5IQLA

Crystal structure of yeats2 yeats bound to h3k27cr peptide
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
130
structure length
130
Chain Sequence
b'SRLFVKKTIVVGNVSKYIPPDKREENDQSTHKWMVYVRGSRREPSINHFVKKVWFFLHPSYKPNDLVEVREPPFHLTRRGWGEFPVRVQVHFKDSQNKRIDIIHNLKLDRTYTGLQTLGAETVVDVELHR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords YEATS domain-containing protein 2
publication title YEATS2 is a selective histone crotonylation reader.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 20
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2016-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03366 YEATS YEATS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1970 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5iqlA00
5IOKA 3FK3A 5HJBA 2NDGA 5D7EA 3QRLA 3RLSA 2NDFA 5IQLA 4TMPA 5HJDA 2L7EA
chains in the Genus database with same CATH superfamily
1NEUA 5DRZB 3VXNA 5I5RA 1A1NA 3FQ2A 3O6FC 4ODHL 1OHZA 1RIHH 2JI1A 4QRRE 5FYJD 1ROWA 4PN6A 5L2KA 4NGHL 2FO1A 5BRQA 1TPXB 2ZX7A 4LPYA 1OSPL 1X5KA 2JFCA 4HXAH 4QJ4B 5DDHB 4NQCA 1TZ8A 2CUAA 2VZVA 2WB7A 2VNCA 4MA1B 2AEWA 4GIAA 3IKCB 1TETL 4A2MA 3HMWL 5GS1A 3PL6B 2JK5A 5SX5H 3GI8H 4N2MA 4WIQA 5ILTL 4ES8A 1S3RA 3JYBA 1ACYH 1LE5A 1RUPL 4DK6A 2OMYB 4YVNA 4KPHL 5GZNA 3UMNA 1JGVH 3KEHA 2EVHA 5FGBA 4LDEB 5AVZB 4AQ1A 2OMTA 3HC3L 3L3HB 1FVCB 4FD0A 4HUCA 4JUTA 2QSQA 2YXFA 1AQDB 4FXGC 1WDAA 1ID5I 5L88L 1Q0YH 2P5EA 1WT5A 3GIVB 4QRQA 4PV1C 5CBEA 1E5ZA 1BFSA 4KHXL 4AYGA 1DBJL 2KKQA 5I1EH 2IWGA 3K8MA 2E6JA 3B2VH 4CC4C 5TDOA 3ULUL 4HIQA 4NZRH 5I5JA 3HR5B 5I5IA 2FB4L 3W11C 2X87A 3NJKA 5I1LA 5SWZE 3TJEL 2IH8A 3AGVA 2AQ3A 2JNZA 2P3YA 1TU2A 4M9OA 4PGDB 5LGHL 1IM9D 1NKOA 2NCEA 4N8VA 1I3VA 5DC2A 3HG1D 4W9EC 1SN2A 5ESVB 2EECA 4G82A 4FFYA 3TT1H 1E6JH 1H3WM 3RVWC 4OUUA 2IAMB 2WGXA 3QCUL 3OLEA 4XNAA 4HK3J 1X4ZA 2CHWA 3CFMA 3JYCA 4FQHB 4EMZA 4DEPB 4MFHA 1ZT4B 3L5JA 1VB9A 1L3NA 1SXCA 3RKPA 1ZTXH 3ARDA 1RIVH 4B97A 4TSBH 4Z6AT 3V0DA 2VUOA 2CO3A 2OYMA 3BSHA 5JHLL 5ISZB 2EIEA 3DDGA 1N5YL 4KRNA 2E9GA 1VFOA 2H6PA 1RPUA 2D03H 3SE4A 1NMBL 4D8PB 1IT9L 4MD0A 1E5AA 1A6ZB 2XCMC 3KL5A 3PWPD 3H56A 4HPYL 4PRIA 1MCIA 4WKXA 3QHTC 2F1EA 5F9OL 4HU8A 3LQAL 1R5WB 1HXMB 2O6CA 4OJAA 1CB4A 4Y16C 1C5BH 5DFAA 4RMWA 4NKOA 2J57A 5H35B 5I6LA 4OZFG 2HKFL 3DX6B 4N2GA 4Q0XH 4GKNA 2XKUA 3CHPA 4X6EA 3RL1B 4TQIA 1A9EB 2OMWA 5ADOL 3FRPA 2FZ3B 4Y19D 4ZXBD 2H2PD 2OJZL 5CEXA 1PLCA 3WJLA 4LOVA 4WO4C 4HIHA 5EB9A 1WG3A 4PJFF 1B0GB 2AQTA 1IGYA 3CG8A 3AUWB 4BSVA 5C0CE 3BAYA 1D7CA 3VXRB 3CDCA 5C71A 3LNDA 3M07A 2UXVA 5JDSB 4NSKA 4XPHH 4KJPC 4LVNB 2AQQA 3GBEA 3GSWB 4MB1A 2N0KA 1X44A 4LSQL 1ECZA 4KUZH 4WWKD 1NCWH 1X5FA 2EYTA 3P30H 4Y4FA 5F7AA 5K39B 1CD8A 1JNNH 3MSPA 4LNRB 4OTXH 5JHDA 3RJQB 3A4AA 4D94A 4TQEL 5GGRB 2X4SB 5BV7C 2RALA 4JFVA 4DGYH 3HBPA 1F3DJ 3BPNC 3L8QA 4YE4L 1SUJA 1TEYA 4P2OD 1Q9LA 1YEHH 5AVVB 1KGIA 2G5BB 3O3DA 3LIZL 3V6ZB 2UUDH 1VEPA 2Q3XA 4ZUVB 1MFAH 1ZHLA 4Y2OB 1HJCA 3CXHK 1DFXA 3AWGA 5JIMA 4BCYA 5FO2A 1I8AA 1UD6A 3CDYA 1Q9KA 4XP5L 3FH7A 3CFCH 4Y4HC 3NEXA 1VFAA 3H4HA 5EO0A 3VJ6B 3EGSA 2VOTA 3T8XB 5FA4A 3J8F7 4I3SH 4UZGA 3ARWA 3EUUA 3R7QA 3GSNL 1Q38A 3ES6B 4EOWL 5J57B 4PJ8B 1J1OL 4NCC2 4F15B 5IWLA 1A6AB 1F1AA 3GBNH 3KLDA 3JWOL 1WPCA 3MJ8B 4FTVB 5C08A 2BCKA 3QJVB 3AUVA 4K7PL 5D72H 4UTAH 4O2EB 2GJRA 4UBDD 4X7CC 4ODVH 1MCHA 1SRDA 3VXSA 5C07A 3FQRB 2QV2A 5JPNC 4GRWE 3NEEA 2E9BA 1DDHA 1KTRL 2WCPA 4JM2C 2CG9X 5C0JA 1A7RH 3TN0A 1AKJD 4BWUA 1J1XH 3FTXA 4YK4B 4CC1A 5T8IA 1S6NA 3GEWB 1SXZA 1YAIA 4AJ0A 1O9WA 2MMXA 2CA3A 4UINL 5BS0D 3MRHA 3SGKC 3ARED 5GZOA 3T6QC 4ORGA 1QLRA 1REIA 3VW3H 4BFRA 4RGMC 3ULVE 4MAUL 1XD1A 5D1ZA 3A47A 4ATTA 2IGFL 1XGUA 1KN4L 4ZX4A 3CSFA 1E50A 4X0NA 5IEHB 4KV5F 4RFEA 4YSOA 4CNIB 4R5TA 2MHAA 5J13B 2BZDA 3DRQA 5E1HB 4FX5A 2BOCA 2GY7B 2AK4D 5AW9B 3WJMB 2HAZA 5AWNL 3QUKB 3OR6B 1T04A 1LP9B 5HJGA 5K1NA 2VKWA 1RPKA 1M1SA 3UTSE 5ACMA 2YGVA 4UT9H 2ZXCA 4UTBA 2EE9A 2O6EA 1X9QA 1XZWA 1VIWA 2XX1A 5KSVA 1FVEA 3UZEC 1OY3B 3MV9A 1S9KC 4IK7A 3GK8H 3U6RB 3MV7D 2WNWA 2ICES 4OD2A 5EEWA 3AT0A 2Z7UA 1AG0A 4E5XG 1KTLA 4OM1H 1PEWA 1QZ1A 3DHUA 2VERA 1JPTH 3QYMA 3RWGB 3DV6A 2A73A 4HISA 1D6VH 4RRPA 1WIPA 4YLQT 2ZUWA 3U7YH 5A6MA 5LGJB 3MA9L 5K59E 1OGTB 2KERA 3RVXC 1HH6A 3PG2A 4AMKH 4QRPE 2DBLH 1KIUA 3EFDH 3H42H 4I0KA 3WKQA 5T3XE 2CGRH 5IV2B 1PBYA 2Y2WA 4DGUA 1T1YB 4PJ9D 1VCBC 4TLSA 5C2UB 4DP2X 3FFCD 4WW1A 2Y5TB 1J9TA 5DLML 2UZXB 2NX5E 4WFHD 4DO6A 1LDPL 3DA0A 3G6JF 4O51A 1IVLA 1CXIA 6TAAA 4QUOA 3U0TB 2QMJA 1XCWA 3HZVA 1GGTA 25C8H 3F83A 2R1XA 2Y3AA 4DPAX 4LLWB 2NYZA 4D0CA 5EWIL 3HNVL 4PTTB 1UD5A 4ZZKA 2JCCB 3DXAB 4GG8B 5C7XH 4HIXL 1W8OA 1YEWA 3MCKB 2CGYA 4HPOH 4OV5B 1NAML 3FT1A 1U2YA 1ZV2A 2ICWB 3RA7H 4RFNC 4KY1L 1MCCA 4XVTH 1EGJH 2LT9A 4FHBD 4FGMA 5DO2C 5AZ2L 4QJ5B 5IW6B 3QO0A 4HS8L 5CZRA 3BC9A 3V0EA 1XH3A 1IKNC 1T1ZB 2F15A 2H9GB 4PBXA 4PRDA 4BXSV 4Y8DC 3BUQA 5C0DB 1NFIA 2NT0A 2OSYA 4G7VH 5L2JA 2F2HA 5HHMB 5IKCA 3SOBL 2BFVH 4G6FD 1L9RA 5AKVA 1WC7A 4W4OA 3QGVA 1I4FA 5I28A 1URZA 1Z1WA 4RAVA 1T0PB 4WHCA 4NRYA 3VG0H 5EDSA 1IE5A 3SBPA 1TZAA 1HYRC 4DEUA 1GSMA 2P8LB 2UXFA 4P2RE 3GSVA 4X7SH 3NIGB 5C0BD 3DX9A 3ZYIA 3O6KL 3D7PA 3MRBB 4X9GA 1FNAA 3MKKA 1SXNA 3WN5B 3LRLA 4LHUD 2DYPA 4CMMB 2DQEH 5EZJA 1IAII 1QSFA 4DPRA 4RWHA 2ORBL 1BEYH 3S96B 1GZPA 3L9RA 4MMXB 3KYMB 4Y5VB 1Z9PA 2EEBA 2WTRA 5IB2A 2VR5A 3DUSA 2JIXA 3BCDA 5C09D 4NHCL 2DMHA 3LMJH 1ZLSH 3WUWA 3K1KC 3MBED 4M6OL 3HE7C 3QG6B 6PCYA 1QD0A 2XNAB 4ZAKD 3BSGA 4GAYA 4JFFA 3HBGA 4K3EL 2OK0L 2MOGA 4YPGA 1UHVA 1J8HB 1PS3A 2WKOF 4NNYA 2ZUYA 2PTTA 3CFQA 5DD5L 3P77B 5EU7C 1F4WH 4KGJA 4NC1C 2MPAL 1NFDA 4KKBC 3RNKB 3ULUD 2HN7B 5HJBA 2FEDD 2J1WA 1J0JA 3ZO0A 1JWSA 4ZFFA 2KL6A 2ZOKB 2YLHA 2PW1A 3ULSA 3PAUA 4DCQB 1NC2D 3H9HB 1CGVA 1MG3C 3DSFL 1HSBA 3ARTA 3GSOA 3EYUH 4GXVH 1NC4D 4NZ8A 2NSMA 5I9QC 2GJ6D 4EKJA 4GKOA 4LGSB 4YHNA 4ZNCD 2D4DA 1MCRA 1Z66A 1YJDC 3BD5A 3D08A 5FCUH 1DZ0A 1NCJA 1QNZH 4Z1PA 5LGKA 3KR3L 3EJPA 4ZSOA 1Q9WA 3DVNA 1YN7B 2DYRB 3H6JA 3OJMB 4KKLC 3TBVA 3KYAA 3QDGA 2WN2A 1XAUA 5KVEH 1HHIB 4LL1A 1QVOB 3VA2C 4PRHD 1YG9A 4XNMA 3HCVB 3HFML 4IRSB 4LB8A 4ODWA 5HXMA 5HHVH 1NBVL 3WE6B 3KLLA 2FHBA 3Q3GA 4AQOA 3UGEA 3L4ZA 1R3KA 1UB5B 3P0GB 3QSKB 4G8FB 4X42A 4AUUA 4JM4L 2IDFA 4WWNA 2XN9A 2V2XA 2CDGB 1VLXA 2CGZA 4Y4KD 5B4MD 4M56A 1PPIA 3A67H 4LKCB 5DK2B 4B9YA 4RFOL 5F0MB 2DQIH 2NY0B 3GXNA 4IOFC 4JO3L 4LARH 4BCXA 1J88A 2PPEA 3CMGA 5B1CA 3RWEB 3VTAA 2EH8H 3QUYB 7FABL 1DBML 4WLCA 3W37A 4XC1L 1MRFL 2R0KH 2VXTH 4OAWB 3B2PA 2CZNA 4UZSA 2IV9A 3BVUA 4NO0A 4UT7L 5AEAA 3LRHA 1A6VL 4HIIA 4PJGF 2CCVA 2D7TL 3GRWH 3P9LA 1TFPA 2HFEA 4WI2A 2R2HA 5FKPB 1UXMA 5HDWA 3ECBA 2PO6C 2WQWA 1SXSA 4I77H 3TV3L 3ARQA 5B39G 2WLYA 5L2KD 1CCZA 1MJUH 4FAAB 2V37A 3K4AA 4LCIL 4NQCD 3V5DA 1IEAA 3MYZA 4ABWA 5EU3A 4WFFD 2FNWA 2LTQC 5CSZA 3BLBA 4G7YH 3BVNB 3OKDA 3CZLA 1T22B 1M71B 2DQHH 1MUJB 1N9PA 1M05B 2FGWL 5DR5L 3U1SH 3P4MB 1CICA 4KI5F 5GZND 4IKNA 3QORD 1G1KA 1BVLA 4U0QB 2R1WA 1AP2A 5F7NC 3GKZA 2JCWA 3BMVA 5DYFA 3FUEA 1WV7T 5J3HD 4R9HA 4PLKC 1FL6A 2FK9A 5D5MB 3BJ91 4OFIA 2FO8A 2KHAA 2P5ED 4I2XA 3SE8L 3B8SA 5DSCB 2JJVA 4WI4A 5K9JH 1KTDB 5DVKA 2PTVA 3E6FA 4PGCB 1M4KA 5BV7H 1W15A 1BVZA 1ZLWK 3O6FB 3QCVH 3R1GH 2XN1A 1I7TB 4YHYC 5KVGL 1GZQA 4TUKL 4OD3H 2E27H 4AKOA 1QYGH 2NY1C 4JRWA 4YN3A 4NRXB 3QH3A 4C56B 1OPOA 2VWEC 4ZYKA 2P52A 1VACB 4YPJA 7PAZA 3UAAA 2N7SA 4JRXE 5T1DL 1NDMA 4QIRA 4PJBF 2EDNA 3L08A 2MEJB 4LQ1A 1NGZB 2EDEA 5BVJA 3T8MA 5KS9E 1BMGA 2WXJA 4XO4A 1I7ZA 4DUXA 2W0PA 1YYCA 1R5IA 3O81A 3KYKL 3ULVL 1I7RB 3ARDD 1CLCA 1A3ZA 3QUGA 2Q7YB 4HBCH 4OGAD 2JKIS 4MMZA 4OCRH 2EIZB 1KBWA 4PLJC 1SEQL 3PWUB 2BVQA 4ONGH 1Q94A 4FXGB 5IJDC 1X7SA 3GPSA 1A4KB 3N40P 5FECA 4MZ3A 4IHOB 3T3MF 2N4IA 4PJ7A 1XX9C 3BSZA 2F53A 4JAMB 4LEBA 4PRID 3ZDYF 4Z8FL 2WNKA 3DETC 1KJMB 4JKPL 5A16B 1UYWL 4F9PC 3WFDL 2MQ0A 1U58A 1DE4A 1JD9A 2YK1L 2E47A 3TWYA 3D85B 2BOLA 2X6VA 2KT6A 1G6RA 3DOSA 2ODIA 4LRIC 1BF8A 4LLDA 3BN3B 1DVZA 1YEDB 3DJTA 4WO0A 1F11B 4XCCH 4CILA 3EYFA 3C09C 1GL4B 4Y5XC 4BKSC 3FB7A 1LO0L 1U8HB 4PP2B 1SDYA 1V7NL 4HUWA 2VMJA 1GIGH 2XLLA 1IARB 1NCGA 1FYTB 2XXGA 2I27N 1DQMH 5CCGE 1TDQA 4XVSL 4D3CL 4G72B 5E8DL 1KZYA 3NCBB 2H41A 2XG4B 4KITB 2IOOA 5C6PB 1I3RB 2OTPA 5T3XL 1CTMA 5EF2A 4YSSA 3HTLX 1V7MH 32C2A 4QXWA 3TFBA 3CIAA 4U3SB 1WBZA 4GSDH 4X4YB 4HLEA 2QV4A 2V7NB 1EPFA 1T0OA 1WFIA 4Y4FD 1EFXB 1Q9OB 2WO3B 1FI8C 3N1FC 3P0YL 5JHBA 4HUMB 1SVBA 4H40A 5JHDD 4MA8H 2FR4B 3MLXH 3D3VB 3HAEH 5F7FA 3HE6B 1J12A 4MNGE 3OJVC 2ZCLL 1F3DH 4Y16B 4ANWA 1BJ1H 4H13C 5IMOB 2VLMD 2VISA 4YBLC 1EMTH 4MXWL 2FX7L 2YEVB 5DVLA 4N90E 2JLLA 2CLZA 5ADPH 3DMMC 1T21A 2JI3A 3MRDA 4WUUE 5E9AA 1N26A 2FAUA 4AQAA 5FUZH 3SY0B 3NA9H 5CEZD 3CJJA 1T7WA 3QXDB 5AUMA 1EV2E 1QBML 3C08L 3J07A 5IHUL 2B1AH 5IHZB 3HN3A 4WO4B 4LLMA 1YA5A 5A1AA 2EKJA 5LLIC 5BRZA 5FHBH 2R69H 4L1LA 3RTQD 2GIMA 4OIIH 1E27A 1FZKB 1HOCA 3H9SE 5EHFA 5HVHC 1CGSL 4ZOBA 2MSPA 4FMVA 2YFNA 3TYGL 4QRRD 3LZOA 2CIKB 2A77L 4IDJH 4PWHA 4X9FA 3CIQA 1I9EA 4R7DA 5F3BA 5F2FA 1TIUA 3MBWB 3FPYA 1A6WL 4XMLH 4OSUL 1SLXA 4JDZB 1LILA 3I3DA 3L95B 2VM4A 2M2DA 1I8UA 2FQGA 3G6DH 2QPUA 5E1AA 1JYVA 5BV7B 5IFAL 5KW9L 1RIUL 3MPCA 5GISH 3U1QA 4KX7A 3VXSD 4PWFA 4ZS7H 5GJTH 4M43H 1WIUA 5D7JA 2E8ZA 2F5BH 4PJFB 5EOTA 4HUUA 3VRLE 3K6SB 3QISA 4A68A 2CSPA 4Z7OE 5IHLB 4KTEL 2IFFL 4Q6IA 1DLHA 3VFMB 4LEXH 2WVVB 3HVNA 1BYPA 1M6OA 5A2KH 5EBMB 1QBBA 4X5XB 1IGFL 4L05A 1NINA 3FQNB 2HRHA 4PJ5A 4YQXL 5F44A 5GZOD 3QS3A 3O0RH 4Y4HB 3F7QA 4GH7B 5D1ZD 1CT8B 5EF1A 1PKQE 5AAMC 2Z91B 4Z77B 3RGBA 3MACH 1G6RL 3MUUA 3AACA 4X6CE 4TTDD 4DZ8B 1NCAL 3QIBA 4DAGL 1JVOA 1KPVB 1KLGA 1HOEA 5I66B 2EICA 4K8RL 3BD3A 1XDTT 3KPMA 1TTAA 4J4PA 2WZ6A 3LPWA 2E7DA 4NOBA 2CHDA 3BHBA 1N64H 4XBPB 2BS8A 3K91A 2HYMA 2ROYA 3KGSA 5I0VA 3MV9D 2Q8AL 1QFWM 2OR7A 3R0MA 4HD5A 1E9QA 5JPNB 1E9OB 1YPZE 4JN1L 4JPVH 5FGSA 4EZLA 4JM2B 4ZUWB 3RGVD 4TOYH 3U7WL 3HNTL 4GAJH 3ZDZB 2DLGA 3H9ZA 1KCSH 4JEGB 4UWQB 1JZJA 2YPLB 4ETQA 3K71A 4HA1A 3V0JA 4TRPL 4P2QE 4FZEH 1IGIH 1L6PA 3N5AA 4BGLA 3GBDA 2X0WA 4U1SA 4URTB 1UCTA 2GI0A 3DO3A 4JVUA 3V5KA 3GMOB 1B90A 1XEDA 4B9ZA 1BZ9B 1U2CA 1ZPUA 1KCBA 4RSVA 4RGMB 3B2UD 2P8MA 3VFOA 1YNKL 2J72A 1QEXA 4NQDB 3GBLA 1E4KA 1URIA 4G59C 3ZHLA 4BKLA 4OGXL 1NCUA 1SYVA 4DHLA 5ELIA 9CGTA 3W0WA 3V4VA 4QT5B 1NBCA 3APDA 3OJDA 4GG6F 1P5UC 4PS7A 2YRLA 5E4IA 3GJEA 1BGXH 5JPMA 2Y7QB 2NYYC 1T0MA 3HAEB 3DPBA 3DRTB 3IJEA 4JQIL 2FLBT 1XR8B 5CFAA 4PGBA 4U6XB 4UZUA 3SQBA 1MHCB 3FQTB 4FABH 1YJDH 4JBSA 4E9YA 3FCUB 3H0TA 1WAAF 2IWFA 5MP6L 4HQQL 3VA6A 3ZKNC 4NJAH 3UEZA 3VFRA 5C0CD 3EYVA 1RUQH 1N2RB 2J43A 3NFPA 2K4WA 2PPAA 1D9KC 3FO0H 4O02H 3SPJA 1R3IH 4XPFL 1KCRL 4JO8A 1NGWB 3I85A 4C59B 1T66C 2HPTA 3UH8A 4LCWA 1NWOA 1MY7A 3EDKA 2PCFA 1XIWC 4KRPD 4NJ9H 3ZKXB 3MUZ1 3MRNB 1TR7A 3WMPA 3TURA 3VFNB 1S8DA 2F19H 4NEHB 4WF7A 2YSSA 2DIBA 1A6TA 2WKLA 5J6HB 3U9UA 4ZMQA 4C83A 5IT2H 2Q9OA 5HGHB 4H2CA 2D9QB 1P6AB 1YY9C 3CVHA 2X4OA 4LVOC 1OCOB 1KBGH 5E5RB 2D7NA 2DQGL 3IRZA 2X12A 4AIOA 1U8KA 4D9LL 1S7VA 2CDEB 4BD4A 3KYNA 3FUIA 4HIJB 2EDJA 2FT6A 2FX9L 4Y5YA 4WKZB 4FEIA 3SE3C 2R56H 3EBAA 1E4JA 4OZIF 2DYPD 1Y7VA 1IZJA 2RH0A 1QTSA 2DWDA 1QSFD 3ABLB 4JFHE 4W68A 4X8JB 4UM9A 5MEPA 3E8VA 4Y2NA 4J39A 1TJGH 2VDLL 3EBHA 2VLKB 1YMHA 5DI8B 1AD9B 4RFNB 3N85L 2XXFA 3QIWB 2BVPB 5IZ7A 1T5WB 4X6BB 1MZZA 4QLRA 1KMGA 2R59A 4F8PA 1L9OA 1KPRA 1L7TH 1BD2A 2ZXWB 3QZMA 2YD3A 4PY7B 5I30L 5E00B 5D1XD 3QRGH 1Z5HA 3OL2A 3LPFA 5DD6A 3BP6B 4AG4L 3EYSH 5J1SC 4AMWA 3IVKA 2YFOA 1T7ZA 1KJ3L 4XB7A 1CFMA 3ROOA 4D9RE 3RWCA 5MHSD 1MVUB 1BBJA 1KFAH 1AZBA 2WQXA 2AP2A 3O8XC 4ENED 3IJ9A 1RJLB 3PDGA 4ERSL 1JDDA 4WHYG 4Q14A 2LU3A 1MFEH 2G3ZA 4ODSH 2ZYIA 4YSAA 5E6SB 1R0AL 2DQDL 3M6DA 2UV3A 2J8UA 4DN3L 3CHRA 4FLSA 3DO7B 1IILE 2AAVA 2MPVA 5EU6D 1JN6B 3T4AA 4AEEA 5LG6A 1DQKA 4OCSL 1N5AB 4ECNA 3V4VL 1E3ZA 2DBJA 2Z4TA 3BWZA 4MJ5A 4WU5B 3HE7B 4B7LA 3NQIA 3QIUC 2MCPH 5H2BB 2KYIA 2YJQA 1S9WA 3JV4B 4E9RA 3WAJA 2XN9D 2C1OB 2G3MA 3CH1B 1CLZL 2QHLA 5D2LE 2XPGB 4H5SB 1F6AA 1KT2B 4PJHB 1FZMB 1UENA 5IVNA 1RV6X 3X2QB 1PG7W 2BSSB 3O4OC 1RVFL 3GPEA 2W65B 4P0DA 1DJIA 5JORB 4L5FH 3KPOA 4TPRH 5J5EA 1UZ6E 4IU3B 3ME0B 5KYWB 3R18A 4S10A 1TVHA 1RMFH 1X9UA 1X3DA 2XTJC 4OUOA 4WI6A 1JGUL 3Q48A 1AZVA 4BXVA 3NZHL 4ELMA 1XGYL 4NO0D 1V10A 3ARYA 3FSAA 5F1IB 2YPVL 2ZG1A 4JNXA 1AR1C 3RPBA 1B2YA 5CBAA 1SJMA 3ZKMC 2MQ3A 4ADIA 3L1OH 4JFOA 4Y7OC 2H3KA 3RTLA 5HHOB 4XX5A 1IJ9A 1P7QB 1NICA 2AMUA 3BKCH 4AM0B 2EO7A 4QOKB 4O02B 2R0LH 1JXGA 1G7IB 1UWFA 5AW2B 2I07A 2DQCH 1JZ3A 4HVBA 1GW6A 3ARGA 5FHAH 1WE5A 2CDFA 1UXLA 2R4RH 4N9GA 2EJ1A 4ALAL 3EDJA 5ALCL 4PI0A 4IRJC 4F7PA 2YXMA 1DN0A 4XMUA 2ZUUA 1A4BA 4P3WA 3PJSB 1XFPA 2CO1A 3OKLA 3T2NH 2VLJE 2BP5M 1JCVA 5BQ7B 4APQC 5LUMA 4L37A 5F9DC 4L4TB 1JGLH 4OCWL 4JZJA 4QHNB 4IBLT 3OKMA 3LKNB 2EXSA 2ZTBA 2G9HA 1CICD 2LAGB 3Q8BA 4M48L 4XPAL 1LO3H 5JTWA 4XC3H 3VWKD 5LJYH 4KZDL 4JFQB 3NH7L 4FA7B 2WP3T 3H2QA 1B0RB 3OKEB 4C55A 1TF4A 5LVEA 2HRGA 4QNPE 4ZJ9A 3R8BB 4A6YH 3RWFA 1F1DA 4QRAA 4YDMA 3MQIA 3N2JA 3N1QC 2QMKA 3MTXA 5DT1L 2MCG1 5I8OL 1KXTA 5I8CA 2AVFA 5AVUB 3IMBA 3QFJA 3RUGE 2PO6B 4DOHE 1R17A 3MZGB 3SIKA 4RMTA 1NQBA 4Z78A 1WICA 1ND0B 2AF2A 3DTUB 2YIHA 2DWYA 3L3JA 5J06A 1KEGH 3NFSL 2PF6A 3QQ9C 3ZE0E 3WYRA 3F6LA 4D2NA 3MV8E 3OMZA 3PXHA 5ILTH 5ABDE 3SPVB 1JV5B 2LTQB 1IVTA 3V2AR 4L2LA 1U8OB 2R23B 2GPZA 4PJGB 2AXFB 5A7EA 3HPJA 1AD0B 5FFOA 2PN5A 5GHWH 3ESNA 1WQVT 4UM8A 1K8IA 4M00A 5KJRL 4B0MM 1G7PB 1C16B 1WA0X 3RGHA 4B50A 2VXSL 4PJEF 3VGAC 5CNHA 2UYLA 1FGNH 2E46A 1CE1H 2ZKHH 1MCQA 2ICEA 2HVKB 2GUOA 4V11A 3VGGA 4YSRA 1H0DA 1QI3A 2NY3B 3ROLA 4HHWA 4GW4B 3VRIA 1CFVH 3HPLB 1RURH 1GSKA 1U8NA 2DEXX 2QPEB 4HF5L 4NAMA 2F53D 1HYSC 2LLNA 4IRZA 1BOGB 2FLRT 1UWXH 1RZKH 2CK2A 4PJAE 1R5VB 1OTTC 2Q2EB 3ZZSA 3FCSA 4P3CL 2BY1A 1BQ5A 2AJVH 2ZPKH 4OCXL 2Y1AA 4HK0A 4YHYB 3WEXA 4V1DA 3IU3B 2ROXA 3QXAA 4N8VG 4YMPA 3GWJA 4YUEL 5CINL 3A6BH 3GHEH 5C0AE 4K8RD 4FFZA 1WS8A 1UACL 1ZLVH 1YZZA 3KPSA 2OSXA 1LEIB 1XR9A 2F8XC 3HS9A 2D7OA 3IFOB 4HCRA 4UQAA 3QUMH 4PJXA 3LKQA 5EU4A 3PY9A 1TZGL 5IMLA 1KPUB 1AZNA 1VFBA 3UTTA 1CDGA 1M7IB 1M7XA 2MQCA 2RCSL 1IC5H 1UASA 2VRQA 2IDTA 2X4RB 4HPYH 4PV9B 1DLFL 1JZ2A 2GITA 3CVDA 5IG7B 2Y7OA 4L3FA 2BS9A 1KFGA 2K45A 4PJBB 3IE9A 5DQJA 1K6QL 5AQ0A 5FLUA 5ADOH 1JFHA 4N85A 1E8XA 5HY9B 1QQDA 3NABH 3I75B 4LEOA 4KDVA 1CDYA 3EHBB 4XI5D 3CSBA 3SGEH 3ZTJH 1JPFA 1PSKL 2XUWA 1RK1A 3DGCR 3LNEA 4YHZL 3C09B 4BH8A 2KQMA 4P5TD 4KK6D 2H47C 5CILL 4GRWF 4MBRA 1EDYA 5INCB 1ZPLA 2HRLA 1OTUC 2XWZA 4X0KA 4RX4D 4JPKH 4NQSA 3IDIA 4FQPA 4YEEA 1NIEA 3GMLA 1LK2B 3BH9A 3BZDA 1ZS8B 3U7AA 1H5BC 1UATA 1YEFL 3ZIYA 5CGYD 4U1NB 3F65A 1I1RA 3RHWK 3W5NA 2VMEA 4LSQH 1SYSB 3T0EE 1MLBA 2BC4B 2EADA 5HGDB 2R8SL 4OZHE 5J89A 4Z7VF 1RUKH 2EIKB 4QHLB 1RZQA 5EZOH 4PTUB 5E5MB 3ZN6A 3ULVF 3H3PH 3VXMA 2HTLC 3C5ZC 3N41B 4A6YB 2Q10A 1JXFA 2AQ2A 1P4BL 1AQMA 2AEPH 3WS3A 1GGBL 4OLWL 3RU8L 3D39B 5IQ9A 1NCBH 2GCYB 1XH0A 1TQCC 4X7TB 1U8IA 4IBYA 1ZT7B 3BEVB 1WBXB 2J25A 4YBLB 1E9PB 1A7BA 2OP4L 1VPOH 3RIAF 5C8JA 5JQ6H 3S8FB 4IMKC 1OAZL 3QZWG 2N1TE 5J9PB 4PR5A 4FQIL 3GZQA 1TTBA 4L8SA 1EEYB 4ABQA 1ETZA 2WUBH 3FQYA 3UYPB 2J4WL 3NIFB 1D5BA 4JY5H 5I1KH 2BNQD 3MUHL 4Z3HA 4KXZH 5BVPH 5IP4A 2EZ0C 2ZX9A 1FO0A 1TJHL 2ZONA 5ECGA 4KJYB 4PJ5D 5CGMA 4IRZL 3P11H 3SYPA 3T0AA 2RGSA 2XWJB 5F89A 1I9IH 1QA9A 4AYMC 2Y7LA 1OP5H 1E0OB 4PGJA 1XHHA 3JWOH 5A2IH 2EDDA 1R3LB 4Y1AE 3QIBD 4NC0B 5AW1B 5K59F 4K9JA 5I0YA 3BW9A 4ZW6A 2PP7A 4A04A 4FFZL 1HE7A 4GI6A 5HP5A 2VR9A 1SDDA 4GRMB 4U0RB 4OU3A 3NP4A 4J4PD 2WBJC 1LNUB 4MJIA 2NZ9D 5D2NE 2EH7L 2HVJA 4FNQA 2UUDK 2WVTA 1I1YB 3D18B 2A0LD 2BP0B 3DIVA 3F00A 3P4OA 2BIPA 3PDOA 2APTA 5C9JA 4LLAA 5F6IC 4QMEA 4S2SB 2EO9A 3NACL 2W9DH 2B59A 1QPKA 4PVBA 3KPRB 4WJ5A 2V5SA 3IFPB 3L4TA 2V33A 2DM4A 3HZKB 1NBYB 4F58H 2QQNL 4HOZA 5FYLD 3UPCA 5FKAB 1L0QA 4Z7NB 4PRPA 3SDDC 3HMXA 5GGSA 12E8H 1T2QL 4L1HA 2VR7A 3CFEA 1QO3B 1IQWL 1NPJA 3KS0J 2J3SA 4UB0H 3QUMB 5T3ZH 1F2QA 1KN4H 1A7OL 1K5WA 3CWGA 1EANA 5C08E 4NKIH 1A0QL 1LEGB 3LS5H 1XO8A 4L8DA 1KB5H 6FABL 2SEBB 4LOEA 2VDQL 5C07E 3VXUD 5IBTL 5C6TL 3W0WD 4NP4L 3KLHD 2IALA 1SF5A 1W16A 2X89A 1H9VA 3CX5J 1S9XB 3DGDA 1W72L 4MX7B 2DQJL 2FWOB 1G9EA 2Z35A 2G3NA 4JG0L 4NX0A 4NKMB 4RDBA 4NM8H 1CFQA 2FJUB 3LHPH 4Z76B 3O4LA 3BQUC 4ZFOA 5JIPA 2IO5A 3VWJD 2VAAA 4NOFA 5AG9A 1AXSB 3LZPA 2PR4L 3EF7A 1NGQH 1XBDA 2YO3A 4UQ3B 3RZCA 4OZGA 4PRBB 2ESVB 2WLIB 1T03L 1SN5A 2OZ4L 4RRPG 3GMMA 5TH2B 4PD4J 2QQLH 4N8CL 1S3KH 3FKUS 2BCMA 2Q20A 4LCWD 4LKXB 1WIOA 4TNVK 2FQEA 3NJXA 1UZ8A 2WMPA 3PV6B 2KUTA 4L4VB 3HC0A 2E7LC 2ARJA 2X7LB 2UY6B 1XF2A 2F54D 3U46A 1G9NH 3AB0C 1X5MA 4ONHB 3VSQA 4GY4A 1S5IL 2OMUA 3N9GL 3TO4D 1LDPH 3V52L 2GTZB 2CA4A 3SDAD 3EGXA 3S3CB 3VVWA 1P5UB 1G84A 4B9CA 5JOPE 3IJHA 1MF2H 3MXVH 5BJTB 4PB9L 5AD0B 3UC2A 5EO9A 3FT2A 1QPXA 1ADQA 4HEPA 1MVYA 4XN4A 1USQA 3ARBC 5DXWA 3R4RA 5AVQB 4NO3A 4A38A 1KENL 4CBZA 1ZDSA 2JLPA 4JDVB 1MLCB 1TXKA 4UM9D 4MSWB 4AL8L 3KCPA 4C54A 2XTLA 4EDXA 3FO9A 5IQLA 4K5LA 2GT9A 1D9KB 5B7EA 1DSFH 3N1GC 3PP4L 3SKMB 4WCYH 4OF5A 5DJ2B 3GSXA 4YWGH 3QNYB 4GG6B 1BD2D 1DUYB 3FB8A 2AZAA 4WI9A 1XIWB 4CVZB 2XZZA 3SOBH 2ZKXA 1IUZA 2FSEA 3E9UA 1X5XA 2GC4C 2B5IC 3G6AA 4LSTH 4XP9H 2CKBA 2P48B 1MAMH 5HI3C 3MROB 2WIIB 4GP4B 3AXLA 2GSIA 3HMXL 4UUJB 3C60D 3EXJA 3MRKA 1PZSA 1Z9SA 3NCFB 1V3MA 4G8GB 3VG9B 1T5KA 4I4WA 1OSEA 3V0GA 3ARFC 4PW3A 3SHSA 5C0GB 1OM9A 3HRZB 2CJUL 1ZCRA 3VGEA 1DJGA 4P5KB 1TCRA 5EZLB 4K3GA 1QZNA 2W07A 5DMGC 1OW0C 4RGNE 4FQCL 1AQHA 5DRWA 1AYRA 4ZPTA 2J2ZB 3MUGA 3QI9D 4OQTL 1EZUA 1QRND 1W2KT 3R06B 4GP8B 3H6AA 5D7EA 3QEQD 1ED3B 4J27A 1BQLL 4I0PA 5LBSH 3W82A 2OQJA 1C5DA 4U7MA 4PY8J 1ZHKB 3U4EB 1AKPA 1P1VA 2IWEA 1J5OL 5D71H 3C5SB 5TE7L 4XH2A 1KB5B 3CFBA 1DVFC 5EC1B 3WLBB 2ZJSH 2J1ZA 2CQVA 2ZSWA 3D05A 2VMDA 3MFGB 4L8CB 4HP5A 1GOFA 5FYKE 2W59A 2AABL 4TM9A 1J9CT 4F91B 1N0LB 4F9LA 4AYFA 1TTUA 5FOBA 3O8XB 3RVVC 2ADGA 5SWSA 2G2PA 5GRVK 5FW7A 4LOUD 3KR3H 3F8UB 2YQ3A 1I1FB 2BY0A 2P26A 2DY2A 2HPOA 5IIEA 2ENYA 1GRWA 3SYCA 1DL7H 2GTWB 5TTRA 4JFFE 3HFMH 1C9SA 3PGDB 1DO6A 4FNUA 3S4SB 4I7ZC 1HEJC 1U8QB 2GAZB 2JXMA 4MQ7A 1OL0A 4C8XA 3TNMB 3ARGD 3IDNB 1SJVA 2JMRA 1RZJL 3IJ8A 5GGUA 3Q2VA 3QIUB 4AVHA 1CO1A 3MBXL 5I0XA 4DPCX 3BCFA 3FTVA 1EEZB 4RFOH 4D0BB 1MHHA 4L29A 4EN2A 3NDZE 3NPSC 4DF9A 4NM4L 3FQUB 3APCA 1DBMH 4WW2C 4CSTA 4TVUA 4XC1H 3JWDL 3GS7A 3NSYA 1KB9K 1KTCA 3RY6C 3QDGE 5KS9F 5JUEL 3L3DA 4OZFH 4JR9H 1NOFA 2Z34A 3RL2A 3REVA 1UM5H 2TRYA 5GJSH 3TV3H 4JZNA 4R0LC 3CN2A 4P9HC 1HILB 1CE6B 4G6AD 1D5IH 2VDNB 5HGAA 1G7HA 1S7UA 5F1SA 4CN6A 3KVPA 4LCIH 3B2MA 3VFUA 2BPBA 4GAGH 2MTAA 4PSRA 4QR7A 2VXUH 3UPAA 1SXBA 1U8MA 1M1XB 1UADC 5LXGL 5TPWL 3FONA 2VRAA 4JG1L 1KCWA 5KN5B 3GI9L 1OOAA 4JQVA 5CP3H 4QI3A 3TASA 2ALWA 2DQUH 2YAPA 3UXFA 4AQ8C 1M2VB 2PMZA 3LN5B 5DR5H 4QPEA 3F7VA 3CQFA 3TBTA 4ABUA 2E7MA 3SKJH 4APQB 2GFBA 2JKTM 2RHEA 1TZOA 5A2JH 2A9NL 1YYML 4P2YA 5DYOB 1MCPH 4OLVH 2Z8RA 3MX0A 4XBEL 2E4FA 1JWMA 2A74A 2KDYA 2V9RA 3AABA 2EEFA 2O5ZH 4OT1H 3ELQA 1YECH 2QSCH 3TESA 3IK2A 4EZKA 1DZBA 2KBGA 4AEIL 2NYKA 5ESQB 4FLHA 4HIEA 2WBXA 1X7TA 4N2HA 4GRWH 1QFWH 4GKSA 3S7GA 3ZQXA 5SWZB 2Z31C 3B7SA 4AV4A 2Q6WA 2X5PA 2KLRA 4XVOA 4HFUH 2EEAA 4V1DD 3PWVA 4N4YB 1SMOA 3GGWB 4NWUL 4WENB 1S78C 4J3OD 2YD5A 4FZ8H 5AVYB 4AXWB 4KO5A 3IDJB 2IH9A 2YA1A 5E2UH 5AZEL 3KPSD 2PYFA 1VEOA 4FN0A 3O9WB 2BSCA 5E6IC 2FD6L 3EBGA 3CLEH 1FAKT 4XP4L 2IG2L 3L81A 3ULVH 3P3UA 1S7XA 1R3JB 1U4EA 5F7UA 3RX8A 1FL3A 1WSST 4H8UA 3U9WA 4CVWA 4I2XE 4DUWA 2CUIA 2NW2A 5FV2A 1INDL 1A2YB 2NTFB 3O2VL 4Z9KB 4NN5C 3IFLL 4K9EL 5DJZB 1O6SB 1EBPA 3TCLB 3QRFM 1E4HA 3VGAB 4YFLF 1TQVA 1YEEH 4TQPA 5JMRA 3AY4A 3MYJA 1FFPA 3FSWA 4JKPH 2FEJA 3O2DL 4PW4A 3RWHB 3L4CA 3EGDA 1AGCA 1H8NA 4HAGA 3KMDA 2VN6A 1AI1L 2VLLA 2ZOLA 4A7UA 3OX8B 1LM8V 4YX2H 4J3SA 2HUEA 4OLUL 3APMA 1RULH 2Z93B 5DTFA 5B38G 1CL7H 4ZW7A 2O61B 2ENJA 2A38A 3QUXA 4BM7A 2G5RA 5FO8B 3FAWA 2X6AA 1JWUA 2QJDA 4KK5C 3ZJAA 4BFNA 4LLVA 4NBZB 5L7XH 3VRLF 2WHVA 5I23A 1TFHA 4PS8A 3WFBH 3KXFE 2HT2D 2IADB 3ILEA 5ERWB 5T3XH 4D0DB 4Z7OF 4AQEA 4HWBL 4PJ7E 3GS4A 5TFSH 2XJLA 2W60B 1F4YH 5GRJL 3F05A 4R6UA 3SJVA 1DVUA 4G42A 5E94A 1I8LA 4MD5B 1WBYA 4ONOA 1V54B 5CHNA 3D25B 4M61A 1QKZL 4OZFB 3WBDA 1KSRA 3MAWA 2H2PC 4X8GA 5B1JC 1D5MA 3UTPD 1BZOA 1IBHA 2LHAA 2C9VA 4X6CF 5ANHA 4ZODA 3C6EA 1OB0A 5D7HA 5E6ZA 4GFTB 3S35X 1ULVA 3N06B 3GZOA 3S3DB 1UZGA 2Y07H 4XO5A 1ZVSB 1FSKB 1KEML 4LPVA 5HI5D 2DW5A 4XXWC 3EOAA 3VX0A 3LXAA 4CJ1A 1PLGH 1UD4A 5D96B 1BZ8A 3C08H 1MH5B 3SGJA 4TVSa 3VFWA 3OAZH 1GW0A 4EUPG 4PJDA 3TOPA 4WWKC 4JB9H 3MRLB 4BGDA 2ZCHL 1YPZF 4AJVA 3MLWL 4ZMOA 5D7LB 4UU9B 2O93L 5FX3A 4U2YA 5HHQB 3KAAA 1J8KA 3EH2A 3L2NA 1A21A 1HCYA 3IDXL 3K72A 3L7EA 3WIFB 2ENSA 3CGTA 1H5BB 5KG9B 1FN4B 3BIKB 4XO3A 3HG2A 2QHRL 2H32H 4JFPB 2DJUA 4XN8A 4ELKA 4MLSA 1RU9H 4P2OC 1GXEA 2ADJB 3EADA 5ICYB 1L9NA 5SV3A 4KUCD 3ZTNH 2QPDB 4IS6A 2F7PA 3MZTA 4O2CB 3C5ZB 5IFAH 1OEZW 1PLBA 3MRRA 2NMSA 3AM8C 4MJID 5I73C 3N43F 4B9GA 4UDTA 4GRWB 1GGIH 3E6HB 3F7YB 3I6GA 4NHUA 2DMCA 4UIKH 4M6NL 4LLUA 3GUTA 2FATH 4MHHI 4FP8L 5FCSH 3KVDD 3Q8FA 3TFKD 5BRZE 2IFFH 3G5ZA 1G7LA 4DQOH 4RQQB 4YE0A 1ZGLP 1CTNA 3DSNA 4U31A 5JQHC 2XV2A 5DZVA 4KWUA 4HKBB 5IM7B 2XETA 1CXFA 3MJ9L 2VUKA 1T83C 3U9PL 1NEZA 5TGBB 2W9EL 2B0SH 3GMPA 4HJJH 3KS0H 2R0WH 2KI6A 2XICA 4M8QA 4OLYH 5I1GH 3H8NA 4MNQA 4UBDC 5F88B 4PV8B 5F9JB 5JIIA 5L9DL 3FN0H 1J1PL 1AGFA 5F7MC 1IM3B 4XMTA 2QLYA 4BINA 3HG3A 4FMKA 2RAMA 4Z7UF 4Q89A 2NR6D 5MENE 1MFCL 2VE6B 3QP3A 4H1LA 4GI9A 1K2DB 3I3BA 4B5ZA 5AW3B 4G3YL 3UTSB 4XTRD 2X89D 1MJJA 5AOMA 3MRFB 2QVMA 2WBJB 3WNIA 3LZQA 5A6LA 3AC0A 3AREC 4J3VA 4WU7B 1DBKH 1YQVH 1IEBB 2NXZD 1BFOA 5B8CC 4X99A 3IXTB 5F6IB 1C5CL 5BZWA 3ABZA 3A4DA 4BSWA 5BW7C 3V4PL 1AVAA 5A2AA 3U2SB 1LDSA 2Y36H 4LBEB 1A14L 2AERT 1FFOA 2VDML 3GC3A 4OIAA 2Q86B 4G8IB 3T4YA 5FDWB 4OGYL 3RZCD 2HFFB 1JS4A 4R96A 4IEFA 3RX7A 4TRPH 3BE1H 3LV3A 4QAMB 3EO1B 1MELA 2DEYX 4AC4A 4NENB 2F8OA 2CRIA 4PBVC 1TEFA 1KJVB 3SDDB 2WXOA 3F6JA 1EZSA 1U41A 5AFAA 5ETUB 4FKHA 1UOWA 3F64A 4JFZH 4QRPB 1YNKH 1Z0MA 3ZLQC 2VIRA 4YBHA 5FK9A 3ALPA 4PCYA 2NY6D 2QTEA 3M46A 2NX5B 4JHAH 3DMMA 1BBDL 3U4BH 3VNYA 5DEGA 4QO1A 3S8GB 4JRYD 1IGTB 4N0CD 4BQCA 3D0AA 4MKTA 1GGCH 4GUCA 4E5XB 3P4LA 1NCDH 2NCMA 3MXWH 3SKNB 2UWEA 5CZXC 1TZHB 4H2AA 4QF1A 1AZUA 5CWSB 4BK4A 1CVSC 2OM5A 4HQQH 2WXKA 3MGTA 3BQUB 2TSAA 2WY3B 4MJHA 1HINH 1AQKL 2LFGA 4C57C 1T1XA 5DLLA 1VADA 3WEAA 4S0HA 4PJ9C 3L3OC 3TIEB 4KVCH 1YN6A 1KWGA 2GBTA 1JZIA 2FJGA 2X4PA 4ZUSB 1LD9B 4Y8AA 2ITCB 2YBRB 4NKDB 1CD1B 3D50A 3WSQH 2DRUA 5DHYB 4P23A 3HZMA 4TN9A 1T4WA 1OGAA 4M1DL 3WMSA 1BAFL 3ZE2E 1KCUH 5AAWC 1E65A 2H32B 4Q4EA 2CBPA 1I1AA 1RHHA 2L04A 4XAWL 4E41D 4H0GA 2ZD0A 1S7SB 3AB0B 1F4AA 1YMMA 2RR3A 2YD6A 2KZKA 1IKFL 2H26A 4ZFGL 1RZGB 4H8PA 4JL1A 4D9LH 2B3IA 3FOLA 3RLSA 4Z5RB 1MPAL 2VXQA 2XA8L 4P2RB 1LO5B 3CZSA 3HHRB 4QKTA 5D2LF 1EAQA 1ODUA 1JZFA 3S37H 1CS6A 1KUMA 2UX6A 4KKAD 2CNZA 4L0PB 3L5WB 1CF1A 2P7TA 5CCKL 4YL9A 5J12C 1GPOH 5LNDA 1KXQA 1KYOJ 3MU3A 5DDHA 1UZ6F 3OF6A 1QRKA 1C12B 1D2OA 1SEBA 4K15A 3GXTA 1CZ8L 1FLTX 3ARBB 4MA3A 3UBHA 1XMWA 4ONFH 5JO5B 1U3HD 2YC1B 3UC0H 4P9HH 1CFTA 2BWQA 4P5MA 3N85H 2WUCH 3AS0A 3PL6A 3VRJB 5BO1H 2WV3A 5JDJA 3GSUB 3KLQA 5IR1B 4KROC 4JFXB 1IGML 3ESUF 2WWKT 1MRCH 2BWIA 2X44D 4GSRA 4YSPA 4I0PD 5I30H 1ZKAA 2P43B 4QYOB 1Y6NR 1HHJB 2JJTA 1GJUA 3S35L 4AG4H 1OAQL 1U4FA 2XIIA 2BIHA 3QZOA 1DQVA 4X9BA 3N42F 4HEMA 2YXWA 2OW6A 3EH1A 1VESA 3K2KA 4I1NB 4TSCL 4XN1A 4ATWA 3UIYA 2HWZL 4P46C 1CXHA 2B5IB 4FHKA 5HJDA 4LMQE 4ERSH 4K5MA 3D48R 2D31B 5EC2B 4NQED 3BUBA 3MTRA 3QJOA 3DBXA 1IBDA 1KTBA 3QDJA 2EABA 4EI6B 1QUPA 4HSCX 5K93A 1R0AH 5D8JL 1ZTMA 3NJGA 1OARL 1K5NB 4S1SL 5T33H 1LP9E 1PYWB 2C5DC 5ESVA 2ENQA 3ARFB 2YPKB 3ZXAC 3D0LA 4TTGA 3UJTH 1WZ1H 4KTDL 4JFEA 5TQ2H 4BA8A 2AQNA 2IAMA 5IB5B 4KXAA 4QNPF 1QPPA 2FEDC 3CUPB 4XCYA 2VO8A 3D69A 5IESL 1TEGA 4GQ9L 2HXAA 4B27A 3VFSB 4J8QA 2XIDA 5F0LB 4HBQA 3T2PA 3GT6A 3RUGF 5ISZA 4HUKB 5DUBB 3VMPA 3PGFH 4ZO9A 5L4FA 5KSBA 5KYXB 1H8LA 3UP6A 3FU7A 3OM3B 2CE6A 2R2CA 4N3TA 5EOCJ 2IBZY 5F3FA 2XQYG 1A6ZA 1PTZA 1QHQA 2FIKB 3DVIA 1KY7A 3ZE0F 2DI7A 3ZL2A 1YCSA 3LEYL 4Y2DC 1OPGL 1N18A 2VITA 2OI9C 1A7NH 1MJ7L 3WIHA 4GSUA 3O6ML 1YUKB 4KFZC 2R29A 3NZHH 5J1AB 1U3JA 2NY4D 4RNRB 1EUUA 1TJIH 3GJFB 3M8OL 1KNOB 5H35A 3DX6A 3Q6FA 1TQWA 4BZ2A 3QULB 5DFVD 4Y1SA 2W91A 2EINB 4NO2B 2MQGA 2QQKL 1ZV9A 4HDIA 3BZ4A 5EBWA 3KGRA 1GGUA 1R24A 1VDGA 3BRGC 4D9QE 4K7FB 2F7OA 5B4MC 1F86A 3QDMA 2OYPA 3S9DB 1OM3L 4GW5B 4XBGB 2JJSA 5D7IB 3TA3A 5HYJE 3DLQR 4ALAH 5ABZA 1PX3A 2AQSA 3AJ7A 4UI2A 3KPQA 3VXRA 4QHUA 3HKFA 3WTVA 5JDSA 5DEJA 4PJAF 1D7FA 2OJEB 3GFUA 4HS3B 5B3NA 1JP5A 3F7LA 1IC4H 1SXAA 1CBJA 3S5LA 3WLWD 5B3SB 4UT6H 3UZQB 1DJHA 2VT0A 4NUGH 1ERNA 4ELME 5C0FB 1M3JA 3NPSB 4XPAH 4ZOEA 1E3XA 2X4SA 4M7KH 4QRFA 4WW2B 1HEZA 4FMFA 4Q9RH 3MLTB 4G9FA 3S5YA 3SSGA 5B39B 1O6VA 3FUNA 2MFNA 5DT1H 3S3SA 4XPTL 4OFKA 4MAYB 2G5BA 2DF3A 3I6KB 2DJMA 4I9WD 5I75B 4YHMH 3WKPA 2D0FA 2CRYA 1ACXA 3QAZC 5ES4B 4OJFL 4R0LB 4XPBL 4DZBA 3KPPB 4JLRB 5GS1C 1CPUA 3QCTL 4ZD3H 4NT6B 1UT1A 3IJSA 3BGFC 5IBLC 4R26H 1TENA 1PZBA 5GZNC 3T8XA 1NDGA 5FGBC 4JRXB 4AQ1C 3MGOB 4OFDA 3LQZA 4H0HB 3KWVA 3EZJB 3O2WL 3L5XH 2AQPA 2IQ9L 3ES6A 4MCZB 5KS9B 3EBIA 3CZGA 2XZQH 4R2GD 1QEWA 5KJ7E 1WT5C 4MBOA 4HV8B 2ZWKA 3MJ8A 4IHBA 5DJAB 2WQUA 1CR9L 2E9IA 2F0CA 2XBTA 3LPOA 2C9UA 4K3DH 4PJCA 4E2OA 5T5FA 3VXQB 4JM0A 2E8YA 1YEGL 2VXSH 2YJLA 2ZQKA 3REWA 1MRDL 5AW6B 3QFJE 4ESKA 3VI3A 4F7MB 1AZRA 4YDLB 2J88L 1GCFA 4LP5A 1JZ7A 3CDGA 1L5GB 4A2DA 3DPDA 4F2ME 2W0FB 2QFRA 1NCTA 4R7VA 5I8EA 1MCDA 1BSIA 2IF7A 1LE9B 5IFJB 1NBZB 3F12B 4OZHF 3COOA 3PHQB 3RVUD 4P3CH 2ZZUT 4IBZA 4TL5A 1H3GA 3AXHA 4JPSA 2YAFA 4YJZL 4LU5H 5DRXB 2Z31B 3V79C 3OAUH 3IRPX 3ARDC 1KDIA 1PZ5A 4FL4C 5T1KB 1UACH 3WN6A 1NGYB 2XKNB 4OGAC 1SOXA 4OD1L 3AU0A 3O3BA 5DGQA 3QUXD 2Y1YA 2QR0B 3QHZH 3SE4C 1PY9A 1V3KA 4FADA 4X8XA 3HB3B 5TK4A 4BZ2L 4F33A 4X2UA 4H8WL 1W91A 1XCTB 2OTUB 5E6IB 2Q8BL 3N0AA 3MNWA 5EEXA 2ZYSA 4G80B 1O5DT 2Z8SA 1N10A 1TZGH 2R83A 4XXDA 1NFAA 1VFUA 1Z6JT 4XCFL 2BVTA 2GBAA 2E9WA 2RCSH 3SGEI 3OJ2C 3OV6A 4KKRA 3SJVD 1U3YA 1NCNA 4NN5B 3ZTEA 2P42B 4LAQH 2X9YA 2YS4A 1UWXK 1NIAA 1SMAA 3CC5B 5CLWA 1IAKB 2ZOUA 5J6SA 5T1LD 5E5UB 2Q3ZA 3GO1L 4XAKE 5DZLA 2AV1A 4IRJA 1YUHB 1CXEA 4Q97A 4MNGB 3I2CH 2P46B 4BCZA 5EA0H 3WJLC 3K0YA 4RZKA 3D33A 2FNBA 1ZLVK 3UG5A 3ESVF 4X7EC 5JNYA 1Z9MA 3NN8B 4AUJA 5LGJA 1AHWA 4WUUB 5I74B 2C3HA 5AOJA 2K9FB 3BP4A 3DK2A 3QUZA 1RIHL 1SJHB 5JOEA 4LSUH 4C47A 1T1YA 2K6YA 3FAXA 2IPKB 3CAFA 4Y4FC 1AY1H 4HXAL 1SOSA 3UTTE 3VFVB 1IBBA 1INQB 5GGVH 2M83A 5TE4H 4BUHA 3FZUD 3GRBA 5BNXD 3LSOA 4R4FH 2V17H 4RAUB 4EXKA 3U0TA 2X1PA 1WZKA 1ZJAA 2OLDA 4KQ4H 1KG0B 1ACYL 4NO5B 2HZHA 2VXVL 5B21A 4PTTA 1DEEB 3G5XB 1LXMA 3HLKA 1E6OL 5E08H 1JGVL 3F58L 2P24A 4Q8BA 2ZWNA 1P4BH 3KPNA 5CU5A 1BF2A 2WXPA 4OV5A 1QR1B 4U7KA 1Y1DA 2GSGB 2A9BA 2X53A 4S1QH 3PJNA 1HH9B 1FNEA 2VDRH 3Q9PA 1JXKA 1JJUA 2YA2A 3L4XA 1Q0YL 1HAUA 2P5WD 1X4YA 1EJ6A 5F6HJ 2H9GA 3HLAB 1C08B 4Z7OB 3OGCB 5C0DA 5H94A 4BFKA 1BQHA 2OCFD 3B2VL 2PKDA 3HFFA 5AKRA 4C58B 4OFPA 3U0PB 5CXPA 4CJ0A 5ITBH 1HKLH 5IWLC 2VLRA 4AT6A 2UXTA 2Y7NA 2VM3A 4C56E 1L6XA 3K8LA 2OULB 4WGKA 5BPPA 5MI0C 1AOHA 5H37A 2HVBA 5EUKA 5HDLA 1B6UA 4MNQD 4AGQA 1JGDA 3TT1L 3B2XA 1E6JL 4NI3A 5AL0A 1KBKA 1E4XH 5EV7A 1O6TA 5INDB 3MRBA 3L3GB 4KC3B 3VAEA 4W9FC 1X5YA 3OKKB 2D4FA 4MS8D 2P80D 3D0VB 3MA7A 4GO6B 4MYPA 3ZK0A 3OLIA 5IW1A 4UCFA 2CLVB 3TN0C 1ILUA 4B9KC 1ZTXL 4U1IB 4ZFZB 1RIVL 3OKYA 5D1QA 4TSBL 4URKA 4FG4A 1PAZA 4GP5B 1JZGA 2GI7A 3PWLB 1DQJA 2D03L 1PNCA 1UD3A 3RNQA 4GMSH 3V5HA 3DJSA 2LU7A 5I73B 5L4MA 1GYAA 4WI0B 4ZTPH 1YPZB 1EDQA 5GZOC 1NJ9B 3BDYH 5D1ZC 2QQNH 3A0OA 3HUJA 5ICXA 3TO2B 2XACC 5E1QA 2JELH 1C5BL 4B7IA 2B8OT 4WHTB 4TTDC 4LT7A 1FWXA 2EUZA 1A9BA 4ZUUA 3IMVA 3RNKA 2HN7A 2X4TB 3V6FA 1QNIA 5DJDA 5HHPB 1EBAA 3IGKA 1A0QH 5DZAA 3SDXA 1E2ZA 3H9HA 2VQ1B 4BFJA 5LB1A 1HHKB 1J48A 1J0KA 4UT9A 2O6PA 4RBPH 3N43B 4HFWA 1FYTE 1UXSA 4AI7A 3FBQA 4KMLB 2WOBA 3C75A 4WHYH 2HSIA 2QELA 3M1OA 3RGVC 4FQ1H 4UOW1 2FQFA 2HT4D 2WXRA 4FJYA 2VYRE 1FFQA 2DQJH 3T2LA 3ZR5A 1G7JA 4IRSA 4Z0XA 3IF1A 4KUZL 2X28A 3WL9A 1NCWL 3P30L 3QZBA 1JZDC 2LR4A 4FS0A 1HDMA 4PRPE 4L1DA 1JNNL 4H88H 4OTXL 3CVIH 4EF3A 5B8CB 1IJNA 1UA6L 1NLDH 3D3VE 3W9EB 1Q72H 2AI0L 1P7KA 1T80A 1U2HA 2CDGA 3UAJD 4DGYL 2WLZA 5E70A 1EHXA 3TYFB 2KPNA 1N59B 1RFDH 4F8QA 1WYJA 1YEHL 5FF6B 1ASOA 1XGRB 4WZ9A 2WD0A 4WFED 2EDMA 2FE0A 4EN3B 2QZ5A 1MFAL 1K4DB 5C0EA 4P23D 1CU4H 4RSYA 1WFJA 4P9MH 3VSTA 5I16B 1S5IH 4Y9BA 4A55A 3BXNA 3MUJA 2YD7A 1VENA 3CFCL 2B20A 1J05B 1I1AD 5D7KE 4QCIB 1N3NA 2AKRB 5FKPA 3O4LE 4I3SL 3WNOA 1DSYA 4RIRB 2ISDA 3K46A 4CADB 4EIUA 2PW2B 3OKNA 4F8NA 2ZWLT 2VDRB 4PJIA 3SKUD 1DJXA 3GBNL 1HK6A 4D7BA 4HEPG 4NWTL 3CN0A 3M1BA 4HIPA 5D72L 3OF6D 3SCMA 4UTAL 5HVGB 1OE3A 3P73B 4ODVL 3VD0A 4RISL 3GDCA 1V3JA 3CFDA 3PL6D 4PJ9B 3DHMA 4OJEH 5I6XC 5AVXB 3FFCB 4W4OC 1A7RL 3BISA 3HHSA 1MUJA 1F1GA 1J1XL 3P4MA 4NZUH 2WINB 1ZT1B 1WCQA 1Z9LA 2CBMA 4JHWH 3B5HA 2CK0H 3IJYB 2IANA 2RB8A 5E4EC 1P4UA 1JK8A 5HTSA 4Y89A 1D6EA 3VW3L 5DSCA 4LASL 1ZGLA 4PGCA 2CCLA 3OC8A 4MTMA 3U82B 3NJLA 4F24A 2HJFB 4OCYH 5IB3B 4ZS6D 1GHFH 4HKJB 3UGUA 2IH3B 2LVCA 3X14B 3OSKA 3I84A 4HZAA 1TYRA 5GRUH 3RKDC 4U49A 2QADB 1TO5A 1CD0A 3IDYB 3QBTB 1SQMA 5EMYA 1A6PA 1NZRA 4KKQA 2O4EA 1KCKA 1LMIA 1NGZA 2IAMD 5DCCA 4G6FB 3C6LB 3O3UN 4Y9CA 3GK8L 1MJ8L 3MLZH 1R19A 1EJFA 3NCWA 4KROB 1I7RA 4IGBA 4WFGD 2Q7YA 5ISZD 1S7QA 4PVLA 2MWCA 5D2LB 3SGDH 5CN3A 3LKPA 2YHGA 2IXQA 1JPTL 4G1EB 1OQOA 5EOCH 5AKSA 1D6VL 2OBGA 4GKLA 5FO7A 3U7YL 4IHOA 4LHUB 3DVFA 1O9VA 3WTUA 2FWSA 2HLEB 2AABH 2DWEB 2VSDA 4JAMA 2PP8A 4LF3B 4AMKL 2DBLL 3H42L 3EFDL 4P46B 1DQLH 3MRMB 3NCEB 3EUDA 2CGRL 4N5ED 4P49A 1L9QA 3RAJL 2YD4A 4XGZA 4HOWA 4JVWA 2NY2C 4X98B 2LGNA 3TEUA 2G75B 1FG2B 3C8KB 4KAQH 1WLHA 1U9KA 3QHFL 1G0YR 4M4RB 3RDTA 4ZTEA 4ANKA 3IRCA 1N68A 3H7LA 25C8L 2J44A 4B41A 4U6VH 3U83A 3WFHA 1ORSA 5BZDA 2P45B 2HX8A 1I9JH 3EFFA 4OB5H 1XL4A 5C7XL 4L3EA 4AIZB 3U1PA 1RZJH 1KLUB 1SVZA 3WTXA 1HFUA 4HPOL 1I3RA 1GYWA 3VXRD 3RA7L 4ZDHA 1I8MB 3M17A 2V2TB 5HYQB 4BWTA 2DKMA 2EC9U 4XVTL 4ZX3A 1EGJL 2DYSB 1P4LA 4X4YA 1QSEA 2H0EA 1KJ2B 4R4NC 3FB6A 1NMCB 1ZD6A 4KOCA 5SWSE 3RJDA 4EPSA 4TUJB 2XX0A 5LXVA 1EFXA 5I19H 3GRWA 5LNEA 2FR4A 2XVBA 4M1CD 3UZVA 4FRWA 5EN3A 1JNLH 4PGZA 2AJSH 3HE6A 4Y2DB 2F68X 3Q5TA 5DS8A 2OI9B 4G7VL 4X83A 5IW3A 5GS0H 4G9FD 4X9YA 1U8PB 2Y5QA 4KKPA 2NLJA 4QTHB 2W88A 1KGJA 1F02I 3WGVB 3ZL4H 3OTTA 2FRGP 5GRXG 3VG0L 2RFXB 3ZE1E 2CO6B 3WKYA 3EOBB 3RUGB 2X6UA 4KMTH 5IJBC 4J23A 3EOTH 1AOZA 4KNQA 5I1AA 3IN0A 4JO4H 3C5JB 1BZDA 1NIBA 2J71A 4U1HA 4JJ5B 4XHQA 5IF0A 2DQEL 3VE0B 1CICC 2P5PA 3QEHB 4HKXB 4YHOH 5EFIB 1BPLB 3GMQB 3VWKC 5JW5A 3FQ1A 4E68A 3EDEA 2DWXA 3E1F1 3TVMA 4PJ8D 5KSAA 2QGBA 4KO9A 4FFTA 3LMJL 4O2FB 1XZ0A 4HG4J 3JUZA 3V10A 3QEUB 3FN9A 1E42A 4FTVD 1EZVY 2XWDA 1JRHH 3PIQB 4DO5A 1AS8A 1TO4A 2P8PA 4L1BA 3NRPA 3VXNB 3PHOA 3L48A 1F4WL 5FV1L 3HC4H 1ZLEA 5GGVY 3K3QA 4N6RB 4P3DA 3NIDB 5L2KB 4PJFA 1CG9A 3RBSA 4AUYA 2EXTA 4HGWA 4PJ7F 4NQCB 1MFDH 4KZCA 4GXVL 1YNTF 1J5DA 3EYUL 3IU4H 1B4LA 5GRZA 4ANXA 4HWEL 3QWRD 3PU7A 4XVUC 5HVFB 3ARSA 2XHNA 4JHZA 1TUPA 4I1PA 3QAZB 3MVSA 4NUQA 1JD7A 4EVNB 5GS1B 2JK5B 3ASNB 1DVFA 5FCUL 1QNZL 4L1TA 1X5AA 2JJUA 3FQNA 4RCAA 1Y1UA 1C8QA 3IAQA 2I60H 2Z0BA 3BGFB 1T0NA 5C0AB 1TQSA 4TL4A 3WOVA 4LLQA 2GKIA 5KVEL 3RP1A 4AQ1B 4Z77A 4MMZC 1PLAA 5HHVL 4DZ8A 2DWTA 3GHBH 2QKIA 4AW4A 5JZ7C 4JFDA 4O5LH 3ZHDA 4WQOA 2P5EB 5DMKA 3TCXA 4AC2A 3M1CA 4K5OA 1IB5A 2D7QA 5CBEB 1BCIA 5GIRB 4GT7A 1CI3M 3SBWA 2ZP0T 4GS7C 4JZOA 5LBGA 2IGTA 4PJHE 5EU7E 5TDOB 4HW6A 1TMCB 4NC1E 3FTWA 2DQIL 3SN6N 3FQXA 3M86A 3BOVA 5I1LB 4LARL 1EHNA 2YEZA 1TQTA 3MMEB 3DVGB 1S9VB 1TU2B 2VH5H 2EH8L 3FC8A 4K8RC 4OVUA 4N8VB 3OZKA 2OCJA 4K0OA 4W6YB 1FA4A 3PREA 1GS7A 1TITA 1DVYA 2R0KL 2J21A 2YPLA 3K81A 3RPIA 4MD4B 2EDKA 2GJZA 4OUUB 2YAEA 5CGBA 3QQ4A 3L7FA 3NSJA 1U30A 4DQAA 1RZIA 3E7JA 4BKTC 5HHOE 3GMOA 2R9HD 3ARDB 4I77L 5F9WC 4FL4B 5GGTL 3W1ZA 3CZUB 2ARJQ 3QUZD 4R7NB 4B9IA 1UM4H 3AS2A 4NQDA 2YAOA 4G7SB 3KWUA 1YO4A 4NNXA 2BMKA 2H6PB 1MJUL 1PU0A 1FNLA 2C7UA 3GIZL 1BA9A 4MD0B 4PYHA 1FNSH 4HWBH 1UEMA 3LOWA 2UVEA 1LTXA 5IHBA 1ZOXA 4AZ8A 3RIAK 1WWAX 2HKHH 4O58H 4UTBH 5DWPA 4G7YL 4NS0A 3GUFA 1T89A 1VKXA 1QKZH 5AYTA 4Y9FA 1H15A 3KBPA 2ZSVA 2DQHL 4NKOB 4HX1A 4X6EB 1FC1A 4XI5C 3WEMA 2ZAGA 2BVOA 3JBG7 2OSWA 3U1SL 3DXAD 4UQCA 2OMWB 5FGCE 1Z3GH 4KK6C 5CEXB 3QT2A 1UCBH 1QAWA 2OR9H 1KEMH 4HIHB 4Z95L 3KLAA 3CXDH 3I6LD 1U8LA 2Z1KA 1P5VA 1IGYB 1PFOA 5K9JL 2D2CC 5KYUA 2R69A 1HZLA 4YBQD 1LWRA 3FT4B 5BV7L 4HC1A 4E9SA 3T0BA 2HA1A 3GTVA 3QCVL 4NSKB 3MRIA 3VI4E 5IQ7H 2PYEA 3GSRA 3VFNA 4OD3L 2E27L 5HHMD 5D9SA 1QYGL 4R7LA 2VLRD 3C6SA 2EYTB 4M8VA 3PPSA 5HGHA 3IDXH 3AT8A 3CFIC 1F00I 5JHDB 2F7IA 2EXWC 5IB4A 3GXPA 4RZCA 4O00A 5EZPA 3EG9A 4WKZA 3EIFA 3S48A 4H26B 1GA2A 1Z9NA 3C87A 5IHHA 1T6VN 2B9AA 4IOIB 3FUKA 2MKWA 4U6HA 4I18B 1Q9LB 4WJG3 3U30C 4AE1A 1BEXA 4BFOA 4W6WB 4BDVB 3O3DB 4X8JA 3QZWB 2CR3A 1AGBA 4KKCD 4Q6IC 4X8CA 1ZHLB 1P9MA 4OCRL 2WW8A 5D4QA 4ONGL 3QIWA 4QHKJ 4PJDE 3OAZK 1IE4A 2BVPA 5EOQH 5EPMB 5DD0H 3QA3A 4TUOB 3NFNA 1VFAB 5EO0B 3EGSB 1W0YT 2OKMA 2HT3C 3G6JA 2Y72A 1WJ3A 4TV3A 4KVNL 1DDTA 1J8HD 1RK7A 1JDCA 1FG9C 5LCVA 1IRAY 3BP6A 2NZ1A 3QIBC 4X5RA 3HG1A 2W9EH 2H6UA 4KRLB 2VZOA 4LIQE 3VTMA 4UIMA 4XCCL 5L9DH 4FEMA 3W57A 2VWEE 5C08B 5MI0B 1WWWX 4J4PC 3QJZA 2NZ9C 3JTTB 1OZTG 4BV1A 4JO1H 1WHOA 2NUPA 5BQDA 2A0LC 2D8KA 1MFCH 1SDAB 2BNRE 5C0IA 2IMMA 4UV7H 3H55A 3VXSB 5C07B 4XODA 1EZLA 1DQML 4H1LG 1DDHB 4L5FE 5FYKH 4OY9A 5C0JB 4G3YH 3RFRA 2Y25A 3MRPA 3TN0B 4ZZFA 1K3IA 2VZTA 3BPLC 1V7ML 4JG5A 2CHNA 3Q2CA 5IMMB 2J7LA 3BWUF 4JY6A 3VQLA 2L0DA 3PWPA 4IRSD 1N5AA 4YXHH 3UYRH 1AO7E 1C5CH 3MRHB 3VCLA 3BDBA 3IJ7A 3UBXI 5E1IA 3T6XA 4Z3EA 2O72A 4JHVA 4MA8L 4ORGB 1F6LL 1ZK9A 4K94C 4NBXB 1FHNA 1XGUB 2YN3A 2WLHA 1KCLA 4AVJA 1E4KC 3MJWA 4M7JH 4H5SA 1KT2A 3A23A 1FZMA 4RFEB 5HDOA 4OF6A 2MHAB 4ZXBA 2BSSA 1TVBA 3DRQB 2NY0D 1DP0A 2W65A 5JORA 5KBMA 2BOCB 3KLHC 2PXYA 4IU3A 3NA9L 4HU2A 2A9DA 5AVWB 4ISVA 5JPMC 3QUYD 2ZKWA 2B1AL 2XFXA 3BWUC 3BP5A 1X5GA 2VDKH 3QQ3A 5KSVB 4KDTA 1FVEB 4GUOA 5F1IA 5FHBL 1P1ZB 3K6DA 2Y24A 2KZBA 3UG4A 3TZVA 3ZU8A 3TH4T 4OIIL 4OD2B 5TF1H 3VH8G 2BSED 1X4XA 4Z7QE 1KTLB 4DP5X 2WKOA 2LV4A 1MHEA 4QOKA 4O02A 4IDJL 1CBVL 4L9LA 1G7IA 2YRZA 5ITFA 3VGHA 1UUSA 1NUGA 1OAYH 3OBAA 3DV6B 2A73B 4XMLL 4XCNA 1AQKH 1QWNA 2ITFA 4N0FA 5IMKA 1P69B 3G6DL 4PD4K 3A4EA 2R2BA 1PZ3A 1BVNT 2XVKA 4HJ0D 1KIUB 5GISL 3PJSA 3MLSH 3MLYH 4QXTB 4ZS7L 5GJTL 4M43L 3PQYA 2F5BL 4K7PY 4YXKH 4WW1B 1LP9F 4M93C 5CCJA 3KJ6H 3CMOL 4LEEA 3LKNA 4M8UA 3N50A 3BP7A 3FRUB 1S2EA 2ADFH 1DVSA 3DJZA 1TKWB 3B83A 1MREH 5I2IA 4O51B 4LEXL 1RLWA 4IBQA 3HNSH 4Y5YC 4BK5A 5DK0A 2XJKA 2BIIA 3HZVB 4M5ZH 2Y23A 4DK5A 2R1XB 4NP9A 1HQRA 1UJ3B 3B3IA 4D0CB 3O0RL 4FYRA 3SKOA 3MACL 3WIAA 2ETWA 4G6ML 3PNWA 1JHTA 1MY5A 1WK0A 3LCYA 1F0LA 1GC1C 1HI6B 4N1EA 1XF5B 4W6XB 3B9KB 1MIMH 3QO0B 4Y7MA 1ONQB 4KO6A 1U0QA 4TYUA 1PL3A 1QSZA 4F7EB 4RGNB 3TXAA 1NFIB 2JKRM 3ZUCA 1OGAE 5L2JB 2E0PA 1U8OA 5IKCB 2BSRA 3ZRFC 4JPVL 2AXFA 5I6XB 1WC7B 4W9KC 1AD0A 4TOYL 1MCOH 3MNVA 4GAJL 4RAVB 5FFLA 3ILQC 1YMME 2B1OA 2Q7NA 1KCSL 4IGBD 4MB4A 4NRYB 4I89A 5BS0A 1RUMH 4Z7NE 3VD4A 3GSVB 3UCRA 3DX9B 3RRQA 4FZEL 2JCCF 4NLAA 3G08A 2BIQA 2H3XC 1IGIL 1ML0A 3C9NA 4JFTA 5AW0B 2HVKA 2J5LC 2Y7MA 3LD8C 1Z32X 1AZCA 1I82A 2F74A 3L6FB 5EZJB 3TBCA 3DV4A 3S8WA 1BOGA 3ETBF 3T4AC 3D4ZA 1GZPB 3UGXA 3QARA 4ELMF 3QQNA 1G9MC 2JIXB 1EEUA 2YGQA 4HXBH 3AS1A 4Y9GA 4K73A 1OIOA 5T5NG 1A1MB 3SO3C 5CN2A 5EU5B 4KTDH 1BGXL 4JFFB 3RDTD 4W70A 4HMDA 2H4EA 3KD4A 4YPGB 3OQRA 5FYJU 4CL7A 1PZCA 3AU1A 2O1AA 4NNYB 3MV7A 4FABL 3HS0A 4GQPH 1YJDL 3HI5H 2J6EA 4HEME 1JWSB 4L3ED 1WZAA 1R34A 4NJAL 2PW1B 2XWBA 3ZYZA 1RUQL 3ULSB 3G5WA 2MTPA 4PWJA 1J18A 3GSOB 1HSBB 4O02L 3FO0L 1OE2A 3KZ8A 2ESVE 1R3IL 4J6IA 3MGAA 4LSSH 5GRWA 2WWMD 3QJFA 2M26A 1QSED 2PWGA 3TNNA 2VDKB 2X4RA 3QDJE 1EFXD 1SLWA 3BSZH 1Q9WB 3BUYB 4ZSOB 4NJ9L 3RE0A 3FH8A 4L4VE 4DKAA 3QDGB 2X4QA 3FS9A 4PJBA 3HE6D 3M8OH 1H8OA 2F19L 3GQFA 4JFEE 4LFHD 4XNMB 4Y16D 3QW9A 4ODWB 2X40A 4RAHA 5IT2L 4FQXA 4M4PA 3ARGC 4YR6A 2NY2B 4DO4A 4F20A 3N3EA 3Q3GB 1KBGL 5DJCB 3NDYE 4J1UB 1R3KB 4NAQA 5E2TH 5TD4A 4YFLI 8PAZA 1DANU 4UILH 3T8VA 2XN9B 2V2XB 2GK0A 5DZJA 4W9LC 5INCA 3THMH 2X9XA 1U6AL 1CDIA 1JMZA 5KSBE 2R56L 3I02A 4WO4D 5DHVA 3Q06A 1MHPH 4JZJC 4Q58C 1ZS8A 2ZOWA 1L9PA 3LKOB 1ZVNA 1DJWA 4XHJC 1UJTA 5HGDA 3WS6A 1TJGL 2Y6SC 2YUXA 4O4YH 4F57L 3IDUA 3MNDA 1OOWA 3QJUB 4FXKA 3BVTA 1BOYA 5KSAD 3TVMD 5FLVA 1U95A 4LE8A 2VJXA 3L4YA 1CD9B 1DSWA 2BHYA 5H8DA 3HOGA 3RFZA 1L7TL 3JWNC 3MI6A 3CHXA 3P9LB 2HFEB 4ZTOL 3PHSA 2EDTA 4GRLB 1N19A 4M03A 3QRGL 5I18L 5K69A 1DQDH 4YHLH 3EYSL 5FIEA 1T4KB 3QDME 3BEVA 1HZHH 1D5XB 4X4ZA 5CZKA 1E9PA 5DQ9B 3VXPA 1MKFA 1KFAL 3CSYA 2BRRH 4QDGA 4YH6A 5E8NB 4OJFH 3V5DB 2CO7A 1GYVA 3NSCA 5FUOH 3T09A 1XF4B 4EUPH 5FB8A 2OPCA 3UYPA 1I9RH 1JZEA 1AE6H 4XMZA 3OKDB 4ODSL 1FH5L 5ANMA 1J8RA 5G4NA 1ANUA 1XTLA 4G7QB 4PVNA 3DIFB 4OH2A 4XNUH 5KUKA 2ZWSA 1BVLB 1IFGA 1KV7A 2WXQA 1AP2B 2ZWZA 3MBEA 3MC0A 2XV3A 4M7ZC 1FCCA 4B9PA 4ZAKA 4DP4X 2ICEC 1FL6B 4TLUA 2CCWA 4UQBA 4AGLA 1OB1A 5JXAH 3WMQA 2MCPL 4I2XB 1PW3A 2XVLA 4GRMA 4XBMA 3OHXB 5KANG 3E6FB 2K8MA 1KIPB 1N67A 4MCYB 2LABA 1QFUH 3B7YA 5CJ8A 1NEPA 3BKYH 4PH8A 1GZQB 4JCLA 1OCZB 1SPDA 4L5FL 4TPRL 4J3OC 3X1FA 2B39A 3QH3B 1O0VA 3IAPA 1NCHA 2VSKB 4HKZA 1MIEH 4ZYKB 1RMFL 4P2CG 3Q6GH 2YXVA 1NDMB 3WAKA 3BZFA 2YPLD 4IKJA 4UQDA 5FKAA 4MZRA 4DGIH 5I76A 3WTYA 5BVJB 3U4KA 1I7ZB 3GKWH 5CKGA 1HVXA 1QO3A 3TM6A 1QTYT 5J6GA 3QUMA 4PRHA 1R5IB 4LCCA 3L1OL 3KG5A 3X17A 5DFWH 5DJ8B 3BKCL 1MCWM 3WGUB 5J56B 3Q2LA 5E24E 1ZAGA 5DS1A 3GM8A 4NQDD 1DR9A 4MJ4A 4MMZB 4WUKH 2SEBA 2DQCL 1VSCA 1XSOA 3CLFH 1Q94B 3VI3E 3KXFB 1JTPA 4Z7WE 4RWYL 5K9OA 4MXQC 2R4RL 5FECB 1JI2A 3TGXA 1IC7H 4PJ7B 4Y4KA 4XCFH 2F53B 3QNFA 3SEPA 5DD1H 1U58B 1DE4B 3QNXB 4GS7B 5I6PA 1XAKA 4KK8D 4NKMA 1G4RA 3T2NL 3DOSB 4PWGA 4Z76A 1JGLL 1MEXL 2OX5B 4LLDB 5IJCC 4BSJA 4HHAA 3GMNA 4OZ4A 4NXSA 1LO3L 4UQ3A 1KELH 3FB7B 1NA8A 3BZEA 2XTJE 1AS6A 3CBJB 4PRBA 3WIIH 2WLIA 2WZAA 5IFHH 1LMKA 4HUWB 2AXGA 2VAJA 2BY2A 4A6YL 2HT2C 4JANA 1WD9A 1PMYA 2BIOA 4HALA 4FQQA 4GJTB 2Q2LA 4I3RH 4EDWH 4K94H 5A2CA 5F9WB 3K74B 2PYED 5JYMA 4ONHA 4P4KA 1WBZB 4U3XA 4R97B 2B15A 2WXHA 3JXAA 1AAJA 2DKSA 1KEGL 3EAKA 2X1XR 3ZBMA 3N91A 2E6QA 2GTZA 4POYA 4LZKA 1P7BA 2VXVH 1OD7A 5FEBA 4GQQA 4AIXA 5HI5C 2A6IB 1E6OH 3F58H 3QORA 4XNXH 5JIHA 2VISB 4GXFA 5GHWL 2FGZA 3LIZA 3FPXA 3NPZB 1NFKA 3ARVA 4AQAB 3MRDB 5FM5O 5EDXA 2PCPA 4L8SC 2WBKA 1CDUA 2WXMA 2ZXQA 4QEGA 3LHAA 2VLKD 4EUPB 1FFRA 1FGNL 1SMDA 1CE1L 2ZKHL 3QIWD 1CGXA 3SKMA 4AENB 1E4XI 2ARWA 4JN2B 1CFVL 1RLBA 1RURL 1ZHBA 2KLTA 3IWUA 5BRZB 3GSNA 3V9FA 4IKIA 1RZKL 1E27B 4TVPE 1OZUA 2E9JA 5C9KA 2XC8A 5DJ0A 2AJVL 2ZPKL 5DRNB 3ILPA 5KVMC 5AB9A 5IUCA 5EEZA 3IAGC 4R7DB 1C7SA 5GS2H 1UWEH 1T1WA 3DO4A 1WAAA 4N20A 3A6BL 1AC0A 3GHEL 3ABMB 3CVHH 2XV0A 1OSYA 5HHNA 5EORH 3VB9A 2YQGA 1H9DA 4MB3A 1MI5E 2K6ZA 1RHFA 3PABA 3U0WH 1BAGA 3P40A 5MENB 3V0HA 3VXOA 3NRFA 4GIPD 4ODTH 3B7TA 3QUML 5PAZA 5D7JB 3HRZA 1UXWA 4FI8A 3U30B 1G5GA 4AJYV 1THCA 5ACZA 5EZLA 2YR3A 3NJVA 4JKWA 3T0DA 5L6YH 2BH0A 5DVMA 3V95A 1DLHB 2ZX5A 1S9YA 5E9DE 1IC5L 1J5IA 1GC1H 1M6OB 4UQ9A 5IB1A 5AG8A 5I71C 1MXDA 4H8VA 5JIKA 3KJ4C 5F7WC 3HE7D 4PJ5B 1WO2A 4N6QA 3LZLA 2XBDA 2E7BA 5CJOH 4YGVB 5HJ3A 5EC1A 3QIBB 3NABL 3KWTA 4DVRH 2NNCA 1BPVA 1VGEH 4KKBD 1KLGB 3RWDA 4OZIA 1A9VA 4KY2A 4XOCA 1FIEA 3FUJA 1P6WA 2PXYD 3KPMB 3FT3A 1BAWA 2CRZA 2XDHA 4U1KB 2NXZC 5EN2A 4JPKL 1FH2A 4NN6C 3D87B 1E9QB 1SM3L 3TZVD 5EO1A 3RZCC 5HHOD 4FG2A 5BXFA 4S1RH 4A39A 1RUKL 3GXFA 5F1OB 4QOKD 5EZOL 3AGWA 5CMAA 4ETQB 2GAZA 4FERA 3K71B 2LAAA 3H3PL 3RWJB 2ILLA 3TNMA 1UA6H 4HUVB 4RGOH 1Z9OA 2AI0H 4U1SB 4JX0A 1NGXB 4X4MA 3RPKA 1Y6KR 2VJ0A 2AEPL 2P8MB 3VFOB 4MMYA 4WNQB 1EEZA 5DUMH 4BUQA 1HWHB 1NCBL 1Y18B 4RBPK 1TOXA 4BKLB 3K80A 3PQYD 4X80H 1SYVB 4L4TD 1VPOL 5JQ6L 3W0WB 3E2HC 1CFNA 3OJDB 4XNBA 2A83A 3JVFC 1LEKA 3VFGH 3ZE2B 3D09A 3GJEB 5JPMB 2FO4A 2WUBL 4N86A 5HYIA 1T0MB 4PJ6A 4JM2F 3WY1A 5D7LE 4JY5L 2VQUA 5I1KL 2V5MA 4NPJA 4PGBB 3RTQA 3SQBB 2WVUA 3ZDZF 4U05A 5BVPL 4DWHA 4MQXC 3DROA 5KZCB 3H0TB 3QJHA 2ZF9A 3P11L 4HJTA 1NAMA 2OSLA 4QRRA 1I9IL 1BQUA 2F1AA 3VFRB 4JPIA 3EYVB 3QO1A 3AQDA 2PO6D 5F1NB 3NFPB 4P48A 1IEHA 2AJZA 4NWTH 2PLTA 4WV1A 4JDEA 3ALWA 1A8ZA 1P2CA 3NOIA 4I3GA 4KOBA 4LO9A 1Z3RA 2FEEL 4RISH 4L9DA 3VMNA 1BG1A 2PCFB 2WB1A 4I13B 1PCSA 3Q7JA 4RETB 5EF3A 1F8TH 2R2EB 1S8DB 2W9DL 1HQ4A 2Z8VC 1A6TB 4ZUTA 3U9UB 2DJ4A 3T6VA 2OAAA 5D4HA 4FKEA 4F58L 2OYKA 3UCQA 3CVHB 2X4OB 4KKAC 5SWQA 1ES0A 1RSFA 1U8KB 3EYOA 1S7VB 3KYNB 3O11B 2G0KA 12E8L 4Y5YB 3UDWA 2X05A 4L18A 4LASH 4PLKD 4PJIE 4KQ3H 4UB0L 4P57B 2WLNA 5T3ZL 1MQKH 2XWTA 2NY3D 4NKIL 4PBDA 4PREA 4V2BA 3LS5L 1TCMA 4UM9B 4JFSA 1IL1A 2VTFA 5MEPB 3B4NA 5SWZA 1KB5L 5L8KB 5TDPA 1YMHB 3OXSA 4WGWB 4NUPA 3OD3A 4M7LH 4PEEA 4I0PC 1ILSA 4X9IA 1GOGA 3CHSA 1KPRB 4F92B 5EBLA 1BD2B 4KI5D 4NQQA 5CIPA 3VGDA 4AXWA 3V8OA 5G2NA 2D9CA 2XG5A 3O9WA 3HG0A 4NM8L 1MJ8H 3RGVA 3LHPL 2HTKD 5HHXH 5DD6B 2IANE 3WCYA 2OTWA 5KEZA 3ZE1F 3S98A 2HLFD 3IVKB 1KIQB 4PYGA 2X2JA 3OSVA 3UJIL 3ROOB 1NGQL 1BBJB 4F9LC 1A2YA 1KGWA 2NTFA 3US1A 5E51A 1EJ8A 2IH1A 1O6SA 4WK2B