5IQLA

Crystal structure of yeats2 yeats bound to h3k27cr peptide
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
130
structure length
130
Chain Sequence
SRLFVKKTIVVGNVSKYIPPDKREENDQSTHKWMVYVRGSRREPSINHFVKKVWFFLHPSYKPNDLVEVREPPFHLTRRGWGEFPVRVQVHFKDSQNKRIDIIHNLKLDRTYTGLQTLGAETVVDVELHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords YEATS domain-containing protein 2
publication title YEATS2 is a selective histone crotonylation reader.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 20
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2016-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03366 YEATS YEATS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1970 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5iqlA00
3FK3A 3QRLA 5IQLA 2NDFA 4TMPA 5D7EA 5IOKA 2L7EA 2NDGA 5HJBA 5HJDA 3RLSA
chains in the Genus database with same CATH superfamily
1F3DH 1JRHL 5E0QA 5L2KE 2CGZA 3A24A 5IUSA 1BEYL 3K0YA 1J5DA 4HUVB 4ZW7A 4PRID 1UATA 4XBGB 5D2NB 4G1EB 4QOKE 3T0ED 5D1XA 5K9JH 3F6JA 1RZQA 3DTDA 3FT4A 2M83A 1J87A 3MOAL 1UTDA 4JCMA 1P5VB 2WZPD 5IUCA 2BVYA 2VDNH 3KWTA 1RPKA 3H0TB 5EHFA 3ZL1A 2OTUB 5JHAA 1UXSB 3AT8A 5KYNA 1L0PA 1A21A 3DSFL 3OHXA 3MRLA 3QIBC 3D39D 4K8RL 1KUMA 2BZDA 2KMWA 2PTUA 4A67A 3FU9A 4LHJB 4Y2LA 4P2OB 5LGYA 1TTUA 3DUUB 5EBLB 2C3GA 3HMWH 5EUKA 9PCYA 1G9NC 2E8YA 2MQGA 1E6JH 4P57B 3TT1L 1DFBL 1G9MC 3VYPA 2I9LB 2NY4B 1BG1A 3EDDA 4XPTH 4YHLH 5C08D 3QDJD 3CXDH 3RWFB 2J4WH 3H2QA 4C83B 4NN7B 3IRPX 1KPVA 5DLLA 4X6DE 4OFKA 2PNDA 3QEUB 4HV8A 4OGAC 5AVVB 1JZDC 4TQEL 1QSFA 2V37A 3WV0A 3D69A 4LSUL 3NH7L 3RTQC 2HFEA 4G6AD 4G70B 4MD0B 1P7KB 4N2OA 3UH8A 1KFAH 4LNRA 1S7RA 4M1CC 3M7FB 2K4WA 4DQOL 1CS6A 2CK0H 1CXEA 3RDTA 4FFWC 3VXOA 2ALAA 3QI9B 2FYVA 3EJZD 3BWSA 4X8JA 1G4RA 3HS0A 5IW1A 1HXYB 2WCPA 4MQTB 4YGVB 1KCUH 3RFRA 4X6EA 5GZOA 2WXHA 4UB0H 4B0MM 4RGOH 3CNKA 2YQ3A 4JREC 4NQED 3QORD 3MFFB 4KJPC 3SDAD 2BC4A 1OOAA 4JO1L 4D2NA 4KV5E 3VXRB 4BFBD 5CFAA 4MCZB 1PFOA 3H2PA 1MG2C 4HJUA 3VI3A 3IWUA 4Z3IA 1LXMA 1A9BB 1I9IL 1P84K 1VEPA 4UT9L 2IFGA 1YQVH 2X42A 5GS1A 1BXXA 1MCLA 2MIZA 1ET7A 2EYRB 5I1DA 2W59A 1WP6A 1KYFA 2J88H 3JZYA 4UNIA 3H6AA 3KG5A 1NBZB 5D2NE 2CKBA 4ZS7H 5DC0A 5FM4A 1JZ4A 2LE9A 3BZFA 1DVYA 5E9DB 2JB5L 3J2PA 3OSKA 1BBJA 3TA3D 6PAZA 5JPMB 4GQ9H 3U0TB 1JK8A 2BVPB 1I9RH 5D9SB 5AD0A 1RJCA 3QJUB 5BV7H 3M8OL 5I8CA 1TETH 2N4IA 1L9NA 4LPYA 2NXYB 2IH3B 3VFWB 4E5XB 2JLLA 3LRKA 1JWSA 1XTMA 2P28B 3O41A 4L18A 4NAJA 5E94B 4RFNC 2QKSA 3GMPB 3FQNA 5C2UB 1A3LL 5C0NC 3NK4A 4BKTC 5HYJA 1SN2A 4Q6IC 1QVOA 2V2WB 1SJEA 4A7QA 5KOVC 1G1KA 2EDMA 1P6WA 3QPXH 3FXIC 2B0SL 5T3ZH 4UYQA 1SOKA 25C8L 2WO3B 3EYOB 2WQVA 2A9MH 4OQTH 2P47B 1GSKA 1IBZA 3D0LB 4AEIL 4BFFA 2EZ0D 4MAZA 2KKQA 2BXYA 3PAVA 1ACCA 1E6OH 3PP3K 3VO0A 3AQZA 2O6CA 1L7IL 5J0BA 4Q6KA 1USZA 3ECVA 2F8XC 1EJFA 2WO4A 4UOW1 2IGLA 2GK2A 5E2VL 4EF3A 5KAQF 1QYGL 3ARWA 1IGML 5INCB 1OE1A 3D5OF 3VXRE 4U1HA 4ZX5A 1FZJB 1ADQL 3NSJA 3TBSA 4JFEB 2ZP0T 3CWGA 4HWBL 4LLVB 3SCMA 5D70L 3CZFB 2FLMA 4YPJA 1P2CA 4CDGC 5CJ5A 5GS2H 1YVLA 4WVRA 3S0PA 5SWZD 1RUML 1YECL 1ADWA 1M3JA 3TCXA 4PRNA 3MXVL 4LCUA 3UMTA 1PG7L 3N91A 2XWEA 4HJGA 4GXFA 5E9DE 4TS6A 1EVUA 4OF0A 1NMCB 4NN6B 4CADB 2HRHA 1EK3A 3QRFM 5F7MC 1O7SA 1RZPA 2D4FA 4KO9A 1BSIA 5ESQA 3FTXA 1LE9B 3U4AA 3AY4C 1ID2A 1OAZH 1EHLL 2LQRA 4P46C 5HGAB 2VDOL 3N44F 5CD5C 2YRBA 1TZIA 5HVHC 4W4OC 5FK9B 5B1JC 1ZT1A 3O3BA 4A6YA 4WEMB 4EKXA 1KLGB 4YR6A 4FNLL 1DSFL 1K4DB 2PPCA 2GY7B 2ZOOA 3P4OB 5EBGA 3K72B 4UMSA 2F08A 3SE6A 1PG7X 5AKRA 5G55A 2XPGA 4MZ2A 4B5EA 4BQBA 3TYGL 2G9HB 1FLRL 3WY1A 1WO2A 3TJPA 4ABUA 4BH7A 3IDIA 3F05A 4Z95H 1T2QH 2Z7WA 3TO2B 5I6OA 5L2JA 1VFUA 2OMVA 1HDMB 1WJ3A 2PN5A 4B9ZA 3UMNA 1VEOA 4BA8A 2HMIC 4Y89A 4NNPL 2BIPA 2R56L 1BECA 2C3XA 2IDQA 2JJSC 4ZMZA 3DUSB 1U8PA 2HUEA 3SQBB 2I85A 5KVEE 1N0XH 4Q9RH 1G9HA 3G6JF 5F0MB 5SX4H 3L3GA 1Q1JH 3DYMA 4CVZB 4JFEE 1IIIA 1D5BB 1DEDA 2RACA 1UA6L 1LQBC 4K7PL 5EBWB 1CGSL 4BRVA 4U1GB 4ZDHA 5JMOC 2J5WA 5BXFA 4A7UA 5KVDH 1Q9LA 2EYSA 4RRPM 1Y0LA 4UNUA 1A6VL 1D2PA 4PJHB 3V0WH 3KW8A 1CDYA 2BSRB 4DP4X 2YD9A 1HNGA 1XT5A 5F7NC 1FN4B 3ARSA 2EYTA 1Y1DA 5IR1A 3MRMA 3RWIA 3VM5A 3G5WA 5F7UA 5ITFA 1CYWA 4NUMA 1NJ9A 1G6RA 1SFDA 2J6EA 3ZRCC 5A43C 5FYJH 3IETA 4JM2F 4I48A 3RUGF 2WLMA 4HIXH 2H5UA 4K7PX 4F8PA 1IL1A 2Y6SD 4GLRH 2WTOA 1BD2A 2A74A 3ETBF 1S7SA 4Z7UF 2CHXA 2DLIA 1XF4B 1RIUH 1TQUA 3EO1A 1JPTH 3QEQE 3S96B 4AL8C 2EACA 3KYKL 1OV8A 3VQMA 1AGFB 1PSKH 1PZSA 3WMSA 2EUXA 1ES0A 4JZOA 5F3BA 1UKQA 3QFGA 2MCPL 1MI5A 3WS6C 3CZEA 4O02A 2XG4A 1OM9A 4N85A 4FAAB 4S0HA 3VFNB 5BV7C 4I0PB 3X11B 4Y5VB 1FNEB 1ZXQA 3GIVB 4G59C 3L3KB 5BQ7B 5K59E 4H8WC 5I1CH 5IJCC 3W9EA 5J4MA 4Y7OC 2D03H 3SKMB 4QRRB 5DYFA 3E1F1 4CU6A 2FIKA 4LRNH 3AREA 4XX5A 5FECB 3UPAA 3HB3D 4UV4L 3SPVA 4AY0A 5IGXH 2PO6B 4FABH 1I4FB 2FX8L 2OA9A 2WQUA 3O4OB 4HC1L 4JPSA 4FADA 1ERNA 2FNBA 1MIMH 3EUUA 4ODSH 3DSNA 4KUCF 3APDA 4DZ8A 4U1NB 4XPGL 1OM3L 4DEPC 2EH8H 4F7KA 2D8KA 4R5XA 3MU3A 4N8CL 4LLWA 1DEEB 2UWEF 2YUVA 1G7QA 3CN2A 4ZYKB 3ZL4H 4OT1H 4PJHE 1CTOA 2V3DA 3WFBL 4M8QB 2GK0B 2YEZB 3CFBB 3QG6A 5DQDL 2XNAB 5I75C 4MAYC 2DS4A 3WKML 3IPFA 1OZUA 5GXBB 1M6OB 3DROB 1XL6A 2AQTA 3FT0A 3VWJC 3WO4C 3ARXA 3MTXA 4ZMNA 3ESPA 5T3XH 4FQJH 3PV6B 1G5GA 2F53B 3QUMH 1NEZA 3K8KA 3EF4A 4PLJC 4OTXL 2MHAA 2N1KA 4G42B 3QW9A 2DEXX 1MLBB 1T20B 3ESVF 4WFGE 5CGMA 1NTDA 4HIJA 5F21B 1E4JA 3FB6B 3RY5A 1CN4A 1SXSA 3ZU8A 3DMMC 12E8H 2AXFB 3N42B 2YD6A 1KCLA 5SWQA 1W80A 4Z7AA 4OIIH 2BDNH 3HZVA 1D7FA 3PWUB 5IB4A 1BV8A 1S78C 5JO5B 1ECZA 2KERA 3FSZA 2Z7YA 3LNFA 1U93A 5DD5L 2WPGA 2BMKA 3KPOA 2IAMC 4LP8A 1XGZA 1Y18B 2X4UA 3IDNB 1EEUA 3LPOA 1GMEA 3O8XD 4J2XA 3BPNB 2AAAA 1ZLSH 4R7NA 1MCJA 1LMKA 1LO0H 3T4YA 4F57H 4JR9H 3OLIA 3ZHLA 4Q9QH 4IJ3C 5AVSB 5KANI 2P52A 2C7UB 3BRDA 5DHVA 2ZXGA 2ZXWB 1NUGA 2XWXA 4QRRE 1HH9B 7PAZA 2NSMA 2PW1B 5JOPE 3ARFA 2KS0A 3D3VD 3D48R 3UP6A 5AALA 3VDBA 2BHZA 4GAYA 1HOCA 2XKUA 1WGVA 2J8UF 2W94A 4ENEC 1X6LA 3T6VA 3ZXAC 1YCSA 4HYTB 5DS2A 5DSCA 5EOCJ 2Y3AA 3CVHA 2WO2B 4X99A 2H32A 4RAUA 5FYKH 1NWPA 2F68X 4DPRA 2NYKA 3ABMB 2CO7B 4H8PA 5EIIG 2A6DA 1ZK5A 1CE6B 1QWHA 1ONQB 4PPTA 3X3GL 4M5YH 4P23C 1U30A 2QV4A 4O58H 3U7WH 1MH5B 3D50A 4U1LB 2MNWA 4FXKB 3IDMB 4R7VA 2MQCA 3LZFH 3O6MH 3K4AA 4QHMB 1KLFB 4HCRA 1MCIA 4P2QA 4Q97A 4N26A 5FO9B 5F9OL 2F53E 2WLHA 1H3GA 2ENSA 4OJAA 2GEEA 1COBA 4RAVA 1HJCA 2EE9A 1K2DB 5ACMA 3SDDB 1HQRB 1MJ8L 4HSAC 4PGBB 4AQ1C 5DXWA 4NPYA 5ALCL 3ZGHA 4DP6X 5ISZD 4JFDB 4AUUA 1ROCA 3BGFC 1ODUA 1A8ZA 3QIUC 1GH7A 3ECWA 5J11C 1OPOA 2X4PA 4A63A 2Q7YA 3L7EB 5A40E 1W8EA 2HN7A 2WYIA 3BP5B 3LHPL 3P3YA 5BUAA 1BF8A 3ECUA 4GY4A 1E9QA 4NRZB 1GHFH 3HAEB 1IARB 1GL4B 3SSGA 3P4MA 2DY2A 4HAGA 3B56A 4UANA 3V5DA 4XC3L 4XXWC 4XNMA 3U6RA 4NQXB 4OLXH 1SEQL 3Q6GL 4JDEA 3WYRA 3DX7B 2B1HL 4J3OD 3QIBD 5IVXA 2X05A 4GO8A 3W38A 2EDRA 3QQDB 3CLEH 4RNRB 1NGPL 3FO9A 2EEDA 4AEFA 5LNGA 4RSYA 3S3CB 3WN5C 1CVSC 1DL7L 2WC7A 2LAAA 4O2EA 2YGPA 2NW3B 4X8XA 4Z78A 1NLBL 5CN3A 1U3YA 5DS8A 1WE5A 3O6FD 4OGAD 1G9NL 1K85A 1PNCA 1TR7A 3RTQD 3EBHA 3WAKA 2R2HA 5I1JL 4BZYA 2QVTA 5D1ZB 3SBQA 1YEHL 4LIQH 1RIVL 4OGYL 4KHTL 4LPVA 1E65A 3IFLL 4M1CD 3QDMA 1YEWA 1RZJL 3QE5A 1OO2A 4XMZA 1FIEA 2P5WA 4FFWD 5D1QD 3IRZA 5EOTB 2YFNA 3MUUA 3PQYB 4OR1A 3IEAA 2IDUA 3NFSL 1R6VA 4ZUWA 2HLFC 4LSRH 4G7VH 5CP7A 5E8OA 4PRPB 4XO9A 4NJ9L 2G2PA 2FEJA 5TDNB 3L3DB 5HYSB 3ZT6A 1LDPH 3MRHA 3Q5TA 3V7AE 5I1AB 1U8NB 3VCLA 1E4XL 1K5NB 3OKKA 4PJGB 4UAOB 3V4PB 4KJPD 2B16A 2GHWB 2HFFB 2ITFA 1KJMB 3UTTE 1UWFA 3PHQB 5MEQB 5G4OA 1U3HB 5IIEA 1YMHA 3VFUB 4ZMYA 1D9KC 4JFDE 1RJZB 2JKSA 3DO4A 3B83A 1WH0A 4LHUD 1A1OA 1V7NL 2OM5A 1A7BA 4OIFA 3TH3T 3QQ4A 4GINA 1GZQB 3GSNB 4AYSA 4AGQA 1KPRB 3KGRA 2XV2A 3NZ8A 1IM9B 2QSCL 1YEFH 2IBGA 1DVFC 1U2HA 3AVEA 2WCSA 4JQIL 5EIVA 4E9SA 3IU4L 5C0RL 4Y4HA 4GUOA 1Q94A 4ZO8A 1A22B 3BT2L 4YIQB 3I50H 2BNRD 4XPAH 3G9VA 4H5SA 5ID1B 1CZ8H 3ERXA 4JDTH 5C0BB 1F56A 2K8MA 1T0NB 2YOCA 3K6SB 1RMFH 2HKHL 2V7HB 1N19A 3LEVH 1DBMH 1VSCA 3N1QC 2XRAL 4IYKA 3OMNB 3UTSB 3CZNA 2XQBH 4YHIB 1TVHA 3FF7A 5C0AB 4JO3H 1PQZB 3KBHE 1AVAA 3FBKA 5CCGE 3ULVE 5DD1H 5C0ND 2IPKB 3CDFA 3EJPA 4QRQA 4WI6A 3HNVH 35C8H 5BS0B 2OYMA 4GKZA 5GIRB 3WJJC 2P1YA 4N86A 5FO7A 4CMMB 4KQ3L 4Y5XC 1OL0A 3HA0A 1O5DT 2XZQL 4ZPTA 4N6RB 3UCQA 1NMBL 3V52H 3WHXA 4F5CE 3PQYE 1KY6A 1B0RB 2NMSA 1JHTB 1O7DC 2EDNA 3OC5A 5EU7E 1QSED 3S35L 1A6AB 4Q9CA 6FABH 1Q9KB 3DOHA 5E6SB 4PRPE 3F62A 2CH8A 3LRGA 4K2UL 5HJBA 3ZL2A 1ZS2A 2UZYA 3MLWH 3BH9A 4H8QA 2N59A 3Q5YA 3HEIB 4PJGE 2EVGA 1LP9F 5F0LB 5GGTL 4ICXA 2CLVA 4KNTA 4GRWH 5MEOB 2HLAA 2XWTA 4ALAH 4KQ0A 2ATPB 3EZ8A 3F7YA 1T5XB 1KTDA 2PW2A 2AXHA 2R4RH 1HCFX 2YD1A 4F7PB 4YH6A 2N0MA 3CDZB 1F02I 2DZEA 4BDVA 4LCCC 5I19H 4H1LA 4X5WB 5BZWA 2Z35A 3VMPA 3WJLC 1TKWA 5JOFA 3S35X 2D7TL 3KPNA 4WCYH 3IXTA 4YL4A 1AGEA 3QDHA 2H3NA 5I1GL 5KSAB 4AQ8A 3DBSA 1NBVH 3Q43A 5EN3A 3CVIH 5EZIH 5BCAA 3QRBA 4GRWF 5IBLD 5BRZA 4ODBD 2E9WA 1A7RL 3BKCL 5IY5B 1RAMA 3FJTA 4P46D 2BVUA 5C0BE 2QMJA 4EBQH 5CD5D 4LSDA 3B9DA 5DMIL 1EX0A 1JWUB 4GXVH 4PY7A 1XXFC 2QJDA 1UWEL 3RU8H 4J8QA 1JZ5A 3ILEA 3UTSE 4IOSD 1BVKA 2K7PA 2XT1B 3MLTB 5C0AE 4A2MA 1N6UA 1IBGL 5C8JB 1WPCA 2P9RA 1SM3L 4UTCA 1U8QB 3HG0A 4PTTB 4DHLA 4KKNA 4HWNA 4PR5A 1T1ZA 4ZAKA 2FD6L 3VE0B 3UJTL 2VQTA 1HXMA 4WY7L 5CJQL 5BS0E 2FBJL 4MYWB 2JIXA 2PPEA 4ZUTB 3ZVVA 3MFGB 4NO5A 3TV3L 2X1QA 4WU5A 4H7VA 5DRXA 2WINA 4TVUA 2R2BB 3RB5A 3CFDA 5CZRA 3E1ZA 3HBQA 2XA3A 3PHOB 4CC1A 2HMID 3PF2A 3IJ9A 1IGFH 1ITCA 2WQWA 1A14H 1GW6A 3VXPA 2YA1A 5K9JL 4R97B 1BM3H 2ZONA 3GTTA 4GQZA 3B2MA 3NRPA 5DYOA 1PEWA 4XGZB 2VDMB 2VDNL 3MA7A 1I8KB 1ZTXL 4UTAA 1BOGA 2L4OA 4FKEA 4A39A 1JF5A 5D7SH 2Q6WB 4OD1H 2ITDA 2YD2A 1J8HA 3OR7A 1I7UA 5CZVH 2AW2A 3IJHA 4Q2ZB 4PJAA 3MRCA 2XIDA 3ARZA 5ERWA 3B5GA 4WLCA 4YHLL 2VJ0A 3CXDL 1GS6X 4JFTA 3DTUB 3B8SA 3CHSA 3STZB 1HIMH 1AGCA 4Y9FA 5TTRA 5JIHA 3T65A 2E7LC 1ET5A 1HT6A 4P3DB 1LE5B 1YNLH 4LPUA 2IXQA 3GT6A 5AVYB 4YPGB 4WNQA 3DRTB 5ADPH 3HMXH 1ZGLP 2BFVL 4W4OA 3KXFA 3X2QB 3FCTA 1K3IA 1BPLB 2FK9A 4PJIB 2ICEB 3AU1A 2RCSH 4HT1H 4RFEA 3DXAB 4HKBB 1G84A 3G9AB 2GJZA 2QTEA 4UB0L 2ATAA 4LBEA 2IAND 2FJGA 1AD9A 3FQWB 3ZDWA 1H6EA 1HEZA 2PXYA 4OM1H 3LVTA 1QEWB 1AGBB 4RGOL 2AGJH 1ZGLM 3SEPA 3WTSA 3I9AA 3SYOA 3CMOH 2C8NA 3H9ZA 1XF1A 3KPRD 1NDMB 3T08A 3BKMH 5LBSL 5B8CC 2WLJA 4K23H 2XBTA 1EZLA 2YD5A 1S9KC 4I8DA 4J7RA 1FC1A 1P69B 1XCQB 2B3IA 2J88L 4JFPA 4P07A 5IW6A 4HBCH 2OL3A 3F85A 2EQDA 3PS6A 2DQJL 3S36H 2ZCLL 4MJID 4ZS7L 3KLAA 1LWRA 3OKDB 5E4OA 7TAAA 2X6UA 1G1OA 2DQUH 4GW5B 2FECL 4PJ7B 4IBZA 4GRLC 4WEUD 4OGZA 4XB7A 2KDGA 1GTNA 3BH8B 5JTWA 1I9RL 5HYFA 4Y4FA 1GYAA 3VGDA 1DZ0A 4P5KA 3GXFA 4KBPA 4MJ6B 4MNGB 3UPCA 3S6CA 2V4LA 1TU2A 1XH0A 2ZF8A 2NY5L 5KJ7E 3MCLL 2HCZX 3QEHA 5CEZH 3C60D 1HNFA 1L9PA 2XN0A 4M9OA 1FO0B 5CLXA 3GO1H 5T3ZD 1I9JH 1NDGB 2K70A 5BVJA 3ZTNH 1CFSA 4IQHA 2JCWA 3UGUA 1JIBA 3SDYH 3CSPA 4N0UA 2JCCB 5IHUH 3SDCB 3FO1A 5DT1H 4M43L 2Q8BL 1PZUB 4CN4A 2G4EA 2WXIA 1QUPA 1NCBH 3L1EA 3D85A 3OAYK 4NP4H 2C7FA 1XGRA 2A9ML 4PJIE 2O61B 3AS2A 1R3KB 4OQTL 1WV7T 1C5CH 4QRAA 4S1QL 3VWJD 4N2AA 4ALAC 5GGRB 4N87A 3DXAE 5ADOH 1AZBA 3VFVB 4IKKA 1E6OL 3JWDL 3MJWA 3NN8A 4PLJD 5HHXH 4X7FC 3TNNA 3HPJB 3K71A 3BIBX 2VZSA 2IOOA 2KDYA 4HIHA 2Y5TA 4Z9KB 3B6SB 5GS2D 1FAIH 2OMWB 3JWOH 1DJZA 3QGVA 3DMMD 5AOKA 1UYWH 3LQZA 4E41B 3AB0C 2V3EA 3RZCA 2W9LA 4X42A 2R1WA 3WS6A 4AC2A 1S78D 1MLCA 5I17B 3NCJH 3H3KA 5JR1H 4MJJA 4W6WB 3I6LE 4J1UA 3RPIA 4NWUH 1UKSA 3QJHA 3T3MF 3DGGA 2VDRH 2P8MA 3QJFB 1HJBC 2AI0L 4BWUA 3U9WA 3EJJX 4JB9H 4QYOB 3BDXA 3O0RH 1QRNE 8PAZA 4PJ7E 4WEEA 3EJRA 4FCHA 4HK0B 1CLOL 5IJVA 1VADA 1ZVYA 3CZSA 3C9NA 4OZHF 1NCDH 3AGVA 1GGIL 1J9SA 2FO4A 4PUBL 3Q1EA 5DD6A 3TM6A 2AMUA 4MNGE 3BPCA 4ENED 5A2JH 4PP2A 3I74A 2XV3A 5HJGA 1VPOH 4HAKA 4L1LA 4Z7OF 1J0ZA 3OV6A 3IFPA 3VG9C 3QUXC 1ZSDB 4ADJA 3D51A 1BVOA 3WE6A 2EIKB 1U8MB 4XAKE 5BPPA 3CFQA 2XXFA 2AJYH 3MV9B 5CSBA 5TDOB 5B39B 2JCCE 4P23D 3IU3B 2AABH 4Y4KB 1A64A 3QAZC 4MA8H 2WUCH 2CR6A 3QA3A 1U8JB 1YEIH 2DQCH 2H0PA 1T2QL 5C9KA 4JJHA 4BZ1L 3BUTA 2P3YA 1SVCP 2EDHA 2FX7L 2VM4A 1U0QA 3BX7C 5DHYA 4HUKB 3EYFB 3RWDB 3JV4B 1HHJB 1L6PA 2TRYA 3M17A 3WMPA 1HH6A 3L3JA 3O3DB 1T5KA 4ZQKB 4JM4H 3OPUA 1CF8H 8FABB 4Q9RL 4E41E 2JJTA 1N3NA 1T0MB 3ES6A 5EORL 1G87A 1LNUA 1KIPA 3QIUD 4HKXB 5H37A 1PS3A 4LVOC 1JBJA 1CCZA 4L3CA 4KXCA 5BMFH 2VQ1A 1OIOA 1JZHA 1UGKA 4P59H 4WSGA 4WUKL 4F7TA 1QHOA 2X88A 4QI3A 3UYRH 1CJYA 3RGBA 4OFYD 1BIIB 1DJSA 3HRZC 1AZUA 4JZJB 2EC9U 5CIPB 5EUOB 4HH8A 4O2FB 1F42A 3MV7D 5T5FH 2E59A 1FFNB 1RULH 1DSYA 2ZKMX 3MUJA 2DQHH 4NSKA 5D7EA 3ZZQA 1A7OH 1H8LA 1AQDA 1MW3A 4LCWB 5FYJD 3EFDH 4N8VB 2Z7UA 2VUYA 1EQWA 2K7QA 3G6JA 2HAZA 4X8GA 3DOIA 4JO2H 3EH2A 3G5ZA 3GDCA 3L48A 4Z0BH 1FL3B 5HI4C 4JFOB 4OLEA 3KL5A 4D7BA 3O11B 5FYJL 1JHKH 2D7PA 1P1ZB 4GH7B 1BZ7B 3NCFB 3WKPA 3RGVC 3QZPA 2FJFA 1MWAH 3C6LA 2R23B 4HIXL 5EA0H 5HHNA 1J0IA 4TLTA 1A6ZB 4MMZB 1EIBA 2NUTB 4PGCB 4AZ8B 2VMEA 4N2GA 4M1DL 4GJTB 3C8HA 3MV9E 1TVDA 1RIUL 1W8NA 4FULA 4ETQA 5TF1H 5C07A 3FQ1A 2UXFA 2DYPD 2VM9A 2CA3A 4XNDA 5J6SA 5C92A 1HZHH 1X5GA 2QQNH 4WZ9A 5E70A 2HLFD 1EEQA 2ZKWA 4TUJB 4K9EH 3VMNA 4NNXA 4IGBC 1Z7JA 5MHSE 2XXCB 2ZOUA 3QWOB 4N8UA 4NO0B 4LPTA 2AEQH 3OGOE 4JGNA 1W72B 4JM2A 4M9PA 3RUGA 4UM9B 5D7JC 4WK0B 5L4JA 3KD4A 5LXVA 1OSYA 3DTXB 4MDRA 2OCCB 3PWVA 5AVXB 4I1RA 1MUJB 1J05B 4Z77A 4GG6F 4Y1AB 2QLYA 3CFTA 4Z7UA 5AW1B 2D03L 1QLFA 2AQRA 4FXGC 1QFPA 4IU2A 5C6WH 1N5YL 1HHGB 3VFOA 5HHPB 3WEBA 2TSAA 4K73A 4IRJA 4FABL 2WWOA 3UDWC 2JK5B 3JQOB 5D96C 4KK5C 4HMEA 2Q1EA 3RAJH 4WI7A 5I8KL 1MIML 2Z8RA 4ZXBC 5BVPL 4NKOB 1TPXC 1I8IA 3IB4A 5F93C 5CKGA 4JFVA 5JYLA 2NZ9C 5EZOH 1OP5H 4LPCA 2EH8L 2NZ1A 3CVDA 1JG9A 5EUOE 3DX3A 3D09A 2F7OA 4UQEA 1T1YA 3G5VB 3JT2A 4UYPA 2B77A 4WWKC 5T3XD 3HE7A 4IHOB 5I8OH 1QO3B 4LCWE 2DKMA 2B1AL 2GAZA 4PRAB 4CU7A 4U0QB 1ZHKA 5MI0B 2BO0A 5F1SA 4AITA 4F3FA 3PGFH 3MREB 1I1RA 3RVTC 1PEZA 3CLFL 3UTPE 4E2OA 5FKPB 2VR6A 1CD1A 1OXYA 3ZR5A 4AKPA 2EUVA 1WBXB 3QUML 4IMKC 3F84A 3ZKSD 3K6DA 3L6FB 5F71A 5B3JF 4EVNA 3IDUA 3J07A 4PWGA 3FCBA 1NC4B 3L7FA 3NA9H 1HCZA 4M61B 2AF2A 3ABKB 1QFUH 4NKMA 4E5XG 5B1CA 4PCYA 3SKNB 1Q72H 4FG6C 1NFDF 2ZWSA 3Q1SH 1JCKA 3FQYA 3MUY1 2QKIB 1RK1B 1CFNB 4W9EC 3VVWA 4OCRH 5EF2A 3LV3B 2EINB 4GQQA 4ZUUA 3QHFH 3OLGA 3DURA 4M3KB 3GI9H 3VD2A 2DM7A 1FNGA 5FF6B 3TBYB 2ZYRA 1LO0L 5C09A 2BCMA 4AYGA 2YMTA 5C0GB 1N0LB 4JR9L 1FBIH 3V5HA 4TQHA 2VLJA 5FFLA 3IF1A 4Y1AE 3PPEA 4RISL 1T3FA 5CUSL 2ICWJ 5BOPA 3B2DC 1BYNA 5FYKD 1AR2A 2D2OA 3RNQB 1ZVNA 4XN2A 4BK5A 1DVFA 1R75A 3L4UA 2ZKXA 5GGSB 1YEEH 4WV1B 4P5SA 2VW4A 4PIRF 5HHOA 5AFAA 3GB7B 5CU5A 1ND0B 5CFHA 3S8FB 5G4MA 4YDLB 3QBTB 4NHCL 3LKOA 5ANMA 1AC6A 4QRFA 5HXMA 2EADA 1FE8L 2A1WL 4LKXA 4O58L 2YPLA 2VDQB 1EMTH 7FABL 1KIQB 5KSUB 3QIWA 5DHXB 4X6BA 1AQ8A 3JV6A 3LZFL 5DTFB 3IXAB 1L7TH 3KPSA 5L6YH 2DIEA 3AM8C 4G8GA 4ZO6A 3HCVA 3Q2VA 1Q9OB 1UJ3B 3P2TA 5J5EA 4M6NL 3SGEI 5D7LA 3VX1A 3QXUA 2F5AL 3AROA 3MRDB 3SQOH 2R69A 4JRXA 1UOVA 1ACXA 2APXA 5F7HA 4X7SL 1ZLUK 2QEJA 3WJJA 4PU2A 3N55A 2G3NA 3P0VH 4LEOB 2FO8A 1G7MB 4GSQA 5JW4Q 5GGRY 3SOTA 4EDXA 1PVHA 3VXTA 2C1PB 3U0WH 1PZBA 2XBZA 2A0LC 2RBLA 1TJIH 1W15A 4CBZA 2F54D 1BAFH 2DJUA 3I84A 5IB2B 4W68A 4BZ2A 4B9IA 2VUKA 5B3SB 2BSSB 4P5TB 3MGOB 3NCXA 1OCZB 4RETB 2GT9B 2QSVA 4KMTH 5EOQL 3EHBB 3RWEA 2J1WA 5A7BA 1JE6A 3PWJA 3TO4C 4C4UA 4IIQB 2VM3A 3RWHB 1YNKH 3KNBA 4OLVL 4FYSA 3BIKB 2VJ8A 1F3DJ 4JCWA 4OLXL 3UOAB 4BWTA 3FN3A 4K9JA 4NFCA 2H8PA 1UZ8B 1RU9L 4ODVL 4LEEA 1KPUA 4F93B 2CNYA 4WI0B 2A73A 4DVRL 3MNVB 4RESB 4ONOA 3DV4A 3RBSA 2WXGA 4GBXA 4GRMA 4H2AA 1BBDH 1DANU 5I73B 1PW3A 1AQKL 1J0YA 1R4XA 1TYJA 3BD3A 2BINA 4L1HA 5DUMH 5KVEH 4ZUVA 3FB8B 4OKVA 1KV7A 1WRFA 2MPVA 5D8JH 1WCQA 4LIQL 1SLXA 1GMIA 1JYNA 2VZ1A 2OZ4L 5IWLA 2ZAIA 3LCYA 2NX5D 1ANUA 4GI8A 3W1ZA 4QNPF 2OMYA 4DZBB 3FT4B 3U7AA 1T22B 4LSRL 4G7VL 3WFHA 5KYYA 4MXQC 4NM8L 4YLCA 4M8VA 1C8QA 1CK0L 2AXGA 2ZXAA 4HFUL 2MKWA 1LEKB 1KXQE 3OHXB 3Q2WA 3DHPA 1D5IH 4G1MA 1CD0A 1SJHB 3MRLB 4X4ME 5AVWB 3UPRA 3HTLX 4WFED 1DQDH 2DB8A 3QUZB 1QUNA 1HVXA 2GCYB 4NBXB 1F8TH 4ONGH 2V2XA 2DQFA 1MCOH 3KYNB 1IAMA 4HHAB 5KVGL 1SGKA 2O72A 4XTRC 4AXWA 1SY6H 2MCMA 3OR6A 1T03L 1KPVB 4XCNA 3L4VA 1QFWI 5EB9A 3AY2A 1JNLL 5I6MA 1WISA 2F19L 3K7UA 3SPJA 3FONA 5IROC 2HFEB 3LRMA 1YEFL 4F2MA 3FFCD 2AKRA 4QRSB 1OAQH 4LNRB 2N3JA 2UYLB 1VB9A 3HC3L 4FQXA 5CR8A 2O6PA 5EZLA 2EILB 1VFMA 4GRLD 4IW4C 3I50L 3VXOB 3R0NA 4GT7A 4CSSA 4XPAL 5F7AA 4LCYB 3EKCA 2P80D 4JHBA 4JO5A 4M3HA 4X8JB 4DK6A 4JDTL 4G6JL 4GAAA 1GYUA 3K1DA 4GAFB 4TULL 4LASH 4X6EB 3SO3B 1JJUA 3AS1A 1RMFL 4L9LA 1DBML 3QISA 1TOXA 2BC4B 4XMKH 5HGBA 2AJ3B 1BCIA 2XQBL 2J21A 1UURA 2EJ1A 1B4LA 4WJKB 4NHUB 3F7VB 2PR4H 3WIIH 4WEBH 5AZ2H 5DD1L 3GJFK 1NLDH 2GKIA 4Q8BA 5I5MA 1IFRA 1R3LA 3HNVL 1R17A 4PRIB 1VCBC 5AL8A 1FL5A 3D06A 4LOFA 3T0EB 4RBPK 5DJZB 3SD5A 5TPWH 3GXDA 5I6XB 3S88H 1A25A 2YLHA 3SE9H 2FGWL 3U46A 3HHMA 2CKBB 3V52L 1OQOA 4QHNA 5DO2C 3FRPB 3OKNB 1OY3B 3KJ4B 1BBJB 3WTYA 2X4RA 3LSOA 1OSEA 2PCFB 1JK8B 3CFMA 4FCAA 4KK6D 4XMUA 5CBEA 4F33A 5AD0B 4ALAL 4M03A 2EUWA 5C08B 5I8CB 1UFUA 3GBLA 2DL9A 4C56D 5IF0A 4JLRB 4FQPA 4NM4L 1NFAA 5F88A 1JWSB 1UXLA 2QHLA 4PJ6A 1T21A 2R4RL 4TN9A 2RALA 4N2MA 3KM1A 4ODWB 1J9TA 2BP3A 5I1KH 4ERSH 1QTPA 3FQNB 1GC1C 5I19L 1QVOB 3S98A 4WCYL 2UUDK 3DK2A 1AIZA 1HEHC 3CFEA 4NWTH 5DJCA 1NBVL 1ED3A 1X9RA 2RA1A 4XCYA 3UBXI 3CVIL 1IKNC 5EFIA 3APMA 3MRNA 5F9WB 1FFOA 2QADB 1X4XA 2Y7LA 2X4NA 1WK0A 2H26A 4EBQL 2WAHA 2H45A 2WJ7A 3QORB 4J8RA 2WLLA 1M1XA 3UIYA 4GI6A 1DQLL 3NJLA 1EV2E 2WQSA 4GXVL 3F7QA 3QUXD 1NEPA 1RZKL 4APQC 2NXYC 5JPNC 3S8WA 1QSVA 3KCPA 2LFGA 1Z0NA 4KRNA 4U1HB 2YEQA 4DFHA 3T1WA 1CDGA 3FHQA 4BFGA 2EIMB 4LDLB 5DJ6A 1MCFA 4MNHA 5F7DA 2D2CC 5KSBF 3LKPA 5HHMD 4PRIE 1F97A 1DJYA 1P2CB 3T0EE 2BWDA 2P8PA 4IRZL 2XXGA 1QFHA 4HBQA 4W93A 1IGCL 2EKSB 2IMNA 5GHWH 1JYVA 3LIZH 4LCUB 1R0AH 4OI7A 3TA3B 1OPGH 2X0UA 4HJGB 1EZVX 4KZCA 3GBDA 3CZJA 1IGFL 2YXMA 1A14L 3SN6N 3D39E 2X4QA 4C4BA 2Z0UA 2V5MA 3SGDI 1FL6A 2IPTH 2QV2A 2NY1B 3QO1A 1PCXA 3QQ3B 4KI5F 1XGTA 2CR3A 1J1PL 3F7RA 1F4HA 5C08E 3QDJE 5KVFE 5L4IA 1ZPLA 1TZIB 3OC8A 1I3RB 5D7SL 4RAHA 5EF1A 1ZT1B 3O3BB 1ADQA 4P4KA 3WFZA 3QUYA 4UDUA 3Q5OA 2HX7A 3O2DH 4LSVL 4YAQA 2BHFA 4KKAC 4L4VB 4YR6B 4HWBA 3V7AG 5SWSD 4F7CB 1D5XA 4X80H 2OR9H 3LS4L 4WSKA 4U7SA 3ZY7A 2GEQA 1I1CA 3GBEA 1H6FA 1ZK9A 3BP4A 1LM8V 2QL1A 2GJPA 3W0WD 1MCRA 4CC4C 2C9VA 4OCYH 4W1TA 3CXHJ 3UTQA 1CC3A 4YHMH 4BH7B 5GGSY 3B34A 4CL7A 4DPCX 1LVEA 1YNLL 1NMCC 2EDXA 2OMVB 1CTNA 3FU6A 4YSUA 4NT6B 5ADPL 3O4LD 2BS8A 3QG7L 1MFEL 1WUZA 4X7EC 2DKUA 4WW1B 2DJMA 4BCZA 3QZWA 2H9GA 5JHMA 5HI4D 3HAEG 1ZDQA 2NTSP 3Q7JA 5E2JA 2ZCZA 2KI6A 1JZFA 2GC4C 1YZZA 1U8PB 2WBJC 3RGVD 3FNKA 4YHOL 2HLEB 2IO5A 2XBDA 1W0WA 3HBGA 1DVZA 4OM1L 3T6WA 1LILA 3VG0H 3TFKC 3A67H 3QNYA 4PCSA 3CMOL 1KTKE 1ZS8A 4Q0XH 3MLPA 3BKML 3WNLA 2QR0A 2VSKB 2CXGA 2AVFA 2RFXA 1NC2D 4Z7QB 1AD0A 4D7PA 1T7VA 2DMCA 1KJVA 4ZDHB 3GXUB 3VXQB 1N67A 4PJ5D 1KV3A 2CHNA 4YFLI 4NZTH 5F7EH 3HI5H 5JHDD 5BXFB 5CGYC 4U1MA 4H0IA 5E24E 4TNVF 1Y0LB 3D52A 3CTTA 4Y5YA 1R24A 4QTHB 2YZ8A 3I6GA 3LKNA 5D7JD 3HE6C 3SZKC 2JH2A 2WYZA 3MRJA 5C0CD 2VERN 1NOFA 2VLLA 3TZVA 2DQUL 2EYTB 3MRMB 3RWIB 1MCSA 3FW6A 5ITFB 4XPHH 5CEZD 3ZE1F 5EF3A 1NJ9B 1G1YA 2EE0A 2E6QA 2DJ4A 1FZMA 4JG9A 3FT3A 1PFCA 4GW1B 5DU7A 4B95C 4I48B 1AR1B 3NT0A 4KK5D 3HRZA 5HYSG 4L4VE 2A9AA 4NBZB 1IL1B 4ZXBD 4AT6A 3VMOA 3WL9A 2EE2A 3MYZA 1JGVH 5D6DC 1S7SB 4G6MH 5CEZL 4OSUH 4QR7A 4OZ4B 1FVEA 2F9BT 4AV4A 2BSTA 3MLYH 3ZTNL 2WKOA 4MXWH 1X9UA 3SDYL 2RGSA 4Z5RA 2UY6B 3B7SA 1XIWC 1WBYA 1VZHA 2DPKA 4GMTH 3GZOA 4MXVF 4WWKD 5DT1L 1AHWC 4LOEA 1NM4A 4OLZH 4F9PA 4EXKA 5JHLL 3N5AA 4JZOB 4NP4L 5F3BB 5JMRA 3CHRA 1MI5B 3KL3A 5IJDC 1IKFL 3GMQA 3RVTD 1WD9A 3NACH 5GGVY 2I26N 1USQA 1N8ZB 4MCMA 3GRWH 4YSRA 2WTRA 3LXCA 5TK4A 3A4FA 1E30A 4LMQI 5HHXL 3WLWD 3W9EB 4NQUA 2CJSA 3RYMA 1KF9B 2HPTA 2DQTL 3AREB 3SPVB 2LV4A 1FAIL 3JWOL 3L2LA 1IAIH 4NQDD 4QXTB 4EZKA 2COQA 4R90H 3T6QC 4WWPA 2JI2A 1H6UA 3PYCA 4FG6D 1JF6A 4Z7QE 2EIEA 4NXKA 4DZ8B 1VESA 5JR1L 3ABLB 1M7IA 1UM5H 4ZTOL 4I9XA 1GGCL 3PNWA 3QP3A 5JIMA 1T7YA 1BMZA 2HKFH 2AJVL 4NWUL 4QTIL 5GGQH 3EOTH 3PNRB 1NGXA 1I85A 4N2DA 3QG6B 4L3EA 1MCWM 1XHHA 1CQKA 32C2B 5IMOA 3ISWA 4OGQC 3SHSA 5HVFB 4S2SA 2QQQA 3K5RA 3IAGC 3TLRA 3O0RL 3R18A 4NIKB 5I5RA 4I0PC 1Z3RA 1XSOA 4R5VA 1NCDL 1MAJA 4TNFA 1IEBB 1NSNL 2BK8A 3KYMA 4KI5C 1UB5B 2AANA 4P3CH 1NEZB 5J8OA 1XB8A 4YBLC 1NCIA 1SBSL 4HC1A 5DVPA 3V4PH 2XG5B 1TNMA 1Y6MR 4Z18A 3BI9X 1T1XA 2PO6C 1VPOL 1MWOA 1OTSC 4QHUA 4KDTA 4E42B 5FLUA 5BJTA 3MV01 2YWYA 5SV3A 4PWEA 5AAWC 4G8EA 3HJEA 2AJYL 5IT2H 3HZVB 4ES9A 4JUTA 2UX6A 4K55A 4MA7L 2ZOWA 1TEFA 2AABL 5IB4B 3WTVA 3GSNH 3RWCA 3R8BB 3KPOB 2Z31A 4MA8L 2A99A 2X4UB 4OZHA 2FL5A 1WAAA 1MI5E 5F9JA 5D7IA 1YEIL 2DQCL 4NC1C 4AM0B 2YA2A 4R7NB 2P5PA 3T4YB 4QRPA 1Q90A 3EFOA 3EGDA 4F24A 1YN6A 3U30B 4I3GA 3IN0A 3OKOA 3JTTA 4WGVB 2MOQA 3HB3B 2M26A 1A1MA 1HU8A 2ZUSA 5EU3B 4G7RB 5DHVB 3GMLA 5DEGA 4K71C 4W9GC 3SB3A 4WJG3 4D9LH 3NJVA 2WTPA 4JM4L 2WP3T 2L04A 1AXSA 2A0LD 5JOEA 2AHIA 5FYLE 3QDAA 5GRXG 3UZQA 1FP5A 2I60H 5BMFL 5JXAH 1F1AA 1DBBH 1WQVT 2Y2WA 5DSCB 3CVHB 3KH4A 4XHJC 2H32B 1NGZB 3BEWB 3TIEA 1VRSA 2Z4QB 3F5WB 3R7RA 1D7CA 3B9KC 1NUFA 2W80C 2A6DB 2DQDH 5DMYA 2OP4H 3VGGA 2NLJB 3T2LA 1R3JB 2XX0A 3B2VL 3FUJA 4MASA 3T0AA 4QOKD 5EF0A 4HJJL 2G2RB 3ULUE 3QQ9D 1C16A 4WHTB 4GQRA 3DVGB 4BSWA 5FGBA 1RULL 4BFNA 5GRYA 3JWNC 1A7OL 1CWVA 4OLWH 4ZUSB 1PLGH 4GS7B 3O3UN 4HQQH 1KJ2L 1H0DA 5DEZA 1ZVSB 1EFXD 2XQYG 4JO2L 1UD8A 2JJWA 1EVTC 1QRKA 4Z0BL 2CDGA 4RAVB 2ADFH 5MERB 4DN3H 1AG6A 3T4AC 1KELH 1TO4A 5FA4B 1MWAL 4NPYB 2CJ3A 5FCSH 1DP0A 4XVJH 3BPLC 3EBGA 2R1XB 2X4PB 2Q7YB 4HEME 1A4CA 3TIDA 3PWPA 1A4KA 1S7WA 4WW2F 4JHZA 3WIHH 1A9EA 4EIGB 3FQTB 4X98A 3UJIH 1DVSA 3PJSA 1E9QB 4W9LC 3GUTA 4ZMAT 2YAOA 4M93C 1YSOA 4MXQD 5DHEA 3OTTA 4K9EL 1X7QA 3V5DB 3QXDB 3IJ8A 4XNMB 3KR3H 4LLUA 2Y72A 1ZANL 1P4BH 4WK2B 3UYPA 3D3VB 1RVFL 2AEQL 2VDLB 2PWGA 4JS7A 4AIOA 4FG2A 3MNZA 2FQGA 3EZJB 2BFGA 5KTEL 1CI3M 1WYJA 2JQAA 3FO9B 3LZPA 3WG7B 5GRUH 4LT7A 5IMMA 4JPWH 4K3EL 1JF1A 3R06B 3I9GH 3TJEH 1IEAA 1KOAA 4XTRD 4X5LA 4ZX6A 3HG1D 4KX8A 1BF2A 5DS8B 2ODIA 4QWWC 4I18C 3ARRA 4HXAL 2G5BB 4PGDB 5HDQH 5CD3A 5E9AA 3ZBMA 2XJKA 5IROD 2CRZA 2D3VA 1U91A 1LK2A 2A6KA 3F83A 4DK3A 3QDMB 4EUPA 2BY2A 2B3RA 5J1AA 4WHCA 1FAKT 2P5WB 4WQOA 2A6JB 3VB8A 2OQJA 1RZ7L 1YY8A 2ZUYA 4PVLA 5DURB 3VUAA 1IUZA 4ZUWB 1XO8A 5CP7B 3MOBL 5E8OB 2WWNA 5KANG 1KIUB 3SYQA 4GG6A 3PXLA 3O6KL 4MA3A 1KIRB 4FE9A 4MHHG 4M8UA 5DC9B 4XMTA 5DEFA 3MRHB 4LCIH 3V6FA 3OJ2C 3OKKB 1A1NA 4PJ8A 2VDMH 5LNDA 3ILQC 3N1MC 5IKCA 2O6DA 3BKYL 5AW3B 2NY4D 3MBXH 5D2LF 1YMHB 5IIEB 2LLLA 3VJ6B 1GR7A 2X87A 3BLKA 2ROXA 4G8IA 1S7TB 2ERJC 1CLZH 3NA9L 1EEYA 3MV8D 1QSZA 4QRBA 1QFUL 1ILSA 1GZPA 1XFPA 1H3TA 1JNNL 1BXVA 5KUMA 3O6FA 4IM8A 1XB6A 3D25A 2J6WA 3U7YH 1Q72L 5DO2D 3Q1SL 4G8FA 2E7HA 3QIBB 4OCRL 1KGIA 5D71L 3NJIA 1QA9B 3HS9A 2A9NH 2BRQA 5E2TH 3F01A 4XN4A 3D3VE 4XAWH 1VZGA 5D1QA 2B1OA 4P9MH 1OW0A 1GGYA 4RDQG 2C34A 4PJCF 2WHVA 3V4VL 1BG9A 3RWGA 1BZ9B 2VLRA 3HIZA 1E2VA 1TVHB 2XVKA 1PIFA 1AS6A 5CLZA 1YEEL 1NFDA 2E4TA 2EDLA 3UAAA 2F61A 3DIVA 2ZWZA 5DHMC 1TJXA 2MNJB 5I28A 4C8XA 1M7XA 3QDGA 4GKZB 4Y2DC 5FO7B 3QDME 1G7PA 2AQQA 3NCBB 4EAEA 1HX0A 2X7LB 2P5WE 2DQGL 2FEDC 1TJHL 3WHXB 1GAFH 3B9AA 4YO0A 1B4JH 3ARDC 1U8IA 5G5DA 4BA0A 3TCTA 1IC0A 1OF2A 4L8CA 1XEUA 1WFJA 1DUYA 1JGLH 2FT7A 2UZYB 3BH9B 4JFXA 3DVFA 5KZCD 1L7TL 2LVEA 4KZDL 1S3KH 1N6VA 2FATH 2BNRA 1E5ZA 2NXYD 3RHWK 4APQD 5TH2A 4JHWH 5DWUH 3MR9B 3SQOL 3L17A 4R4NC 1JFQH 3F7YB 4LHUB 1AKJA 1E4WL 1KTDB 3ASWA 4U3XA 1FZKB 3P73A 2PW2B 1XH3B 4HDIA 5INDB 4P9HL 2WLKA 1QZNA 1ZT4A 4RVBA 3U0WL 3L3IA 3BGMB 1MHHB 4H1LB 4U1JA 1R5IA 2VH5L 1FO0H 1TKWB 5JOFB 2P24B 1SHMA 5ECGA 3KPNB 1HK6A 2JE8A 5ILTH 3BAKA 1UM6H 4MB5A 2CALA 4L8SC 3UEZA 4I3RH 1YAIA 2J8HA 1T0PB 4M48H 5F6HJ 1SQ2N 1XGYH 1RUKL 2XA8H 2K6ZA 2CO6A 3BQUC 1YNKL 5B39G 4I4WB 1CLYH 3DIFA 5KYXA 5GGTA 4UOZA 1DTUA 3PIQA 5F70A 3SJVA 3BSZL 1KEGH 4NQCA 1ZHLA 4DF9A 2OJZL 3FZUC 5ACZA 2R39A 1YDPA 1RZ8B 4KKAD 4EI5A 4XPFH 3ARBA 3KLQA 3PREA 1PIGA 2NUPA 1KULA 3VDCA 4JFED 1AO7D 5AB1A 4HZAA 1OT4A 3GSOB 1KXVC 2ODHA 3MXWH 3S9DB 3I02A 1BBDL 1TTGA 4PR5B 1T1ZB 2YIHA 4MJ5B 4PJFF 5DUML 4ZAKB 3MRRA 5DK0B 5KVEL 1O7VA 1HXMB 5I74C 1IKNA 4WDIB 1EERB 2JIXB 1KCBA 3ILPB 3MLSL 3CVCA 4NO5B 3VRJA 1HHIA 1IAIM 1P4LB 1WZKA 2R83A 3HS8A 5D8JL 2AQ1A 1QFOA 2VLKA 2NZIA 2WINB 3VFTA 1HHKB 3CFDB 4D8PA 5KSAC 3KVQA 4QUOA 2CCWA 2G5RA 2Y7SA 2EE3A 5EU4A 3MLVH 3B7TA 4BUHA 4NQSA 5EO9A 1N6QH 1UWGH 2P4AB 4P2AA 4LVHC 1WLHA 3MA7B 2WBJD 1FFTB 1WS8A 5ESAA 3MLRH 2ENJA 2PYED 1KBGL 5IVZB 5F2FA 4WKZB 3RI5K 2ITDB 3TFKD 1J8HB 3OF6A 1DQDL 4OIAA 4KUZH 2E56A 2WANA 3BUQA 3IJHB 4N8VG 3IDJA 4KC3B 2EABA 2VXQL 3EF7A 3RLSA 3AXLA 3OX8B 1RUAH 2H2PC 2WVUA 3V9FA 1T04A 1KB3A 4G3YL 2IWEA 1AGCB 5CGYD 3BEVB 1NCTA 3T65B 3LQAH 1MJUH 1XR8A 4DT2A 5DI8A 3BVTA 2I9TA 2IXQB 3HE6D 4FZ8L 1P6FA 4G6FD 4WNQB 4BUQA 4CILA 3O45B 2LU7A 4PV1C 3KXFB 2X4SA 2WWMC 4M00A 3TEXA 1MVFA 4OLYL 4HIQA 5T1MB 2JKRM 1EA9C 2DF3A 3AU1B 4LCVA 3CDCA 3CSGA 4RFEB 4ZFOB 5T5NG 1IT9H 2PPFA 4LASL 3HZKA 3NRQA 1RV6X 4LBEB 2FJGB 1AD9B 4LGPB 1HEZB 2PXYB 2Z0BA 4D0CA 5T1KA 3VRIB 2O93L 3KGSA 3ARTA 2EO1A 3WIIL 4DP7X 2VDKB 5AZ2L 2GI0A 3EJUA 1XIWD 4PREA 3VGFA 2F18A 2WGXA 4PHXA 4LU5H 3H2WA 1TJGL 2D0GA 5TPWL 3SY6A 3E9TA 2OL3B 2WNWA 2Y7OA 2DDQL 3KLAB 3FK3A 5CIPH 2F1BA 2J44A 3T0BA 4R7DA 5IG7A 3TCLB 2A5UA 2ICEC 3H9SA 3WKNA 4D94A 3S37L 3ZZLA 1I31A 1BF5A 4HWUA 3L4CA 3ZHNA 1J8HE 3RKPA 2X1WL 4AYFA 4P5KB 4GP8B 4WFGD 4BRJA 3NTCH 1Z2KA 3HZMA 5LBSA 1R5VB 4RFOL 1O75A 1X5IA 2BP8A 5DD0H 5DZVA 4PYGA 4R9HA 3W9DB 2YGQA 2F8VA 1HL4A 3DHUA 3AWFA 4I2XB 4RX4A 3PRZA 5JNYA 4JPKH 1NAML 1E50A 4KO6A 4NWTL 3TN0C 2YD4A 2NQ3A 3D85B 1UD3A 3KXFE 3DBXB 1OGPA 2A83A 3UJJH 3CQQA 2YPVL 5JXEA 4UIKH 1JK9A 2XYCA 4I0PD 3EDJA 1YPZA 4CVXB 1INDH 1QP1A 5I15L 3EYSL 4HS6B 3KL0A 4JY4A 4KI5D 4TVPH 4QRRD 5GJSH 5JIQA 3Q0HA 4HIHB 1HINH 3KPRB 1WT5A 2PO6D 2Y5TB 3D07A 4NUQA 3ZO9A 4YSOA 5DVMA 2ZKHL 1TTFA 4V1DA 3UTOA 2B14A 1FQ9C 3GM0A 5HI5C 2APWA 4P5MA 1K8DA 1JWMA 1M9WA 3U4KA 5H2BB 3SY0A 1HS6A 3CE1A 1IZJA 1OCCB 2R1WB 3D7PA 5HVGB 3N43B 1MLCB 4OZFG 3HLAB 3C60A 4QO1B 5A2CA 4J1UB 4B3VA 5BV7B 4QXGH 2NY2C 4FFZH 4NXSA 3QJHB 2IBZY 5GHWL 5FYJU 5H35A 3LIZL 1R0AL 3O9WA 4G5AA 4A7SA 1IVTA 1OPGL 2BM3A 4OBRA 4PGZA 3V0EA 3QB7C 1CG9B 5LQBL 3T8VA 3TS8A 3BRFA 2ENYA 1JRHI 5IJVB 3M07A 1VADB 4KNUA 4KRPC 1FI8C 2F53D 3C9NB 5DA0B 3WUZA 2AQPA 1OD7A 2FO4B 5DD6B 2WXFA 4PJEF 5DZAA 2FZ3A 2WXKA 2R4SH 3BPCB 2YRPA 3DPDA 4M7LT 3RIFK 3ZKQD 4KZ0A 4DEPB 3HR5B 5KSBA 3GKWH 5TE4L 2FYYA 4XNZB 1F1DA 4P4RA 4XHJD 2Y7QA 4WO4C 4ELMA 3C5ZC 2ADIA 3B9KD 4WU7A 1K9TA 2AITA 3BJLA 3X14A 3GSQB 5I75B 1R46A 1TQSA 5E99H 4MAYB 2ZCKL 4V11A 3TBWA 1XAKA 4I2XE 5JLZA 2UXGA 3CD4A 3D87B 1KB9J 1P5UC 3ZUCA 3VWJB 4K5LA 3WO4B 4OCYL 3MACH 1YYLL 1NCNA 4KX7A 4YHML 4LFHG 1X5XA 4N2LA 4JG0L 2F7PA 4N2KA 1GJIA 4OZGF 4JAMA 3SDXF 3N44B 4X9BA 1QI5A 3MLXH 1NINA 1CU4H 4UT6A 3FQRA 2DJSA 5DHYB 3ARQA 4UCFA 3JBG7 4PRHA 2K45A 1P4IH 3M17B 1HSAA 1HH6B 2VO8A 3VXMA 2O30A 4YDJB 3KPRE 2YS4A 3LOWA 3OKMA 1N3NB 3ES6B 4YDKL 1IJNA 1LNUB 3A21A 5LBVA 4CRPA 4Y8DC 2CSPA 4L3CB 4GAJL 3RVVC 2WLIB 2VQ1B 2IAMB 2X89D 4OZFH 3GGWA 4PIBA 2E76C 1A2YB 4UQ2B 1BREA 5FX3A 3ZTEA 1MHCB 3ZE2F 3IGAA 2FSEA 1WTGT 4JQXC 1A0QH 1MAML 4I89A 1IC5H 1MJJA 3OB0H 4Y4KC 2Y7MA 4IJ3B 4IU3A 4NZTL 4W9FC 1NL0H 4BZ1A 3BMVA 3P9LA 1Q0YH 1EJ6A 4NSKB 3CX5J 3G08A 3IRCA 1LEIA 1AQDB 3UO1L 3RHWF 3H7BA 2EP6A 3DNKA 3MRBB 1AMYA 2VDQH 5IV2B 2K3TA 4AJYV 3O3EA 3HRPA 4IEFA 3BFWA 4ZODA 2RMNA 3IPEA 5IQ7H 1ACYH 5T3ZE 3MQIA 3U4EA 1CFVL 4QWWD 4JFDD 3FRUB 5BZZA 2ISDA 5IHLB 5GJTH 2FJFB 3C6LB 4FFVC 4P23B 4X83A 1U41A 1JGVL 3PWLA 5HHVH 4G6ML 5G4NA 4OSUL 3THMH 4TTGA 2ZOKB 5E5RB 4RMBA 4A7TA 1Y07A 1UFGA 5DQ9A 3MLYL 1AXTL 4BHUI 4ETQB 1A7PH 1AZVA 2J3SA 4J6IA 4MX7A 3FO0H 1IAOA 4MXWL 3UZEA 3HUJA 4L2LA 5E0FA 1K8IA 3B8YA 4AYDC 3W5NA 4L4TD 2CO2A 4POZD 4NNXB 4WGWB 4N0YH 3FPXA 2W91A 1S7XA 5I0XA 2OMXA 5LG6A 1QR1A 5TE7L 1KJ3L 3NACL 1K4CA 4AQ1B 1LO2H 3RUGB 4W9IC 3ILQD 4B6ZA 4DCQB 3BGFB 3CDYA 3QIUB 5J11B 3PWVB 1DLHB 3CFKA 3DYOA 2LU5A 1J5HA 1Z6JT 2Q5BA 2JQZA 2GI7A 3SGKA 1EGJH 5AB0A 3CBJB 1IAIL 4BKSC 5FOBA 3ZIYA 2HVKA 3V0DA 4MMZC 2APTA 4OB5H 2JXMB 4MCNA 5D1ZD 3S34H 2FLRT 2OYKA 1J1XH 3KHQA 1I8IB 3MV7B 5LCVH 3QJTB 3WAJA 4I77H 2CJUL 2DWYA 3ULVL 3WNNA 2HKFL 5GGVH 4LPXA 4EOWL 5GGQL 3WN5B 1O6TA 4PRPD 3HE7B 1I3VA 1OE3A 3NEOA 4UU9A 2Y1YA 2GAZB 5IVOA 3TURA 2LVCA 5K39A 2WBWB 1ZHKB 3T0DA 3TWCH 4ZMVA 1RJLA 4F3FB 5KN5B 1SEBB 3AG4B 3IMUA 4RMWA 3RI5F 5GZNC 1MVYA 1TTAA 4QCIB 1DDHB 5MENA 4UAHA 1BVLA 1G0YR 2YGNA 1JZ3A 1FA4A 4UI2A 5KW9H 3U36A 1T89C 5DJDA 2GTQA 4I88A 3V4PL 2WQ8A 2QQLH 1C1EH 4EVNB 3ZE0B 3CCHA 4QKXB 2QTVA 1MFDL 1QQDB 4N0RA 2UWEB 1JZ2A 3BD4A 4MQXC 2IG2H 4OU3A 2FEDD 4NKMB 3BN3B 5DUJA 3VSTA 3UYOD 3P4NA 1JPGA 1XF5A 5IT2L 2XC8A 3KLLA 1PLBA 2YAMA 4BCYA 2XTJB 3QJQB 3GSNL 2OR8A 4ZJ9A 2OTWA 2YKKA 1RPUA 4ZUUB 4G83A 3VD5A 5FB8B 2QPSA 2R0LL 2Z65C 5C0BD 1B3IA 5C0EA 5E1GA 5MI0C 2ETWA 4MCYB 4KKCC 3RUGE 3CIQA 4AG4H 3BWUF 1D9KB 2GUOA 3A47A 3NEXA 2XFXA 4LL9A 2FBRA 3V5HB 4R4ND 1THCA 5IESH 4MQ7A 4R4FH 5KVDE 1JUFB 3AACA 4UIMA 3QUKA 5C0AD 2IVFC 4UQDA 1RHHB 4GUQA 1U9KA 1KN4H 4G80A 3NJJA 2PCPA 4JRFA 5F96H 1DVFB 1F00I 3MNDA 3PGCA 5BS0D 2I60L 4JRYA 1NKRA 2C5DC 2C3VA 3MGTA 3MV7E 1MCDA 3L9YA 3HI1A 3ATDA 3LZQA 3SYAA 1WFUA 1BQ5A 2R7EB 5FUCE 2W0KA 5ANMB 2OP4L 3C08H 3EW3B 3ME0A 3U83A 3BQUD 2BNUA 2OBGA 4YC2C 4MNQD 3E7JA 1KFGA 2YPLB 4Y8AA 1IGIH 2FGZA 1PKOA 4FQIL 3V8CA 3GLEA 3VW3H 4X6BB 4DP5X 2CKBH 3JV6B 4KQ4L 1J9QA 1FIGL 1NIBA 1TZ8A 3KPSB 4H25A 1BFOB 2Y36H 1WHPA 4G8GB 4HF5H 4HMCA 3HCVB 4OLWL 3F6IA 1UH4A 3BXNA 3FZUD 4RCAA 3HC0A 2J8UB 1X5MA 3GJFA 5D7LB 3GEFA 2HJKB 3D18B 1Z9SB 2KLTA 4JRXB 3Q13A 1HTYA 1RPQA 3QJSB 3VI3F 2HT3C 2IV8A 3ASNB 4OJYA 4Y5XB 3ZE0E 4DN3L 4EDXB 1KELL 3VXTB 5DDHA 4WV1C 1U95B 5KVMC 2UWEE 3QC5X 4FNRA 3MC0A 1CDUA 43CAA 2AERT 1BXUA 1JNHA 2L7UA 3FMGH 4JPQA 5KSAD 3FYEB 3GDBA 4YDLC 1XXDC 1CXHA 1GY2A 2YR3A 1IC4L 4AGOA 3ATBA 1LK3H 2XTJE 2H41A 3IKCB 2UVEA 3ZTJG 5CINH 3RWEB 3SKJL 4R0LA 3PPSA 4FL4C 4UILH 2XN9D 3ZDZF 4Q58C 3BZ5A 2ILLA 2NCMA 3N50A 2B4CH 4UQ3A 5FXCH 1OP9A 1BPVA 1P4BL 4EEEA 2LAGB 1BQLH 3WLBB 1CB4A 1UJ3C 2H8PB 2OMUA 4AQEA 1T4KA 1XBRA 2QFRA 2WN2A 1QBLL 5IFHH 1KXHA 5F1IA 2ZAGA 4NKDA 2J43A 2FLBT 1XGPB 2FHBA 3MODH 4OIBA 5FIEA 3UBGA 4ZMOA 2A73B 3MAWA 1H5BA 3IDXL 5F44A 1T1WA 1BVZA 3DV4B 1RK0A 4RA3A 5IFJA 4GRMB 2H2PD 3IMTA 1JP5A 2OK0L 4N2NA 4WW2A 4KTGA 3SKJH 4UOQA 2P26A 4ZUVB 4HALA 1FDLH 4JE0A 5ITBH 3AG2B 4GKLA 4ZMWA 5T3XE 1OB0A 1UWYA 4YFDB 4NX0A 1DVUA 5ANME 5HYQA 1W9XA 4GUPA 4NFDA 3FTSA 4F8LA 2CRMA 3FO2A 5AOMA 5LAXA 1CBVH 1N64H 3EHBC 4POYA 1UASA 2WWMD 2DWXA 2BOLA 1IM3A 2DWSA 2OMBA 3NZHL 3KYOA 5IB1B 5KYYB 3KPSE 5C9JA 4G8GE 1QR4A 4OI9A 5EU5A 3VACA 1W0VB 2J8UE 4FHJA 2AXGB 2OXGA 4TTDC 5D7LE 3RIFF 5LJYH 3OGCA 5JORB 4JRXE 1KTBA 4NPJA 1DVXA 4FQHB 2VDML 1VKXB 4AGLA 5AKSA 1QUNB 2HFGL 3QYMA 3HW7A 2DQFB 5I6PA 3MBXL 5I73C 4QKTA 1O7DE 2R29A 3C87A 4A6YH 3WHE0 4FYQA 4ACPA 1U8KA 1AIFA 4M6OH 4ZFFA 5E03A 3ZTJH 1SDDB 5I2IB 5EEYA 1FG2A 1MHPL 3RNKB 1MF2H 2BOBA 4UV7H 2OZ4A 3FONB 3U7YL 4DESA 4F2MB 1MFBL 2AV7A 3A6BH 2BP5M 2OX5A 1Q9WA 4ZW8A 3CFCL 4FQXB 3DX9A 4J3XA 5D1XC 5EZLB 4R5TA 2A9NL 1F2QA 3GNMH 3DXAD 3PLYA 3L3HA 5FYKE 1CQYA 4AJVA 4ORGA 4P9ML 3EYQC 1FH5H 5D2LA 3BWUC 2A3TA 3OHXC 1RFDH 2W38A 4AOFA 4O4YH 4TF4A 4L9LB 1TQWA 1NPNA 2PP8A 1HHHA 3BUBA 3R1GH 5HGBB 3SYPA 5JW4N 4BK4A 4OH2A 2ENQA 4E9XA 2R1YA 1MY7A 6CGTA 2ID5A 2J1ZA 5KG9A 2XY2A 4F27A 5JW3H 2P46B 1R3LB 3LKRA 4K5PA 5ALBL 1XF2A 4L8BA 1WIUA 4ADIA 2ZSVA 1HCVA 2NX5B 3TN0D 5IBTH 1QKZH 4PV8A 3JTSA 4PLKC 3LH2H 3NRFA 4XBEH 3VFRA 1E5AA 3DVNB 4ABWA 1B4JL 3PAZA 1XCWA 4HX1A 2GJJA 5ETUA 3RDTC 4HG4K 5KYWA 3U6XA 2MH4A 4IKNA 2X4RB 5HYEA 1HQ4B 2HFTA 4X0KA 3H9HB 4P05A 3HS0C 4Y19A 4DGVL 3EYVA 3DYPA 4O51A 3VXUA 4F33B 3MV11 5GZOC 2DH3A 2FATL 3SO3C 1U2YA 3T09A 4NP9A 5DWUL 2ZUUA 3BZEA 5HI5D 3BVXA 4KPHH 3GK8H 3TYFA 2EXWC 4TQPA 1E4KA 2OZNA 5CWSA 1G6RH 3LHAA 2J6EH 3V7MA 5K9OA 1FYTD 2BW4A 3GD1C 1T21B 4TSBH 4XXCA 1V27A 1U8HB 3Q9QA 5C3TA 5B1AB 1GYWA 1NEZG 5GS1C 1EPFA 2DBLH 5AW4B 3BCDA 3EDFA 4DKFH 3DI2B 4B3EA 4FDWA 1FO0L 4GRLB 5I6XC 3LNDA 4C47A 4F2ME 5AVQB 1D5ZA 1SQMA 4BGLA 5HPMB 3CFEB 3DGDA 3SGEH 1DBAH 5BQDA 4M48L 1ED3B 1LP9B 1RKRA 3WOVA 1XGYL 4BFRA 5IOKA 5EFIB 2XA8L 3S3BB 1FG9C 3LPWA 3MRNB 3TJHD 1PZ3A 5DR5L 2VL5B 3C09C 3ROLA 4OCMC 3X1NA 4JFFD 2H26B 5J1TC 4PS7A 4G6KH 2WLLB 1KEGL 4A2LA 1E3ZA 4O02H 4EN3A 1MNNA 1IQDB 5FM5M 1OAUH 3L08A 4FZEL 4E41D 4AIXA 3A4AA 4HMDA 4ODXA 1KBVA 4LAQH 3C5ZD 1OAKH 4XP9H 4CC0A 3N1FC 4LRIA 3LYRA 1YUKB 3MXWL 1F4WL 5DJ6B 5F7DB 1KENH 4JQVA 4YHZL 3LKPB 4LNVA 5JA9A 5FYLH 2NX5E 3RL1A 4NNYB 1ZA3B 2XV6B 3IFOA 4GRWB 1S9WB 4MZRA 4WF7A 4KAQL 1GJWA 2FR4A 3N2JA 1WZ1L 2Y06H 3HFML 4L1DA 4KITB 1J0JA 1L9QA 1L9OA 3MTRA 4I3SH 5FHBH 4FLHA 2ZNXA 1WC7A 4O2CB 1FH2A 2B4CC 2ED6A 3X1BA 1XL4A 4DAGH 1BAGA 3MLVL 4QJ3B 3NAAH 4APXB 2X4QB 5LN8A 4QY8A 2QADC 1N6QL 1FL6B 3ULUH 3NSFA 4D9QD 3QO1B 2B5IB 1V5JA 1IGYB 3DO3A 4M7KH 4C57C 1M2VA 2G3XA 3OMZA 2Z1PA 1SHWA 3RVVD 2BSEA 4KJYA 4P4KB 3GHBH 3QUYB 4IS6B 4R83A 1BFVH 2IAAC 4KUZL 1M53A 2IFFH 1E2WA 4LF3A 5DA4A 3QNZA 1BZDA 1Z5YD 4UMGA 1E4XI 3QNXA 1D5XB 1MZZA 3MV9D 2X41A 2H0FA 3EGSA 4IRZA 1GKOA 1D5MA 3SCMC 1LTXA 1PJ9A 4Y4KD 3BP4B 5K9QG 2XU9A 3QPQC 4QT5B 1LO5A 2W0LA 4JL1A 4KVPA 3LQAL 5AWNH 2B2XH 2E8ZA 4XZ4A 2W9EH 3NA4A 1LP9E 1OLLA 3VI4B 2VTFA 3C6EA 2X0VA 3X3FH 3HVDA 3VG9B 4UINH 1HYRC 2VDOB 4X7CC 3QXWA 1AOZA 1FNSH 3E6HA 1OHQA 2ITCA 5GS3A 1OARL 3RIAK 2OJEA 1Z5LB 1K72A 3SPGA 3RVUC 4FFVD 5E6IA 1U92A 1QHPA 5DHVH 2H47C 5HHMB 4BQ8A 4GKOA 3QNYB 2FCBA 3QR1A 2FO1A 1G7HA 1YJDC 3REVA 1F2XK 1WA0X 1KTCA 2RFXB 2WUBH 4GRWE 1GIGH 1AD0B 4FKKA 4JCLA 3CVHH 1KJVB 2VR5A 2KZKA 2H32H 1SXZA 1BWMA 5EO1B 2DLHA 3BVNA 5CLYA 4MMXC 3FSWA 4LCWD 1I3GH 4X0NA 1GS8A 4LZKA 1VFAA 4QLRA 2GUYA 4Y5YB 3V6OA 5GSVA 3LKNB 1M7UA 2Y9RT 4KHXL 1DQJA 3MRJB 4M1GH 4U6YA 5DJ0B 3H1ZA 4BWWA 1YEKL 1E43A 2EEBA 4LVOB 3BN9C 3D2TA 2E47A 3UTPD 4Y1SA 2E46A 3DARA 4JPIA 4QAMB 4RMUA 3N9GH 1KB5B 4HCRH 3MBEA 3FT3B 5SWSB 1Y6NR 2EAEA 3C12A 4G7QB 3EO9H 4J6RL 4DH2A 2FWOA 4RGMB 3PGDA 3HRZB 3NTCL 4AT6B 1WBZB 3GS0A 3WL9B 2HH0H 4Z6AT 5L0QB 1A9VA 3FPYA 5EPMA 4UOW0 1AXIB 4JDZB 1FVEB 5DD0L 3LKQA 4ZOBA 2BSTB 4EDWL 5FO8A 3QFDA 4C4KT 3MYJA 3VQLA 2NTFA 1WBYB 5E56A 3D1MC 1CBJA 3K6IA 2BIHA 4TVPD 4JUSA 3LMJH 4JJ5A 3VI4E 1I1YA 3KVDD 1YEGH 3UJJL 2IH1B 5GZND 2AJZA 4FKHA 2VXUH 4WKXA 4XNBA 3PHAA 3Q8AA 3PV7A 4LSPH 3P30L 1INDL 4H0HB 3GI8L 2ZCHL 2WTRB 4NRXA 3FQUB 1KYAA 3MRIA 5GJSL 4YX2H 2VDLH 1FVCA 1W72L 1R47A 2X70A 1SYSA 4GP5B 4MD5A 5BO0D 3F64A 5HHME 3V9CA 4OD3L 1AR1C 3RWJB 4U6VH 3P2BA 2V17L 3VXSD 1NC2B 3RE0A 4RIRA 5KOMC 3DJRA 3GTVA 1IZKA 4OJFH 4OUUB 2A74C 4PJ5B 4UUJA 3FU5A 2IDFA 2K8QA 1ULVA 3BW9A 2VC2H 2MPAH 2CRYA 4YSQA 4IGBB 1E67A 2F58L 5EWIH 3TV8A 3TVMA 1SXAA 1WF5A 2ZG3A 3WNIA 1YRKA 4NENB 4UT7H 4B9PA 3PNWB 2X4TA 5D7JB 2UZXA 4QXGL 3ZIMA 1SRDA 5IHBA 5JHLA 4FFZL 2XDHA 2LW3A 4D3CH 3ULVF 1NGXB 2FNWA 3G04B 5FDWB 3BD5A 1KGWA 4KKCD 5EN2B 4QF1B 5IMOB 5IVXF 3GFUA 3SO5A 4OCWL 1IFGA 3BZ4B 2FB4H 2MNUA 3H4HA 3BZDA 4P2RA 3X1EA 4UQIM 4H8HA 5I1EH 3TBTA 5J6GA 2XZAL 3S5ZA 5D96B 3P3SA 3G6AA 5E6UB 4ZXBB 2IPUG 3KYMB 5E8NA 5SWSE 2J71A 1OT1A 2GTWA 2PUQT 4D0BA 2R4SL 5GRVL 3WFDH 4KO5A 3KWXA 2NYYC 3AREC 3FAWA 3IKKA 3GKWL 1CFQA 1T1XB 2BH0A 5AYQA 4H0GA 1SMAA 3T71A 1ZSHA 2FJHA 1KBBA 2D0FA 1EO5A 1Y1UA 4OI8A 3T3MB 5AEAA 1I8UA 3RA7L 1QW9A 2KPNA 4FQ2H 4G8EB 5E99L 2BHYA 3GF8A 4MSWA 3E38A 5DUBB 2QVIA 1J7VR 4HUXB 5GRJH 2E86A 5E5UB 5ICXA 3EOAA 3RWCB 1PTZA 2Z31B 4OZHB 4HXBH 3ESUF 4PJXF 3ULUC 4PCKA 3F65A 3C5XA 2LGNA 4H1LG 4PJEA 4LPWA 5D7KE 1AP2A 1CPUA 1N18A 1ODAA 1PY0A 3CFIC 3FOLB 3EFOB 3EGDB 5KYUA 2BIQA 4Z7WA 1CU4L 1NAKH 3M6DA 1L6ZA 2ZNWA 1L9MA 4OKDA 5I0ZA 2NDFA 4YHPA 1M6UA 1UA7A 2OMZA 2HT3D 2J20A 3K2UL 4JANA 5DRWA 3VDAA 4DPBX 2VDRB 1R1CA 4YXLH 4RRPG 3VB9A 3LNHA 1ZHNA 1AXSB 3ZR6A 2HSIA 1II4E 3PUUA 4GG8A 1HOEA 3HHSB 4I7ZC 4TXVB 2VABA 4PJ5E 2JMRA 3KLDA 4JZNA 5HJ3A 2R15A 1CIUA 3CBKB 4F37K 1JCVA 2OW6A 1EAPA 2WNGA 3II1A 1KC5H 1RUQL 3TIEB 3G3LA 2BVTA 1RZGA 3UACA 3EOBA 2Z6FA 3UABA 1Z32X 3SDXA 1F90H 2A38A 1IC5L 5DUPH 3OKEA 2Q86A 1NL0L 1ID5I 5J56B 5T1LA 5KUKA 1Q0YL 2DTSA 3OM3B 3QCUH 4KKRA 4X6FB 1MFAH 1QLEB 1TITA 2Y24A 3ZQ9A 4EIUA 1BZ8A 4FGMA 3MI6A 1H0DB 2JKLA 2VDQL 4GKSA 2QDWA 2XFGB 3MA9H 3V95A 1F3JB 4NUJB 1ACYL 2A4CA 3ARFC 2CDGB 3DOSA 4NUGH 3TEYA 3ECBB 4LFHD 1KNOA 2XZZA 2FECI 5DJAA 1NEUA 1NIAA 3T3ME 1WICA 2W07A 1Z3GL 5HHVL 4JKNA 3QEGH 4F8NA 4YHNB 3PWPB 2W88A 1S7WB 4ONHA 3DA0A 5FEBA 3EHBD 1A9EB 1A7PL 2G3MA 5C7XH 4X98B 3FO0L 3FU7A 3PJSB 5IB5A 4H1LH 3GUTB 4OZHE 5DVLA 2NW2A 1ORQA 2VMDA 5L2KA 4U3SA 3L4XA 1A6TA 1YAZA 3KW7A 3KZ8A 1KJ2A 4AW7A 5LKNA 3D08A 4L4JA 4TTDD 4ZFGL 4LVNC 4LLUB 4FF9A 3ZUNC 3TT3L 2YKLH 1LO2L 4YFLF 4HD5A 4DETA 1JTTA 3D2UA 1S7UA 1F5WA 3TC9A 1KCVL 5IMMB 1JF1B 4HLJA 1RD6A 1RCYA 2JVUA 4XVTL 4XXDA 1UM4H 5DF0A 3U9PL 3TO4B 2CIIA 2YSTA 4H0LC 4EE2A 5D7HA 3ALWA 4XP1L 3S34L 1DQVA 2NNAA 5CD3B 4TOYL 5H4YA 3LDBB 3FN0H 4CKQA 3JTBA 1BA9A 3FT2A 5LCVL 2QQKL 2A6KB 4DP0X 5A2KH 2J12B 5J7CC 1E8ZA 4CBPA 4X6DA 3QWQB 3DX8B 5D1XD 4G9FA 2OQJB 4AEHH 5GGVL 1YY8B 4PBWD 3WE1A 2R0ZH 4EKJA 1SOQA 4CSZA 1EFXB 3OKYA 4LGRB 3UADA 3EYQD 4GG6B 4U1IA 4OD2A 1VAHA 5C2BL 3TWCL 5CBAA 4YDVB 2HRPH 3FQXA 1HXKA 1P7QA 3CSTA 4CSTA 4JFWA 4PJ8B 3CFJA 3GSWA 4UTAH 2A2QT 3GHPA 2Z64C 4TNWK 3U2SB 3LAFA 2APBA 3L8QA 2BS71 2RD0A 3T1FA 3ZLQC 5D6CB 3RVXC 1M56B 2XUWA 3CDGB 3NIGF 4PS4L 4TLKA 5G2NA 3TPKA 4QJ4B 2EDBA 3F58H 3PWPE 5GRVK 1QSFD 3US1A 1FZOA 4PLKD 1BYPA 4OLUH 3NFNA 3AABA 1GZPB 4N9OB 1IGTA 3IFNL 4PI0A 4XMWA 5HDRA 1YY9C 2Y5QA 3CFUA 4X9FA 3RDTD 1C12A 4G8FB 2NY7L 4NPKA 4AIEA 3CK0H 4KY1H 1OANA 3AQXA 2VW6A 3IJ7A 5D2NA 4BSVB 3LXBA 4MVBC 2CMRH 3RILA 4L2YA 2ORBH 5GZOD 2VZOA 3RIAF 3BOVA 1P5VA 3GXTA 3TTSA 4ZS6C 2K6WA 3WGUB 5FCUL 5I71C 1AHMA 4IMLA 2EXWD 2P5EA 3CUPB 3HG1B 3NYKA 3ZDYF 5E4EC 3K6OA 4PB0H 1TCMA 4PJAF 5T33H 4YS4A 4PJIF 1MNUH 2VLRB 1PLAA 2HJLA 1FORL 4P2OA 3DUUA 3DVIA 4YBQC 5EBLA 2WSDA 5I1IH 1UA3A 4X9YA 4P57A 1NFDB 2I9LA 2ZX6A 5MEPB 1G7JB 3LEYH 3G6DH 3KPTA 3L95B 1G7IA 4I0CC 2NYZA 3QDGB 4C83A 2JTYA 1NCAL 2LLNA 4HZLB 2VDKH 2X2UA 1G7PB 5HGDB 2W92A 1C7SA 5JUEH 1FPTL 5SX4I 1S46A 3NGBC 4Y4HC 3HOGA 4YO0B 1UH2A 4MD0A 1P7KA 5TFSH 2OL3H 1IGIL 1YA5A 3O2VH 4GG6E 4L8CB 3ZKMC 3U4BL 2CKBL 4XMLL 4QHKI 3SOBH 3QI9A 1S2EA 3V4VA 4ONFH 1DN0A 5EU6A 1HXYA 2AXWA 1E2ZA 2JKWA 3EYUL 3W2DH 1OAYL 2CBTA 2JF1A 2ATKA 1AKJB 3OAZH 5E2UH 5IQOA 1CGXA 2GABA 3MJ7B 2YUWA 3MV8B 5KAQG 1J10A 3MFFA 3HG3A 3K3QA 4XPBH 2FWLB 3W39B 1ZT4B 5KVFL 2DQEH 3VXRA 3BISA 5E8DH 4ESKA 1U6AH 4GKNB 1N68A 1MXGA 5EO0B 5HYJD 3MUGA 1JDCA 2OS7A 2WM0A 4TPRL 1R5IB 4HW6A 4DW2H 4B60A 1XEDA 4FQLL 4L5FE 2J25A 3QWRA 4OF8A 2EYRA 2YGOA 1CL7H 3AITA 4GLRI 1IC7H 5A2IH 1AZRA 1NBZA 2QADD 3QUHA 4FG4A 4UILL 2CO6B 3WEXB 5E9DA 2JKJA 1HL5A 5I76A 4NO3B 3DIFB 5E4IA 2ZX9A 2QSQA 5KYXB 2BERA 4JO4L 1ZLVH 3ZTCC 3UC2A 4K94H 1QBMH 3WI9A 2JNZA 5B3JE 1BQLL 3NDYE 3V6ZB 1ZHLB 3HG1E 1HKLH 5JPMA 2N7AA 5ACZB 3J7HA 1OWWA 5D9SA 2VLRE 2MQ0A 5TQ0L 2AXJA 4EI5B 3JVGA 2IH3A 4C54A 3VFWA 4E5XA 1NFDE 3SCMD 1OCWL 3REWA 3QPQD 3MRRB 4AL8H 1Z66A 4J23A 1PU0A 2IDSA 1FDLL 3QDGE 5E94A 5KJRH 4AMKH 3GMPA 2X3AA 2CA4A 2VLKB 4XNYH 4EZMA 4JN2A 4PGEB 4AQ8C 4QRUB 1RLWA 5KZCB 3WSQL 1N64L 1IC1A 3GJEA 5EU4B 5C86A 3P0YH 5EO9B 1KT2A 4APQB 5JPNB 5I82A 2NY1D 1I1AA 1BMWA 1XSKA 4H8WH 3BSZA 2FT6A 4HGKC 3Q8BA 3NJFA 3R0MA 3WD5H 3ET9F 5ESVB 1FUNA 5ESAB 3RVUD 4TVSa 2XHNA 3KJ6H 2K4AA 2LFEA 4D0DA 3GPEA 4L4VD 4ZPVA 3MV8E 1ASPA 1KTLA 2MWCA 5INCA 1NIFA 1PYWA 1F6FB 3AXLB 4M8RA 1DJIA 1YQ2A 1FZJA 4ZAKC 2AJSL 2M1KA 5HDWA 3D12B 4JFEA 2KBGA 1H9VA 3WNMA 1JDDA 3R4DA 4M4RA 4J3VA 3HC4H 4UV7L 1XR8B 3ULSA 1I8LA 5DI8B 1MHEB 1CE1H 4HS8L 3RIKA 2I9TB 1B9ZA 1VFBA 4FNTA 2GJRA 4JJOA 4FC3E 2VW7A 5DJ8A 5EC2B 3INOA 3BN9D 4NDMB 4CADA 2D3JA 4HWEH 2Y23A 3F6LA 5FOJA 1DO5A 1N5AA 2ZXBA 1KLUA 1QPXA 4M7JH 4LP4A 1NBYB 4XO8A 1AS8A 5JA8B 4W81A 4K07A 1KCWA 1AO7B 1LE9A 1FH5L 1F3RB 1RZFL 2GFBB 2VAJA 1UT1A 2P42B 4O4YL 2GG1A 1NMAH 4EJ1C 2VXQA 1UQSA 1VENA 2I07A 3M1OA 5IMKB 3D0AA 1U3NA 3R1GL 4TSAH 1FRGH 3VWKA 3OLDA 1JGDB 1KLGA 3TONA 2QGEA 1NCWL 5IHZB 4HIPA 4BK8A 2XWZA 5H37H 4OF6A 3P4OA 1UENA 1BFTA 3K72A 1NGYA 4OCXL 4PREB 5JW3L 5EZPA 1N7ML 3NCEB 4LQ1A 2VLKE 2YMOA 4YNYA 3CN0A 2G9HA 3QEQA 2Q87A 2QDVA 3FSAA 4TL5A 3NPZB 1UZGA 2WBJB 3IJSA 5ABZA 5D93C 5CLTA 3F00A 2PYEB 1RIHH 1CFTA 2BJMH 4JY5H 2DIJA 3WXWH 4FJ6A 4R7DB 1L0XA 5DGRA 1ZLWK 2LU3A 3S3PA 1SXBA 4B9GA 3H9SB 3TPUA 1XGQB 4JKLA 1AR1D 2CAKA 3O0LA 1OSPH 1XMEB 3VQ2C 5IEKB 3IMVA 4N3UA 2PXYC 3FUKA 1WVZA 4WHDA 5BZDB 1X3DA 2J6EL 1DE4B 1E9PB 3BH4A 4L29A 1ZAGA 4MMXA 2KPWA 3AGWA 4JGJA 4CVZA 2BWIA 2UX7A 5EV7A 3VAEA 3IAQA 1D5BA 3HE6B 4HP5A 1H19A 2DBLL 2P48B 1X5FA 4G6FB 4DKFL 4QNPE 1MZYA 1TYEB 2WVSA 4BIKA 1N8OE 1SLWA 1OZTG 1RHFA 1MI5D 1MRCH 5CEYB 4M29A 1JXKA 4KFMA 4FNUA 2WLYA 2O26U 4ODTL 2BY1A 5LGHH 4PJHA 3RU8L 2BSRA 5AZEL 5K93A 4DPAX 1PKQA 3Q8EA 2ZPKL 4JY4B 5M94B 2CM5A 2XPYA 1AO7E 2YFOA 5FKAB 4MQSB 4GP4B 3ARED 4GXUN 1KYOJ 3CN3A 4Y4FC 1EWHA 1JGIA 1U58A 5FYLD 4GYBA 4R8WH 1MCQA 2C9RA 4N28A 5CSZA 2OFQA 4V1DB 1XIWB 1OAKL 3KPLB 2KLRA 4NQTA 1AHWB 3L1FA 3C8KA 4P5MB 4XP9L 1JWMB 5FHAH 4OBSA