3VYSA 4DUZL 3HZXA 4YCWA 3DEOA 4KK7A 4CDEC 3I4MH 3F2DA 4LF5H 2W9BA 1Z2PX 2KVMA 4JI2H 1VQJA 2VQFH 2OQ0A 2DGYA 4OIJA 4LFAH 1F9RA 4ME5A 1AZQA 2RGRA 1HZ9A 1MI2A 5EBDA 4B3TH 1G91A 2DZDA 1XMQL 2K1BA 3NPPA 5GQOA 3I12A 5CAEB 3RB4A 1TQOA 4JPBW 4Q8FA 4XZ3B 2W71A 5FLXE 2NVYB 4JI1Q 5C3XA 3L9AX 5KFLA 4JV2A 1D7QA 3RZDH 3OIQA 4DR4Q 2UVWA 2AQ4A 2UVRA 4C5BA 3VR4A 5IYZF 1DONA 3RN5A 4I65A 3BZKA 2YZNA 5CA0F 5JQWA 2B63A 2W57A 5GONF 3M4PA 3T4AC 4MV3A 4C5AA 1TKWB 2DY7A 4J9NA 4JC0A 2R7ZA 5M3FB 1SLJA 3ICEA 2AQ3B 5DG8A 5IGCA 2NN6G 3I4MB 1H95A 4TQSA 3RAXA 3SK8A 2HVSA 4IUNA 1YBYA 4JYAL 5DG7A 4GN4B 1R9TA 3FRPB 4A76A 4PZ8A 5D1OA 2UXBL 2MCTA 2PBZA 3CAMA 5C4HA 1A0IA 3LGJA 2F0WA 5I2XA 1N36L 4ZQ3A 1F77A 1NAPA 2R7FA 3LWEA 1VKZA 3KJOA 3K3PA 4K8JA 3RZDB 5EQ0A 1SYFA 1UC9A 5FLXW 2DNCA 1RHPA 4DF7A 1XMOQ 1C7YA 2ZTCA 4MTNA 4LF4Q 2VUGA 5JVG3 3HBLA 2LSSA 1RODA 2CW0C 2HIVA 2K5HA 1I3QH 4XT3B 3DM3A 4QL5A 2SNMA 5CV8A 2R8JA 5NUCA 3OUUA 2XCAA 4BXXG 3EIVA 3NBHB 1C48A 1TS4A 3H3VC 1I50H 5L1KA 4OIKA 3NTKA 3D0FA 3CF5A 3JAMi 2ATLA 2B2TC 1VQ9A 1JJCB 4DR1H 4RHRA 2YCHA 2F0DA 1K1QA 4XYLB 5EPLA 1JOKA 4HN7A 4QWBA 2PCFB 1EEID 3ZYYX 1I4QA 3GV6A 2NVQB 3HOYH 5IYBH 1JQYD 2W6PA 5A35A 1CQVA 5FD5A 4JI4L 2ZJRA 2AUKA 2WP8J 3BZCA 3PIO3 2VUMA 2XWJB 2R92G 1MGSA 2MUYA 4TV8F 1PTOH 5D3IB 3PR4A 1RTOA 2J6UA 1LTID 5FLXc 4LJZC 3NBIA 5AJ3L 4LF5L 2AHOB 1EOTA 1I3QB 2J6TA 1B70B 5EWGA 4JI2L 4O0AA 2VQFL 2V5AA 3NGDA 4Q8EA 5BN5A 3G6YA 4LFAL 1H9SA 2K6AA 4IPHA 1EY7A 4XXEA 4B3TL 1N8RC 4RB1A 2YTXA 4EBEA 4UAIA 3UDIA 2WKCA 3A8KE 5F2DA 1I50B 2EIFA 3OHXC 3GTOB 1BJTA 2F0PA 2PVPA 2P5ZX 3CCSA 5FLXL 4X3TA 4ECYA 1HPCA 1HFNA 5JH7F 3A55A 1IBKL 4YHHH 5C6AA 4DUYH 1Z6HA 2DY8A 1ZETA 1TS3A 4QW8A 1BR9A 5IWAL 3T5HA 1GGOA 5KFRA 3AFPA 3HOYB 4ECSA 2KCTA 4ZK9B 3OMGA 1C8CA 2E76C 3T1YQ 1E4EB 2IW3A 4DV1L 5LXTF 2B39A 1LT6D 5EJWA 4OO1G 4O42A 2O03A 2EY5A 3Q8RB 4JV1A 1PTOB 4X62H 4RNOA 1Y1VG 1VQHA 1DV1A 1VQDA 1K83A 3TP6A 4EEQA 3UQ8A 3R2IA 5K36G 3CU7A 1T94A 2KHSA 2PNHA 3MA2B 2Z4IA 2IWHA 1AUXA 4DL4A 2J4XA 3VYTA 2DPIA 5C3EG 2OLSA 2JA6G 3A5UA 5DQHA 2OCEA 5KG4A 3A56A 3CC2A 1BXTA 1BCPF 3PV0A 3HOVG 1A6XA 1PX2A 1IXRA 3GILA 4GLVB 1B1ZA 4OHJA 2BDNA 5EZYF 1PFMA 4WRDA 5ELOA 2SDFA 2KUMA 2RF4A 4E6IA 1G291 3K3VA 4KHPQ 4C3JH 1Q86C 5KG6A 4HJ8A 1STHA 4UCSA 3E3XA 4PV1C 5CORA 1GJXA 3GIJA 4OL7A 3Q8QB 3P7JA 4K6LA 4PMBA 3C2PA 1KRSA 4YQWA 4RA8A 4A3MG 3T16A 4DGZA 3OWFA 1B50A 5KFCA 3NELA 2B63H 1VDZA 2TSSA 3F2UA 4C3IG 1SYXB 4LUZA 3TBIB 1S10A 4JI1H 4DR1L 1EYZA 4O2AF 3G6XA 4POGA 2R7ZH 3DM1A 4DR4H 5CA1F 2YYZA 4FF4A 2VA3A 5C0XG 1K3BC 4FP5D 2RHQB 4DFAA 3KF6B 5BR8L 4YR0A 4J6HA 4KY6A 4KN4C 5EDWA 3RZOB 3K5OA 3BJUA 1R9TH 1XPRA 1YNXA 3EFXD 3Q8PB 2UUBQ 2C00A 4EBDA 4PQXA 1S4ZA 3PUYA 2ES2A 1WCMG 2YZGA 3VYUA 4ED7A 1ZEQX 2SOBA 2EY2A 1PLFA 2PO4A 4A3FH 4C3JB 5IYDG 1PHJA 1KJQA 5LMUQ 1O80A 2E2IA 4C2MA 1NE3A 5E4XA 5GADC 1F2MA 1NUCA 4HEDA 3TP7A 3BYTB 4ED1A 3KAJA 4NXNQ 2B63B 2R8IA 1SJHD 3N52A 1A9XA 3FHWA 4CJ0B 1I4XA 4LFBQ 2R7ZB 1A62A 5CV7A 4YHHL 4DUYL 1PH2A 3ORRA 1LYLA 1XMOH 2OTLA 4H13C 4JOIC 4E4TA 4LF4H 3CW2C 2KEEA 1R9TB 4X65L 3MR5A 2C2RA 4DV7Q 3IG0A 2R8HA 5C44G 4J9KA 1S5DD 5D1OB 2X6GA 2XIWA 4X62L 1RIPA 4A3FB 1SR3A 1BOSA 1KNAA 1U4MA 4K5WA 1AUVA 2DUDA 4WFN3 2EJGC 3SGIA 3RN2A 3RJ0A 1O7IA 3CKIB 3TN2A 1Q81C 3S16H 2D5DA 4DR2Q 2WB1A 2VUMH 4A3KH 1VQCA 3HOXH 2W9AA 3PO3G 4IR9A 4AQYQ 1W93A 3AU7A 3KHLA 2CWPA 5KG7A 3F8TA 5T1IA 3X3NA 5IGEA 4LNQA 4ME3A 3GP7A 3WOFA 1AP0A 3BG3A 2FPGB 4JBWA 3DUZA 1RJTA 1SYBA 3NQIA 5KNCA 4BY7H 2FMAA 2CHBD 1QNUA 2AKWB 4R8NA 1QZHA 1OWTA 1VBGA 5KNBA 2FK1A 1N56A 4N9TA 4OX9H 1AEXA 1TT2A 5CV9A 4H44C 4FXKC 4ECWA 1PH9A 1M4VA 4ID6A 3HOZG 4A3BG 4GC6A 4ZKCB 4ZI7F 3N43B 1TA8A 4K5VA 3IFDA 3J7AV 4A93H 2DLNA 2B2YA 2EYHA 3F8NA 1DYQA 4P72A 1ULZA 4NKLA 2F3WA 2SNSA 4HQ6A 1UE1A 2B2TA 3S16B 2F0VA 1B3AA 2QYZA 3HOUH 2VUMB 1WR2A 3DWPA 4O2DA 4DR4L 4BA2I 3KYHC 3PGZA 2I5LX 1GOZA 4CKEA 1EIFA 4MTEA 1MBYA 3CVZA 1K83H 1BUVT 4ECTA 3G48A 1NR2A 3OPOA 3T1YH 3OHBA 2FINB 3H94A 1MKHA 2VB2X 1EIGA 1H9SB 4H7BA 2FLPA 4CC5A 3IAYA 2RCNA 3C1EA 1KBLA 2SEBD 3FP9A 1NNXA 3AFQA 1EY9A 3M85A 1K0SA 1D5XC 3VPCA 2XTIA 4B3MQ 1F2LA 2Z6BA 5D8DA 4M8AA 4Q43A 1SRUA 1S0OA 3H09A 4A93B 4RGNA 2JYOA 2D2CC 1Y1VB 1PH5A 4EFEA 3S2DH 1C30A 2ASBA 1N32Q 3G4SA 2R61A 2A69C 3K5IA 2WKDA 1PH3A 3V6JA 4ECZA 5FLMH 1BCPC 1EWHA 3K0YA 1KLUD 1XMOL 3EA6A 1K83B 1H9KA 2RGVA 4DK3C 1PFNA 4A3LH 4LF4L 4KHPH 4O1NA 1SMXA 3E9HA 4IPCA 4J0MA 2BDOA 1E24A 2CH4W 5KFGA 3I91A 2GPWA 3FDTA 2FPPB 1CTMA 1X65A 1TWAA 2F0JA 1A3TA 3T51B 2V4QA 2FKLA 2WAQG 2OXPA 1Q1BA 2QA4A 3TIIA 2W9CA 3ORQA 3V4SA 3MR3A 1E1OA 3GTQA 2Y0SA 4MZ9A 3S14H 3TS2A 2YL2A 3F2BA 2L12A 1CKNA 1ET6A 2Q8IB 4RGOS 4XQNA 1EIYB 5KFPA 5FPOA 1GO3E 2Z1CA 3ULPA 1NCVA 5DEHA 4UCTA 5KGUA 3S2DB 4TSSA 3T5JA 4F8MA 1XNQH 2NTSA 4ILWA 2YZMA 1IW7C 2O2LD 2EYPA 2E2IH 2F0SA 2UUBH 4C2MH 1B44D 2JA7A 5IGFA 3RLNA 4RCOA 5A2QE 2I5HA 5AJ3Q 1Q8KA 2C5CA 4PMWA 4IOCA 1RCVD 4RUAA 1ENAA 5KFIA 1IOWA 3RUPA 4Q45A 1ESFA 1T9HA 4NW2A 4TUYF 3MFYA 3P20A 3CMAA 1Q7YC 3WNZA 2AGPA 3UI2A 5LMUH 2K5WA 2O4XA 1HXYD 1LT5D 1L1OB 2RDJA 3MXNA 4CDDC 1SFOA 2WACA 3FPPA 2ALYB 2VPQA 4IWYA 1Y8PB 5KFVA 3S14B 1PMRA 2I8CA 3Q6SA 4JV5Q 1KJIA 5J2TF 2ASJA 5M3FG 4LUVA 2UU9Q 3I4MG 2AWNA 5IWAQ 4LFBH 5I47A 3T56B 3HRZC 4EGJA 4DR7Q 1YEZA 3R93A 2BE5C 3D6CA 4LH7A 1J6QA 1QE6A 3FPUB 3NP8A 1RK5A 3U4VA 3E6ZX 1JE5A 4FXDA 2OTJA 3SE0A 4MV1A 3T1YL 3N8DA 2WB1E 2IX3A 3ND8A 3PIP3 2E2IB 3GQCA 1ZHSA 5IP7H 4DV7H 4IOAA 2PMZA 4BBRH 4FBTA 2PNRC 2VL6A 4ALPA 2F03A 2NU6B 2E8GA 4HAEA 4TQUS 3STBC 4A75A 2KECA 5D14A 5LYJF 5LL6b 2ZM6Q 4J9SA 3K5HA 4S3SA 4DR2H 4KN7C 3S24A 4X64Q 2NVXA 4EEYA 2W6ZA 1RJQA 4AQYH 4BBSH 1WSCA 1SNMA 1Y8OB 2J0TD 2QILA 4YCVA 1VQ6A 3MWMA 5CB4F 2R93A 3BDLA 1PH8A 4ZQIA 2VQDA 3A7AB 2L1BA 4DUZH 3OHAA 4XYOA 3J7YW 3E9IA 1JC7A 3MAQA 1I94L 1TAEA 3H3VH 4GNXC 4KHPL 1EQVA 3OYYA 4PWQA 1VQAA 1HH2P 2WB1B 1NJIC 4BBRB 3CD6A 2F0EA 1LT4D 1IL8A 1V9PA 1IKLA 1WD1A 4MV9A 3J81i 3KLWA 4NB3A 2JA8H 3KAKA 1K8AC 1M1KC 5JOBA 1E2ZA 3S1RH 1KJ8A 2P0AA 2B2VC 1S5ED 2FXQA 4ED8A 3KHHA 1O75A 3DXJC 3GLKA 4PDBA 4XIGS 1IYUA 3IN5A 3OTOQ 1VCIA 4NPSA 2HVRA 1GKHA 3E0EA 1B9MA 5EKIA 4BBSB 3S9WA 1GD7A 2LXKA 2QEXA 4HIMA 3J81j 3RGXA 1XNRQ 3BQ2A 1GHJA 2UUBL 3QFFA 4V190 2MGSA 1YHQA 3S17B 4YJ2F 3S1QH 1HA6A 1WTWA 2I07B 3BDCA 2Z6KC 4EG0A 3JRWA 1JICA 4JVZA 3MEHA 3BU2A 4FNFA 5LMUL 1PA6A 4J9MA 4PNYA 4B3MH 4RNMA 1EYAA 2UXBH 2NZOA 1L2ZA 4TVAB 3CCLA 2JA8B 3BQ0A 3HOYG 5IYBG 1KLGD 3TREA 1F9QA 3RUZA 1PVOA 3S1RB 2DWCA 1BDOA 2PI2A 4NXNL 3AMUA 5KG0A 2DNEA 4XYQA 3FVQA 3AYHB 4GN3B 1CSPA 3N42B 1N32H 4C3HH 1QOHA 5DAUA 4IHJF 5AFWA 4RB2C 4LFBL 2A69D 4L6TB 4JI7Q 2JA9A 1TWAH 1TS2A 1BCPD 1CHPD 1SNPA 3M9OB 2XVSA 3MR2A 4RGTA 5C4JH 4LK1C 2Y0SE 5C4XH 1Q46A 3GTQH 3CCRA 3Q1KA 2ICEC 4DV7L 5EAYA 2N78A 2V9WA 3MXUA 1YHAA 3S1QB 4N8X1 4I55F 1EY5A 2V4RA 4DK0A 5GAHC 2PN1A 2WDTA 4WJWA 1A15A 3ND9A 4QGUA 3WO0A 3M4QA 4CGYB 4LSXA 4R4OA 4C56C 2R7MA 3KBXA 1SNDA 5KFMA 1X55A 3I3CA 3MTSA 2JA7H 1F2YA 3G6EA 1EWCA 1FNUA 3TP5A 3JC66 3SEBA 3U9OA 2EQSA 4K2KA 1S40A 1JCKB 2FJZA 2R85A 4IFDH 2K5NA 4KHVA 4AQYL 4EGVA 3KHRA 1I6UA 1HNXQ 2JEIA 4NXMQ 1FKAH 1S3OA 2PZTA 1X3QA 4C3HB 5CGKA 3QO2A 5FO8B 2CCZA 4P71A 3KDFA 3KOJA 1IW7D 4G7OC 5I6YA 3GIMA 1LTRD 1TWAB 1SFOH 1EFID 5C4JB 1KAAA 3I4NH 5IYCG 4RZQA 1ENCA 3D4RA 3GTQB 3L7ZC 1HR0W 1KL9A 2Y0SB 1T36A 5DGBA 2W7OA 4A3JH 3PW5A 4L5TA 5IGDA 2RSOA 4IUPA 3HOWH 3V96A 4UP9A 4RAUC 5LHY1 2F4IA 3FDSA 3S2HB 2CW8A 2PMZE 3BA8A 4JV5H 1X56A 1IBKH 4WORA 3PW4A 1OXVA 1E7ZA 1R4PB 4G7HC 1JJGA 5LL6S 2UU9H 5IWAH 4C3JG 3RIZA 1H9MA 3D8GA 1S72A 4DR7H 2A19A 4A3DB 1DJRD 2K03A 5BPFA 4DR3Q 4DV1H 2BE5D 3OIPA 3A8JE 2A8VA 2CKZB 1S5FD 4UCUA 3V05A 4UCVA 1R4QB 3P75A 1CA5A 3UDXA 5E7NA 2B63G 2KOLA 2NVXH 3TP8A 4O2BF 3BJYA 1SFOB 3ITPA 3I4NB 2KSWA 1XX8A 3PO2H 2F0OA 1VQ7A 2L15A 3I73A 3STBD 4A3JB 2R7ZG 2ZM6H 2L5TA 4ZKBB 1V8QA 3TZDA 1UNSA 3D31A 4ABNA 4B3ML 1CT1D 2XWBB 1WTRA 4UHVA 2R93H 1K3RA 3HOWB 1KC8C 1KTKA 4CJ1B 4X64H 1M0TA 3EQLC 5J1ZA 4GKKQ 4LF9Q 1VF5C 3QB3A 3R2TA 5KG1A 3SK4A 2J9GA 1FNVA 3BVMA 4UDUC 1TWHA 1N32L 5C5JA 3MXGA 2F0UA 1VBHA 2A6HC 1NMFA 2M9VA 4XTCS 4O4HF 3K5MA 4A3FG 4J1MA 2LFNA 4J9PA 3K81C 3GTLA 3H6MA 3GTGA 2FLLA 1HR0L 2MQHA 2RDHA 3K0XA 3KK7A 1Y1WA 2K7VA 4P74A 2ATWA 3KUPA 5IOCA 1S97A 3EVQA 5KFZA 1SYGA 3PUWA 1QJOA 2YU9A 3L4KA 2NB0A 2NVXB 3NQTA 3PSIA 1DD2A 2R6FA 2ZT9C 4FVMA 3PF5A 3EROA 4IUVA 1KIXA 4F50A 2E2HA 3LNNA 5I2YA 3PO2B 2IX0A 3K8AA 5DG9A 1FYCA 4DKAC 4P2CB 3VYRA 4OEMB 4EGQA 4MIUA 3PIOA 2EYJA 2HT1A 2MO1A 3OTOH 3KLRA 2NU8B 3N40P 2B3GA 5M5YH 5BR8H 3TIGA 4A3CH 2RHSB 1B33N 1HZBA 5ISRA 3PMFA 2QKIC 3W1GA 1X6OA 5CBEE 4C1NK 1XNRH 2W6OA 3Q23A 2JN4A 1X32A 1PH6A 5JJKA 1KDAA 2E5LL 1PRTF 2PI2E 4IZOA 3S1NH 4GNXA 3JZIA 3UE0A 4RMFA 2VUMG 1MSGA 4A3KG 3V6KA 2LKVA 3FMAA 3V6HA 5KFEA 1PYSB 1EZ6A 1N34Q 2EVBA 1JDBB 3RV4A 2NBFA 2G9DA 3CRLC 5ELEA 2B2VA 4GN5A 2GPSA 4WD3A 1XJVA 2FLNA 4DNTB 2BA0A 2YRXA 4BY7G 1PFSA 5HGQA 5IP9H 1VQNA 3N6XA 4JV5L 1DXMA 4MA5A 2UU9L 4DAYA 5M5YB 2F0IA 2JEAI 4DR7L 4JI7H 4QQBX 4I7ZC 4EYIB 4R4QA 3L2PA 2VA2A 4X65H 4QUCA 2A68C 5J22A 2LMCB 5FJ8H 1SEIA 3VPDA 3BS1A 4A93G 1TS5A 1EL0A 5DQIA 3RAQA 4ZUIA 4QUFA 3DMUA 4YBZB 1SNOA 2W6MA 3S1NB 4Q5VA 2CH4A 2Z6KA 1VQMA 1GLVA 1SYEA 3A5ZB 1KEEA 3HOUG 4KKSA 2ZM6L 3H3VI 1O7YA 3R5FA 1Y14B 3KF8A 3UE1A 2FMMA 5DLQE 4X64L 2K05A 1C9OA 3C46A 4GZYC 1SYDA 1C3OA 1HNXH 1IZ6A 4QIWA 2Z9HA 2WV6D 3U9SA 5KNDA 4MV7A 1G6PA 1AZPA 2ZDHA 1ML0D 2PW5A 2PQEA 4JCVE 2JP1A 3GV3A 2JQOA 1I94Q 3UDFA 3NTHA 2DIKA 4AH6A 4DL6A 5EWFA 4ECQA 4UFZA 5JJLA 2AQ1B 5C0XJ 5ELCA 4HNVA 1WH2A 1ENFA 5LMNQ 1NMGA 3JSLA 5K2MA 1LM0A 1WFQA 2W70A 3GDEA 1OO9B 1K1SA 1V43A 5FLMG 4HJ5A 5KT5A 1JXLA 3KDFB 3MWYW 1GVPA 1BCPB 3OTOL 1RL2A 1I4HA 5KFAA 4G57A 4A3LG 4KY7A 4ECRA 1SDFA 3MC0B 3G6JB 3GTMA 1GUOA 1ZHQA 2W9BB 2CFMA 3SI8A 1SYCA 1YJ9A 4L1KA 2N3SA 4YAJB 2W6QA 4DR3H 4HNUA 3SVMA 1RK6A 4NP5A 2TMPA 1OXTA 1LTTD 1XNRL 2RKSA 3CMEA 4U673 2BR0A 1I4RA 1E1TA 4J15A 4F87A 4H02A 1VQ4A 4BY1H 2RQXA 4O4LF 2N88A 4EQPA 4YR3A 4DL7A 4IURA 2QGQA 1WCMA 1TWHH 3I56A 4J9RA 4DL2A 3K7AH 1F9PA 2H4OA 5JEAJ 3DEPA 3BA9A 2FK2A 2W8KA 4J9QA 2C35B 3GTLH 2CW7A 3GTGH 2VXWA 5GROA 4GKKH 3PCOB 1Y1WH 4LF9H 4RB0A 2NUAB 3C3LA 4OELB 2CVRA 2VQEQ 3NWSA 2YU9H 1SJED 1TR5A 3N44B 1VQBA 2A6HD 3M7GA 4ZYSA 1AE3A 5IODA 4JI7L 2B2WC 1PZKD 4YWKA 5IIFA 4JI0Q 2E2HH 1EU4A 2ASDA 3TINA 4XX0B 4IFDI 1UAPA 1SROA 3MFIA 4ED0A 2BH8A 3U9TA 2R86A 5KFUA 2K5VA 4RAZA 5KT4A 1SAPA 2F0MA 2MO0A 3CCEA 1L2FA 1HUMA 2UUCQ 2OWOA 4BY1B 4JI8Q 1JE4A 4RG1A 5CV6A 1RKNA 4IZ8A 1GSOA 2KENA 3W2DA 5J39A 3K7AB 4L5SA 4HJAA 2F1MA 3TEHB 1LUZA 2WIIB 1B8AA 5KFBA 3FKIA 5KFDA 3CXCA 5FK9C 3PZPA 3GTLB 2JE6I 3GTGB 4RWSC 2K52A 4IQZA 3KFUA 1Y1WB 2HUGA 4R8IA 5IP7G 1HNXL 1EUJA 2WB1G 2DN8A 4JI6Q 2IA6A 4BBRG 4NXML 4FF1A 3Q22A 4HIOA 1JWUD 2YU9B 1PZID 1EQRA 2HIXA 2YW2A 1H9RA 1KABA 4IPGA 1EHIA 1GXDC 3TMEA 2E2HB 5C8YF 3KLSX 5EPJA 3CCVA 5KFKA 1PDQA 3GD7A 2JJQA 1FR3A 1ILQA 1QUQA 2NVTH 5DLGA 1PRTC 2R6GA 1E4GT 4WJ4A 1VQKA 4B3RQ 1M8AA 1W3SA 2A1AA 1N34H 2JSOA 4BBSG 2R8KA 5DM63 1UUPA 3HP3A 4KD4A 3J81W 5BN4A 2HQEA 5DQGA 3CHBD 4JBJA 1ASZA 3VR6A 1SMYC 3CC7A 4X3UA 5I4DA 5KFHA 4LFCQ 4A3KB 3HOXB 1L0YB 3ULJA 2I80A 1OXXK 2R7NA 2J7ZA 3KALA 4AYBA 1CM9A 4GNXB 3VA5A 3ETHA 4RUCA 3E5SA 2KA7A 4DR3L 4OO1H 3HKZA 1RJRA 4BY7B 2JA8G 1P8LA 4Q0FA 2A68D 3VR3A 4LSAA 3RB0A 2B2UC 2E2JH 1TWCA 1CE8A 4QIWE 3K5NA 3N6RA 2NVTB 5KFYA 3CCUA 1E0BA 3MXPA 4TKOB 5KFOA 3EPIA 1MSHA 3SDZA 1YI2A 4DAYB 1KDCA 5C5MA 1EYGA 2FB9A 2C9OA 1ICWA 3T1HL 4FF2A 4GKKL 4L5RC 1IKMA 2RDFA 5DNFA 4O3NA 4LF9L 4ZAIA 1HTLD 1KRTA 3HOUB 2UXCQ 1A63A 4GKJQ 1KAWA 1HR0Q 5LL6X 1I94H 3SHLA 5HBRB 3HGBA 2XNAC 1D1IA 3LWBA 4K0KQ 4KJNA 4HSPA 3ZJYC 4MA0A 3GTKA 4KKUA 2M2LA 2ZDQA 2CWAA 2FE3A 4QW9A 1N48A 4DV6Q 2R7KA 3R5XA 3OSPA 4POFA 1VQ5A 1VQIA 3J81L 3KF8B 4A3MH 1LTSD 4KI0A 1MIUA 3RNUA 5KFJA 4O3QA 1J5EQ 5LMNH 2KHIA 4JBMA 3GTMH 4C3HG 3U4ZA 3OW2A 4EVOA 1Z7TA 1KHIA 2PZUA 2RA4A 2JEGA 5KIXA 4R4TA 5C0XH 1U4LA 5C4XG 1BVSA 1Z9FA 2F0HA 2Y0SG 3DF7A 2Q2IA 1SSOA 1UEAB 2RDGA 4YAKB 3KBGA 3M9NB 5DLFA 3K7UC 1WCMH 5L1JA 4KY5A 2O5JC 2E5LQ 1U5KA 1XPUA 5IYDH 2N55A 4X3KA 2JA5A 1DCZA 5C5LA 1VF7A 1BBUA 2HDLA 1STGA 3DWQA 4Z9CB 1E3PA 3IKJA 4RH6A 1YJNA 4ETSA 1X3EA 5KRUA 4IFDG 1N34L 4A3DG 4LF8Q 2NZHA 1EQTA 3VR5A 2CQOA 4F7XA 1WVLA 2VPSA 4DNIA 3GTMB 4NXNH 3HS0C 1HZAA 1WTXA 5E3FA 3HEJA 5LMNW 1FNWA 3PIPA 5DGAA 1Y69U 4LAAA 3K59A 1CQFA 5JEAH 4XDXA 2VQEH 5JAVA 2B8GA 5L1LA 3I4NG 5KT2A 4JK1C 1K73C 3NE5B 1TU2B 1KJ9A 4A3JG 4JI0H 4MAMA 3C1FA 5C44H 3H0GA 1Q12A 2HCIA 4C2MB 5KYIA 3HOWG 4UCOA 3A7LA 1CK1A 3J80i 3FKIH 1LTGD 5EOYA 3I90A 1F9SA 5CC4A 1SE8A 3JAME 1BNCA 3LX0A 4Y8VB 4ECUA 5COYA 4JI8H 4J8QA 1GSAA 1ZXTA 3A0JA 4K5XA 3NWTA 4GLAC 5L37A 5TSSA 1HNZQ 1JORA 1KXLA 1XDNA 3KHGA 2I46A 3J7A5 1TIID 1KDBA 1NTGA 4UP7A 4IRDA 1J8IA 1JT8A 4DPGA 1LT3D 3AQQA 1WOCA 2YS6A 1MZBA 1U4PA 3DHQA 5D1PA 4EYHB 1HTPA 4R9WA 4ECVA 3J7AK 1IBMQ 4JI6H 3TZUA 1TVXA 2IMWP 1N33Q 3IRBA 5KFXA 1V51A 1Z2NX 3PO2G 4JOIA 1DOLA 2B2WA 3VA7A 4A3GH 1AN7A 3WDNA 4EQOA 2R93G 3RD4A 4DNRB 4A3BH 2JEBI 2Q2TA 1E2WA 3FKIB 3L0OA 1GSHA 1M0WA 3W1BA 1PRTD 1X9NA 1OTCA 4B3RH 2I5MX 4JBKA 1EUDB 2KQ3A 3VPBA 3OWEB 2G5DA 3PW2A 4AYBE 4WBNF 4IAJA 1CKOA 4HCSA 1JJ2A 1DOKA 5LMNL 4FS1A 5BMVF 3HKZE 1B6SA 1Z47A
chains in the Genus database with same CATH topology
3HOVH 1BKBA 1NY4A 3I4OA 4LW1A 4B3ML 1E22A 1EWIA 2B29A 2YV5A 3D31A 4IJLA 1KRSA 1WI5A 1K3RA 1Q82C 4A3MG 1KC8C 4JYAQ 3NELA 2B63H 4GKKQ 4LF9Q 4LUZA 1TWCH 2UXBQ 4DR1L 1VQFA 1N32L 1OXUA 1QUQB 4P75A 4POGA 2R7ZH 1NMFA 4XTCS 1X54A 2YYZA 4A3FG 5C0XG 3K81C 1N36Q 3CP0A 3HKSA 4DAMA 1ASYA 2RHQB 3KF6B 5BR8L 3S15H 1HR0L 2MQHA 3K0XA 3BJUA 1R9TH 3GO5A 1YNXA 4P74A 1XPRA 4C3IH 2UUBQ 3M7NA 2ATWA 4IO9A 3PUYA 5M5XH 1V1QA 3PUWA 1WCMG 5H1SE 2ES2A 1L0WA 4A3FH 3PSIA 1X3GA 5JJIA 4DR5L 5IYDG 3PF5A 2HHHQ 1PHJA 4A3CG 1NBWA 1UE6A 1KIXA 4B3TQ 1AH9A 1QZGA 4JI3Q 5LMUQ 2IX0A 3K8AA 4MNOA 4PG3A 4DKAC 4X6AH 3GTKH 3MEFA 1NE3A 5GADC 4OXPA 3PIOA 2HT1A 2MO1A 2VQEL 4A3IG 4IFDJ 3JAMc 1VQEA 3I7FA 4NXNQ 2B3GA 3Q8DA 5M5YH 5ELNA 2K14A 4A3CH 2RHSB 3FHWA 1OXSC 2ZTDA 1HZBA 4DV4L 2F3IA 4A3EG 2BA1A 4JI0L 3W1GA 4LFBQ 1X6OA 1A62A 1U0LA 1TXYA 4YHHL 4DUYL 1PH2A 2JA7G 1LYLA 2F4VL 3CPFA 2V1CC 5JJKA 1PH6A 2OTLA 4JOIC 2E5LL 4A3IH 1C0AA 2PI2E 2JA5G 4JI4Q 3CW2C 3S1NH 4GNXA 4X65L 2UUCL 3UE0A 4RMFA 4JI8L 5IP9G 4DV7Q 2VUMG 2UUAQ 5C44G 4A3KG 4AIMA 4DV5Q 4A3EH 1PYSB 4EQ5A 4X62L 1N34Q 4LF5Q 1RIPA 4OX9L 1SR3A 4LF6Q 4JI2Q 2DUDA 4QJFA 2VQFQ 3PUZA 4GN5A 3SGIA 4LFAQ 2JA5H 1XJVA 1QVCA 2BA0A 4JI5L 3RN2A 1O7IA 5FJ8G 2H5XA 1PFSA 5HGQA 1Q81C 2Z0SA 5IP9H 4JG2A 4DR2Q 1VQNA 4BY7G 3M3YH 4DV3Q 1IBLL 2VUMH 1UE7A 4JV5L 4JI6L 4A3KH 2IHFA 1VQCA 3HOXH 3PO3G 4AQYQ 2UU9L 2VY3A 2CWPA 2JEAI 4DR7L 4QQBX 3F8TA 1HJPA 4R4QA 3L2PA 4ME3A 4LNQA 1IBKQ 2KBNA 4JBWA 4UP8A 3H0GG 4DV2L 1L1OC 3PUXA 5FJ8H 4LUOA 4BY7H 2AWOA 2AKWB 1CKNB 5GAEC 4GOPB 1QZHA 4A93G 4DV0Q 2ID0A 1PH4A 3WWVA 4DV1Q 4OO1I 3ULLA 3PO3H 4B3RL 1XPOA 2Z6KA 1VQMA 3A5ZB 1PH9A 3HOUG 2Q2HA 3HOZG 4A4IA 1PYBA 4A3BG 5M3FH 2ZM6L 4GOPC 3H3VI 2YTYA 3H0GH 2UXDL 1Y14B 3KF6A 4LFCL 3UE1A 3S1MH 5DLQE 1EFWA 4A93H 4X64L 1HNWL 2VNUD 4P72A 2LXJA 1G51A 5GAGC 1C9OA 4B3SQ 4LF7Q 1UE1A 1D8LA 1IZ6A 4QY7A 3A74A 2Q2UA 3HOUH 1G6PA 3HOZH 3I55A 3RR5A 4O2DA 3KJPA 4DR4L 1N9WA 4R1JA 4BA2I 2HQLA 4JCVE 1FL0A 2JQOA 3KYHC 3PGZA 1I94Q 2I5LX 1EIFA 4IJHA 3MXNB 3UDFA 1K83H 1YITA 2ZJQA 4FDBA 4AH6A 3G48A 1KD1C 2NN6I 3TRZA 1MKHA 4WJ3M 5JJLA 3S17H 3EBEA 2GVAA 5C0XJ 2RCNA 3NEMA 3FP9A 5IY0A 5LMNQ 3AFQA 3T1HQ 3M85A 1FGUA 1NMGA 1LM0A 1WFQA 2IY5B 2XTIA 3GDEA 3I2ZA 4B3MQ 1V43A 1YHBA 2VS1A 5FLMG 4HJ5A 1SRUA 2PQAB 3H15A 3KDFB 1CKMA 4KLKA 1GVPA 3OTOL 1RL2A 1FJGL 1PH5A 4A3LG 2UXCL 4BY1G 3F2CA 4GKJL 3S2DH 4DR1Q 1HZCA 1Q1EA 4L5QA 1K9MC 2ASBA 2CFMA 3G4SA 1N32Q 1YJ9A 1PV4A 2N3SA 3RLFA 5C0XI 2KCMA 3HFZB 4HIKA 4K0KL 1PH3A 4YY3L 4PZ6A 1GM5A 1OXTA 3UDGA 1XNRL 5FLMH 1EOVA 4DV6L 2NVQH 5BR8Q 3CMEA 1XMOL 1QVFA 1I5FA 3RLOA 4DK3C 3PF4A 1E1TA 4A3LH 4J15A 1Y1WG 1VQ4A 4H02A 1QVGA 1SMXA 4BA1I 4BY1H 4LF4L 1XNQL 3E9HA 4IPCA 1J5EL 1WJJA 2QGQA 1E24A 3CC4A 3M4OH 1TWHH 1VS0A 4OONA 3I56A 3K7AH 1YJWA 2EXDA 4DR6L 3CCJA 5JEAJ 4DR5Q 3ER0A 1X65A 4KHZA 4APVA 2C35B 1YIJA 3GTLH 4YWLA 3GTGH 2WAQG 1VQOA 3K80C 1Q1BA 2QA4A 4UY8C 5GROA 1DGSA 3PCOB 1E1OA 1Y1WH 1TWFH 4MZ9A 3S14H 3TS2A 2N49A 3F2BA 5IT9c 1CKNA 2VQEQ 1EIYB 1GO3E 2I0QA 2YU9H 3ULPA 1VQBA 3GTOH 5M5WH 2WAQE 5J3BA 2VW9A 1AE3A 4JI7L 4YWKA 4DV4Q 4JI0Q 2E2HH 2AMCB 1P16A 2VZAA 3CQZH 4YHHQ 4DUYQ 1WYDA 4EX5A 2E2IH 4IFDI 1SROA 4C2MH 2F4VQ 2BH8A 3RLNA 3HOXG 1CUKA 4Y52H 1MJCA 1BBWA 2BH2A 2I5HA 2K5VA 1Q8KA 2K75A 4PMWA 5AJ3Q 4IOCA 3CCEA 2GN5A 2JK8A 1L2FA 2MO0A 4X65Q 2UUCQ 2OWOA 4JI8Q 1T9HA 4RG1A 4X66L 4LF8L 2KENA 3CMAA 1Q7YC 4X62Q 2K4KA 1W2BA 4L5SA 4OWWB 4HJAA 3TEHB 1LUZA 4OX9Q 1B8AA 3B6YA 1L1OB 4GLXA 3CXCA 2JE6I 1CSQA 2ALYB 4LWCA 2N8NA 2K52A 3F1ZA 4JI5Q 3U50C 2NVYH 3KFUA 3S2HH 5IP7G 5M3MG 1IBLQ 1HNXL 1EUJA 2WB1G 1K8GA 4JI6Q 5M3FG 4BBRG 4NXML 4JV5Q 4YWMA 4DR2L 1A8VA 2OQKA 4LUVA 3VDYA 4HIOA 2AWNA 5IWAQ 2UU9Q 2IX1A 3I4MG 1EQRA 2HIXA 4DR7Q 1YEZA 2F52A 1J6QA 1VQPA 4A3DH 4IPGA 4HIDA 5HY6A 3U4VA 1JE5A 2OTJA 3CCVA 3T1YL 1XTDA 1JMCA 3GD7A 2ZTEA 2WB1E 1FVIA 2JJQA 1QUQA 2NVTH 5IP7H 5IE8A 5M3MH 3EN2A 4IOAA 2R6GA 4BBRH 4DUZL 1K0RA 4WJ4A 4YCWA 1VQKA 2XGTA 1W3SA 2A1AA 2VL6A 4ALPA 3I4MH 4B3RQ 4BBSG 3F2DA 1HNZL 2E8GA 4TQUS 2KHJA 3STBC 4A75A 1VQJA 2R7ZG 2OQ0A 4JBJA 1ASZA 2ZM6Q 2DGYA 3CC7A 2UXDQ 1HZ9A 1I6HH 4R4CA 4LFCQ 1XMQL 1HNWQ 3S24A 4X64Q 5GQOA 3ULJA 1IBML 1OXXK 3GTPH 4BBSH 4JI1Q 1N33L 5IYCH 4GNXB 4HJ9A 4YCVA 4DR3L 1VQ6A 2B63G 1D7QA 3RZDH 4DR4Q 1VQLA 1PH8A 1B7YB 2JA8G 1P8LA 3RN5A 3E9IA 3BZKA 4HJ7A 1I94L 3M4PA 2ZJPA 3H3VH 4OWXB 4R4IA 4UPAA 1EQQA 4GNXC 2E2JH 3RZOH 1X3FA 3OYYA 4QIWE 4KHPL 1UEBA 2IHEA 4YCUA 1VQAA 4JC0A 1HH2P 3CCUA 1NJIC 1SLJA 3CD6A 3ICEA 1V9PA 3J81i 2NN6G 3KLWA 4NB3A 2JA8H 1H95A 1YI2A 1K8AC 4DAYB 1M1KC 1YBYA 4JYAL 3S1RH 4IPDA 1EYGA 1YVCA 4GN4B 2FXQA 3T1HL 4GKKL 4L5RC 4A76A 4PZ8A 4LF9L 4XIGS 2YTVA 3J7ZC 2UXBL 1KRTA 3OTOQ 1VCIA 1FJGQ 3CAMA 2UXCQ 1A63A 1TWGH 1A0IA 4NPSA 3LGJA 4GKJQ 1KAWA 1GKHA 3E0EA 1HR0Q 1N36L 1GD7A 2LXKA 2QEXA 2R7FA 4HIMA 3J81j 3KJOA 4K0KQ 2WFWA 3ZJYC 4YY3Q 2MNAA 1XNRQ 2CWAA 2MFIA 4DV6Q 2UUBL 1L1OA 4PZ7A 1XMOQ 1YHQA 4GS3A 4POFA 1VQIA 2IT1A 1C7YA 2ZTCA 3KF8B 4MTNA 4A3MH 1KQSA 1VQ5A 4LF4Q 3S1QH 4KI0A 1MIUA 2LSSA 1XNQQ 2HIVA 2K5HA 3RNUA 3S16H 1I3QH 2Z6KC 1J5EQ 2KHIA 2HHHL 3ERSX 4JBMA 3GTMH 3DM3A 4DR6Q 3BU2A 4P73A 3U4ZA 4QL5A 4JI3L 5LMUL 1IYJB 1PA6A 3OW2A 3GTJH 4GOPA 2NZOA 1KHIA 4TVAB 3CCQA 3CCLA 4BXXG 3EIVA 3NBHB 5IYBG 3HOYG 4R4TA 3TREA 3PUVA 1PVOA 1I50H 3D0FA 3CF5A 5C4XG 2PI2A 1BVSA 4NXNL 3JAMi 2D62A 1VQ9A 1Z9FA 1JJCB 2Y0SG 3M9BA 3AYHB 4GN3B 1CSPA 2Q2IA 4C3HH 1MJEA 2R7DA 3K7UC 1WCMH 4LFBL 2E5LQ 4JI7Q 4BXXH 1U5KA 2JA9A 5IYBH 1IL2A 1TWAH 2D0PA 1XPUA 3HOYH 5IYDH 1AE2A 5C4JH 2Y0SE 5C4XH 4JI4L 1Q46A 3GTQH 2ZJRA 1BBUA 3CCRA 2WP8J 3BZCA 2R92G 1E3PA 1SN8A 5EAYA 5JEAG 2N78A 4DV7L 2UUAL 1YJNA 4DV5L 1YHAA 2D0OA 1X3EA 4IFDG 5FLXc 1N34L 4A3DG 5AJ3L 4LF8Q 4LF5L 2AHOB 2NZHA 4X66Q 2CQOA 4LF6L 1B70B 5GAHC 4JI2L 4DNIA 4O0AA 2VQFL 1HZAA 4QGUA 3M4QA 4LFAL 4R4OA 5LMNW 4IPHA 3PIPA 4B3TL 1N8RC 1X55A 2JA7H 2R92H 2YTXA 3FKIG 3G6EA 1JB7A 3TQYA 3JC66 3UDIA 4DV3L 2EQSA 1S40A 2EIFA 3I4NG 1VQGA 2K5NA 3W5OA 4AQYL 1K73C 1UWVA 2R93H 1HNXQ 4OWTB 4NXMQ 3CCSA 1S3OA 4A3JG 4DV2Q 4DK6C 2CCZA 1PH1A 4P71A 1PH7A 5C44H 1IBKL 1Q12A 2PQAA 3AEVA 3KDFA 3G71A 3HOWG 3KOJA 5IWAL 3J80i 3AFPA 3FKIH 4DV0L 1YZ6A 2KCTA 1SFOH 3T1YQ 3I4NH 1SE8A 4DV1L 5IYCG 3L7ZC 3DLLA 1HR0W 4OO1G 1KL9A 4DUZQ 2K50A 3A0JA 3J80c 4A3JH 4L5TA 1Y1VG 1UE5A 1VQHA 4GLAC 1VQDA 1HNZQ 3HOWH 1KXLA 4UP9A 3J7A5 4A3GG 5K36G 1NTGA 2PNHA 3CPWA 4UP7A 1JT8A 4DPGA 3AQQA 1WOCA 3TS0A 4B3SL 1XMQQ 4LF7L 2PMZE 1X56A 1M90C 1IBMQ 3U58A 1OXVA 1E7ZA 1VQ8A 1JJGA 5C3EG 1Y1VH 3NENA 1N33Q 2JA6G 3IRBA 3A5UA 1S72A 2A19A 2OCEA 3CCMA 3CC2A 4JOIA 3PO2G 3PV0A 4DR3Q 4AYBG 4A3GH 4JI1L 3HOVG 4Y7NH 3HKZG 2A8VA 2CKZB 1IXRA 2R93G 4A3BH 2JEBI 2Q2TA 4GLVB 3UDXA 3L0OA 5E7NA 1LTLA 5ELOA 2RF4A 2GVBA 1G291 3W1BA 1X9NA 1OTCA 2NVXH 2I5MX 4C3JH 5C3EH 4JBKA 4KHPQ 1Q86C 2JA6H 4AYBE 4HJ8A 1CKOA 1JJ2A 5LMNL 3PO2H 3HKZE 1VQ7A 1Z47A 2L15A 3STBD 3J81c
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOV H;  1BKB A;  1NY4 A;  3I4O A;  4LW1 A;  4B3M L;  1E22 A;  1EWI A;  2B29 A;  2YV5 A;  3D31 A;  4IJL A;  1KRS A;  1WI5 A;  1K3R A;  1Q82 C;  4A3M G;  1KC8 C;  4JYA Q;  3NEL A;  2B63 H;  4GKK Q;  4LF9 Q;  4LUZ A;  1TWC H;  2UXB Q;  4DR1 L;  1VQF A;  1N32 L;  1OXU A;  1QUQ B;  4P75 A;  4POG A;  2R7Z H;  1NMF A;  4XTC S;  1X54 A;  2YYZ A;  4A3F G;  5C0X G;  3K81 C;  1N36 Q;  3CP0 A;  3HKS A;  4DAM A;  1ASY A;  2RHQ B;  3KF6 B;  5BR8 L;  3S15 H;  1HR0 L;  2MQH A;  3K0X A;  3BJU A;  1R9T H;  3GO5 A;  1YNX A;  4P74 A;  1XPR A;  4C3I H;  2UUB Q;  3M7N A;  2ATW A;  4IO9 A;  3PUY A;  5M5X H;  1V1Q A;  3PUW A;  1WCM G;  5H1S E;  2ES2 A;  1L0W A;  4A3F H;  3PSI A;  1X3G A;  5JJI A;  4DR5 L;  5IYD G;  3PF5 A;  2HHH Q;  1PHJ A;  4A3C G;  1NBW A;  1UE6 A;  1KIX A;  4B3T Q;  1AH9 A;  1QZG A;  4JI3 Q;  5LMU Q;  2IX0 A;  3K8A A;  4MNO A;  4PG3 A;  4DKA C;  4X6A H;  3GTK H;  3MEF A;  1NE3 A;  5GAD C;  4OXP A;  3PIO A;  2HT1 A;  2MO1 A;  2VQE L;  4A3I G;  4IFD J;  3JAM c;  1VQE A;  3I7F A;  4NXN Q;  2B3G A;  3Q8D A;  5M5Y H;  5ELN A;  2K14 A;  4A3C H;  2RHS B;  3FHW A;  1OXS C;  2ZTD A;  1HZB A;  4DV4 L;  2F3I A;  4A3E G;  2BA1 A;  4JI0 L;  3W1G A;  4LFB Q;  1X6O A;  1A62 A;  1U0L A;  1TXY A;  4YHH L;  4DUY L;  1PH2 A;  2JA7 G;  1LYL A;  2F4V L;  3CPF A;  2V1C C;  5JJK A;  1PH6 A;  2OTL A;  4JOI C;  2E5L L;  4A3I H;  1C0A A;  2PI2 E;  2JA5 G;  4JI4 Q;  3CW2 C;  3S1N H;  4GNX A;  4X65 L;  2UUC L;  3UE0 A;  4RMF A;  4JI8 L;  5IP9 G;  4DV7 Q;  2VUM G;  2UUA Q;  5C44 G;  4A3K G;  4AIM A;  4DV5 Q;  4A3E H;  1PYS B;  4EQ5 A;  4X62 L;  1N34 Q;  4LF5 Q;  1RIP A;  4OX9 L;  1SR3 A;  4LF6 Q;  4JI2 Q;  2DUD A;  4QJF A;  2VQF Q;  3PUZ A;  4GN5 A;  3SGI A;  4LFA Q;  2JA5 H;  1XJV A;  1QVC A;  2BA0 A;  4JI5 L;  3RN2 A;  1O7I A;  5FJ8 G;  2H5X A;  1PFS A;  5HGQ A;  1Q81 C;  2Z0S A;  5IP9 H;  4JG2 A;  4DR2 Q;  1VQN A;  4BY7 G;  3M3Y H;  4DV3 Q;  1IBL L;  2VUM H;  1UE7 A;  4JV5 L;  4JI6 L;  4A3K H;  2IHF A;  1VQC A;  3HOX H;  3PO3 G;  4AQY Q;  2UU9 L;  2VY3 A;  2CWP A;  2JEA I;  4DR7 L;  4QQB X;  3F8T A;  1HJP A;  4R4Q A;  3L2P A;  4ME3 A;  4LNQ A;  1IBK Q;  2KBN A;  4JBW A;  4UP8 A;  3H0G G;  4DV2 L;  1L1O C;  3PUX A;  5FJ8 H;  4LUO A;  4BY7 H;  2AWO A;  2AKW B;  1CKN B;  5GAE C;  4GOP B;  1QZH A;  4A93 G;  4DV0 Q;  2ID0 A;  1PH4 A;  3WWV A;  4DV1 Q;  4OO1 I;  3ULL A;  3PO3 H;  4B3R L;  1XPO A;  2Z6K A;  1VQM A;  3A5Z B;  1PH9 A;  3HOU G;  2Q2H A;  3HOZ G;  4A4I A;  1PYB A;  4A3B G;  5M3F H;  2ZM6 L;  4GOP C;  3H3V I;  2YTY A;  3H0G H;  2UXD L;  1Y14 B;  3KF6 A;  4LFC L;  3UE1 A;  3S1M H;  5DLQ E;  1EFW A;  4A93 H;  4X64 L;  1HNW L;  2VNU D;  4P72 A;  2LXJ A;  1G51 A;  5GAG C;  1C9O A;  4B3S Q;  4LF7 Q;  1UE1 A;  1D8L A;  1IZ6 A;  4QY7 A;  3A74 A;  2Q2U A;  3HOU H;  1G6P A;  3HOZ H;  3I55 A;  3RR5 A;  4O2D A;  3KJP A;  4DR4 L;  1N9W A;  4R1J A;  4BA2 I;  2HQL A;  4JCV E;  1FL0 A;  2JQO A;  3KYH C;  3PGZ A;  1I94 Q;  2I5L X;  1EIF A;  4IJH A;  3MXN B;  3UDF A;  1K83 H;  1YIT A;  2ZJQ A;  4FDB A;  4AH6 A;  3G48 A;  1KD1 C;  2NN6 I;  3TRZ A;  1MKH A;  4WJ3 M;  5JJL A;  3S17 H;  3EBE A;  2GVA A;  5C0X J;  2RCN A;  3NEM A;  3FP9 A;  5IY0 A;  5LMN Q;  3AFQ A;  3T1H Q;  3M85 A;  1FGU A;  1NMG A;  1LM0 A;  1WFQ A;  2IY5 B;  2XTI A;  3GDE A;  3I2Z A;  4B3M Q;  1V43 A;  1YHB A;  2VS1 A;  5FLM G;  4HJ5 A;  1SRU A;  2PQA B;  3H15 A;  3KDF B;  1CKM A;  4KLK A;  1GVP A;  3OTO L;  1RL2 A;  1FJG L;  1PH5 A;  4A3L G;  2UXC L;  4BY1 G;  3F2C A;  4GKJ L;  3S2D H;  4DR1 Q;  1HZC A;  1Q1E A;  4L5Q A;  1K9M C;  2ASB A;  2CFM A;  3G4S A;  1N32 Q;  1YJ9 A;  1PV4 A;  2N3S A;  3RLF A;  5C0X I;  2KCM A;  3HFZ B;  4HIK A;  4K0K L;  1PH3 A;  4YY3 L;  4PZ6 A;  1GM5 A;  1OXT A;  3UDG A;  1XNR L;  5FLM H;  1EOV A;  4DV6 L;  2NVQ H;  5BR8 Q;  3CME A;  1XMO L;  1QVF A;  1I5F A;  3RLO A;  4DK3 C;  3PF4 A;  1E1T A;  4A3L H;  4J15 A;  1Y1W G;  1VQ4 A;  4H02 A;  1QVG A;  1SMX A;  4BA1 I;  4BY1 H;  4LF4 L;  1XNQ L;  3E9H A;  4IPC A;  1J5E L;  1WJJ A;  2QGQ A;  1E24 A;  3CC4 A;  3M4O H;  1TWH H;  1VS0 A;  4OON A;  3I56 A;  3K7A H;  1YJW A;  2EXD A;  4DR6 L;  3CCJ A;  5JEA J;  4DR5 Q;  3ER0 A;  1X65 A;  4KHZ A;  4APV A;  2C35 B;  1YIJ A;  3GTL H;  4YWL A;  3GTG H;  2WAQ G;  1VQO A;  3K80 C;  1Q1B A;  2QA4 A;  4UY8 C;  5GRO A;  1DGS A;  3PCO B;  1E1O A;  1Y1W H;  1TWF H;  4MZ9 A;  3S14 H;  3TS2 A;  2N49 A;  3F2B A;  5IT9 c;  1CKN A;  2VQE Q;  1EIY B;  1GO3 E;  2I0Q A;  2YU9 H;  3ULP A;  1VQB A;  3GTO H;  5M5W H;  2WAQ E;  5J3B A;  2VW9 A;  1AE3 A;  4JI7 L;  4YWK A;  4DV4 Q;  4JI0 Q;  2E2H H;  2AMC B;  1P16 A;  2VZA A;  3CQZ H;  4YHH Q;  4DUY Q;  1WYD A;  4EX5 A;  2E2I H;  4IFD I;  1SRO A;  4C2M H;  2F4V Q;  2BH8 A;  3RLN A;  3HOX G;  1CUK A;  4Y52 H;  1MJC A;  1BBW A;  2BH2 A;  2I5H A;  2K5V A;  1Q8K A;  2K75 A;  4PMW A;  5AJ3 Q;  4IOC A;  3CCE A;  2GN5 A;  2JK8 A;  1L2F A;  2MO0 A;  4X65 Q;  2UUC Q;  2OWO A;  4JI8 Q;  1T9H A;  4RG1 A;  4X66 L;  4LF8 L;  2KEN A;  3CMA A;  1Q7Y C;  4X62 Q;  2K4K A;  1W2B A;  4L5S A;  4OWW B;  4HJA A;  3TEH B;  1LUZ A;  4OX9 Q;  1B8A A;  3B6Y A;  1L1O B;  4GLX A;  3CXC A;  2JE6 I;  1CSQ A;  2ALY B;  4LWC A;  2N8N A;  2K52 A;  3F1Z A;  4JI5 Q;  3U50 C;  2NVY H;  3KFU A;  3S2H H;  5IP7 G;  5M3M G;  1IBL Q;  1HNX L;  1EUJ A;  2WB1 G;  1K8G A;  4JI6 Q;  5M3F G;  4BBR G;  4NXM L;  4JV5 Q;  4YWM A;  4DR2 L;  1A8V A;  2OQK A;  4LUV A;  3VDY A;  4HIO A;  2AWN A;  5IWA Q;  2UU9 Q;  2IX1 A;  3I4M G;  1EQR A;  2HIX A;  4DR7 Q;  1YEZ A;  2F52 A;  1J6Q A;  1VQP A;  4A3D H;  4IPG A;  4HID A;  5HY6 A;  3U4V A;  1JE5 A;  2OTJ A;  3CCV A;  3T1Y L;  1XTD A;  1JMC A;  3GD7 A;  2ZTE A;  2WB1 E;  1FVI A;  2JJQ A;  1QUQ A;  2NVT H;  5IP7 H;  5IE8 A;  5M3M H;  3EN2 A;  4IOA A;  2R6G A;  4BBR H;  4DUZ L;  1K0R A;  4WJ4 A;  4YCW A;  1VQK A;  2XGT A;  1W3S A;  2A1A A;  2VL6 A;  4ALP A;  3I4M H;  4B3R Q;  4BBS G;  3F2D A;  1HNZ L;  2E8G A;  4TQU S;  2KHJ A;  3STB C;  4A75 A;  1VQJ A;  2R7Z G;  2OQ0 A;  4JBJ A;  1ASZ A;  2ZM6 Q;  2DGY A;  3CC7 A;  2UXD Q;  1HZ9 A;  1I6H H;  4R4C A;  4LFC Q;  1XMQ L;  1HNW Q;  3S24 A;  4X64 Q;  5GQO A;  3ULJ A;  1IBM L;  1OXX K;  3GTP H;  4BBS H;  4JI1 Q;  1N33 L;  5IYC H;  4GNX B;  4HJ9 A;  4YCV A;  4DR3 L;  1VQ6 A;  2B63 G;  1D7Q A;  3RZD H;  4DR4 Q;  1VQL A;  1PH8 A;  1B7Y B;  2JA8 G;  1P8L A;  3RN5 A;  3E9I A;  3BZK A;  4HJ7 A;  1I94 L;  3M4P A;  2ZJP A;  3H3V H;  4OWX B;  4R4I A;  4UPA A;  1EQQ A;  4GNX C;  2E2J H;  3RZO H;  1X3F A;  3OYY A;  4QIW E;  4KHP L;  1UEB A;  2IHE A;  4YCU A;  1VQA A;  4JC0 A;  1HH2 P;  3CCU A;  1NJI C;  1SLJ A;  3CD6 A;  3ICE A;  1V9P A;  3J81 i;  2NN6 G;  3KLW A;  4NB3 A;  2JA8 H;  1H95 A;  1YI2 A;  1K8A C;  4DAY B;  1M1K C;  1YBY A;  4JYA L;  3S1R H;  4IPD A;  1EYG A;  1YVC A;  4GN4 B;  2FXQ A;  3T1H L;  4GKK L;  4L5R C;  4A76 A;  4PZ8 A;  4LF9 L;  4XIG S;  2YTV A;  3J7Z C;  2UXB L;  1KRT A;  3OTO Q;  1VCI A;  1FJG Q;  3CAM A;  2UXC Q;  1A63 A;  1TWG H;  1A0I A;  4NPS A;  3LGJ A;  4GKJ Q;  1KAW A;  1GKH A;  3E0E A;  1HR0 Q;  1N36 L;  1GD7 A;  2LXK A;  2QEX A;  2R7F A;  4HIM A;  3J81 j;  3KJO A;  4K0K Q;  2WFW A;  3ZJY C;  4YY3 Q;  2MNA A;  1XNR Q;  2CWA A;  2MFI A;  4DV6 Q;  2UUB L;  1L1O A;  4PZ7 A;  1XMO Q;  1YHQ A;  4GS3 A;  4POF A;  1VQI A;  2IT1 A;  1C7Y A;  2ZTC A;  3KF8 B;  4MTN A;  4A3M H;  1KQS A;  1VQ5 A;  4LF4 Q;  3S1Q H;  4KI0 A;  1MIU A;  2LSS A;  1XNQ Q;  2HIV A;  2K5H A;  3RNU A;  3S16 H;  1I3Q H;  2Z6K C;  1J5E Q;  2KHI A;  2HHH L;  3ERS X;  4JBM A;  3GTM H;  3DM3 A;  4DR6 Q;  3BU2 A;  4P73 A;  3U4Z A;  4QL5 A;  4JI3 L;  5LMU L;  1IYJ B;  1PA6 A;  3OW2 A;  3GTJ H;  4GOP A;  2NZO A;  1KHI A;  4TVA B;  3CCQ A;  3CCL A;  4BXX G;  3EIV A;  3NBH B;  5IYB G;  3HOY G;  4R4T A;  3TRE A;  3PUV A;  1PVO A;  1I50 H;  3D0F A;  3CF5 A;  5C4X G;  2PI2 A;  1BVS A;  4NXN L;  3JAM i;  2D62 A;  1VQ9 A;  1Z9F A;  1JJC B;  2Y0S G;  3M9B A;  3AYH B;  4GN3 B;  1CSP A;  2Q2I A;  4C3H H;  1MJE A;  2R7D A;  3K7U C;  1WCM H;  4LFB L;  2E5L Q;  4JI7 Q;  4BXX H;  1U5K A;  2JA9 A;  5IYB H;  1IL2 A;  1TWA H;  2D0P A;  1XPU A;  3HOY H;  5IYD H;  1AE2 A;  5C4J H;  2Y0S E;  5C4X H;  4JI4 L;  1Q46 A;  3GTQ H;  2ZJR A;  1BBU A;  3CCR A;  2WP8 J;  3BZC A;  2R92 G;  1E3P A;  1SN8 A;  5EAY A;  5JEA G;  2N78 A;  4DV7 L;  2UUA L;  1YJN A;  4DV5 L;  1YHA A;  2D0O A;  1X3E A;  4IFD G;  5FLX c;  1N34 L;  4A3D G;  5AJ3 L;  4LF8 Q;  4LF5 L;  2AHO B;  2NZH A;  4X66 Q;  2CQO A;  4LF6 L;  1B70 B;  5GAH C;  4JI2 L;  4DNI A;  4O0A A;  2VQF L;  1HZA A;  4QGU A;  3M4Q A;  4LFA L;  4R4O A;  5LMN W;  4IPH A;  3PIP A;  4B3T L;  1N8R C;  1X55 A;  2JA7 H;  2R92 H;  2YTX A;  3FKI G;  3G6E A;  1JB7 A;  3TQY A;  3JC6 6;  3UDI A;  4DV3 L;  2EQS A;  1S40 A;  2EIF A;  3I4N G;  1VQG A;  2K5N A;  3W5O A;  4AQY L;  1K73 C;  1UWV A;  2R93 H;  1HNX Q;  4OWT B;  4NXM Q;  3CCS A;  1S3O A;  4A3J G;  4DV2 Q;  4DK6 C;  2CCZ A;  1PH1 A;  4P71 A;  1PH7 A;  5C44 H;  1IBK L;  1Q12 A;  2PQA A;  3AEV A;  3KDF A;  3G71 A;  3HOW G;  3KOJ A;  5IWA L;  3J80 i;  3AFP A;  3FKI H;  4DV0 L;  1YZ6 A;  2KCT A;  1SFO H;  3T1Y Q;  3I4N H;  1SE8 A;  4DV1 L;  5IYC G;  3L7Z C;  3DLL A;  1HR0 W;  4OO1 G;  1KL9 A;  4DUZ Q;  2K50 A;  3A0J A;  3J80 c;  4A3J H;  4L5T A;  1Y1V G;  1UE5 A;  1VQH A;  4GLA C;  1VQD A;  1HNZ Q;  3HOW H;  1KXL A;  4UP9 A;  3J7A 5;  4A3G G;  5K36 G;  1NTG A;  2PNH A;  3CPW A;  4UP7 A;  1JT8 A;  4DPG A;  3AQQ A;  1WOC A;  3TS0 A;  4B3S L;  1XMQ Q;  4LF7 L;  2PMZ E;  1X56 A;  1M90 C;  1IBM Q;  3U58 A;  1OXV A;  1E7Z A;  1VQ8 A;  1JJG A;  5C3E G;  1Y1V H;  3NEN A;  1N33 Q;  2JA6 G;  3IRB A;  3A5U A;  1S72 A;  2A19 A;  2OCE A;  3CCM A;  3CC2 A;  4JOI A;  3PO2 G;  3PV0 A;  4DR3 Q;  4AYB G;  4A3G H;  4JI1 L;  3HOV G;  4Y7N H;  3HKZ G;  2A8V A;  2CKZ B;  1IXR A;  2R93 G;  4A3B H;  2JEB I;  2Q2T A;  4GLV B;  3UDX A;  3L0O A;  5E7N A;  1LTL A;  5ELO A;  2RF4 A;  2GVB A;  1G29 1;  3W1B A;  1X9N A;  1OTC A;  2NVX H;  2I5M X;  4C3J H;  5C3E H;  4JBK A;  4KHP Q;  1Q86 C;  2JA6 H;  4AYB E;  4HJ8 A;  1CKO A;  1JJ2 A;  5LMN L;  3PO2 H;  3HKZ E;  1VQ7 A;  1Z47 A;  2L15 A;  3STB D;  3J81 c; 
#chains in the Genus database with same CATH topology
 2F0G A;  3SXH A;  1BKB A;  3JAM W;  1IOV A;  2B29 A;  4IJL A;  4K14 A;  1SMY D;  1WI5 A;  1X3P A;  3NTI A;  2A5H A;  2QF7 A;  1J9O A;  5KG5 A;  5IT9 W;  1ILP A;  1LO5 D;  1TWC H;  1W6J A;  5CV5 A;  3L3O C;  2KCN A;  2JXM B;  1QUQ B;  4P75 A;  1QIL A;  3PR5 B;  2WYO A;  3I4L A;  5EPK A;  2EYM A;  4J9O A;  3CP0 A;  4RFB A;  4EQN A;  1ASY A;  3MR6 A;  2AGQ A;  4ZUJ A;  4A3G B;  3GV5 B;  3RB3 A;  5T14 A;  3Q0A A;  5M5X H;  4HR7 A;  5H1S E;  1B4O A;  3P1H A;  2NU9 B;  2ZXO A;  1B3Q A;  4CDF C;  1V1O A;  4IUQ A;  3T13 A;  3QZ7 A;  3GTO A;  2DJF C;  2Q8T A;  1BBX C;  2HHH Q;  4A3C G;  3QOL A;  1AH9 A;  3RGZ A;  4JI3 Q;  4PG3 A;  3HKZ B;  3GTK H;  1NR4 A;  4DXG A;  3TSS A;  2OF1 A;  4OXP A;  3MFH A;  2ZDG A;  4ME6 A;  2VQE L;  2M00 A;  3PW0 A;  1SE2 A;  2UXC H;  1E4E A;  4TV9 F;  1I6V C;  3JAM c;  4LH6 A;  3Q8D A;  4CC6 A;  3X3M A;  1HR0 H;  1TWC B;  3D4D A;  2ZTD A;  4JI0 L;  3BYY B;  2BA1 A;  4FXG C;  4K0K H;  1EU3 A;  1U0L A;  1TXY A;  5JUM A;  4DV6 H;  1HCZ A;  1RTN A;  3CPF A;  2V1C C;  2QDB A;  1E2V A;  3BAA A;  3NHH A;  4A3I H;  1C0A A;  1KNE A;  4ECX A;  4NDX A;  1KC7 A;  2B2U A;  2FK3 A;  2UUC L;  5IP9 G;  4JI8 L;  1O7L A;  2L4N A;  3MZ5 A;  4OGQ C;  3JAM L;  1BGW A;  2K33 A;  1J5E H;  5M5X B;  2UUA Q;  4DV5 Q;  4A3E H;  1PK8 A;  2FHT A;  2QDL A;  4LF6 Q;  2A6E C;  4QJF A;  2X0S A;  3PUZ A;  1XWE A;  4QWE A;  2JA5 H;  1QVC A;  1VMP A;  1W96 A;  5FJ8 G;  2H5X A;  3GV7 B;  2K5D A;  2Z0S A;  5CR3 A;  4JG2 A;  4KMU C;  3GTK B;  3M3Y H;  4DV3 Q;  4JI6 L;  4C5C A;  3BDO A;  2F0L A;  3D4W A;  3DWA A;  2E5L H;  3OOC A;  5KFQ A;  1WTV A;  3URY A;  1I7L A;  2W9C B;  3D6W A;  5C4X B;  2KBN A;  4IUU A;  1DOM A;  4MN3 A;  4DV2 L;  1L1O C;  1LTA D;  4LUO A;  3RF2 A;  5GAE C;  1CKN B;  2VR1 A;  4DV0 Q;  2EJM A;  1E4F T;  2B8F A;  2RDI A;  1PH4 A;  5HV6 A;  3GTP A;  5C3W A;  4A3I B;  4OO1 I;  4B3R L;  1HHV A;  4LF8 H;  4RU9 A;  5JPM C;  4RHS A;  1BO0 A;  2EZV A;  3A8I E;  1V4Y A;  3RB6 A;  4A4I A;  4A3E B;  5M3F H;  4GOP C;  2YTY A;  3H0G H;  5ELD A;  5I6W A;  5KFN A;  1SE3 A;  3R3O A;  1DV2 A;  2JA7 B;  1LV9 A;  3RBD A;  3KF6 A;  4LFC L;  5KFF A;  1LAC A;  3BAB A;  2WE6 A;  1SE4 A;  2X69 A;  2VNU D;  3Q2O A;  1S9F A;  5GAG C;  2JA5 B;  4MV4 A;  4B3S Q;  4LF7 Q;  2XCP A;  1D8L A;  1JOO A;  4QY7 A;  1LLR D;  2Q2U A;  3E0J A;  2VB3 X;  3M4I A;  3M3Y B;  3I55 A;  1B53 A;  1CZW A;  2R7L A;  3GIQ A;  1N9W A;  4BWS C;  3MXN B;  3I72 A;  1YIT A;  4BS9 A;  4CDC C;  3WO1 A;  4ODG A;  1UC8 A;  4FU0 A;  2HDM A;  1FD7 D;  4O4I F;  2YYA A;  4JW0 A;  4YR2 A;  2W6N A;  1TWG A;  2PW7 A;  4IRC A;  4EBC A;  1HNZ H;  4ED2 A;  3R23 A;  2O5I C;  1QWY A;  2IL8 A;  3T1H Q;  2IY5 B;  3I8Z A;  1IYV A;  1YHB A;  1SBB B;  1SNQ A;  1STN A;  3H0G B;  4O3P A;  1T3N A;  2PMZ B;  1IBM H;  1LTB D;  2UXC L;  4BY1 G;  4GKJ L;  1N33 H;  1QG7 A;  1Q1E A;  4L5Q A;  1K9M C;  2DJG C;  1PV4 A;  1CZG A;  5C0X I;  2KCM A;  3HFZ B;  2C22 A;  3GTJ A;  5HUR A;  4K0K L;  1CQI B;  4PZ6 A;  1D2B A;  2FFK B;  3NXW A;  4DV6 L;  1ZYR C;  2NVQ H;  2A74 C;  1QVF A;  1I5F A;  3RLO A;  1Y1W G;  1H9J A;  1Q90 A;  4G7Z C;  1QVG A;  4BA1 I;  5KT7 A;  2NYZ D;  1J5E L;  3LWU A;  1WJJ A;  5H80 A;  4DL5 A;  1STE A;  1VS0 A;  4OON A;  2R93 B;  3CCJ A;  2IBK A;  4DR5 Q;  5LA6 F;  4TQR A;  2QEJ C;  1YIJ A;  2IJ0 A;  5IGB A;  4UY8 C;  1W6K A;  2K01 A;  3WOE A;  2MP1 A;  5LOV F;  3V2T A;  3MWE A;  2N49 A;  4RKB A;  4B9W A;  4CJ2 C;  2NZ1 D;  4F4Z A;  2QK4 A;  4N8F A;  2B2Y C;  2I0Q A;  3E5N A;  3GTO H;  4MTD A;  5M5W H;  5J3B A;  4KD3 A;  4DV4 Q;  4YJ3 F;  1P16 A;  2VZA A;  5ELB A;  1WYD A;  1I4G A;  4EX5 A;  2F4V Q;  1S0M A;  2R92 A;  3HOX G;  1CUK A;  1MJC A;  1BBW A;  2BH2 A;  2K75 A;  3G8C A;  2R84 A;  2EYL A;  4APM A;  1EIH A;  2E75 C;  1JB3 A;  2JK8 A;  2HHH H;  4LF8 L;  1BF4 A;  4G3I A;  4JI3 H;  1JIH A;  1EY8 A;  3IL8 A;  1W2B A;  1S0N A;  1GUT A;  4OX9 Q;  1UNN C;  4A2A A;  4GLX A;  4FBU A;  2ZXP A;  5FD6 A;  1PTO F;  3SR1 A;  5E4W C;  4FF3 A;  3BG5 A;  1CSQ A;  4LWC A;  5KEE A;  1HQR D;  2N8N A;  4JI5 Q;  3U50 C;  1QCB D;  1TY2 A;  1IBL Q;  2EJF C;  1S68 A;  4QCL A;  5M9O A;  4YWM A;  1A8V A;  4HR7 B;  2IX1 A;  1M7J A;  1PRT B;  4HYK A;  4CKB A;  5M5W B;  2F52 A;  1VQP A;  1V1P A;  4RAY A;  4HID A;  5HY6 A;  1A3V A;  5KKN B;  3K6O A;  2CQY A;  2ZTE A;  1XTC D;  3T53 B;  5M3M H;  3EN2 A;  3TDQ A;  2UUA H;  4DV5 H;  1K0R A;  5CYU A;  2XGT A;  1D6E C;  2EOT A;  1Y1V A;  2C2D A;  2OH2 A;  1HNZ L;  4RNN A;  2KHJ A;  4LF6 H;  3PW7 A;  2F0F A;  2A6E D;  4QB4 A;  5G3L D;  2UXD Q;  2OEO A;  1I6H H;  4NXM H;  4R4C A;  3M9M B;  3H4B A;  1HNW Q;  2XSC A;  4DV3 H;  4G4K A;  4YP3 A;  1IBM L;  4M7E A;  3GTP H;  2JA6 A;  1N33 L;  1B2T A;  2LS0 1;  5IYC H;  5K5P A;  2NU7 B;  4HJ9 A;  2Q8R E;  2L55 A;  2BQU A;  1VQL A;  1IHZ A;  4MV8 A;  1B7Y B;  1BQQ T;  1EZ8 A;  3QIA A;  1B6R A;  5KG2 A;  4DV0 H;  4HJ7 A;  4R8U A;  4U7C A;  4U6P A;  2ZJP A;  4OWX B;  4R4I A;  4UPA A;  1EQQ A;  3RZO H;  2ASL A;  1X3F A;  4QWD A;  1UEB A;  2IHE A;  4YCU A;  4JUZ A;  5M3M B;  2IP4 A;  1Q8I A;  5FPR A;  3KLS A;  3MFG A;  4HTH A;  4IPD A;  1YVC A;  3H4D A;  2KCC A;  3AB9 A;  2L9H A;  2K04 A;  3IFT A;  1STA A;  4B3S H;  4LF7 H;  2YTV A;  3J7Z C;  1I6H B;  1D5M C;  2GLT A;  4I7H A;  3J80 E;  1FJG Q;  2MJ8 A;  1TWG H;  2NN6 H;  3LP8 A;  3GTP B;  3G6V A;  5HGT A;  2Z8L A;  3SK5 A;  5CBA E;  4F4W A;  2WFW A;  1YNN C;  2HVQ A;  4YY3 Q;  5D65 A;  2MNA A;  2MFI A;  1L1O A;  4K8I A;  4PZ7 A;  1O78 A;  4GS3 A;  1RD9 D;  2V4D A;  2IT1 A;  4RGM A;  1KQS A;  3M4O H;  1RYR A;  1BNZ A;  1XNQ Q;  5I9P A;  1ICF B;  2A73 B;  2HJW A;  2HHH L;  3ERS X;  3T1H H;  4DR6 Q;  4P73 A;  4JI3 L;  1IYJ B;  3K5L A;  3TQT A;  3GTJ H;  2FJ2 A;  3CCQ A;  4KV6 A;  4GOP A;  1F2Z A;  1VAJ A;  3EJI A;  3PUV A;  2V59 A;  2UVU A;  2BOS A;  5D3D A;  2D62 A;  4ZCK A;  1Y8N B;  3TQ1 A;  3M9B A;  2RBM A;  3EYY A;  4DU9 A;  1CI3 M;  1MJE A;  2EXZ A;  2R7D A;  3J81 E;  1TWG B;  2QW7 A;  5T1G A;  4BXX H;  1D1K A;  2EY1 A;  4NMZ A;  2WIN B;  1IL2 A;  2D0P A;  1ONL A;  2EYF A;  2Z4H A;  1AE2 A;  1ZYR D;  5L9X A;  3J80 W;  3QJY A;  1FGB D;  2JEJ A;  2XC9 A;  5KYL A;  2CZG A;  1PFB A;  1TWH B;  1SN8 A;  5JEA G;  5I9O A;  3M4O B;  2UUA L;  3RBE A;  4DV5 L;  1JWM D;  2D0O A;  3BQ1 A;  4DR5 H;  3EPG A;  4X66 Q;  3RFC A;  4DL3 A;  4LF6 L;  4DLK A;  4CHT B;  3G7L A;  2VOB A;  2CW0 D;  1A3U A;  3GQB A;  2XGQ A;  1O7Z A;  5KG3 A;  5C1O A;  3FEW X;  3GTJ B;  1QB5 D;  1SNC A;  3R5H A;  2R92 H;  3FKI G;  1PXU A;  1JB7 A;  3TQY A;  4DV3 L;  1CS0 A;  4IN3 A;  2CQA A;  4Q0Y A;  4C1N I;  1VQG A;  1RDP D;  3W5O A;  5C1P A;  3BVZ A;  1UWV A;  5EBC A;  1AN8 A;  3QR8 A;  3QWN A;  4OWT B;  2NTT A;  4DAV A;  2R87 A;  4DV4 H;  1HFG A;  2XRQ D;  4DV2 Q;  4DK6 C;  1PH1 A;  2WTF A;  2ZXR A;  1PH7 A;  4H0L C;  3AEV A;  2PQA A;  3G71 A;  4PMC A;  2F4V H;  3KXY T;  1B04 A;  5JJZ A;  1YZ6 A;  4DV0 L;  1II3 A;  4J9L A;  2MHV A;  3LML A;  3O13 A;  1K28 A;  2BQ3 A;  3BZD B;  3DLL A;  4DUZ Q;  2K50 A;  3J80 c;  1Q3L A;  2ZJT A;  3QOJ A;  1UE5 A;  3PQI A;  1HA5 A;  1CA6 A;  4BWG B;  3RTX A;  3T5L A;  1QNK A;  3RV3 A;  4A3G G;  1MHW C;  3CPW A;  4JI5 H;  2EE1 A;  2E2D C;  5EWE A;  3TS0 A;  3NSW A;  1XMQ Q;  4B3S L;  1TY0 A;  1PTO C;  4LF7 L;  5JVL A;  1DZ1 A;  1IBL H;  1M90 C;  3U58 A;  2R92 B;  3MJF A;  1VQ8 A;  1Y1V H;  1JOQ A;  3NEN A;  3J80 L;  1GUN A;  4IWX A;  1LAB A;  2KED A;  3CCM A;  2XIG A;  4AYB G;  5K36 H;  4JI1 L;  5L1I A;  4F4X A;  1GYF A;  4Y7N H;  3HKZ G;  2XGP A;  4F4Y A;  1CHQ D;  1EY0 A;  4M9U A;  5LP6 F;  1LTL A;  1C4Q A;  2GVB A;  2AUJ D;  5C3E H;  1XYI A;  2PZW A;  2F0T A;  1PYW D;  2PYK A;  2JA6 H;  2UVV A;  5KX5 F;  2FMC A;  1G8Z D;  5EKL A;  1MD2 D;  4B9X A;  2GA4 B;  4L63 B;  3J81 c;  3HOV H;  2F3V A;  3JRX A;  3I4O A;  1NY4 A;  1RF2 D;  4LW1 A;  1E22 A;  1EWI A;  2YV5 A;  4IUT A;  1Q82 C;  3HB9 A;  2XRS D;  2UXD H;  3R8B A;  4JYA Q;  5KFT A;  3GII A;  1HNW H;  3M4Y A;  5KFS A;  1EUC B;  1V1P B;  4O3S A;  5IGG A;  1AFP A;  3HG9 A;  4L8J A;  2XN9 C;  3C0F B;  4FM9 A;  2UXB Q;  1VQF A;  1OXU A;  2K32 A;  3GID A;  5KT6 A;  2NUC A;  1X54 A;  2F0K A;  3T5K A;  1N36 Q;  3HKS A;  1S5B D;  4DAM A;  4ZLT F;  2BQR A;  2HD3 A;  3S15 H;  2RSN A;  3A54 A;  3MVV A;  4KTA A;  1A2U A;  5C4Z A;  2R3Z A;  3GO5 A;  4Y7N B;  2E2J B;  1TWF A;  4C3I H;  3M7N A;  3ETJ A;  4IO9 A;  4QIW B;  1V1Q A;  5FO7 B;  2QCP X;  5CV4 A;  1ESR A;  5G3L F;  1L0W A;  5CMD A;  3J7A F;  1B9N A;  1X3G A;  5C3E B;  4DR5 L;  5JJI A;  3OSO A;  2JA6 B;  1NBW A;  1UE6 A;  2WAQ A;  1YNJ C;  2BCO A;  1QZG A;  3CQZ A;  2C2E A;  1HRJ A;  4MNO A;  2ENB A;  3HOV B;  4X6A H;  1EEF D;  4QWC A;  5F9L A;  3MEF A;  5DM7 3;  2SCU B;  5JPN C;  2DPJ A;  1GUW A;  4A3I G;  4IFD J;  1FJG H;  1VQE A;  3I7F A;  4R8U B;  3KTM A;  3FMC A;  5ELN A;  2K14 A;  3VMM A;  4O3O A;  1OXS C;  4DV4 L;  4A3E G;  2F3I A;  3I70 A;  4RCN A;  4YY3 H;  2HCC A;  2JA7 G;  4O3R A;  1I4P A;  1YNN D;  1EY6 A;  2F4V L;  1RYS A;  4A3M B;  1WTQ A;  2K28 A;  3S15 B;  2JA5 G;  1JKJ B;  4JI4 Q;  1RJP A;  2NVY A;  4HNT A;  3RMH A;  3GIP A;  4C3I B;  5BPH A;  2MPM A;  4DR6 H;  2EPB A;  4AIM A;  4DN4 M;  3K57 A;  4EQ5 A;  3NK9 A;  4LF5 Q;  4OX9 L;  4QWA A;  1DM0 B;  4JI2 Q;  2VQF Q;  1DIK A;  3OMC A;  5KFW A;  4LFA Q;  1VMC A;  4JI5 L;  2KJX A;  4B3T Q;  1EZ1 A;  1G2T A;  4MTK A;  4IAL A;  5ELF A;  1IBL L;  1K8O A;  1UE7 A;  2EY6 A;  4HCE A;  2J6S A;  1WCM B;  2IHF A;  4ZHQ F;  2R82 A;  1WTP A;  3VR2 A;  4ZOL F;  4A2B A;  1STB A;  2VY3 A;  4M1U B;  5FO9 B;  1HUN A;  3H91 A;  1HJP A;  3GV8 B;  3D3R A;  1G2S A;  2UUC H;  1IBK Q;  5BN3 A;  4NLG A;  1G6Z A;  4UP8 A;  4DAP A;  3H0G G;  3PUX A;  1JLL B;  2AWO A;  4GOP B;  5IT9 E;  4FS2 A;  2AGO A;  2ID0 A;  5FKA C;  3H40 A;  1I7N A;  3WWV A;  4DV1 Q;  3ULL A;  3PO3 H;  3CRK C;  3Q8S B;  1XPO A;  3NUC A;  4EFB A;  2JEF A;  4XYM B;  1M6V A;  4RB3 C;  4X66 H;  4YB8 B;  1D5Z C;  3OW7 A;  1EYC A;  2F0Q A;  2K5Q A;  2Q2H A;  2X6L A;  1PYB A;  2H1E A;  4CBV A;  2L11 A;  1WTO A;  2PPB C;  2FP4 B;  3V4Z A;  4K6D A;  2UXD L;  4GC7 A;  3S1M H;  1HNW L;  1EFW A;  3PN1 A;  4QF4 A;  5A2Q W;  1GUG A;  1AW7 A;  2LXJ A;  1G51 A;  4TRD A;  3OSN A;  4ZRZ A;  3A74 A;  4X3S A;  4XT1 B;  4DV2 H;  5C44 B;  3HOZ H;  3RR5 A;  3KJP A;  4CKC A;  3NBH A;  4R1J A;  1JDE A;  2HQL A;  5KT3 A;  1FL0 A;  4IJH A;  2V58 A;  4I7A A;  1JWS D;  2ZJQ A;  4FDB A;  1KD1 C;  3Q24 A;  4MV6 A;  2NN6 I;  3TRZ A;  1CFM A;  1EY4 A;  4WJ3 M;  3PVX A;  3N41 B;  3S17 H;  3EBE A;  4I4T F;  1Z2O X;  4Q44 A;  2GVA A;  3PO3 B;  4LFC H;  3NEM A;  5IY0 A;  2RVL A;  4LMQ D;  2LY7 A;  4HSV A;  2XD4 A;  5EGT A;  1FGU A;  4HMI A;  4IR1 A;  3ONA B;  3I2Z A;  2FPI B;  2VS1 A;  1XMQ H;  2PQA B;  4F88 A;  3H15 A;  1CKM A;  3GIK A;  4KLK A;  2W7P A;  1PTO D;  2ICI A;  1S5C D;  3S1M B;  1A2T A;  1FJG L;  1KJJ A;  4DXF A;  3F2C A;  1I3Q A;  4K2L A;  4DR1 Q;  1HZC A;  4HMJ A;  3SK6 A;  4XQQ A;  1WD0 A;  4ED6 A;  3MWD A;  2HGS A;  3RLF A;  2D9U A;  1SXT A;  4RZR A;  2R8G A;  4HIK A;  3HOZ B;  2L0C A;  4A3B B;  1T5E A;  1WTH A;  4YY3 L;  1GM5 A;  1GHK A;  3UDG A;  1JX4 A;  1EOV A;  5BR8 Q;  2C28 A;  1I50 A;  1ZQ7 A;  2OT2 A;  3PF4 A;  2I87 A;  2ALZ A;  1XNQ L;  1U4R A;  4UCR A;  4AYB B;  3CC4 A;  2EDG A;  1YJW A;  4DR6 L;  2EXD A;  2M05 A;  1K8M A;  2IPK D;  3ER0 A;  5A2Q L;  3OUZ A;  4LMY A;  4ED3 A;  4KHZ A;  4JYA H;  4APV A;  4YWL A;  2F0N A;  3K80 C;  1VQO A;  4GKJ H;  1DGS A;  5JVH 3;  3ERQ A;  1TWF H;  5IT9 c;  4MHE A;  4N9P A;  1SEB D;  3HXL A;  4R7R A;  1XXG A;  1T5X D;  2WAQ E;  2VW9 A;  1N36 H;  1HQM C;  1PZJ D;  2AMC B;  2YS7 A;  3CQZ H;  2NWG A;  4YHH Q;  4DUY Q;  1EYD A;  5FOB B;  4KKT A;  3QZ8 A;  1SCU B;  1JR0 D;  4IRK A;  4Y52 H;  3SE7 A;  1NSN S;  4FO2 A;  1STY A;  3QG1 A;  2AU0 A;  2G9H D;  1S03 G;  5IT9 L;  2GN5 A;  4U68 A;  5E1F A;  4X65 Q;  4QMG A;  4FYD A;  4X66 L;  3BVG A;  3H20 A;  1YNJ D;  4X62 Q;  2K4K A;  4OWW B;  4RKL A;  2XCL A;  1GUS A;  3B6Y A;  4KJO A;  3MHB A;  2W8L A;  1ET9 A;  4DK1 A;  3F1Z A;  2NVY H;  5JVD F;  3UFX B;  5EKK A;  5J2U F;  1TWF B;  3S2H H;  5M3M G;  2YRW A;  4DA2 A;  1K8G A;  4JV0 A;  4ULL A;  2E74 C;  4DR2 L;  2OQK A;  1U9R A;  3VDY A;  3L4J A;  2AQ2 B;  3K58 A;  4I50 F;  2RCF A;  1CQJ B;  4A3D H;  4B08 A;  4XQJ A;  2EYO A;  2WAQ B;  4V0B A;  3JSN A;  3CQZ B;  1BXR A;  1JMC A;  1XTD A;  1L0X B;  4JI4 H;  1FVI A;  3W3A A;  5IE8 A;  4YIJ A;  1ZKO A;  5F9N A;  3VYS A;  4DUZ L;  3HZX A;  4YCW A;  3DEO A;  4KK7 A;  4CDE C;  3I4M H;  3F2D A;  4LF5 H;  2W9B A;  1Z2P X;  2KVM A;  4JI2 H;  1VQJ A;  2VQF H;  2OQ0 A;  2DGY A;  4OIJ A;  4LFA H;  1F9R A;  4ME5 A;  1AZQ A;  2RGR A;  1HZ9 A;  1MI2 A;  5EBD A;  4B3T H;  1G91 A;  2DZD A;  1XMQ L;  2K1B A;  3NPP A;  5GQO A;  3I12 A;  5CAE B;  3RB4 A;  1TQO A;  4JPB W;  4Q8F A;  4XZ3 B;  2W71 A;  5FLX E;  2NVY B;  4JI1 Q;  5C3X A;  3L9A X;  5KFL A;  4JV2 A;  1D7Q A;  3RZD H;  3OIQ A;  4DR4 Q;  2UVW A;  2AQ4 A;  2UVR A;  4C5B A;  3VR4 A;  5IYZ F;  1DON A;  3RN5 A;  4I65 A;  3BZK A;  2YZN A;  5CA0 F;  5JQW A;  2B63 A;  2W57 A;  5GON F;  3M4P A;  3T4A C;  4MV3 A;  4C5A A;  1TKW B;  2DY7 A;  4J9N A;  4JC0 A;  2R7Z A;  5M3F B;  1SLJ A;  3ICE A;  2AQ3 B;  5DG8 A;  5IGC A;  2NN6 G;  3I4M B;  1H95 A;  4TQS A;  3RAX A;  3SK8 A;  2HVS A;  4IUN A;  1YBY A;  4JYA L;  5DG7 A;  4GN4 B;  1R9T A;  3FRP B;  4A76 A;  4PZ8 A;  5D1O A;  2UXB L;  2MCT A;  2PBZ A;  3CAM A;  5C4H A;  1A0I A;  3LGJ A;  2F0W A;  5I2X A;  1N36 L;  4ZQ3 A;  1F77 A;  1NAP A;  2R7F A;  3LWE A;  1VKZ A;  3KJO A;  3K3P A;  4K8J A;  3RZD B;  5EQ0 A;  1SYF A;  1UC9 A;  5FLX W;  2DNC A;  1RHP A;  4DF7 A;  1XMO Q;  1C7Y A;  2ZTC A;  4MTN A;  4LF4 Q;  2VUG A;  5JVG 3;  3HBL A;  2LSS A;  1ROD A;  2CW0 C;  2HIV A;  2K5H A;  1I3Q H;  4XT3 B;  3DM3 A;  4QL5 A;  2SNM A;  5CV8 A;  2R8J A;  5NUC A;  3OUU A;  2XCA A;  4BXX G;  3EIV A;  3NBH B;  1C48 A;  1TS4 A;  3H3V C;  1I50 H;  5L1K A;  4OIK A;  3NTK A;  3D0F A;  3CF5 A;  3JAM i;  2ATL A;  2B2T C;  1VQ9 A;  1JJC B;  4DR1 H;  4RHR A;  2YCH A;  2F0D A;  1K1Q A;  4XYL B;  5EPL A;  1JOK A;  4HN7 A;  4QWB A;  2PCF B;  1EEI D;  3ZYY X;  1I4Q A;  3GV6 A;  2NVQ B;  3HOY H;  5IYB H;  1JQY D;  2W6P A;  5A35 A;  1CQV A;  5FD5 A;  4JI4 L;  2ZJR A;  2AUK A;  2WP8 J;  3BZC A;  3PIO 3;  2VUM A;  2XWJ B;  2R92 G;  1MGS A;  2MUY A;  4TV8 F;  1PTO H;  5D3I B;  3PR4 A;  1RTO A;  2J6U A;  1LTI D;  5FLX c;  4LJZ C;  3NBI A;  5AJ3 L;  4LF5 L;  2AHO B;  1EOT A;  1I3Q B;  2J6T A;  1B70 B;  5EWG A;  4JI2 L;  4O0A A;  2VQF L;  2V5A A;  3NGD A;  4Q8E A;  5BN5 A;  3G6Y A;  4LFA L;  1H9S A;  2K6A A;  4IPH A;  1EY7 A;  4XXE A;  4B3T L;  1N8R C;  4RB1 A;  2YTX A;  4EBE A;  4UAI A;  3UDI A;  2WKC A;  3A8K E;  5F2D A;  1I50 B;  2EIF A;  3OHX C;  3GTO B;  1BJT A;  2F0P A;  2PVP A;  2P5Z X;  3CCS A;  5FLX L;  4X3T A;  4ECY A;  1HPC A;  1HFN A;  5JH7 F;  3A55 A;  1IBK L;  4YHH H;  5C6A A;  4DUY H;  1Z6H A;  2DY8 A;  1ZET A;  1TS3 A;  4QW8 A;  1BR9 A;  5IWA L;  3T5H A;  1GGO A;  5KFR A;  3AFP A;  3HOY B;  4ECS A;  2KCT A;  4ZK9 B;  3OMG A;  1C8C A;  2E76 C;  3T1Y Q;  1E4E B;  2IW3 A;  4DV1 L;  5LXT F;  2B39 A;  1LT6 D;  5EJW A;  4OO1 G;  4O42 A;  2O03 A;  2EY5 A;  3Q8R B;  4JV1 A;  1PTO B;  4X62 H;  4RNO A;  1Y1V G;  1VQH A;  1DV1 A;  1VQD A;  1K83 A;  3TP6 A;  4EEQ A;  3UQ8 A;  3R2I A;  5K36 G;  3CU7 A;  1T94 A;  2KHS A;  2PNH A;  3MA2 B;  2Z4I A;  2IWH A;  1AUX A;  4DL4 A;  2J4X A;  3VYT A;  2DPI A;  5C3E G;  2OLS A;  2JA6 G;  3A5U A;  5DQH A;  2OCE A;  5KG4 A;  3A56 A;  3CC2 A;  1BXT A;  1BCP F;  3PV0 A;  3HOV G;  1A6X A;  1PX2 A;  1IXR A;  3GIL A;  4GLV B;  1B1Z A;  4OHJ A;  2BDN A;  5EZY F;  1PFM A;  4WRD A;  5ELO A;  2SDF A;  2KUM A;  2RF4 A;  4E6I A;  1G29 1;  3K3V A;  4KHP Q;  4C3J H;  1Q86 C;  5KG6 A;  4HJ8 A;  1STH A;  4UCS A;  3E3X A;  4PV1 C;  5COR A;  1GJX A;  3GIJ A;  4OL7 A;  3Q8Q B;  3P7J A;  4K6L A;  4PMB A;  3C2P A;  1KRS A;  4YQW A;  4RA8 A;  4A3M G;  3T16 A;  4DGZ A;  3OWF A;  1B50 A;  5KFC A;  3NEL A;  2B63 H;  1VDZ A;  2TSS A;  3F2U A;  4C3I G;  1SYX B;  4LUZ A;  3TBI B;  1S10 A;  4JI1 H;  4DR1 L;  1EYZ A;  4O2A F;  3G6X A;  4POG A;  2R7Z H;  3DM1 A;  4DR4 H;  5CA1 F;  2YYZ A;  4FF4 A;  2VA3 A;  5C0X G;  1K3B C;  4FP5 D;  2RHQ B;  4DFA A;  3KF6 B;  5BR8 L;  4YR0 A;  4J6H A;  4KY6 A;  4KN4 C;  5EDW A;  3RZO B;  3K5O A;  3BJU A;  1R9T H;  1XPR A;  1YNX A;  3EFX D;  3Q8P B;  2UUB Q;  2C00 A;  4EBD A;  4PQX A;  1S4Z A;  3PUY A;  2ES2 A;  1WCM G;  2YZG A;  3VYU A;  4ED7 A;  1ZEQ X;  2SOB A;  2EY2 A;  1PLF A;  2PO4 A;  4A3F H;  4C3J B;  5IYD G;  1PHJ A;  1KJQ A;  5LMU Q;  1O80 A;  2E2I A;  4C2M A;  1NE3 A;  5E4X A;  5GAD C;  1F2M A;  1NUC A;  4HED A;  3TP7 A;  3BYT B;  4ED1 A;  3KAJ A;  4NXN Q;  2B63 B;  2R8I A;  1SJH D;  3N52 A;  1A9X A;  3FHW A;  4CJ0 B;  1I4X A;  4LFB Q;  2R7Z B;  1A62 A;  5CV7 A;  4YHH L;  4DUY L;  1PH2 A;  3ORR A;  1LYL A;  1XMO H;  2OTL A;  4H13 C;  4JOI C;  4E4T A;  4LF4 H;  3CW2 C;  2KEE A;  1R9T B;  4X65 L;  3MR5 A;  2C2R A;  4DV7 Q;  3IG0 A;  2R8H A;  5C44 G;  4J9K A;  1S5D D;  5D1O B;  2X6G A;  2XIW A;  4X62 L;  1RIP A;  4A3F B;  1SR3 A;  1BOS A;  1KNA A;  1U4M A;  4K5W A;  1AUV A;  2DUD A;  4WFN 3;  2EJG C;  3SGI A;  3RN2 A;  3RJ0 A;  1O7I A;  3CKI B;  3TN2 A;  1Q81 C;  3S16 H;  2D5D A;  4DR2 Q;  2WB1 A;  2VUM H;  4A3K H;  1VQC A;  3HOX H;  2W9A A;  3PO3 G;  4IR9 A;  4AQY Q;  1W93 A;  3AU7 A;  3KHL A;  2CWP A;  5KG7 A;  3F8T A;  5T1I A;  3X3N A;  5IGE A;  4LNQ A;  4ME3 A;  3GP7 A;  3WOF A;  1AP0 A;  3BG3 A;  2FPG B;  4JBW A;  3DUZ A;  1RJT A;  1SYB A;  3NQI A;  5KNC A;  4BY7 H;  2FMA A;  2CHB D;  1QNU A;  2AKW B;  4R8N A;  1QZH A;  1OWT A;  1VBG A;  5KNB A;  2FK1 A;  1N56 A;  4N9T A;  4OX9 H;  1AEX A;  1TT2 A;  5CV9 A;  4H44 C;  4FXK C;  4ECW A;  1PH9 A;  1M4V A;  4ID6 A;  3HOZ G;  4A3B G;  4GC6 A;  4ZKC B;  4ZI7 F;  3N43 B;  1TA8 A;  4K5V A;  3IFD A;  3J7A V;  4A93 H;  2DLN A;  2B2Y A;  2EYH A;  3F8N A;  1DYQ A;  4P72 A;  1ULZ A;  4NKL A;  2F3W A;  2SNS A;  4HQ6 A;  1UE1 A;  2B2T A;  3S16 B;  2F0V A;  1B3A A;  2QYZ A;  3HOU H;  2VUM B;  1WR2 A;  3DWP A;  4O2D A;  4DR4 L;  4BA2 I;  3KYH C;  3PGZ A;  2I5L X;  1GOZ A;  4CKE A;  1EIF A;  4MTE A;  1MBY A;  3CVZ A;  1K83 H;  1BUV T;  4ECT A;  3G48 A;  1NR2 A;  3OPO A;  3T1Y H;  3OHB A;  2FIN B;  3H94 A;  1MKH A;  2VB2 X;  1EIG A;  1H9S B;  4H7B A;  2FLP A;  4CC5 A;  3IAY A;  2RCN A;  3C1E A;  1KBL A;  2SEB D;  3FP9 A;  1NNX A;  3AFQ A;  1EY9 A;  3M85 A;  1K0S A;  1D5X C;  3VPC A;  2XTI A;  4B3M Q;  1F2L A;  2Z6B A;  5D8D A;  4M8A A;  4Q43 A;  1SRU A;  1S0O A;  3H09 A;  4A93 B;  4RGN A;  2JYO A;  2D2C C;  1Y1V B;  1PH5 A;  4EFE A;  3S2D H;  1C30 A;  2ASB A;  1N32 Q;  3G4S A;  2R61 A;  2A69 C;  3K5I A;  2WKD A;  1PH3 A;  3V6J A;  4ECZ A;  5FLM H;  1BCP C;  1EWH A;  3K0Y A;  1KLU D;  1XMO L;  3EA6 A;  1K83 B;  1H9K A;  2RGV A;  4DK3 C;  1PFN A;  4A3L H;  4LF4 L;  4KHP H;  4O1N A;  1SMX A;  3E9H A;  4IPC A;  4J0M A;  2BDO A;  1E24 A;  2CH4 W;  5KFG A;  3I91 A;  2GPW A;  3FDT A;  2FPP B;  1CTM A;  1X65 A;  1TWA A;  2F0J A;  1A3T A;  3T51 B;  2V4Q A;  2FKL A;  2WAQ G;  2OXP A;  1Q1B A;  2QA4 A;  3TII A;  2W9C A;  3ORQ A;  3V4S A;  3MR3 A;  1E1O A;  3GTQ A;  2Y0S A;  4MZ9 A;  3S14 H;  3TS2 A;  2YL2 A;  3F2B A;  2L12 A;  1CKN A;  1ET6 A;  2Q8I B;  4RGO S;  4XQN A;  1EIY B;  5KFP A;  5FPO A;  1GO3 E;  2Z1C A;  3ULP A;  1NCV A;  5DEH A;  4UCT A;  5KGU A;  3S2D B;  4TSS A;  3T5J A;  4F8M A;  1XNQ H;  2NTS A;  4ILW A;  2YZM A;  1IW7 C;  2O2L D;  2EYP A;  2E2I H;  2F0S A;  2UUB H;  4C2M H;  1B44 D;  2JA7 A;  5IGF A;  3RLN A;  4RCO A;  5A2Q E;  2I5H A;  5AJ3 Q;  1Q8K A;  2C5C A;  4PMW A;  4IOC A;  1RCV D;  4RUA A;  1ENA A;  5KFI A;  1IOW A;  3RUP A;  4Q45 A;  1ESF A;  1T9H A;  4NW2 A;  4TUY F;  3MFY A;  3P20 A;  3CMA A;  1Q7Y C;  3WNZ A;  2AGP A;  3UI2 A;  5LMU H;  2K5W A;  2O4X A;  1HXY D;  1LT5 D;  1L1O B;  2RDJ A;  3MXN A;  4CDD C;  1SFO A;  2WAC A;  3FPP A;  2ALY B;  2VPQ A;  4IWY A;  1Y8P B;  5KFV A;  3S14 B;  1PMR A;  2I8C A;  3Q6S A;  4JV5 Q;  1KJI A;  5J2T F;  2ASJ A;  5M3F G;  4LUV A;  2UU9 Q;  3I4M G;  2AWN A;  5IWA Q;  4LFB H;  5I47 A;  3T56 B;  3HRZ C;  4EGJ A;  4DR7 Q;  1YEZ A;  3R93 A;  2BE5 C;  3D6C A;  4LH7 A;  1J6Q A;  1QE6 A;  3FPU B;  3NP8 A;  1RK5 A;  3U4V A;  3E6Z X;  1JE5 A;  4FXD A;  2OTJ A;  3SE0 A;  4MV1 A;  3T1Y L;  3N8D A;  2WB1 E;  2IX3 A;  3ND8 A;  3PIP 3;  2E2I B;  3GQC A;  1ZHS A;  5IP7 H;  4DV7 H;  4IOA A;  2PMZ A;  4BBR H;  4FBT A;  2PNR C;  2VL6 A;  4ALP A;  2F03 A;  2NU6 B;  2E8G A;  4HAE A;  4TQU S;  3STB C;  4A75 A;  2KEC A;  5D14 A;  5LYJ F;  5LL6 b;  2ZM6 Q;  4J9S A;  3K5H A;  4S3S A;  4DR2 H;  4KN7 C;  3S24 A;  4X64 Q;  2NVX A;  4EEY A;  2W6Z A;  1RJQ A;  4AQY H;  4BBS H;  1WSC A;  1SNM A;  1Y8O B;  2J0T D;  2QIL A;  4YCV A;  1VQ6 A;  3MWM A;  5CB4 F;  2R93 A;  3BDL A;  1PH8 A;  4ZQI A;  2VQD A;  3A7A B;  2L1B A;  4DUZ H;  3OHA A;  4XYO A;  3J7Y W;  3E9I A;  1JC7 A;  3MAQ A;  1I94 L;  1TAE A;  3H3V H;  4GNX C;  4KHP L;  1EQV A;  3OYY A;  4PWQ A;  1VQA A;  1HH2 P;  2WB1 B;  1NJI C;  4BBR B;  3CD6 A;  2F0E A;  1LT4 D;  1IL8 A;  1V9P A;  1IKL A;  1WD1 A;  4MV9 A;  3J81 i;  3KLW A;  4NB3 A;  2JA8 H;  3KAK A;  1K8A C;  1M1K C;  5JOB A;  1E2Z A;  3S1R H;  1KJ8 A;  2P0A A;  2B2V C;  1S5E D;  2FXQ A;  4ED8 A;  3KHH A;  1O75 A;  3DXJ C;  3GLK A;  4PDB A;  4XIG S;  1IYU A;  3IN5 A;  3OTO Q;  1VCI A;  4NPS A;  2HVR A;  1GKH A;  3E0E A;  1B9M A;  5EKI A;  4BBS B;  3S9W A;  1GD7 A;  2LXK A;  2QEX A;  4HIM A;  3J81 j;  3RGX A;  1XNR Q;  3BQ2 A;  1GHJ A;  2UUB L;  3QFF A;  4V19 0;  2MGS A;  1YHQ A;  3S17 B;  4YJ2 F;  3S1Q H;  1HA6 A;  1WTW A;  2I07 B;  3BDC A;  2Z6K C;  4EG0 A;  3JRW A;  1JIC A;  4JVZ A;  3MEH A;  3BU2 A;  4FNF A;  5LMU L;  1PA6 A;  4J9M A;  4PNY A;  4B3M H;  4RNM A;  1EYA A;  2UXB H;  2NZO A;  1L2Z A;  4TVA B;  3CCL A;  2JA8 B;  3BQ0 A;  3HOY G;  5IYB G;  1KLG D;  3TRE A;  1F9Q A;  3RUZ A;  1PVO A;  3S1R B;  2DWC A;  1BDO A;  2PI2 A;  4NXN L;  3AMU A;  5KG0 A;  2DNE A;  4XYQ A;  3FVQ A;  3AYH B;  4GN3 B;  1CSP A;  3N42 B;  1N32 H;  4C3H H;  1QOH A;  5DAU A;  4IHJ F;  5AFW A;  4RB2 C;  4LFB L;  2A69 D;  4L6T B;  4JI7 Q;  2JA9 A;  1TWA H;  1TS2 A;  1BCP D;  1CHP D;  1SNP A;  3M9O B;  2XVS A;  3MR2 A;  4RGT A;  5C4J H;  4LK1 C;  2Y0S E;  5C4X H;  1Q46 A;  3GTQ H;  3CCR A;  3Q1K A;  2ICE C;  4DV7 L;  5EAY A;  2N78 A;  2V9W A;  3MXU A;  1YHA A;  3S1Q B;  4N8X 1;  4I55 F;  1EY5 A;  2V4R A;  4DK0 A;  5GAH C;  2PN1 A;  2WDT A;  4WJW A;  1A15 A;  3ND9 A;  4QGU A;  3WO0 A;  3M4Q A;  4CGY B;  4LSX A;  4R4O A;  4C56 C;  2R7M A;  3KBX A;  1SND A;  5KFM A;  1X55 A;  3I3C A;  3MTS A;  2JA7 H;  1F2Y A;  3G6E A;  1EWC A;  1FNU A;  3TP5 A;  3JC6 6;  3SEB A;  3U9O A;  2EQS A;  4K2K A;  1S40 A;  1JCK B;  2FJZ A;  2R85 A;  4IFD H;  2K5N A;  4KHV A;  4AQY L;  4EGV A;  3KHR A;  1I6U A;  1HNX Q;  2JEI A;  4NXM Q;  1FKA H;  1S3O A;  2PZT A;  1X3Q A;  4C3H B;  5CGK A;  3QO2 A;  5FO8 B;  2CCZ A;  4P71 A;  3KDF A;  3KOJ A;  1IW7 D;  4G7O C;  5I6Y A;  3GIM A;  1LTR D;  1TWA B;  1SFO H;  1EFI D;  5C4J B;  1KAA A;  3I4N H;  5IYC G;  4RZQ A;  1ENC A;  3D4R A;  3GTQ B;  3L7Z C;  1HR0 W;  1KL9 A;  2Y0S B;  1T36 A;  5DGB A;  2W7O A;  4A3J H;  3PW5 A;  4L5T A;  5IGD A;  2RSO A;  4IUP A;  3HOW H;  3V96 A;  4UP9 A;  4RAU C;  5LHY 1;  2F4I A;  3FDS A;  3S2H B;  2CW8 A;  2PMZ E;  3BA8 A;  4JV5 H;  1X56 A;  1IBK H;  4WOR A;  3PW4 A;  1OXV A;  1E7Z A;  1R4P B;  4G7H C;  1JJG A;  5LL6 S;  2UU9 H;  5IWA H;  4C3J G;  3RIZ A;  1H9M A;  3D8G A;  1S72 A;  4DR7 H;  2A19 A;  4A3D B;  1DJR D;  2K03 A;  5BPF A;  4DR3 Q;  4DV1 H;  2BE5 D;  3OIP A;  3A8J E;  2A8V A;  2CKZ B;  1S5F D;  4UCU A;  3V05 A;  4UCV A;  1R4Q B;  3P75 A;  1CA5 A;  3UDX A;  5E7N A;  2B63 G;  2KOL A;  2NVX H;  3TP8 A;  4O2B F;  3BJY A;  1SFO B;  3ITP A;  3I4N B;  2KSW A;  1XX8 A;  3PO2 H;  2F0O A;  1VQ7 A;  2L15 A;  3I73 A;  3STB D;  4A3J B;  2R7Z G;  2ZM6 H;  2L5T A;  4ZKB B;  1V8Q A;  3TZD A;  1UNS A;  3D31 A;  4ABN A;  4B3M L;  1CT1 D;  2XWB B;  1WTR A;  4UHV A;  2R93 H;  1K3R A;  3HOW B;  1KC8 C;  1KTK A;  4CJ1 B;  4X64 H;  1M0T A;  3EQL C;  5J1Z A;  4GKK Q;  4LF9 Q;  1VF5 C;  3QB3 A;  3R2T A;  5KG1 A;  3SK4 A;  2J9G A;  1FNV A;  3BVM A;  4UDU C;  1TWH A;  1N32 L;  5C5J A;  3MXG A;  2F0U A;  1VBH A;  2A6H C;  1NMF A;  2M9V A;  4XTC S;  4O4H F;  3K5M A;  4A3F G;  4J1M A;  2LFN A;  4J9P A;  3K81 C;  3GTL A;  3H6M A;  3GTG A;  2FLL A;  1HR0 L;  2MQH A;  2RDH A;  3K0X A;  3KK7 A;  1Y1W A;  2K7V A;  4P74 A;  2ATW A;  3KUP A;  5IOC A;  1S97 A;  3EVQ A;  5KFZ A;  1SYG A;  3PUW A;  1QJO A;  2YU9 A;  3L4K A;  2NB0 A;  2NVX B;  3NQT A;  3PSI A;  1DD2 A;  2R6F A;  2ZT9 C;  4FVM A;  3PF5 A;  3ERO A;  4IUV A;  1KIX A;  4F50 A;  2E2H A;  3LNN A;  5I2Y A;  3PO2 B;  2IX0 A;  3K8A A;  5DG9 A;  1FYC A;  4DKA C;  4P2C B;  3VYR A;  4OEM B;  4EGQ A;  4MIU A;  3PIO A;  2EYJ A;  2HT1 A;  2MO1 A;  3OTO H;  3KLR A;  2NU8 B;  3N40 P;  2B3G A;  5M5Y H;  5BR8 H;  3TIG A;  4A3C H;  2RHS B;  1B33 N;  1HZB A;  5ISR A;  3PMF A;  2QKI C;  3W1G A;  1X6O A;  5CBE E;  4C1N K;  1XNR H;  2W6O A;  3Q23 A;  2JN4 A;  1X32 A;  1PH6 A;  5JJK A;  1KDA A;  2E5L L;  1PRT F;  2PI2 E;  4IZO A;  3S1N H;  4GNX A;  3JZI A;  3UE0 A;  4RMF A;  2VUM G;  1MSG A;  4A3K G;  3V6K A;  2LKV A;  3FMA A;  3V6H A;  5KFE A;  1PYS B;  1EZ6 A;  1N34 Q;  2EVB A;  1JDB B;  3RV4 A;  2NBF A;  2G9D A;  3CRL C;  5ELE A;  2B2V A;  4GN5 A;  2GPS A;  4WD3 A;  1XJV A;  2FLN A;  4DNT B;  2BA0 A;  2YRX A;  4BY7 G;  1PFS A;  5HGQ A;  5IP9 H;  1VQN A;  3N6X A;  4JV5 L;  1DXM A;  4MA5 A;  2UU9 L;  4DAY A;  5M5Y B;  2F0I A;  2JEA I;  4DR7 L;  4JI7 H;  4QQB X;  4I7Z C;  4EYI B;  4R4Q A;  3L2P A;  2VA2 A;  4X65 H;  4QUC A;  2A68 C;  5J22 A;  2LMC B;  5FJ8 H;  1SEI A;  3VPD A;  3BS1 A;  4A93 G;  1TS5 A;  1EL0 A;  5DQI A;  3RAQ A;  4ZUI A;  4QUF A;  3DMU A;  4YBZ B;  1SNO A;  2W6M A;  3S1N B;  4Q5V A;  2CH4 A;  2Z6K A;  1VQM A;  1GLV A;  1SYE A;  3A5Z B;  1KEE A;  3HOU G;  4KKS A;  2ZM6 L;  3H3V I;  1O7Y A;  3R5F A;  1Y14 B;  3KF8 A;  3UE1 A;  2FMM A;  5DLQ E;  4X64 L;  2K05 A;  1C9O A;  3C46 A;  4GZY C;  1SYD A;  1C3O A;  1HNX H;  1IZ6 A;  4QIW A;  2Z9H A;  2WV6 D;  3U9S A;  5KND A;  4MV7 A;  1G6P A;  1AZP A;  2ZDH A;  1ML0 D;  2PW5 A;  2PQE A;  4JCV E;  2JP1 A;  3GV3 A;  2JQO A;  1I94 Q;  3UDF A;  3NTH A;  2DIK A;  4AH6 A;  4DL6 A;  5EWF A;  4ECQ A;  4UFZ A;  5JJL A;  2AQ1 B;  5C0X J;  5ELC A;  4HNV A;  1WH2 A;  1ENF A;  5LMN Q;  1NMG A;  3JSL A;  5K2M A;  1LM0 A;  1WFQ A;  2W70 A;  3GDE A;  1OO9 B;  1K1S A;  1V43 A;  5FLM G;  4HJ5 A;  5KT5 A;  1JXL A;  3KDF B;  3MWY W;  1GVP A;  1BCP B;  3OTO L;  1RL2 A;  1I4H A;  5KFA A;  4G57 A;  4A3L G;  4KY7 A;  4ECR A;  1SDF A;  3MC0 B;  3G6J B;  3GTM A;  1GUO A;  1ZHQ A;  2W9B B;  2CFM A;  3SI8 A;  1SYC A;  1YJ9 A;  4L1K A;  2N3S A;  4YAJ B;  2W6Q A;  4DR3 H;  4HNU A;  3SVM A;  1RK6 A;  4NP5 A;  2TMP A;  1OXT A;  1LTT D;  1XNR L;  2RKS A;  3CME A;  4U67 3;  2BR0 A;  1I4R A;  1E1T A;  4J15 A;  4F87 A;  4H02 A;  1VQ4 A;  4BY1 H;  2RQX A;  4O4L F;  2N88 A;  4EQP A;  4YR3 A;  4DL7 A;  4IUR A;  2QGQ A;  1WCM A;  1TWH H;  3I56 A;  4J9R A;  4DL2 A;  3K7A H;  1F9P A;  2H4O A;  5JEA J;  3DEP A;  3BA9 A;  2FK2 A;  2W8K A;  4J9Q A;  2C35 B;  3GTL H;  2CW7 A;  3GTG H;  2VXW A;  5GRO A;  4GKK H;  3PCO B;  1Y1W H;  4LF9 H;  4RB0 A;  2NUA B;  3C3L A;  4OEL B;  2CVR A;  2VQE Q;  3NWS A;  2YU9 H;  1SJE D;  1TR5 A;  3N44 B;  1VQB A;  2A6H D;  3M7G A;  4ZYS A;  1AE3 A;  5IOD A;  4JI7 L;  2B2W C;  1PZK D;  4YWK A;  5IIF A;  4JI0 Q;  2E2H H;  1EU4 A;  2ASD A;  3TIN A;  4XX0 B;  4IFD I;  1UAP A;  1SRO A;  3MFI A;  4ED0 A;  2BH8 A;  3U9T A;  2R86 A;  5KFU A;  2K5V A;  4RAZ A;  5KT4 A;  1SAP A;  2F0M A;  2MO0 A;  3CCE A;  1L2F A;  1HUM A;  2UUC Q;  2OWO A;  4BY1 B;  4JI8 Q;  1JE4 A;  4RG1 A;  5CV6 A;  1RKN A;  4IZ8 A;  1GSO A;  2KEN A;  3W2D A;  5J39 A;  3K7A B;  4L5S A;  4HJA A;  2F1M A;  3TEH B;  1LUZ A;  2WII B;  1B8A A;  5KFB A;  3FKI A;  5KFD A;  3CXC A;  5FK9 C;  3PZP A;  3GTL B;  2JE6 I;  3GTG B;  4RWS C;  2K52 A;  4IQZ A;  3KFU A;  1Y1W B;  2HUG A;  4R8I A;  5IP7 G;  1HNX L;  1EUJ A;  2WB1 G;  2DN8 A;  4JI6 Q;  2IA6 A;  4BBR G;  4NXM L;  4FF1 A;  3Q22 A;  4HIO A;  1JWU D;  2YU9 B;  1PZI D;  1EQR A;  2HIX A;  2YW2 A;  1H9R A;  1KAB A;  4IPG A;  1EHI A;  1GXD C;  3TME A;  2E2H B;  5C8Y F;  3KLS X;  5EPJ A;  3CCV A;  5KFK A;  1PDQ A;  3GD7 A;  2JJQ A;  1FR3 A;  1ILQ A;  1QUQ A;  2NVT H;  5DLG A;  1PRT C;  2R6G A;  1E4G T;  4WJ4 A;  1VQK A;  4B3R Q;  1M8A A;  1W3S A;  2A1A A;  1N34 H;  2JSO A;  4BBS G;  2R8K A;  5DM6 3;  1UUP A;  3HP3 A;  4KD4 A;  3J81 W;  5BN4 A;  2HQE A;  5DQG A;  3CHB D;  4JBJ A;  1ASZ A;  3VR6 A;  1SMY C;  3CC7 A;  4X3U A;  5I4D A;  5KFH A;  4LFC Q;  4A3K B;  3HOX B;  1L0Y B;  3ULJ A;  2I80 A;  1OXX K;  2R7N A;  2J7Z A;  3KAL A;  4AYB A;  1CM9 A;  4GNX B;  3VA5 A;  3ETH A;  4RUC A;  3E5S A;  2KA7 A;  4DR3 L;  4OO1 H;  3HKZ A;  1RJR A;  4BY7 B;  2JA8 G;  1P8L A;  4Q0F A;  2A68 D;  3VR3 A;  4LSA A;  3RB0 A;  2B2U C;  2E2J H;  1TWC A;  1CE8 A;  4QIW E;  3K5N A;  3N6R A;  2NVT B;  5KFY A;  3CCU A;  1E0B A;  3MXP A;  4TKO B;  5KFO A;  3EPI A;  1MSH A;  3SDZ A;  1YI2 A;  4DAY B;  1KDC A;  5C5M A;  1EYG A;  2FB9 A;  2C9O A;  1ICW A;  3T1H L;  4FF2 A;  4GKK L;  4L5R C;  1IKM A;  2RDF A;  5DNF A;  4O3N A;  4LF9 L;  4ZAI A;  1HTL D;  1KRT A;  3HOU B;  2UXC Q;  1A63 A;  4GKJ Q;  1KAW A;  1HR0 Q;  5LL6 X;  1I94 H;  3SHL A;  5HBR B;  3HGB A;  2XNA C;  1D1I A;  3LWB A;  4K0K Q;  4KJN A;  4HSP A;  3ZJY C;  4MA0 A;  3GTK A;  4KKU A;  2M2L A;  2ZDQ A;  2CWA A;  2FE3 A;  4QW9 A;  1N48 A;  4DV6 Q;  2R7K A;  3R5X A;  3OSP A;  4POF A;  1VQ5 A;  1VQI A;  3J81 L;  3KF8 B;  4A3M H;  1LTS D;  4KI0 A;  1MIU A;  3RNU A;  5KFJ A;  4O3Q A;  1J5E Q;  5LMN H;  2KHI A;  4JBM A;  3GTM H;  4C3H G;  3U4Z A;  3OW2 A;  4EVO A;  1Z7T A;  1KHI A;  2PZU A;  2RA4 A;  2JEG A;  5KIX A;  4R4T A;  5C0X H;  1U4L A;  5C4X G;  1BVS A;  1Z9F A;  2F0H A;  2Y0S G;  3DF7 A;  2Q2I A;  1SSO A;  1UEA B;  2RDG A;  4YAK B;  3KBG A;  3M9N B;  5DLF A;  3K7U C;  1WCM H;  5L1J A;  4KY5 A;  2O5J C;  2E5L Q;  1U5K A;  1XPU A;  5IYD H;  2N55 A;  4X3K A;  2JA5 A;  1DCZ A;  5C5L A;  1VF7 A;  1BBU A;  2HDL A;  1STG A;  3DWQ A;  4Z9C B;  1E3P A;  3IKJ A;  4RH6 A;  1YJN A;  4ETS A;  1X3E A;  5KRU A;  4IFD G;  1N34 L;  4A3D G;  4LF8 Q;  2NZH A;  1EQT A;  3VR5 A;  2CQO A;  4F7X A;  1WVL A;  2VPS A;  4DNI A;  3GTM B;  4NXN H;  3HS0 C;  1HZA A;  1WTX A;  5E3F A;  3HEJ A;  5LMN W;  1FNW A;  3PIP A;  5DGA A;  1Y69 U;  4LAA A;  3K59 A;  1CQF A;  5JEA H;  4XDX A;  2VQE H;  5JAV A;  2B8G A;  5L1L A;  3I4N G;  5KT2 A;  4JK1 C;  1K73 C;  3NE5 B;  1TU2 B;  1KJ9 A;  4A3J G;  4JI0 H;  4MAM A;  3C1F A;  5C44 H;  3H0G A;  1Q12 A;  2HCI A;  4C2M B;  5KYI A;  3HOW G;  4UCO A;  3A7L A;  1CK1 A;  3J80 i;  3FKI H;  1LTG D;  5EOY A;  3I90 A;  1F9S A;  5CC4 A;  1SE8 A;  3JAM E;  1BNC A;  3LX0 A;  4Y8V B;  4ECU A;  5COY A;  4JI8 H;  4J8Q A;  1GSA A;  1ZXT A;  3A0J A;  4K5X A;  3NWT A;  4GLA C;  5L37 A;  5TSS A;  1HNZ Q;  1JOR A;  1KXL A;  1XDN A;  3KHG A;  2I46 A;  3J7A 5;  1TII D;  1KDB A;  1NTG A;  4UP7 A;  4IRD A;  1J8I A;  1JT8 A;  4DPG A;  1LT3 D;  3AQQ A;  1WOC A;  2YS6 A;  1MZB A;  1U4P A;  3DHQ A;  5D1P A;  4EYH B;  1HTP A;  4R9W A;  4ECV A;  3J7A K;  1IBM Q;  4JI6 H;  3TZU A;  1TVX A;  2IMW P;  1N33 Q;  3IRB A;  5KFX A;  1V51 A;  1Z2N X;  3PO2 G;  4JOI A;  1DOL A;  2B2W A;  3VA7 A;  4A3G H;  1AN7 A;  3WDN A;  4EQO A;  2R93 G;  3RD4 A;  4DNR B;  4A3B H;  2JEB I;  2Q2T A;  1E2W A;  3FKI B;  3L0O A;  1GSH A;  1M0W A;  3W1B A;  1PRT D;  1X9N A;  1OTC A;  4B3R H;  2I5M X;  4JBK A;  1EUD B;  2KQ3 A;  3VPB A;  3OWE B;  2G5D A;  3PW2 A;  4AYB E;  4WBN F;  4IAJ A;  1CKO A;  4HCS A;  1JJ2 A;  1DOK A;  5LMN L;  4FS1 A;  5BMV F;  3HKZ E;  1B6S A;  1Z47 A; 
#chains in the Genus database with same CATH homology
 3HOV H;  1BKB A;  1NY4 A;  3I4O A;  4LW1 A;  4B3M L;  1E22 A;  1EWI A;  2B29 A;  2YV5 A;  3D31 A;  4IJL A;  1KRS A;  1WI5 A;  1K3R A;  1Q82 C;  4A3M G;  1KC8 C;  4JYA Q;  3NEL A;  2B63 H;  4GKK Q;  4LF9 Q;  4LUZ A;  1TWC H;  2UXB Q;  4DR1 L;  1VQF A;  1N32 L;  1OXU A;  1QUQ B;  4P75 A;  4POG A;  2R7Z H;  1NMF A;  4XTC S;  1X54 A;  2YYZ A;  4A3F G;  5C0X G;  3K81 C;  1N36 Q;  3CP0 A;  3HKS A;  4DAM A;  1ASY A;  2RHQ B;  3KF6 B;  5BR8 L;  3S15 H;  1HR0 L;  2MQH A;  3K0X A;  3BJU A;  1R9T H;  3GO5 A;  1YNX A;  4P74 A;  1XPR A;  4C3I H;  2UUB Q;  3M7N A;  2ATW A;  4IO9 A;  3PUY A;  5M5X H;  1V1Q A;  3PUW A;  1WCM G;  5H1S E;  2ES2 A;  1L0W A;  4A3F H;  3PSI A;  1X3G A;  5JJI A;  4DR5 L;  5IYD G;  3PF5 A;  2HHH Q;  1PHJ A;  4A3C G;  1NBW A;  1UE6 A;  1KIX A;  4B3T Q;  1AH9 A;  1QZG A;  4JI3 Q;  5LMU Q;  2IX0 A;  3K8A A;  4MNO A;  4PG3 A;  4DKA C;  4X6A H;  3GTK H;  3MEF A;  1NE3 A;  5GAD C;  4OXP A;  3PIO A;  2HT1 A;  2MO1 A;  2VQE L;  4A3I G;  4IFD J;  3JAM c;  1VQE A;  3I7F A;  4NXN Q;  2B3G A;  3Q8D A;  5M5Y H;  5ELN A;  2K14 A;  4A3C H;  2RHS B;  3FHW A;  1OXS C;  2ZTD A;  1HZB A;  4DV4 L;  2F3I A;  4A3E G;  2BA1 A;  4JI0 L;  3W1G A;  4LFB Q;  1X6O A;  1A62 A;  1U0L A;  1TXY A;  4YHH L;  4DUY L;  1PH2 A;  2JA7 G;  1LYL A;  2F4V L;  3CPF A;  2V1C C;  5JJK A;  1PH6 A;  2OTL A;  4JOI C;  2E5L L;  4A3I H;  1C0A A;  2PI2 E;  2JA5 G;  4JI4 Q;  3CW2 C;  3S1N H;  4GNX A;  4X65 L;  2UUC L;  3UE0 A;  4RMF A;  4JI8 L;  5IP9 G;  4DV7 Q;  2VUM G;  2UUA Q;  5C44 G;  4A3K G;  4AIM A;  4DV5 Q;  4A3E H;  1PYS B;  4EQ5 A;  4X62 L;  1N34 Q;  4LF5 Q;  1RIP A;  4OX9 L;  1SR3 A;  4LF6 Q;  4JI2 Q;  2DUD A;  4QJF A;  2VQF Q;  3PUZ A;  4GN5 A;  3SGI A;  4LFA Q;  2JA5 H;  1XJV A;  1QVC A;  2BA0 A;  4JI5 L;  3RN2 A;  1O7I A;  5FJ8 G;  2H5X A;  1PFS A;  5HGQ A;  1Q81 C;  2Z0S A;  5IP9 H;  4JG2 A;  4DR2 Q;  1VQN A;  4BY7 G;  3M3Y H;  4DV3 Q;  1IBL L;  2VUM H;  1UE7 A;  4JV5 L;  4JI6 L;  4A3K H;  2IHF A;  1VQC A;  3HOX H;  3PO3 G;  4AQY Q;  2UU9 L;  2VY3 A;  2CWP A;  2JEA I;  4DR7 L;  4QQB X;  3F8T A;  1HJP A;  4R4Q A;  3L2P A;  4ME3 A;  4LNQ A;  1IBK Q;  2KBN A;  4JBW A;  4UP8 A;  3H0G G;  4DV2 L;  1L1O C;  3PUX A;  5FJ8 H;  4LUO A;  4BY7 H;  2AWO A;  2AKW B;  1CKN B;  5GAE C;  4GOP B;  1QZH A;  4A93 G;  4DV0 Q;  2ID0 A;  1PH4 A;  3WWV A;  4DV1 Q;  4OO1 I;  3ULL A;  3PO3 H;  4B3R L;  1XPO A;  2Z6K A;  1VQM A;  3A5Z B;  1PH9 A;  3HOU G;  2Q2H A;  3HOZ G;  4A4I A;  1PYB A;  4A3B G;  5M3F H;  2ZM6 L;  4GOP C;  3H3V I;  2YTY A;  3H0G H;  2UXD L;  1Y14 B;  3KF6 A;  4LFC L;  3UE1 A;  3S1M H;  5DLQ E;  1EFW A;  4A93 H;  4X64 L;  1HNW L;  2VNU D;  4P72 A;  2LXJ A;  1G51 A;  5GAG C;  1C9O A;  4B3S Q;  4LF7 Q;  1UE1 A;  1D8L A;  1IZ6 A;  4QY7 A;  3A74 A;  2Q2U A;  3HOU H;  1G6P A;  3HOZ H;  3I55 A;  3RR5 A;  4O2D A;  3KJP A;  4DR4 L;  1N9W A;  4R1J A;  4BA2 I;  2HQL A;  4JCV E;  1FL0 A;  2JQO A;  3KYH C;  3PGZ A;  1I94 Q;  2I5L X;  1EIF A;  4IJH A;  3MXN B;  3UDF A;  1K83 H;  1YIT A;  2ZJQ A;  4FDB A;  4AH6 A;  3G48 A;  1KD1 C;  2NN6 I;  3TRZ A;  1MKH A;  4WJ3 M;  5JJL A;  3S17 H;  3EBE A;  2GVA A;  5C0X J;  2RCN A;  3NEM A;  3FP9 A;  5IY0 A;  5LMN Q;  3AFQ A;  3T1H Q;  3M85 A;  1FGU A;  1NMG A;  1LM0 A;  1WFQ A;  2IY5 B;  2XTI A;  3GDE A;  3I2Z A;  4B3M Q;  1V43 A;  1YHB A;  2VS1 A;  5FLM G;  4HJ5 A;  1SRU A;  2PQA B;  3H15 A;  3KDF B;  1CKM A;  4KLK A;  1GVP A;  3OTO L;  1RL2 A;  1FJG L;  1PH5 A;  4A3L G;  2UXC L;  4BY1 G;  3F2C A;  4GKJ L;  3S2D H;  4DR1 Q;  1HZC A;  1Q1E A;  4L5Q A;  1K9M C;  2ASB A;  2CFM A;  3G4S A;  1N32 Q;  1YJ9 A;  1PV4 A;  2N3S A;  3RLF A;  5C0X I;  2KCM A;  3HFZ B;  4HIK A;  4K0K L;  1PH3 A;  4YY3 L;  4PZ6 A;  1GM5 A;  1OXT A;  3UDG A;  1XNR L;  5FLM H;  1EOV A;  4DV6 L;  2NVQ H;  5BR8 Q;  3CME A;  1XMO L;  1QVF A;  1I5F A;  3RLO A;  4DK3 C;  3PF4 A;  1E1T A;  4A3L H;  4J15 A;  1Y1W G;  1VQ4 A;  4H02 A;  1QVG A;  1SMX A;  4BA1 I;  4BY1 H;  4LF4 L;  1XNQ L;  3E9H A;  4IPC A;  1J5E L;  1WJJ A;  2QGQ A;  1E24 A;  3CC4 A;  3M4O H;  1TWH H;  1VS0 A;  4OON A;  3I56 A;  3K7A H;  1YJW A;  2EXD A;  4DR6 L;  3CCJ A;  5JEA J;  4DR5 Q;  3ER0 A;  1X65 A;  4KHZ A;  4APV A;  2C35 B;  1YIJ A;  3GTL H;  4YWL A;  3GTG H;  2WAQ G;  1VQO A;  3K80 C;  1Q1B A;  2QA4 A;  4UY8 C;  5GRO A;  1DGS A;  3PCO B;  1E1O A;  1Y1W H;  1TWF H;  4MZ9 A;  3S14 H;  3TS2 A;  2N49 A;  3F2B A;  5IT9 c;  1CKN A;  2VQE Q;  1EIY B;  1GO3 E;  2I0Q A;  2YU9 H;  3ULP A;  1VQB A;  3GTO H;  5M5W H;  2WAQ E;  5J3B A;  2VW9 A;  1AE3 A;  4JI7 L;  4YWK A;  4DV4 Q;  4JI0 Q;  2E2H H;  2AMC B;  1P16 A;  2VZA A;  3CQZ H;  4YHH Q;  4DUY Q;  1WYD A;  4EX5 A;  2E2I H;  4IFD I;  1SRO A;  4C2M H;  2F4V Q;  2BH8 A;  3RLN A;  3HOX G;  1CUK A;  4Y52 H;  1MJC A;  1BBW A;  2BH2 A;  2I5H A;  2K5V A;  1Q8K A;  2K75 A;  4PMW A;  5AJ3 Q;  4IOC A;  3CCE A;  2GN5 A;  2JK8 A;  1L2F A;  2MO0 A;  4X65 Q;  2UUC Q;  2OWO A;  4JI8 Q;  1T9H A;  4RG1 A;  4X66 L;  4LF8 L;  2KEN A;  3CMA A;  1Q7Y C;  4X62 Q;  2K4K A;  1W2B A;  4L5S A;  4OWW B;  4HJA A;  3TEH B;  1LUZ A;  4OX9 Q;  1B8A A;  3B6Y A;  1L1O B;  4GLX A;  3CXC A;  2JE6 I;  1CSQ A;  2ALY B;  4LWC A;  2N8N A;  2K52 A;  3F1Z A;  4JI5 Q;  3U50 C;  2NVY H;  3KFU A;  3S2H H;  5IP7 G;  5M3M G;  1IBL Q;  1HNX L;  1EUJ A;  2WB1 G;  1K8G A;  4JI6 Q;  5M3F G;  4BBR G;  4NXM L;  4JV5 Q;  4YWM A;  4DR2 L;  1A8V A;  2OQK A;  4LUV A;  3VDY A;  4HIO A;  2AWN A;  5IWA Q;  2UU9 Q;  2IX1 A;  3I4M G;  1EQR A;  2HIX A;  4DR7 Q;  1YEZ A;  2F52 A;  1J6Q A;  1VQP A;  4A3D H;  4IPG A;  4HID A;  5HY6 A;  3U4V A;  1JE5 A;  2OTJ A;  3CCV A;  3T1Y L;  1XTD A;  1JMC A;  3GD7 A;  2ZTE A;  2WB1 E;  1FVI A;  2JJQ A;  1QUQ A;  2NVT H;  5IP7 H;  5IE8 A;  5M3M H;  3EN2 A;  4IOA A;  2R6G A;  4BBR H;  4DUZ L;  1K0R A;  4WJ4 A;  4YCW A;  1VQK A;  2XGT A;  1W3S A;  2A1A A;  2VL6 A;  4ALP A;  3I4M H;  4B3R Q;  4BBS G;  3F2D A;  1HNZ L;  2E8G A;  4TQU S;  2KHJ A;  3STB C;  4A75 A;  1VQJ A;  2R7Z G;  2OQ0 A;  4JBJ A;  1ASZ A;  2ZM6 Q;  2DGY A;  3CC7 A;  2UXD Q;  1HZ9 A;  1I6H H;  4R4C A;  4LFC Q;  1XMQ L;  1HNW Q;  3S24 A;  4X64 Q;  5GQO A;  3ULJ A;  1IBM L;  1OXX K;  3GTP H;  4BBS H;  4JI1 Q;  1N33 L;  5IYC H;  4GNX B;  4HJ9 A;  4YCV A;  4DR3 L;  1VQ6 A;  2B63 G;  1D7Q A;  3RZD H;  4DR4 Q;  1VQL A;  1PH8 A;  1B7Y B;  2JA8 G;  1P8L A;  3RN5 A;  3E9I A;  3BZK A;  4HJ7 A;  1I94 L;  3M4P A;  2ZJP A;  3H3V H;  4OWX B;  4R4I A;  4UPA A;  1EQQ A;  4GNX C;  2E2J H;  3RZO H;  1X3F A;  3OYY A;  4QIW E;  4KHP L;  1UEB A;  2IHE A;  4YCU A;  1VQA A;  4JC0 A;  1HH2 P;  3CCU A;  1NJI C;  1SLJ A;  3CD6 A;  3ICE A;  1V9P A;  3J81 i;  2NN6 G;  3KLW A;  4NB3 A;  2JA8 H;  1H95 A;  1YI2 A;  1K8A C;  4DAY B;  1M1K C;  1YBY A;  4JYA L;  3S1R H;  4IPD A;  1EYG A;  1YVC A;  4GN4 B;  2FXQ A;  3T1H L;  4GKK L;  4L5R C;  4A76 A;  4PZ8 A;  4LF9 L;  4XIG S;  2YTV A;  3J7Z C;  2UXB L;  1KRT A;  3OTO Q;  1VCI A;  1FJG Q;  3CAM A;  2UXC Q;  1A63 A;  1TWG H;  1A0I A;  4NPS A;  3LGJ A;  4GKJ Q;  1KAW A;  1GKH A;  3E0E A;  1HR0 Q;  1N36 L;  1GD7 A;  2LXK A;  2QEX A;  2R7F A;  4HIM A;  3J81 j;  3KJO A;  4K0K Q;  2WFW A;  3ZJY C;  4YY3 Q;  2MNA A;  1XNR Q;  2CWA A;  2MFI A;  4DV6 Q;  2UUB L;  1L1O A;  4PZ7 A;  1XMO Q;  1YHQ A;  4GS3 A;  4POF A;  1VQI A;  2IT1 A;  1C7Y A;  2ZTC A;  3KF8 B;  4MTN A;  4A3M H;  1KQS A;  1VQ5 A;  4LF4 Q;  3S1Q H;  4KI0 A;  1MIU A;  2LSS A;  1XNQ Q;  2HIV A;  2K5H A;  3RNU A;  3S16 H;  1I3Q H;  2Z6K C;  1J5E Q;  2KHI A;  2HHH L;  3ERS X;  4JBM A;  3GTM H;  3DM3 A;  4DR6 Q;  3BU2 A;  4P73 A;  3U4Z A;  4QL5 A;  4JI3 L;  5LMU L;  1IYJ B;  1PA6 A;  3OW2 A;  3GTJ H;  4GOP A;  2NZO A;  1KHI A;  4TVA B;  3CCQ A;  3CCL A;  4BXX G;  3EIV A;  3NBH B;  5IYB G;  3HOY G;  4R4T A;  3TRE A;  3PUV A;  1PVO A;  1I50 H;  3D0F A;  3CF5 A;  5C4X G;  2PI2 A;  1BVS A;  4NXN L;  3JAM i;  2D62 A;  1VQ9 A;  1Z9F A;  1JJC B;  2Y0S G;  3M9B A;  3AYH B;  4GN3 B;  1CSP A;  2Q2I A;  4C3H H;  1MJE A;  2R7D A;  3K7U C;  1WCM H;  4LFB L;  2E5L Q;  4JI7 Q;  4BXX H;  1U5K A;  2JA9 A;  5IYB H;  1IL2 A;  1TWA H;  2D0P A;  1XPU A;  3HOY H;  5IYD H;  1AE2 A;  5C4J H;  2Y0S E;  5C4X H;  4JI4 L;  1Q46 A;  3GTQ H;  2ZJR A;  1BBU A;  3CCR A;  2WP8 J;  3BZC A;  2R92 G;  1E3P A;  1SN8 A;  5EAY A;  5JEA G;  2N78 A;  4DV7 L;  2UUA L;  1YJN A;  4DV5 L;  1YHA A;  2D0O A;  1X3E A;  4IFD G;  5FLX c;  1N34 L;  4A3D G;  5AJ3 L;  4LF8 Q;  4LF5 L;  2AHO B;  2NZH A;  4X66 Q;  2CQO A;  4LF6 L;  1B70 B;  5GAH C;  4JI2 L;  4DNI A;  4O0A A;  2VQF L;  1HZA A;  4QGU A;  3M4Q A;  4LFA L;  4R4O A;  5LMN W;  4IPH A;  3PIP A;  4B3T L;  1N8R C;  1X55 A;  2JA7 H;  2R92 H;  2YTX A;  3FKI G;  3G6E A;  1JB7 A;  3TQY A;  3JC6 6;  3UDI A;  4DV3 L;  2EQS A;  1S40 A;  2EIF A;  3I4N G;  1VQG A;  2K5N A;  3W5O A;  4AQY L;  1K73 C;  1UWV A;  2R93 H;  1HNX Q;  4OWT B;  4NXM Q;  3CCS A;  1S3O A;  4A3J G;  4DV2 Q;  4DK6 C;  2CCZ A;  1PH1 A;  4P71 A;  1PH7 A;  5C44 H;  1IBK L;  1Q12 A;  2PQA A;  3AEV A;  3KDF A;  3G71 A;  3HOW G;  3KOJ A;  5IWA L;  3J80 i;  3AFP A;  3FKI H;  4DV0 L;  1YZ6 A;  2KCT A;  1SFO H;  3T1Y Q;  3I4N H;  1SE8 A;  4DV1 L;  5IYC G;  3L7Z C;  3DLL A;  1HR0 W;  4OO1 G;  1KL9 A;  4DUZ Q;  2K50 A;  3A0J A;  3J80 c;  4A3J H;  4L5T A;  1Y1V G;  1UE5 A;  1VQH A;  4GLA C;  1VQD A;  1HNZ Q;  3HOW H;  1KXL A;  4UP9 A;  3J7A 5;  4A3G G;  5K36 G;  1NTG A;  2PNH A;  3CPW A;  4UP7 A;  1JT8 A;  4DPG A;  3AQQ A;  1WOC A;  3TS0 A;  4B3S L;  1XMQ Q;  4LF7 L;  2PMZ E;  1X56 A;  1M90 C;  1IBM Q;  3U58 A;  1OXV A;  1E7Z A;  1VQ8 A;  1JJG A;  5C3E G;  1Y1V H;  3NEN A;  1N33 Q;  2JA6 G;  3IRB A;  3A5U A;  1S72 A;  2A19 A;  2OCE A;  3CCM A;  3CC2 A;  4JOI A;  3PO2 G;  3PV0 A;  4DR3 Q;  4AYB G;  4A3G H;  4JI1 L;  3HOV G;  4Y7N H;  3HKZ G;  2A8V A;  2CKZ B;  1IXR A;  2R93 G;  4A3B H;  2JEB I;  2Q2T A;  4GLV B;  3UDX A;  3L0O A;  5E7N A;  1LTL A;  5ELO A;  2RF4 A;  2GVB A;  1G29 1;  3W1B A;  1X9N A;  1OTC A;  2NVX H;  2I5M X;  4C3J H;  5C3E H;  4JBK A;  4KHP Q;  1Q86 C;  2JA6 H;  4AYB E;  4HJ8 A;  1CKO A;  1JJ2 A;  5LMN L;  3PO2 H;  3HKZ E;  1VQ7 A;  1Z47 A;  2L15 A;  3STB D;  3J81 c; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...