5IQLA

Crystal structure of yeats2 yeats bound to h3k27cr peptide
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
130
structure length
130
Chain Sequence
SRLFVKKTIVVGNVSKYIPPDKREENDQSTHKWMVYVRGSRREPSINHFVKKVWFFLHPSYKPNDLVEVREPPFHLTRRGWGEFPVRVQVHFKDSQNKRIDIIHNLKLDRTYTGLQTLGAETVVDVELHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title YEATS2 is a selective histone crotonylation reader.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords YEATS domain-containing protein 2
total genus 20
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2016-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03366 YEATS YEATS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1970 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5iqlA00
5HJBA 4TMPA 2NDGA 3RLSA 2NDFA 2L7EA 3QRLA 5IQLA 5HJDA 5IOKA 3FK3A 5D7EA
chains in the Genus database with same CATH superfamily
3CFKA 3I2CL 4BQ8A 4NN6B 1H19A 1K8DB 1UUSA 4LBEB 4ZAKA 4MX7B 3GXUB 1YEFL 1MELA 2UZXA 3KPMB 4MDIB 5D6DA 1ACYL 3QDGE 5AVSB 3AXHA 1NICA 2B20A 3FQUB 5BRZA 2KDGA 1NM9A 4J2QA 3VFNA 1LMIA 3OKMA 4L5FE 2KYIA 1MCOL 3V9CA 5F7EL 3L3OC 3FJTA 5K9OA 1JFQH 4L0YA 3TJEL 3AVEA 5MHSE 5KUKA 2JXMA 3QUKB 5DDHA 4CC0A 4A2DA 2ICWA 3TBSA 1WVZA 4GINA 1N7MH 3QAQA 5DMJB 1BYPA 3JT2A 2J8HA 5I8KH 1G6RB 1RZ7L 3MO1A 2B4CC 2PTTB 1G4RA 4ODUA 3PGDB 1B2YA 5J9PB 3WDIA 5HI4C 4WY7H 4U1KA 2B1AL 2BVPB 1SRDA 1XGQB 4KPHH 1KCUL 3CCHB 3EOYG 3ZKNC 4DP1X 4ESKA 4EZLA 5LBGA 3QC5X 4A37A 2F9BT 3FB6A 3QGVA 1JV5B 4FF9A 4N6RA 2B5IB 2X6MA 5DC0A 5E03A 4PS4L 2BSRB 1RZIB 3S88L 1FO0L 1E7VA 1QASA 6CGTA 2C3XA 4LLVB 4AEIH 2AGJH 4BE6A 2HTLC 5D1XB 3IS1X 4F7KA 5DD5H 4UBDC 3FSZA 4HIPA 1NCJA 4JL1A 3TFBA 3O2VH 3OKOA 3U30C 3EOBA 5JXAL 2BJML 4OIFA 1E4XH 3ETSA 5CHNB 1M6OB 1YQ2A 2XKUA 3BQUA 2MPVA 4ODTL 2AK4B 5L8LB 1Q38A 1X4YA 1L6XA 2ICEC 3NESA 4Z5RB 1AO7B 1KC5L 5EBGA 3H9SA 2CM5A 2R0KH 2NNCA 3HS0A 1OGAA 3ZE2B 5IQ9B 1IBDA 4XP1L 3QJXA 1BOYA 1TNMA 5KOMC 4U1GB 5IB4B 1ADWA 5FOBA 1A7PH 4KTEL 4C54A 2BP0B 1SVCP 2CU9A 3ZTJG 1K8IA 2FWSA 3LTVA 4ZXBA 2X3BA 4Y19B 3RWEA 4QRUA 4BK5A 2VLKD 3IAGC 4FQLL 3KW7A 1HI6A 4JZNA 5DRNA 1IUZA 2EYTB 4PRPA 5KJ7E 2UWEA 5AVYB 3SE6A 1AP2A 4ZO7A 2Q10A 5AD0B 3HHMA 3BFQG 1S9YB 4BUGA 2BERA 3QUXC 4DN3L 5D2NC 4ZMOA 2IDFA 1A7BA 3DK0A 4AQAB 1T03H 2F53B 2ORBL 3G6AA 3V0IA 3ZQ9A 3UYPA 4K9EC 4PY8J 1PZ5A 2JTYA 1RCYA 1YDPA 1TYEB 3OMIB 4HKJA 3HAEA 3ZX1A 3FCGA 3P0YH 3UTTD 3VTMA 4M5TA 1K2DA 1S5HB 4ONHB 4PU2A 4NQSA 5F9WB 2AK4A 2MNWA 1PNDA 2JB5H 4GI6A 3LKNB 5CZXC 2L7JA 1T3FB 3LRMA 1BFOB 5A3IC 3AFLA 3RWGB 5MP6L 1R0AH 5I2IB 1KYFA 1NGQH 2EYSB 3T09A 3VXMB 4MNQD 4ZMVA 5C0BA 3ARFB 4OI8A 3QA3A 2UY6B 4KDTA 5GGRB 2Q76A 4X5LA 3L6FB 4LP5A 4FNLL 4JKLA 1D9KB 2YAMA 4KKNA 4XZUB 1KJMB 1B4RA 5KBMA 4F7CA 2WW8A 2HJKA 4LCYA 4M1CC 5DS8A 3MJ9A 3QYNA 3ZTNL 4BFOA 4U33A 5KSBF 1JAEA 2HT3C 3DVNA 3WO4B 5I82A 1FA4A 5DJ6A 5KSAC 4AG4H 1NGZA 4FAAB 5ALCH 5TQ0H 4BCYA 1AHWA 3BD5A 2HT4D 1M05A 3CFBB 3U79A 3QUZA 4LMQE 1K5WA 5EWIL 2CR0A 4XP9H 1L0PA 2AZUA 1YUHA 4UANA 3KHQA 1OOWA 4TSCL 3TH4T 1YY8A 3S37X 4EIUA 3FT9A 2R0WH 1AXSB 1M1XA 1QYGL 4U6VL 2DDQL 2VDLL 4LKXB 4HMEA 4Q9CA 4F58L 1QABA 4XN1A 5BRZB 3NIGE 1BQLL 1FNHA 3O6MH 3B9VA 5F0LB 1VGEL 4GBXC 1UYWL 2ATPA 3H85A 3QUYC 4F7PA 3FQWB 1O6VA 3L3IA 4RFNB 4ZFOB 3T0VA 1CDBA 1X7QB 4LK4A 4MJ5A 4OIIL 3BUYB 5DVLA 5C09D 2PKDA 4PB0H 3I74A 1CD1A 1WTLA 1L9NA 2DI8A 3QUXD 4GXUM 3UTPE 4DTGL 2JSFA 4C8XA 4UNUA 2WHVA 4NO5B 4ZUVB 1Z9PA 5CN2A 2ZXAA 3S4SA 4TQIA 4H25A 1CD9B 2YGVA 5AALA 3VD7A 4HUXB 5JHLL 3REWB 2YKLH 3CVIH 5ADOH 4J3VA 4LSQL 3OC5A 1INDH 2R59A 3K0YA 1KGUA 1NFDB 2Q9OA 5K1NA 3D4CA 3OC8A 3RUGB 3DI3B 2AXFA 4YBLB 4KBPA 3V0EA 3TFKC 3Q05A 3PFQA 2UVEA 4WO4C 1DN0A 4YPGA 4A39A 1JWMB 3OF6A 1BQRA 1NJ9A 3MRQA 1CE6B 4OI9A 4JFUA 1CDCA 2P8LA 5L88H 3SYCA 2OZ4A 1OCOB 3GBEA 4E41B 3ULVL 2DZEA 3VRLE 2XWJB 1VERA 3NPSC 2P5ED 4QUOA 5K33A 5F96H 4YDJB 1XFPA 5DS1A 5CZVL 3PP3K 3MX0B 1U30A 1XCQA 5HBBA 1PAZA 2JMRA 4G6JL 1XWVA 3WIAA 3WNNA 2Y6SD 2DN7A 3IRZA 3JYCA 2BXZA 2OMYB 4XVSH 2VZUA 4M4RA 1X5YA 1PKQA 1DDHA 3O45B 8FABA 1MJJA 2JV6A 3N1QC 2LHAA 3ARED 3K6OA 5CEZL 1U8QA 1I8IA 1J1PL 4XPAL 4Y9FA 4M7KH 5E5LA 5F7MC 2O5ZH 4H8PA 4P4RA 4HJEA 5EN3A 3DXAD 5IHBA 4OCXL 4G5ZL 1H9VA 2G5BA 2X4TB 3MRHA 2IQ9H 3ZDYE 1EO7A 4ZG1A 4B3EA 1SUJA 5GS2D 3QUHA 3V5DB 2WZ6A 3D18A 3DETD 5D5MB 3FFOA 4OZFG 1U3JA 4P2RB 4XI5D 6PAZA 1MJ8L 1AJ7L 3G5XA 5EO1B 2OX5B 3ZUCA 4M8RA 7CGTA 3A4DA 3OQ3B 4OFIA 5D2NA 3QUYD 5DHYB 1FGVL 1KTDB 4M1GL 5CN1A 3WGVB 1CF8H 4IK7A 3FO2B 3AITA 4UAHA 5DGQA 5F7EH 5HGGS 4CSTA 4JY4A 5ABZA 5DSCB 1GJIA 2EE2A 4EI5D 1VIWA 3L7FA 4WFHD 3VB8A 2XWRA 1NUDA 4RWHA 3BH8B 3MV01 4AKOA 2DPKA 4N5EC 4YDIL 4DAGL 2PP7A 3QUYA 4ZXBC 4MZ3A 3VE0B 1QD0A 4F57L 1ZIAA 4IK6A 2PW2B 4P9ML 4TM9A 3ULVF 4GAGL 1F3DH 3OZ9L 4UUJA 1IIIA 1MVUA 3W0WA 1I1RA 5A16B 3CFEA 5IEKB 4X9HA 5J1AA 1U2HA 1W8OA 3JVGC 4HAKA 2QELA 1TJIL 2X0WA 2FZ3B 3AQDA 4CVWA 3MOBH 3EJZC 1JDDA 3BUTA 4Z95H 2PCPB 1RP8A 4DSYA 3QIBB 5FK9A 2DV6A 4NQXB 4DKEL 1DJZA 4OD2B 3DJ9A 5HDRA 4RIRA 1FVCA 3T77B 4U49A 2CBMA 2FGZA 3K4ZA 5JHBA 1XH3A 1FN4A 3BH9A 4JFDB 1JN6B 4TYUA 3ZDYB 2O6CA 2CRIA 2P28B 2YRPA 4X4XA 1QMUA 2WZ5A 3D3VB 4ZTPL 5HPOA 5LGJB 1I3RA 2GBAA 2AQPA 3TL5A 5E8EA 2Y6SC 1NFDF 5E2UH 1JHTA 3OJDA 2Y2WA 5E8PA 5GRXG 4F8QA 2Z31B 1JZ3A 1I3UA 3QJOA 1IM3D 3NYKA 5A7BA 4O02H 4JREC 5E9NA 2AQQA 1QEWA 1IBBA 1OXYA 3MACL 4JRLA 4KH9A 3AREC 4DF9A 2P5EA 4BFBD 1D3CA 2HTKD 1TEGA 3VU1A 1NGYB 2YEZB 4P2OB 1TFPA 4OCLC 4AKPA 4E9LA 1AIFA 3V55A 2MPAL 1ZLUK 4JLRB 2R69L 1Z0MA 3D8MA 5FV1L 2DMBA 4XODA 1KWKA 1KXTA 1FVEB 1NGXB 3MUZ1 4OCYL 2HYMA 1JZFA 5F7UA 2BC4A 1HKLL 4Z77B 3OXSB 4RWYL 3QJRB 5FA4B 2B3IA 2FLBT 3FUMA 3BDXA 1AR2A 2WOYA 4LBAA 1RZQA 1AHWC 1BP3B 1V10A 4RGNC 1CXKA 3QUXB 2NYKA 4OV6F 3HVDA 1ZRUA 4RGOH 2DLEA 2V8LA 3QIUC 3DYPA 3NA4A 4FFVD 2ZX8A 5GGSA 5C07B 3QJZA 4YFEA 1IGFH 3OLGA 3N42F 2X9WA 3JVFC 1CFVH 3CZKA 3NCWA 2R27A 4N8PA 4NS0A 4WLCA 4A2HA 3MLSH 2KUTA 5FYKE 1V3JA 1XGTB 3MMEB 4MRBA 3OKLA 4CN1A 3EO1A 1DBJH 2A9DA 5B3JF 1JTOA 1AGCA 4N1CA 5J56B 3BDBA 1KIPB 3SZ6A 1CLZH 1CTMA 3EJZD 1E90A 2EIMB 2ZXEB 4Z6AT 1E5UI 4DPAX 3P2BA 1QRND 1FH5L 4P59L 3IDJA 4NHUB 1F2QA 3FS9A 1W0WB 2Y4SA 3VI4B 3SO5A 5DJDB 1I1YB 3ULVD 3BQUC 4OLYH 1IC5H 3SDYH 1WEJH 4AEHH 1QUPA 1RZKC 1YNKH 1FZKB 2QQLL 4KDTC 3VJ6A 1XZ0A 1WICA 2ZUXA 4KKRA 2Q86B 4BKLA 5FA3B 5DJXB 5E6ZA 1UASA 5IHUH 1SYSB 5KOVC 1YMMB 5J06A 1BQSA 3FQYA 1TTCA 2BNQD 4NCDA 4PVNA 5I73B 3NCYS 4DKEH 3MRMB 1D9KC 2N4IA 2YRBA 1ZWIB 5GISL 1F3JA 1KCRL 5GGSB 3CTTA 3T9WA 4GS7C 5EUKB 3SDDC 5FYKH 1CE1H 2D73A 4QHKJ 3KL5A 2D7MA 3ULUL 5HDWA 5D93B 5JPNA 3HRZB 3IDUA 1WUNT 3UBFA 5K9KA 4PB0L 1F90H 1UZ8A 2FAUA 1XF3A 1JPTL 4LQ1A 4NC2B 3BJ91 3L1OL 5D1QD 4OZIE 2NY4B 4ZOBA 1RULL 2R56H 2VABA 5IBUG 3A23A 4TTDD 3DIFB 4EQ2A 3QFJB 4L8DA 2LTQC 5EB9A 2YJQA 3FDWA 1IEAA 1R5IB 1NCDH 3EOTH 4PJIE 1IAKB 3OAYK 3ZE2E 3RIFF 2EZ0D 2J43A 3VQMA 4M9OA 4ZUWB 2PP9A 4UZSA 1VADA 1W72B 3ARUA 2C9QA 3V6FB 3VD2A 5AW9B 2NY6B 3GSUB 4IHBA 3SQOL 5E6IB 1DBBL 5EU6E 1PZAA 3O6FC 3C60C 5DRXA 1MLCA 1KYUA 3QJQB 4N0RA 4Q9QL 2PWHA 1DJXA 3R4DA 3UP6A 2AKRA 1EEUA 3MUUA 2VH5H 2H1LM 3F62A 3HB3B 4KJPD 1JGDB 2VZSA 3AQYA 3EGXA 3JWDL 4G70B 2AQNA 5CJQH 4GEIA 1AQHA 2WWOA 4KKLC 4QXUH 1KC5H 3BQUD 1OQXA 4HCIA 5LNEA 3WNPA 3KW8A 4PQXA 3ZQXA 3O4LE 1B6UA 3NDYE 2JWYA 3BUPA 4ODHH 4BQCA 3KZ8A 3KBPA 5CJOH 4NQXA 4MZRA 4OLXL 5L8KB 3UBXB 2ZNXA 4ZFQA 2P44B 1JVKA 2I9TA 2YA2A 1HOCB 3Q6GL 1IGTA 1ND0A 3WDJA 3NEEA 1MCWW 3S6CA 4MYPA 4RMWA 1V27A 4HALA 3OMAB 1KLGB 1RURL 4NO0D 1E5ZA 3FSOA 4PREB 4X6BB 4ALAH 3SZKC 3W37A 3OLEA 1PX4A 4DN4L 3EGXB 2C1PB 2BNUA 5EIIG 4ODWA 1BW8A 1CF1A 4IRJA 1A0QH 3V4PL 3MBXH 2BCKB 4DKAA 4GMTH 3RNKB 2QVTA 5J6HA 3FBQA 3H53A 1ASOA 2DQHH 1H3PH 5FPIA 5HD8D 2G0KA 1PCXA 2E56A 1FL6B 1XO8A 3GBNH 5ACZA 4NT6B 4UMSA 1NAMA 1TETH 2JKJA 4L0ZA 3T3MB 5I17B 2V5YA 4JNXA 4FI6A 5K39A 4DQAA 4Z0XA 4LCUB 3SGKA 1X9LA 4PV1C 1JPGB 3DPBA 3C2AL 4WJ5B 2B3RA 1AD9B 4CSPA 43C9B 4YUEL 3STLB 5JHDB 3QFJA 1TQCC 5I6XC 4XT1C 3EOAA 1BMWA 3HFMH 3MLUH 1QPPA 2ZJSL 4G8EA 4X5XB 1JNHB 5EZLA 1R3JA 4JFSA 2C9PA 3F6JA 5BNXD 1DBKL 4JFED 4LRNL 1HIMH 4KI1A 4ZSOB 4H44C 3C09B 5BVJB 5DZOA 5C07A 3U4BL 1G7JB 5D7JD 3IPBA 5TQ0L 2R1XA 4F93B 1XCQB 2R0ZL 1IC0A 2CHWA 4XR8C 2WYZA 5GZOA 2VJ8A 4V1DB 5DC9B 1FNGA 3VM7A 4DESA 5KAQF 1JK8A 4AJYV 4BK4A 4BZYA 4KKLD 4U6XB 2QL1A 4XNXL 3O2WL 2NZ9C 2VR7A 4MAUH 4X9BA 4Y4FC 1X5IA 3ZKMD 4GP4B 4PJ8D 5BZZA 3UMTA 4ZDHB 5IKCB 3K74B 4IBSA 5E4OA 3SDCB 3IFLH 5E95B 2FNWA 3TCLB 1J0HA 3MJ9L 4LLWA 3IE9A 4JQIA 4MNHA 3BWUF 4AIXA 4JKPH 2APWA 1HNYA 1BQUA 4WCYH 1QTSA 2VOTA 3MUGB 4P07A 1NPNA 2AJXL 3H2PA 3UYOD 3VB9A 5I0YA 3ARFC 2P5EB 4XAWH 2HKFH 4KXZI 3NSJA 4QF1B 4XPFH 3S5LG 4DQOL 2PTUA 2HN7B 1L6PA 3I75B 4J3UA 4R7DA 1CD1B 5D7LE 2AV7B 3H56A 3NTCH 4L4JA 2X89A 4ZX3A 5ICYA 5IHHA 1OAXL 4POZD 5C0AD 1UOWA 3B56A 4HHGA 3VI3B 1A1MA 4PY8I 1FE8H 1WA1X 2OMBA 1KTBA 4PP2A 2VZOA 1PQZB 4G8AC 3LQAC 4F9PC 4N9OB 3Q5TA 3ZHDA 4JZOA 3KLHD 1HQ4A 3SO3B 1CB4A 4ZPVA 1OWWA 5MENB 3RTQB 4D8PA 1NCOA 1USZA 2K6ZA 3CHOA 1T1XB 3PHQB 1JNLL 3BZEB 3BAJA 1IBYA 3X2QB 2NRDA 2WZPD 2EE6A 4XPHL 5MEQA 3L3DA 2KDYA 2ZWNA 4UQ2A 3II1A 3QB7C 2JCCF 3APDA 3IT8D 3MNVB 3NN8A 2WWNA 1SY6L 3IU4H 5EOQH 3JWOC 4XP1H 1HU8A 3MRRA 5EU6A 3OXSA 2A77H 1NEUA 1ZHKB 4ABVA 3GEFA 3BHBA 5CBEB 4XXDA 4JHAH 2ICWI 5A2JH 4JFHE 3HB3D 2NY5H 3DUSB 4OKDA 3D85D 4Y8AA 1IMHC 4AEHL 1GMEA 2XV3A 1ONQA 5HYJB 4GSXA 4JN2B 2ENSA 3C9NA 4JFPB 4P2QA 4RA3A 4HDIB 5TQ2H 3ZY7A 3VXMA 3UJIH 5T1JA 1XDTT 1YYML 1YEKL 4YK4B 2I25N 3SBRA 2DQEH 1OF2A 3D39A 3QAZB 5T3XL 1AQDA 2P7TB 3WXVL 4XNMA 2J56A 5LO7A 4FOMA 3WXWL 3E7JA 4HPYL 3L4ZA 3BWAB 1I75A 4A7TA 4YNYB 1ZLUH 5ICZA 3CFQA 1KOAA 3WNOA 5GGVL 5TE6L 3VXQA 3O0RL 4CW1A 1T2QH 2BP3A 4K9JA 5I18H 4JHVA 1WBZA 2WXJA 1AGBB 1YEGH 4LEBA 5DFVC 3JTBA 2X6AA 4X4XB 1NCAL 2GTZA 4KI5D 2W59A 2R2HA 4UIMA 4EKXA 5FFOA 3KCPA 3V95A 1H5BC 1UQSA 2LAAA 5FFGA 3VQ2C 4QD2E 2J6EL 3UERA 4AY0A 3L4VA 4APQD 1R33A 4E36A 4Z7WF 4K3HA 1UWFA 3WTXA 4XP9L 3TEWA 1FCCA 2W81C 1PTZA 4K71C 1FYHB 4OTXL 2LABA 1W0VB 3BZFB 5FM4A 1EXUA 3RWEB 4YZFE 3L5XH 4ZUUB 5LAPA 5JIPA 5F7FA 2R8SH 3WJJA 1MVUB 2VAAB 4MAYC 3BVXA 1OAKH 5KSVA 1EHNA 2SEBA 1A1NB 5IFHL 2P5PA 4OV5A 4IRSA 4DO5A 5EC2B 3IN0A 5FUZH 4RVBA 5T3XE 2YGQA 3MRRB 5HJDA 5KUMA 4RLDA 4KTDH 4OJFL 5EA0L 3DRTB 4HU2A 2VL5A 2NY6C 4ZYKA 4HFUL 1XH1A 4XVUC 2WVSA 1UWYA 1WC7B 1ZE3H 4JFEB 1INQA 2AJ3B 3DARA 3P9MB 3VXSE 2V2TB 4L1BA 1AHMA 2DIJA 3VX0A 1SEQL 4D8OA 5I9QC 2Y22A 1MPAL 1JYNA 2A1WL 1TO4A 2AXGA 3U25A 2X1QA 3M8OL 3RVTC 1IZKA 5ITFA 2P52A 2V9RA 4JR9H 5MENA 5I1GH 2OR9L 4M6AA 2UXVA 2EUZA 5DT1H 4CSZA 1E67A 4HUVA 5ABAA 1FAIL 2J21A 3FTSA 3H9SD 3MPCA 4XHJD 2N56A 4KZ0A 1KXTB 4ZD3L 4Q58C 1XF2A 12E8L 1BWWA 1FORH 1EJOL 3ZE1E 4ZFFA 2GHWB 3QJVB 4LDOB 1TJGH 2CE6A 3EAKA 2ED9A 1E4KA 3MGAA 4QOKA 3F65A 5HHVH 5LBVA 3PL6B 1MW1A 1DSWA 4M48L 3MLZH 4K7PX 1SBSH 5A2BA 3QI9B 1IC1A 5C0CA 1YUHB 1ZVSA 3SPIA 3NIFB 4MNQB 3ARDA 2FGWH 3GNMH 5DLMH 3HZMB 3TFKD 3EJQA 1TIUA 4K23L 4PG2C 1A3RH 4K2UL 1A1NA 4QHUB 3C08L 2X44D 4P5KB 3ULAB 4YFLF 1H6EA 4KAQH 4L3ED 3UTZB 1XF1A 5AL0A 3QDJE 1U8HB 3VWJC 4JUSA 5F7DA 4MNGA 2ZXDA 3D3VA 5JA8B 2HFEA 3FQUA 3QIWB 1M7DA 3IDMB 2PPEA 3UO8B 2VO8A 3FCSB 4E9SA 1ODUA 2W9DH 1U92B 1KPRB 2QR0B 1FVCB 4PRNB 4Z3HA 2ZWSA 2PR4L 5A2KH 2VDLB 1OQOA 5GGRA 1SNRA 2PWGA 1NIEA 2RQ8A 2XETA 4H8HA 5HYIA 2QPEB 2WP3O 2GTZB 3LEYL 3PAYA 4AUYA 4EPSA 4U6TA 4UZGA 3ECVA 4PJ7E 4F7MB 4PLOB 4FFZL 5C0JB 4B96A 5J3HD 1CQKA 3DVFA 2MQ0A 3GMOA 3NIFF 4ODSL 4XX5A 5C09B 2F54E 1SPDA 1WQVT 4EN3C 1ZTXH 2WLIA 3NG5A 1J86A 3MRPA 2FJUB 1H3UA 2KMWA 1ZD6A 2WZ0A 1Q8MA 1OTTD 2YMXL 4MSWA 1OK8A 1IJ9A 1IKNC 1T20A 3L9RB 2D7PA 4YPJA 3GYRA 2CDGA 3B2UD 3LEVL 4CGUB 4M1GH 4BSWA 4JPIB 1LO2H 5LHDA 5E6RB 4KHTH 5EN2B 3PP4H 1D2PA 4NN7C 4DO4A 2XV2A 1JGVL 3KEHA 3L5IA 4JPSA 3MBEB 4ONGH 4S0TD 1MCRA 3CVHL 3CZLA 3W39B 4D3CH 5T3ZL 1CFTB 5FUZL 1O6SA 4D94A 4X7DC 4IGBA 4J27A 4IOFC 5IMOB 5HJBA 1A6VH 4NAMA 4M5SA 4NQVA 4DVRL 3ARYA 1HWHB 5KVFL 3W56A 4JDTH 1H3TA 1CTNA 1MJJB 1OT1A 5DZNA 1OARL 4Z3FA 1QTYT 4RH4A 1BAFH 2FDBP 3OR6B 1M71A 4HEPA 2OL3A 2ZOWA 3DJRA 3VXUE 5I0XA 5F9AC 4AUJA 2FX7H 2DBJA 1J0IA 2OMZA 5D72L 5EEXA 3UBXA 5L2JA 1PAMA 1L7TL 4E41A 3LZPA 2ROYA 4Q74A 2DL9A 5GRJL 4FL4C 3WY1A 2HWZH 4LO9A 1Z6JT 5DJYA 1AI1L 3FN3A 4J23A 1I8KB 1QWUA 1F02I 2I26N 2X10A 3KLQA 2B1HL 4JPVL 3BUBA 2VO5A 5IBTL 3K2KA 4KKAD 1OTSD 4Z7WB 1SBSL 4HP5A 3MJ8A 1MLCB 1UACL 3CXDH 1X3DA 5HHOD 4QKTA 4M43L 5E51A 4JMXA 2VLRB 4Y16C 1OGAE 4JJ5A 2ZKMX 1O7SA 1JVLA 5AYUH 3CVDA 3UYRL 4ZAKC 1NGWB 2X4SB 3VFVB 2VNCA 4NQVB 1EQWA 3FT2B 1XCWA 3NA9H 3ILQC 5B8CB 3G6DH 4P0DA 1X7QA 3N06B 1H0DA 3DNKA 1JYXA 1J88A 3OKYA 3QG6B 5JLZA 3QO0A 1HZHH 1BQ5A 1YNLL 2AI0L 3GSNB 3VFNB 4D0CB 3OAUL 2YA1A 5BRZE 4NQCD 3NFNB 5ISZB 3EH5B 1TVBA 3H9SB 1QA9A 4L4TA 1FNAA 1NH6A 4PTTB 1JHLL 3N1GC 3LHPH 3DIVA 4NKOB 4U1IA 1N64L 4QTHA 4BM7A 3QZNA 3M17B 4HJGA 2YD4A 2IFFH 1EJ6A 4JEGB 3B9AA 4G2AA 4WZ9A 1R3JB 3LZFL 1SN2A 3OPZH 4GO9A 1FDLH 4WFGD 1KCBA 4IOFD 4IDJL 3QI9D 3BZDA 2YSSA 4DIXA 1EHLH 2YOAA 1QOKA 3VGAB 3SYAA 4Z7NF 2B77A 3RFRA 2WQXA 4RSVA 3OVUB 4O2FA 3GUFA 1WZLA 3K1DA 2OSLA 2R2BA 3BN9D 1S9WA 5EBMB 2CRYA 2FJGB 3HG1B 2X1WL 3C8HA 3QCTH 3LXCA 2OKMA 1KCUH 2E27H 4P46A 4WSGA 1R3IH 1PYWA 2WWMD 2BM3A 3D9AL 5CD3B 5I1IL 1X5HA 2DKMA 3LQAL 3HAEG 1RK0A 1TYJA 2MMXA 2XWXA 4RRPG 3GMLB 3D33A 4O58L 5JXAH 4PLJD 2XQYK 3MJ6A 3OTTA 4NZUH 3UCRA 5J6HB 2VWEC 4A55A 3X14A 1BF2A 2A9CA 4XTRD 3ILDA 5LG6A 1EJFA 2G60L 1HCZA 4OD3L 3MNWB 5IHWA 4OUUB 3IDMA 2NY2C 3S2AA 3DX8A 3ARBC 4HBCL 3ZZ1A 3WIHL 3A67L 4GMSH 1FPTL 4B9IA 2G4EA 4F37F 4E42A 2B5IC 1DBAH 1PS3A 5I30L 2QKSA 3EJYC 3H9SE 5IQNA 3DO3A 4IRZL 4P23B 4KJQC 3RGVD 4HF5H 1EEZA 3HNVL 4AC2A 3FO9A 3O2WH 2GSGA 4MX7A 4ZX4A 1BD2A 2O4EA 1T5WA 3JUYA 1X5FA 5GRUL 1U6AL 5ILTL 3TT3L 4XI5C 5EOTB 2MOQA 4XOAA 5CU9A 4P49A 4C47A 1WV7T 4TOYL 5DS2A 5FO7B 3ZYZA 4MCZB 5DVNA 5HI5C 4KKBC 2X6BA 4WTXA 2JIXD 2WANA 4I9WD 2XKNA 3PWPE 3Q01A 2XZCL 4JB9H 3RRQA 5J13C 2YMTA 1I8AA 4GBXB 4AXWB 5DD1H 1OP3H 1SY6H 2D0FA 5FYJE 1N0XH 1Z9SB 2W38A 1E28B 2NX5A 2A0LC 3EG9A 2ENJA 1BEYL 5SWZD 4F15C 4JJ5B 3P30L 4R26L 4AVHA 4AVKA 4NN7B 2R4RL 3C8KB 4LDEB 5GZNC 3QI9C 4XMLH 1QVOA 4LXFA 2FO1A 1PJWA 1MVFA 3TA3B 3WTSA 3LKQB 2E7MA 5F6IC 4P9HC 3UZQA 4NWUL 3TBYB 2AEQH 4XP6H 3D85B 4GKZB 1HSAA 5JXED 3PL6C 3KS0J 1KB9J 3JUZA 2CDFB 3DRQB 4IU2A 4KJPC 1EMTL 1Q0YL 5IQMA 4PVMA 1IV8A 4GAYA 3TYFA 3V6OC 4MXVE 3HZYA 3TYGL 2VAAA 4YSEA 1ORQA 2L0DA 5D2LB 1QI5A 1CI5A 4P2RE 1NCCL 2K4AA 1KGXA 4BWWA 5DHXB 2CO4A 3K6NA 2OL3B 1SEBA 4A7QA 5TF1H 3VXRE 3KLDA 3UTTA 3IDXL 3WY2A 1KFGA 2DWEA 1A6ZB 1G6RA 1D5ZB 5T8IA 3SQBA 5DMGD 2DQIL 2QGBA 3T0ED 4L5FL 4ZJ9A 5LUMA 1C5CH 2N7AA 2PR4H 5IMLB 5DHDA 4L3AA 5HHOB 2BRRH 3APCA 1L4IA 3NEOA 2OJEB 1CFTA 5K9OB 5LGKA 3QBTB 3QJHB 3WFBL 3L5XL 3OKMB 2EP6A 1Y6MR 4UTBL 3ORJA 2A74B 1WFIA 5HDBE 4PRBA 3VH8B 1MJ7H 1DJGA 4NZRH 2BNRB 4M93C 1JCKA 1EH9A 1MFBH 5EEVA 2J25A 1AQDB 3PP3H 5DO2C 2GI7A 5ICXA 1A9EA 5L9DH 3EBAA 1N5YL 3PQYE 5KJRH 1HL9A 1O6TA 4HSCX 3V4UL 3SY6A 3I2CH 1AKJB 1UOLA 3U2JA 2R39A 1OKEA 1L9QA 4RQQB 4UOQA 2DICA 1AMYA 5E6ID 1A3LL 4OSUL 5F44A 2BFVH 5J57B 4HIJB 3MYJA 3BAYA 4UI2A 1A7OH 4XH2B 3MA9L 4ISVB 4OGQC 4QYOB 5AW1B 3HG4A 4KXCA 1QBML 4AYFB 1A7RH 5BMFL 5GZND 1R5VB 2BIIA 5DK0B 1S78D 5G4MA 5A2CA 3UAEA 1KGCE 3FH7A 4KY1L 1C1EL 4ZFOL 5CKGA 3P02A 3V0DA 4PR5B 1NCBH 1UXLA 4NDMB 5DGRA 4EZMA 1TMQA 4MCYB 5BV7H 4KPHL 5L8JB 1A9VA 2GI0A 2UUDK 4PRNA 4TUUA 4LOUD 5I75C 1TCMA 4YWGH 3V0VA 2H41A 3DGDA 4KQ3L 4OFKA 4QRPE 5TDNB 3CQPA 4E9QA 4DKDC 4ZPVB 2W8CA 2B1HH 4AL8H 3C87A 1MVYA 3GRWA 3DBSA 4X4ME 4EZKA 1F5WA 1ACZA 3LS5H 4YDJA 3F7QA 1DQJA 1TJHL 2IG2H 3IKCA 4R8WH 4PJ8C 1V7NH 5AG9A 1N5AA 5EEZA 2ZUQB 3CV5A 5B1JA 2VDKH 4NO0A 3II2A 1GSMA 2X4RB 4PW3A 1UCBH 2XTJD 3MRQB 3PS6A 2P5EE 2P8MB 4H0IA 4L3EB 5IFAH 3BDYH 4YSAA 1N59B 3EDKA 4XP6L 2AJZA 1GRWA 4AE0A 3QYMA 1KN2H 2XYBA 4I5BB 1RMFH 2XWBB 3F6IA 3VWKB 5JDJA 3FF8A 4KQ4L 2AEPL 4LVHC 4FLSA 3UDWA 1ID2A 1XF2B 4AMKH 1FFPA 3MJ7A 1E5YA 4DEPC 3GF8A 4ZUVA 3ECWA 3C6LD 4LSVH 1UXWA 3HLAB 3MRNA 5DO2D 1U0QA 1VFOA 2LV4A 3KPNB 3NSFA 4OD2A 1FZOA 4NJ9L 1FNGB 1OD9A 1ZV5A 3RIKA 3K1KC 1MIEH 4V1DA 1M9SA 2WJ7A 2C8NA 1U8KA 2ID5A 4QRSA 5E0FA 1YYMH 3GHEH 5MEOB 3UBHA 3D51A 1RK1A 4V1DD 5H94A 1NFDE 3N04A 3GS4A 4A2FA 1GOGA 3ZW3A 5EV7A 4Y9CA 4C55A 5LQBH 3TBTB 4WGVB 3U7YH 5I5IA 2IOOA 3ECBA 1IM9A 3H55A 2NXYC 4PJEE 1U8JA 3HE6D 4O2CA 1JBJA 3FO2A 3RVUC 1CUOA 3SCMA 3D1MC 4PJ8B 4KHTL 3RBGA 2DYPA 4W4NA 4MA7H 1CFNB 1BOGB 4OSUH 4N2NA 1DUYA 2FT7A 4LOEA 3CDZA 4ILDA 5SX5K 3H42H 4RGMC 4A68A 5LJYH 1XL4A 3E80A 4PEEA 2V37A 5AVTB 4YHYC 1UXMA 2WQSA 3V9FA 3MRBA 5T1LB 4OZHB 4JK0D 1I7ZA 4NUGH 2CUAA 1ZTXL 2CGRH 4PJGE 2H6PB 2EH8L 4RMSA 3WKMH 4OZHF 1NWOA 3G5ZA 4PGDB 3BFOA 4F2MB 3T3PE 4HOXA 2XTJC 4HZAA 2BNUB 4HS6B 5KW9L 2Q3AA 2AK4E 4AK2A 4BHUI 1ORQB 2IWKA 4KI5C 5E24E 5D6CB 1XGYH 5HI4D 2WQVA 4FJYA 1FIEA 2KLRA 3G7TA 4FN0A 2MPAH 4I18A 1YAIA 3AT9A 3DV6B 4JRXA 3TP4A 5BV7C 1G9NC 3TIDA 1QFPA 1ND0B 4GXUN 4JG9A 3T5WA 3GDCA 5JW5B 1F4AA 2GPZA 2P42B 1Q90A 3RHWK 2WLZA 2DQDH 4OCRH 3X3FH 2FQGA 3CK0H 2F53A 5JO5B 5HD8C 4JVPA 2YJLA 2AMUA 2OFQA 3WEXA 2ATAA 5J11C 1UACH 3HRZC 3WNJA 3WS3B 4H40A 3MRCA 4HIIB 5BOZG 2H3KA 4R26H 3UPRA 2YD1A 4H1LB 2VXVL 2R83A 3P3UA 1FVDA 3PNWB 1BLNB 4FQQA 4Y5XC 2XZZA 4O02A 4CC4C 1M57B 3G6DL 5JORB 2IAMC 2WKOF 4ORZC 1L9OA 1HFUA 4IBLT 5MEQB 1N0LA 4ZMAT 4I2XE 4DOHB 3N9GH 1SGKA 4QRQB 3QDHA 4RMRA 4PS8A 2DKUA 2ADFH 4CDHA 1FFNA 5CEZE 3ZSTA 1ADQH 3VGBA 2WWKT 5TPWH 1G7LA 3JV4A 2CCWA 3WNMA 2E47A 1ZLSL 2PETA 1UJ3B 3BE1H 4AIOA 1SOSA 4KK8C 5FM5M 3WI9A 3NSDA 2AQSA 2FWOA 4X7SH 1KBBA 5LDUA 4JUTA 5AW7B 3HNSL 3B6SA 3CLFH 2A4ZA 4ONOA 4FQLH 2ZG2A 1SF5A 3CN4A 2B0SL 4NKQB 4EUPG 2EDOA 4AM0Q 2HWZL 5IESL 1NDGA 3RWIA 2Y0SA 2JH2A 2NSXA 5EFIB 3X1FA 5TGBA 1BGXL 4LSTH 4R5TA 3OM3B 3S4SG 5CLYA 3ZKXC 1AYOA 2ARJQ 4Z0BL 4LIQL 1ET5A 1FFTB 1NPJA 3ULVE 5IK3A 1HIML 2CDEA 2FSDA 4NHCH 2D31A 2ZSWB 4L9LC 3SDXA 4J1UA 2XYCA 1OCZB 4M02A 3MC0A 1MFBL 1S7TA 4A7SA 4G8FB 4YX2H 2MEJB 4U6XA 5E2TH 1IGIL 1CFQA 2APBA 3EADA 4PB9L 2OSLB 2VJ0A 2EH7L 4POZC 4R4ND 4MJ6A 5I71B 4S1DC 5ABDE 1CURA 1NOAA 5I0WA 1G7IB 1PW3A 1TNNA 5B39G 2R1XB 5D9SB 5CIPH 1TJIH 5D7SH 4RESB 2XT1B 1PG7X 2HUEA 4Q52A 2FWOB 3SE8H 5SX5H 3VI4A 1F4XL 3LKNA 4MFHA 4PJIA 4NC1C 1FGNL 1L3WA 2OJZH 3IFNH 2VIRB 4K0OA 2FECL 2WB1A 3BWZA 4NKOA 1XMEB 3WJLC 1NEZB 1IE5A 2JJSC 4HKJB 4NSKA 5D6DC 3ZBMA 3CGTA 4OFDA 4Z18A 4P9HH 3H2WA 2A6KA 5EU3B 4QXTB 4WJ5A 4HBCH 4G42B 1KENH 1PFOA 1KPVA 1KY6A 3WMQA 3RJQB 4J3OG 5JQHC 1DQDL 1MI5D 3QWRD 4BQ6A 5EF2A 4Q9QH 1J0KA 1U4FA 2EDFA 2F58L 2G75A 4QHLA 3CWGA 4PJEA 5AD0A 3BKCH 4GBXD 3SPVB 2D31B 4IBVA 3RPIB 2JK5A 4LL1A 1Q0XH 5TFSH 3NZ8A 4XPGH 5FWRA 4KVNL 4Y5VC 1KTLB 2IDUA 4BZ1A 4DTGH 1OO2A 4LU5L 1IZJA 3LXUX 3V0HA 5CCKH 1U58B 4G7QB 5HHQA 3M6DA 5FW7A 2MJWA 3W5MA 4FHJA 3DPDA 4ICXA 4PJ9A 1LNUA 5F0PB 2ARJA 3QXVA 5IR1A 1OGAB 2R2CA 1L5GB 3PXHA 1AS8A 3RWIB 1NDGB 1G7PA 2A9MH 3NRQA 5EORH 4JG0H 4P4KA 1CLYH 1N0XL 1SOXA 4LRIC 4NGHL 1NGPH 2VXTH 3EFFB 2PYEE 1NAKL 4LSQH 1FI8C 1Q94B 1QUNB 1WBXA 3B7YA 2UXTA 3CDFA 1HHHA 2D7OA 2NR6D 4RISH 3F2LA 4YN3A 4L8SC 4APQC 4BSJA 3OKKB 4ES9A 1I3GH 4OZIB 2RAMA 5KAQG 1S7RB 4Z7VE 1U6AH 3JQOB 3UAFA 2UY7B 3VW3L 3BDYL 4TNEA 1GZHC 4P46D 4MQXC 4NJ9H 1T22A 1RZ8A 4X8GA 2CIIB 3UGXA 1MKFA 4NO3B 4NN5C 4UV7H 1Z0NA 1ZLDA 4D9LH 1DR9A 3EBGA 3TO4D 2DM3A 3O9WC 3GHEL 2PTTA 1DQML 1A6TA 1DFBL 5A2IH 5BZXA 3T8MA 3Q8CA 4MMXB 3TBSB 4OLYL 1KIRB 4YSDA 4FFWC 4JFYA 4JKKA 1TZ8A 4ZZFA 3OPZL 3R7QA 2FQEA 5KJRL 2LU5A 2XIDA 4L4TD 1RZJL 1ULVA 3KWWA 3A4EA 3CBJB 4LCWA 1QZNA 5ICXB 2DTML 3HRPA 3CUPA 1TQCB 2VABB 2R29A 3NCBB 2N01B 4LLYA 5HI3C 5C09A 4I18B 1KGCD 1BMZA 4R9HA 3UCQA 4A38A 3UAJA 3OAUH 3OKDB 1KPUB 5C9KA 2A74A 3TASA 3QIUB 4BH8A 2JKRM 4S1SL 5HHXH 4HC1L 4TLUA 3GMMB 2E5EA 4XB8A 5D1QA 2Q0ZX 3INUH 4MCNA 4E9WA 2VLLA 2OMTA 3L5HA 5FYKL 1BM7A 1E4WH 5J6GB 3RGHA 5HPMA 2WOBA 2C1OB 2BHUA 2QKIB 3HUJE 1Z1WA 3S98A 3MRMA 2Z0BA 1MG3C 3FFCD 3BOVA 4I4WB 4U1MB 5M7QA 3EJRA 1R4XA 4BKLB 3BN9C 1PX8A 5IV2A 5JW4R 3HG2A 5FECA 4PJ8A 4XNXH 1OP5H 3DWTA 1PEWA 5TE7H 5H2BA 3TCXA 3JWOH 3QCTL 3UTPD 5ECGA 1KMGA 4A6YB 3VWJD 2NR6C 1AR1C 1ZAGA 1JTTA 1B4JL 3MA9H 1MCJA 4DP6X 5A2FA 4RRPM 2QDWA 2EDKA 3BIBX 3Q6FB 5DJZA 2HRPH 4CBPA 3IMRA 1OAQH 3B2MA 3E1ZA 1GKEA 3BD4A 3S35L 2GTWB 3DSFH 4W9DC 1Q9WB 3BZ5A 4KUZH 2DLGA 1T1WA 4XMKH 4PGCB 3U82B 3CNKA 1QSEA 4KK5C 1RUKL 3EZJB 1I7TA 2A4EA 2PYEB 3IN2A 1WWAX 5DJAB 4NDMA 3ZL4L 1A6AA 4H5SB 1F0LA 3KLKA 2DEXX 7PCYA 2Q7YB 2CR3A 2ERJB 4L18A 1MRCL 4PWGA 1HILA 4MHHG 1IBZA 5F7NC 3W57A 2NUPB 4OZHE 4FFWD 1HVXA 4JE0A 3W3BA 1DBBH 1Q1PA 5I1JH 4AMXA 2IPKA 5AEAA 1TF4A 4X6DF 2BIMA 1MREH 3I02B 3WFEH 4IBQA 2YPLB 3DMMD 4HKXA 4XB3A 2E4FA 3TWCH 1BD2D 5HVFB 5F7WC 4TRPH 5A6MA 3ZE0F 1WFUA 1DVSA 1BJ1H 4BA8A 3D05A 3D0LA 4PRPE 1PY4A 4ZYKB 4P5TB 4PRPD 4W9FC 1MNUH 2VLKA 3DECA 5ADPL 1CFBA 1FVEA 1G7QA 1NGXA 2VDPB 1G84A 4RX4A 1Q72H 5BZWA 4H5SA 4KV5F 5EC1B 2OYLA 3SE3C 4FFVC 5HHNA 2VQUA 4RZCB 3MLUL 4WO4B 5C3IA 4LVNC 3VSVA 1GZPA 4NN6C 4YXKH 4XMXA 1TO5A 2H3NB 3Q6GH 1HINL 3HI6H 2HRHA 2E75C 4DKTA 1U8IA 1YNTA 3QZLA 5F97E 4EZJA 3I84A 4B6ZA 1R9FA 3BPCA 3SD2A 3CAFA 1WDAA 4JKMA 3PAUA 3RZWA 4DZ8A 5JXEC 1NGZB 1NKRA 2Q7AA 2CCVA 3NRPA 2WSDA 3GPSA 1IAOB 2QMJA 1T0OA 2EO1A 1G0DA 5C0BE 4JM2D 1U42A 5LBSH 2J73A 3AZUA 1MW2A 2OMVB 3CHPA 4Y2DD 1BXAA 1BFSA 2OR7A 3MBXL 3F12B 4P46B 5D5ME 4X9IA 4TVPH 3D07A 1M7IB 2JCCB 3V8OA 2VJXA 4Y2DA 3VXMD 1WEJL 3OXRB 1ORSB 3HN5A 2QFRA 2QKIA 3MLRL 4H2AA 3TBWA 3TVMB 4HIJA 1PL3A 2WVTA 5ALCL 4KJYA 2YSSB 1JF1A 2QSVA 3IAQA 1DVFC 4JO3L 3D85A 5LNDA 2XZQL 1CYXA 2O5XH 5F0JB 2IH3B 2JE8A 3BAIA 1CR9H 1TCRA 3GIVB 4UM9B 1GZPB 2JKSA 3KWXA 5HYJA 1XAUA 3GSRB 2W65B 1OHQA 1K2DB 1MCKA 1BCIA 1QATA 1QX1A 2OW6A 3CBKB 4F1SA 1LEIB 3HFML 3VACA 4GPVA 1RUPL 2VISB 2HLAB 4MJIE 4LE8A 1VGKA 4MJID 5KWYC 1RIVL 4JRYA 4NLHA 1A4JB 5D1QC 4V2CB 3DC0A 1FNLA 1YLBB 5F6HI 2YPLA 1K6QH 4NUJA 3ZU8A 2VDRH 1CTOA 1UWEH 3MQIA 3L54A 2IADB 4ZX5A 4QGYA 1A8ZA 2WQWA 4X7TB 2GFBA 1CJYA 1A4KA 3LNFA 4XC3L 2XG5B 1RIHH 1HILB 5DVPA 1R3KA 2X70A 1HQRA 1U41A 2Q7YA 2ITCA 5KVEE 4WW2A 1KPVB 4W6WB 1NCDL 3EOTL 2IC2A 1RKRA 1FE8L 1RZJC 3G5YA 4FERA 4PP2B 1EEQA 4UU9A 5J1SC 5FFLA 2X53A 4OM1L 3FNKA 2IPUK 4KO5A 4Y1SA 1NKGA 4HLEA 4OIBA 4YHNA 4MKMA 3VWJB 5AVVB 3ES6A 3L3JB 2NQDA 4P5RA 1HSAB 2VSDA 4KMQA 3AY2A 1WK0A 4DT2A 3QCVL 2DWDA 3X14B 2AEPH 3PWJB 5FYLD 1KBGH 1UH2A 4JO1H 4APQA 1UXSA 4QNPF 1TTGA 3OR6A 4HIQA 3HMXL 3RWJB 4KK6D 4PBWD 5DZPA 3BH4A 4UT7L 4OGZA 4M8QB 3P4MB 3GQFA 1DBMH 1EZVY 4WHYG 4E5XA 2X38A 4IBTA 4MA3B 3ARBD 2VDKL 2IDSA 4IDJH 2AABH 5I8EA 4XBPB 1N3NA 3SDXB 7TAAA 5EBWA 1Y18B 1I31A 3T3MF 1HTYA 4FNTA 4KUCF 4N2DA 1LWRA 2FK9A 2PCXA 3REWA 3W39A 4KJQD 1RZJH 5GSRB 3RGVC 5HPMB 2XI9A 3SBWA 2PWEA 3CQFA 3N0AA 2GSIA 3BN3B 4MWFB 5D1XE 1BZ8A 2JI3A 3H0TA 3H6JA 4WEMB 4M6MH 4G9FE 2YK1L 1KV3A 4JY6B 4KGLA 4RGNB 4FQCH 4U0RC 4AGOA 2P43B 1SDAB 2ESVD 1BD2B 2F1EA 2FBJH 5IW3A 3FO9B 2BS8A 4M61B 3RTQC 2QQQA 5JDSA 2O61A 4WJG3 4JFQB 2N3JA 2Z4TA 3KPLB 3W9DB 5IQ7L 4WK2B 2NY5L 1MAKA 4MDIA 3IJ8A 1UZ6F 3UTTE 2ZP0T 3MJWA 4PUBH 3D4YA 4PHXA 2FQDA 3B9KB 1VENA 3WXWH 4Z8FH 2ZUTA 3D2UB 4LGPB 3OB0K 4I3SL 2F8XC 1G9HA 2BOBA 1JFQL 2DLTA 1BAFL 1DSYA 4XCFH 1R5WA 1HYSD 3KH3A 1YEHL 3BUDA 4X80H 2JJSA 3JT0A 1AG6A 1GY2A 1DO6A 2ZJSH 2APSA 3MJ8B 1E8ZA 4Z7IA 3RZCC 2EC8A 1YECH 2R2EB 4O4YL 5HYQA 4YC2B 3RVUD 2AJVH 3BLPX 4E9XA 3EGSB 4OU3A 3MLWL 1VACB 2ZCKL 3D4ZA 5EBMA 4AX3A 2ZXWB 3IE4A 1NIDA 4EN2A 2VKWA 3P0VL 4PB9H 4FQHA 3WKQA 2XN9E 2ZX5A 3DSFL 4RETB 5E1IA 1NLBL 1WITA 4IW4C 5C0EA 4QT5A 2X9YA 4AQ8C 4QHUA 4IIQC 1CLVA 4IKKA 4QOKD 5ACLA 2IDCA 4QOKE 1M71B 1EVTC 2A3TA 1YPZF 2X28A 5EH1A 2SODB 4PJ9C 4A2GA 4I9WE 4NWTH 3N43B 4FKEA 4C56E 3MJ9H 1ZTMA 1EFXD 1OP3K 4PVLA 2ETWA 1HHJA 5KYXB 1VEMA 2HLFC 4UM9D 3TWYA 1I53A 3OG4B 3TN0D 4YDVA 1ID5I 3CSFA 4OCNC 1JGDA 1TMCB 4I0KA 1R34A 4F2MA 3MDJA 4WI0A 4HOWA 3KPQA 5BRQA 4UAOB 3EO0B 2B39A 3QHZL 3NVQA 3QEGH 4AK1A 4L1DA 4BWTA 2QDVA 4P06A 3ROOA 5CGYD 4MAZA 5DD3L 4L4TE 2CLRA 1T5XA 5ERWB 3Q2LA 4YS4A 1NMBH 2BVQB 1CFNA 3AT8A 5JORA 2VDQB 4AT6A 3L5WB 2XN2A 1VGKB 2YBRB 5JOFA 5IQLA 1AC0A 4QI3A 4DOHE 4ZD3H 3QZWB 3A0OA 3HS0B 2B0SH 5ESQB 1E27A 5DJYB 4BDVA 4NXSA 3MLYL 1S8DA 1JD7A 3NZSA 4XVSL 3RB7A 4ELMF 3HG3A 1JPSH 4W81A 5LBSL 3VRJB 3GSNL 5L2JB 3FHAA 4P5MA 1TZIB 4ALAC 3FZUC 4XNZB 2QVKA 1CFSA 1MIML 5HDQL 4LZKA 2DD8L 2JQMA 4HQQL 4MDRA 4R5XA 4J3OC 1EXUB 3FCBA 3BZFA 5ISZE 3QDGB 2V8MA 4F7EA 1ZK9A 1HHKA 3QO1A 4UILL 5C3LD 2XBTA 5HHXL 1DSFH 1S5IL 3DV6A 4JRXB 1ZLWH 2ZUQC 4PRAB 1E2WA 2GJJA 1I8LA 3NH7H 3NJFA 3PDOB 2BX5A 3HLAA 1FLRH 2P49B 3MRNB 5E5MB 2C7FA 5A6IA 1DZ0A 2J20A 4Z9KB 4LEXL 4G6KH 3BGAA 1BVOA 1M42A 2QSQA 1WCBB 2R0WL 1KN4H 1T0MB 1IEBA 2XFXA 2FT8A 1H5BA 4UZUA 2N1TE 2H8PB 2EDLA 3ARBB 4X80L 3S37H 3MRBB 5T1LA 1U8CB 4LP4A 3FFCA 2QTEA 4HKBB 2XWBA 1XR9A 1XGUB 2Y6TE 3L13A 3Q5OA 4WEUD 3HG5A 2H4EA 1DLHA 4YL9A 3T4YA 2P7TA 3QXAB 2IVFC 5L4IA 4G43A 2X4QB 3Q44A 1M2OA 2N7SA 3LOWA 3L2LA 4YBQC 2P8MA 5F8RC 3HA0A 3ZTNH 3KPRE 2X4RA 2ZE0A 5BOPA 4JM0A 4HDIA 4KUCD 4LRNH 2NY5C 4X0KA 2BHFA 5E5RB 3GMPB 1Y07A 1N6QH 2DIBA 1NLBH 4F8TA 3QWOB 1JPEA 1JJUA 3B5TA 3GMOB 4AIZA 3DOIA 1UT2A 4HWBH 2R1WA 4HGWB 2R0LL 3EFOB 4IBUA 4CC4A 5BRPA 3D09A 1SQ2N 1UJ3A 2DMHA 5BUGA 2WYTA 5JHMA 2BS71 3N85H 1Z3RA 1GGUA 2EKJA 4ZTEA 4NX0A 4X4YB 2A73A 2ZOLB 2JKIS 4OFVA 3HC0A 4X2UA 5IVXF 1O7VA 2W0FA 2OI9C 2XTLA 3K72B 3QYCA 4RGOL 5G2NA 4EJ1C 2ODIA 4NQDA 2J8UA 5E8OB 2CMRH 5HYSG 1KBKA 3FTGB 5CZVH 4FXTA 5IFHH 2XZAL 3BP5B 2HRPL 2V5SA 4CC1A 1UOVA 3LJ3A 4R0LB 1MCQA 1KTCA 5I26A 5DC2A 3DMMB 3A67H 4Z77A 3BEVA 3FO0L 3MXWH 3WIIL 4WFFE 2ZCHH 4F15B 1E4HA 5D7LA 2E0PA 3JWOL 1DUZB 4N68A 5KSVB 2RFXB 1ANUA 3VI3A 1U93A 3PV6A 5JIQA 4HPOL 1GAFL 3A6BH 2OR9H 3D69A 2E76C 5JO5A 2BSCA 1TUPA 2L7QA 5T3ZE 1L9TA 4ERSL 3PFUA 4MNQA 1VJSA 5TDOA 4CN4A 4XNUH 1XD1A 1NMCB 1ETZB 4Y4FD 4L1SA 3RG1C 3VFSA 4CVXB 1RHFA 3VXOB 4ADIA 1WHOA 5D8JH 5DQJB 1X44A 2VW4A 2PXYB 5H35B 3OHXB 1JZ8A 1JHTB 4X4KA 3QQ9D 3X12B 2MKWA 1OAUL 1TZOA 1T0MA 3R1GL 4V2BA 3T65A 4Q9RH 1JDCA 2JF1A 3GBDA 3D08A 3K71B 1AY1H 3VXQB 4FNLH 4YBQD 2Q20A 3TPKA 2YQ3A 5AUMB 5JNYA 3N3EA 4KHXH 1IGJA 4JQXA 5D5MF 4TMPA 4PRAA 2L8AA 1XXFC 2YD7A 3MUJA 3MRKB 2V2TA 3CDZB 2LLNA 4G6FD 4KRMB 3LIZH 4N3TA 1YN7A 3VFRB 1DEEA 1U8LA 1ZJBA 1EBPA 1NGQL 2UWEE 4MQXD 3K46A 5FGBA 1VRSA 1AMXA 4HGMA 3NIFE 4MNQE 4Z8FL 1JWSA 3AS2A 2LT9A 1R3LA 3OZ9H 1RZKH 3D39E 1RHHA 2ZT9C 4FQXA 4EI5A 1A25A 1PKQE 2R1YB 3K2UL 4JRYD 3S48A 2YGOA 4LPCA 4OLZH 1G7HA 3KPSB 5FW8A 4IMLA 2AEIT 2Z4QA 4RQQA 1S9XB 1R3LB 3I9IA 1QBMH 1LP9B 5DSCA 3KJ4B 1XSOA 2H32A 5FS5A 3WFHB 1AD9A 1F90L 3TH2T 2YC1B 1YRKA 3QQNA 2NT0A 4OLEA 4YDLB 3VFRA 4RDQG 1R0AL 1V55B 4XC1L 3PJSA 4HHAB 4XRCA 4AG4L 5I1LB 1X7TA 4FQ1L 2FYYB 4CU7A 5B7MA 1Q9KA 4KK8D 2VDRL 4MJIA 3N40F 4MAYA 4N5UA 1ZHBB 2VB5A 5KS9F 4JO4L 4LHUB 3CZUB 4DW2L 2N0KA 4WI0B 1TJHH 2IG2L 1RUQL 1XIWC 5CP3A 5DZJA 3U9PH 3PYCA 4I0PB 2XN9D 3U1SH 3VI3F 5ICYB 3OHXA 3GK8H 5JOPE 3LYRA 4XWGH 1CLCA 2J57A 2DQFA 2FL5A 2HLEB 3KBEA 2X4NB 3BGMA 4E0RA 4NWTL 3GBMH 4XVJL 4A7VA 2K78A 1UA3A 5EBLA 2G5UA 1ETZA 1E30A 3ATAA 5GRYA 5AW4B 3T3PF 2XZAH 1ZT7B 3S8FB 3MV8E 1IFHL 4G9DA 4X8JB 1K9TA 2O5XL 3SGJC 4OD1H 1KB5A 1KEMH 1A6VL 1D2OA 4DVRH 4ODHL 2FQFA 1G7PB 2ZONA 3UIZA 5CJQL 4PRIA 1WTGT 4RA0C 3WGUB 2X4PA 5BMFH 5KSUB 1LDPH 1QNZH 1NCCH 1GS8A 3DJZA 4L23A 4JM2A 2XRAL 5E7BA 3BMWA 5C6PB 2JB6B 4UQ3B 2D3VA 4RX4D 4DZBA 3P4LA 1OAQL 4ZMPA 3NZ8B 2YMOA 1TETL 5CLWA 2F6AA 4BH7A 5L0QC 3QEHB 1AZBA 1M56B 4IS6B 5J11B 2YD8A 3RY6A 1ZGLM 3BC9A 4FKHA 4TLSA 2WBXA 3D50A 1AFVL 4UAOC 4QRBA 4DP7X 3QHZH 2W9EH 3O6FA 1BQHA 3W1ZA 1J18A 3CE1A 4BKSC 3RTQA 3QNXB 1SDDB 2J8UE 3DYOA 4PJBA 4D8PB 1YEDB 4ZW8A 3JWDC 4G42A 4S0HA 2VAJA 2R2BB 2QPFA 4FI8A 3TYGH 4ANVA 1D6EA 1JPST 1IEAB 1R5IA 4U3HA 1QSFB 5KEZA 1NC4B 5CEZH 4ZAKD 4X42A 2FSEB 3CZEA 4H20L 4N28A 3ZSSA 2A74C 3W9DA 2FJFA 3N40P 1P1ZB 4X4ZA 1NA8A 2HJLA 3QNYB 2O61B 2FHCA 1JPGA 3DPBB 2LGNA 3TCTA 5FYJL 3T6XA 4JO8A 2OV0A 4MD5A 3MBWA 5I76A 2DI7A 3V4PH 4MZ2A 4TQEH 3BVNA 1VEPA 5SWSD 2Y5TB 4HOMA 2I07A 3T3PB 1F8TL 2Y7QA 3D2UD 3ARBA 3AACA 3WCYA 5JLZB 1EO5A 3QRGL 5KS9A 1EUUA 5LQBL 4L3EE 4YXKL 2EH8H 1YECL 1LM8V 5MI0B 4PJXA 2O5ZL 1ES0A 3FU9A 2OQJA 4JRWA 5C0RL 2DWEB 3KYKH 1KBVA 4JRXE 4NKDB 1YQVH 3UPAA 1LK3L 2FX8L 4IKNA 2R23A 5EZIL 5C0BB 3KJ6L 3MBWB 5H37A 3VRIA 1D7FA 2VXQA 4LCCC 1C12B 4GUCA 3AT0A 5GZOC 2Y1ZA 2ZTBA 1KLFA 1REIA 2H45A 4G6FB 4OCRL 3SGJA 2VN3A 4MYWB 5LCVH 4WDIB 5B38B 1S9WB 4XGZA 4PW9A 4RAVA 4M7ZB 1P1ZA 5FUCC 4HGKC 4FXKA 3WLWD 3KM1A 4ZODA 1URIA 2YAFA 3UC2A 5IOPB 3WN6A 2CO7B 4NJAL 3KPPA 2MTAA 1L0QA 2V3EA 4JPKH 1WIUA 5C9JA 3JVGA 1EFXB 2VN6A 5TK2A 2AQ1A 1INEH 2CRZA 3VXUD 2CBTA 4XE5B 5K39B 1KN2L 2A6DA 2EIZB 3EJYD 1SJEB 4H8WC 1J0YA 4Q56A 4ZPTA 1ETA1 4PN6A 3M88A 1FFNB 4PTUB 1RIUH 3QPQD 4U4BA 5F7KC 3ROOB 3KXFB 3GXIA 3DX9B 3PNRB 1W2KT 3V4VA 2X3AA 1FH2A 3H54A 5E4EC 5PCYA 1QLEB 3LKPB 3CFUA 5BS0A 4FNRA 2P3YA 5FOBB 4JANA 5IT2H 3BEWB 4AOFA 4KKBD 3RIAK 2IFGA 2YARA 1PDKA 1DQLH 5C86A 9PCYA 2HA1A 2R69H 4FCHA 5HYFA 3IFOA 3JZ7A 4LDLB 4IJ3B 5ALBH 3DHPA 1HJBC 5D8JL 4YR6A 1SJEA 4ZPTB 3A24A 3P9LB 3GSXB 4C4KT 1IGYB 4H13C 4D0BB 2OCFD 1K4CA 1P84K 2D3LA 4M7LL 5SX4I 4AYMC 4LF3B 5JYMA 3VA6A 5JPNC 1NZRA 4N2HA 5C0EB 3ISWA 1NBVL 5CD5D 4NC1E 4R8WL 1S9VA 4NQED 4WGKA 3B2PA 3JWNG 4E42B 1YYLH 1YC8A 3RX5A 4LSSH 2M8XA 1JV5A 4HWZB 3NJHA 3BQVA 2ED7A 5CXPA 2C9SA 2JKWA 3ET9F 3DUUA 2OMZB 4KXZH 3V9EA 3BSZH 4XNAA 3ILEA 4N25A 4QRFA 5IUCA 5DMIH 4K8RH 1MHPH 5AAMC 4QR7A 4Y5YB 4AMKL 2GCYB 4F20A 5L7XL 1QRNE 3WFCL 4FNUA 2V7HA 3GT6A 5IVXA 2FO8A 2Y07H 4IBZA 5IMKA 4RGMB 2XQYG 2RALA 1QACA 4XHQA 3G5VA 3FQ4A 4MHHI 4KK6C 1Q0EA 4ZUWA 5CS7A 4HQQH 4N1EA 1HH9B 3ABZA 1E6OL 3OGOE 3P2DA 1MIEL 4OI7A 1MFUA 3T0EC 3LRHA 4GW1B 2EXSA 3M1CA 3VFWA 1MI5A 4AGMA 3QISA 2ZWLT 1AGEB 3DX3A 4KMTH 5E4EB 3T1WA 4P48A 1KCLA 4GSQA 4NZFA 3MLVL 2ZXQA 1XF3B 1IC4H 4J3WA 3IMBA 1UZ8B 5I19L 4UNTA 3ARDB 1T89C 1GS7A 5CINH 4PTTA 4Y16A 3DETC 3QQ4B 4GJTB 5E1AB 3RVXC 2HH0L 3Q9QA 4W68A 4AEIL 1IX2A 5DJCA 4ZO8A 2F53E 2YA0A 2DBLH 4DWHA 1OP9A 2YPKB 3MRKA 5FGBC 3UEQA 2BSTA 2YQBA 3JV5A 5D5MA 3P11H 4NRZB 3B1UA 4GNKB 4R2GD 5IJKA 4S1RH 1FP5A 2DL2A 3S36L 4PJ7B 1IBGH 5JW4N 3FOLB 1VCBC 5H37H 1N3NB 3KR3H 1B0GB 3I6GA 2WP3T 4EI5C 2OL3H 3F7YB 4K5NA 3QQXA 5J89A 5DJXA 5I6XB 4OKVA 4FX5A 3UGUA 43CAA 4HT1H 3IYLW 2HKAA 4PLNC 2WQAA 3TO2B 5JOEA 1MI5E 3CN1A 1AIZA 4J6RL 4RMQA 3VD5A 3MLZL 1AACA 3RDTD 1I4FA 1S78C 4ES8A 3ZT7A 2HSIA 3AXLA 5AQ0A 1TEFA 1PKQB 3ABMB 1BREA 1X9UA 2OJZL 2EDQA 3IFNL 4DERA 1OD7A 3B2XA 1MCLA 4X7FC 2AEWA 2QV2A 1OW0C 4WUKL 1Q4NX 3P69A 3FFDB 1YJDH 5E8PB 4P57B 4N2GA 4PRHE 5GRJH 3FYIB 2VLJE 1L7IH 3BYYA 4WWID 4BRVA 4X98A 4Y4FB 2YN5A 1KENL 4Y9GA 3CVHA 4ZRGA 1GC1C 2F1BA 2H26B 5H2BB 3VFGH 3WS6A 1YMME 3J8F7 3GTNA 3D6GA 1FZMA 1ZT7A 5D1XD 4OGYH 3U2SB 5C0CB 5EO0B 5F7HA 4KGJA 1UD2A 2WLJA 1ADQL 1C5BL 2OPCA 3FH8A 3MR9B 4M6OH 2AXFB 1OGPA 4YHZL 2XUWA 2ITDA 1A02N 2CKNA 4XNYL 1BEYH 5L2KB 5JW4M 3MLTA 4ATWA 1WLHA 1MQKH 4ZFFB 3RTLA 5I8CA 4LEOB 1R3HB 3KGUA 3CDCA 3AB0B 3GIZL 2OMTB 43CAB 5J1AB 5SWZA 1CO1A 3LNHA 1XXDC 1ZHBA 1ZOXA 2CG9X 2VSCA 4YNYA 5MHSD 3OR7B 1KEGL 4AE1A 5DK2B 4TXVB 3OJMB 4F7PB 4PJAA 3ISYA 1WC7A 5GSVB 4EN3A 5CGYC 2OMUB 3CFJA 3B9KD 3QQ4A 3LX9A 3M07A 5E1AA 1JGEB 1TLMA 5DUBA 1KTDA 1GA2A 4MA1C 1HE7A 2H32B 1AZRA 4JFPA 4LCIH 1AY1L 2BWQA 2XICA 5I8KL 2YHGA 1RXLA 4PJAB 1J9CT 5F6IB 1BVNT 4UF7C 4EUPH 5D7HA 3MCYA 1N26A 2HX8A 2Z31A 4HKBA 3RL2A 5JW4Q 1E40A 4J5VA 5IB2B 2F5BH 4KX7A 5BJTB 5HXMA 3MRHB 1CGXA 4HG4K 2YWYA 4X5PA 4POYA 3BCFA 1H3XA 1FHNA 3RDTC 1AOZA 2D3NA 1XB8A 2W60A 4C56A 4ODXA 1E5CA 4NNYA 4PI0A 3UTSD 1A1OB 1W0VA 4F58H 2MQCA 1U91B 3PIQB 2BRRL 2VTFA 1MCEA 4LFHG 5FF6A 1ACXA 1IKFH 1OAJA 3MLTB 4KWUA 3WHXA 1NC2D 1HHGA 3K2UH 2CIIA 3VXSA 3TEUA 1RZ8B 2WTOA 3ZTEA 1MEXH 3BP7A 3L3HB 4JGMA 4LCCB 2DQUH 2PCPA 5D7EA 1KDIA 3IDGA 4ABWA 3KCPB 4G9FD 3ARFA 1FZMB 2D03H 3MZGB 5JIKA 4GRWB 4GO8A 4LARH 2HFEB 4I0PC 4OF8A 1NCIA 3ZOAA 1HHHB 3DUUB 3QUMH 3SN6N 1NBCA 4HUUB 4R83A 4NIKB 2DQGH 4X98B 4F24A 1EDQA 5ICZB 2XWJA 4BZ2L 2ZOKB 1WAPA 2CO6B 2FJHB 4HMCA 3QNZA 2P8LB 3I75A 3M8OH 5CWSA 25C8L 3NJLA 4GKZA 4OTXH 1NUGA 1KACB 5C92A 1OP5K 5CR8A 1Q9LB 2HFTA 2I27N 2AJYL 1NFDA 2AK1H 3DO4A 1E9OB 3EDJA 4L9DA 5JXEA 3ARDD 1DQLL 1ONQB 3ZT6A 4HH8A 1S9YA 4ZX6A 3FRPG 3SDCA 5I71C 3LY6A 5BS0E 5LAXA 5T5FL 3NJXA 2DQDL 1PDKB 4R96B 4NQCA 1JHKH 5EUOF 4FNQA 2AITA 5FO8A 3HE6A 1DQVA 4Y1AE 3IJYB 2OW7A 1IM9D 4FTVE 3TGXA 3VFMB 5K59E 1SMOA 2AAVA 5D2LF 4AL8C 1D7BA 4IMKA 4Z1PA 4J3OF 4N2FA 2AJ3A 3QSKB 1FL5B 4MCZA 4Q0XH 1YYLL 4LAQH 4F92B 3VCLB 1UATA 4YEFA 1MCDA 1AGFA 1CGWA 1VZGA 3DX7A 3IFLL 1I3GL 4MMZB 2XLLA 1G9NL 4PG9A 3L45A 1T1XA 5FYKU 1J10A 2GT9A 2GY7B 3QUMB 3A4AA 3IMSA 5BVJA 4HUCA 3WHE0 2ITFA 3FN0L 3KD4A 1QLRB 1NWPA 4NQQA 5FO9A 5K9QG 1I82A 4LOFA 1USQA 4AIZB 4K8RL 4UT6H 4JG0L 4HLZH 1G7IA 4CMHC 1BIIA 1RSFA 2AI0H 3VFMA 3DHMA 3MRDA 4I13B 3RZCD 4MJ6B 3QEQB 4E41D 2HJKB 3PPEA 4OQTL 4OZGE 1WUZA 1JMXA 1PKOA 3H9YA 2NNAA 3LMJL 2P5WB 5C0IB 1EHLL 3TJPA 4I4WA 4OCSH 1IARB 4KNSA 5H4ZA 1LD9B 3U83A 2YPVA 1DANU 4NZUL 3TCLA 4LQFL 1AD0B 4ZUSB 1HSBB 4K9EL 5I1KL 3SPJA 4C59B 4PJFE 3KL0A 2BOBB 3TVMC 1ZCRA 1DJIA 2WUCL 2C26A 2E3VA 2PN5A 4MD4A 4ODSH 2BCKA 4Y2NA 3WFDH 4QJ4B 3I6GB 1B0GA 1BGXH 1OSYA 4BH8B 5DDHB 3CX2A 1F8TH 2FJHA 3BWAA 3OKDA 1MCOH 1N8ZA 4PJFF 4YHKL 2BW4A 3F7PC 3SCMC 1S9VB 2YPKA 1V3MA 3HZVB 3KYOB 3RVVC 4U7KA 4KTGA 4OZIF 1HHKB 4JVUA 1G9MH 3BVNB 4H88L 3GGWB 2Q8AH 4HCRH 3UYPB 2Z7WA 1YY8B 3DXAE 4MXQD 3QUML 1RLWA 3MTRA 3MV7D 3P9LA 4D0BA 1TZIA 3CFCL 1MUJB 4WI4A 1A2YA 5T5NG 4ELKB 4F91B 5GQBA 1SLUA 4ETQA 2F5AH 1AHWB 3SJVE 4IEFA 4YVUA 3F7LA 1HXMB 1X9RA 1AXTL 5D96B 5F72S 1VFUA 3FCTB 3UJJL 2UZIH 2XG4B 1AO7D 3NN8B 1WBYB 3MCKB 4LCYB 4YL4A 4Z3GA 1IO4C 3OAZK 4POUB 5HDBB 1GH7A 4KC3B 3V4VB 1JK9A 1HDMB 3T8VA 4FQQB 5ERWA 5J13B 1L7TH 4I9XA 4YSPA 3P4MA 4UINL 3PP4L 1VKXB 2IGFL 4X8XA 2AC0A 2X2UA 2F54A 3FQ1A 4UTAL 4NWUH 1W72A 3HZ3A 1S3RA 3ZPDA 3RE0A 1NC2B 4KUZL 5I74C 4J6RH 4J3OD 2G2RA 4WWKD 3ZIMA 3OJ2C 1UB5A 3RNKA 5INDA 3CC1A 4E68A 2B4CL 4L8DB 1FZJA 5IBTH 3NFPB 2CKBB 1OAXH 1CGSL 1KFAH 3GDBA 4PRIB 1U21A 2QGDA 2YD9A 1TQUA 3V0WH 3P54A 4NKIL 4WDIA 5DLML 1RPUA 2OMWB 1Z7JA 5D6CA 4XO4A 3ZYOA 2ZKYA 1KCKA 2CQVA 1CYWA 3FOMB 5D72H 1UWGL 5I8CB 1P6AB 3GHBL 2DAVA 1XGQA 1EERB 3AUVA 2GJZB 5FGCB 3EH2A 3HBQA 4WU5B 2UZPA 4N90D 4CNIB 3SEPA 4KROD 4N6QA 4XO3A 3P30H 3SPVA 1OLZA 3SCMD 1VLXA 3ARFD 3QORB 2WXFA 35C8H 3DROA 3PWNB 3IDYB 4XWOD 5AZUA 1RK7A 3G6JA 3IVKB 2H0EA 1QZ1A 1TDQA 4P46C 4P2QE 5FW6A 2ZWZA 2AXHA 4AVIA 1YUKB 3ALPA 1JG9A 2WXRA 1IM9B 3ESOA 5I76B 3GKWL 1AO7A 1FDLL 2NYYC 4TN9A 1WWBX 4GSDL 5FCSH 5TQ2L 2VIRA 2A6DB 2EIZA 4G8GA 2XX0A 2Z64C 3AXLB 1CVSC 2ZKXA 5IVZA 1DLFL 1ZS8A 2YLHA 5DMIL 5TJWK 3DA0A 3HHSA 1MH5A 4YFDB 4L1HA 2DM7A 3CHQA 3OGCB 4JFXA 1U2YA 4L2YA 4LLVA 3K2MC 4MMYB 5E1HB 4OVVA 1N9PA 4UT7H 3D25A 2W07B 1QWHA 3U6XA 3QQDA 3QJTB 3V5HA 4LPYA 4H8UA 3UAJC 1FJ1B 2K7QA 1VZHA 1CFQB 4PYHA 1A3ZA 3AGVA 2DQJH 4OVUA 3IAPA 5DQ9A 1HE8A 3F8UB 2XN9B 1JMZA 4HIEB 1AGDA 4NRZA 2BSTB 4XMPH 3TNNA 4F2FA 4F9PA 2OMVA 4PGEA 2CCLA 4WWKC 3LRKA 5ACZB 1X5GA 3S36H 4EXPX 3QE5A 5FHBL 4LSPH 5J9PA 3B8YA 4NKDA 2XQBL 4O9HL 1FFPB 1Y6KR 1EDYA 5ID1B 1ROWA 4EO5A 2NPLX 4AV0A 3FQNA 1GY1A 5AOIA 3KYNB 4FNPA 4TUOA 4YGVA 3SKOA 1QR1B 2I5YL 3PU7A 1OTUD 3O4OB 2WIMA 5F93C 1FYTE 4HJ0C 5F7YC 3HKZA 2VE6A 1BVZA 2QZ5A 4P5KA 1HH9A 3PJNA 3AU1A 4XPFL 5DFVD 4ZNEE 1HNFA 1JNNL 1DQJB 4WFED 4U1HA 2I9TB 5GGUA 2ZUVA 4G9DB 5KVEL 2WVVA 4WU7B 3KJ6H 1H9DA 5IMKB 3BT0A 4RWYH 2J44A 3O3EA 4WI3A 5DJ2B 4K3EH 4E9VA 5G55A 4XMLL 1CK0H 1U3YA 5C0CD 1UCBL 6FABH 4YMPA 1XCTA 5DVKA 3VD9A 3CXFA 1NFIB 4IGBC 2GSMB 3E8UH 2ADYA 1XIWA 2IWGA 3RDTA 1N68A 3AAZB 3FQXA 3CVHH 2C3HA 3B83A 1R3KB 3FTUA 4AM0A 2I60H 4R0LA 3RPBA 1EGJA 3T0DA 3DI2B 1MRFL 3VXPA 2C3VA 5T1KB 1IGMH 3P3RA 2GJ6A 2YD2A 2RCSH 2B9AA 2VMCA 4BBWA 1E7UA 4AGQA 1JGUH 2X87A 2IADA 3DDFA 4HFWB 3WLBA 4KQ4H 5FDWB 3MGOB 1CDYA 1DJYA 4HJJL 1IAKA 1SN5A 2L04A 1EIBA 5CGBA 2NY6D 2PPFA 3UC0L 1K3ZA 5BXFB 4JRFA 3ZQWA 1SFDA 3W0WB 3FW6A 1SXZA 1JPFA 4LKCA 1TPXC 4P99A 2NNXA 3WYRA 4LSUH 3S0PA 3IGKA 4D7PA 4MDJB 3WEBA 1KB3A 3RVTD 3NEXA 1GGBL 1D5MB 2MOGA 3UTSE 3B43A 2WD0A 4FQXB 4EI5B 3ZKQD 5F9OH 3VFTA 4N2IA 4MA7L 3NP3A 4G8IA 5EEUA 1LE5A 4A6YA 1HKLH 1X5MA 4IRSD 3H7BA 4JPQA 2LE9A 1FNFA 2VRKA 1VAHA 5DHYA 4HPYH 3MRJB 4LASH 1E4XI 5EZOL 3T2LA 2W92A 5EO1A 1KJ2A 3IGLA 1WD8A 5I0ZA 2X4NA 3BGMB 3J7HA 3AUWB 2EDXA 1P84J 1N67A 1LE9B 4YHZH 5JPMA 3V6BR 3OJDB 3W11D 1R24B 1GZHA 1T7XA 1I1CA 4UB0L 2C1OA 2FYVA 3IDXH 3Q8EA 4I0PA 4QRTA 4G80B 2XFXB 4Y9BA 2P24B 3K4AA 3LKSA 3NH7L 4KROB 3V4PB 2WWKO 4CW1B 3FH5A 4MAYB 4AGPA 4WV1C 5E5MA 2MCPH 2QFPA 2JJUA 4OR1A 3RDJA 2X1XR 1LE5B 1YYCA 1WF5A 5EU5A 3KDPB 4X5WA 3RL1B 2V5MA 2BXYA 1A4CA 3LN9A 1OAZH 2FZ3A 3VXUB 5ES4B 4NHUA 4R7XA 4F33A 2Z31D 1LP9F 4OLVL 1ZT1A 4JN2A 4FFYH 5IM7A 3TBYA 2V5TA 3C60A 4BFIB 4PLKD 2H3NA 2E6JA 3A4FA 5AENA 3KBFA 5IVNA 4WO4A 3SPCA 4PJXB 1S7XA 1NANH 2WK2A 1L0XA 5ICUA 2W88A 2V4LA 2W80C 3UIYA 3BUIA 4I0CC 1C7SA 3VD4A 3IPFA 1S7VB 3IETB 1Y6NR 1CR9L 4XOBA 4AH2A 4DCQB 1JF5A 4MD5B 1K3IA 4IU3A 3K72A 4JFFE 5AUMA 4OLXH 1B0RA 2F53D 3TC9A 1FIGL 1EHXA 4X4YA 1ROCA 4OZIA 2AJZB 5EEYA 3NABH 2LTQB 3B2UC 4GLRH 4LLUB 1EJOH 2PCYA 3LXAA 2Q8BH 5CM1A 3WIFB 2GG1A 2IMMA 1GC1H 4QRPB 1BAGA 1M6UA 4X6CA 2PPCA 5AB9A 3FQWA 4N2AA 4OCYH 5KZCD 3Q8BA 3QRLA 3AU1B 4ZQKB 4Y0GA 4JPVH 1F58H 1D7CA 4ZS7L 2HX9A 5T5FH 3WMSA 4YSSA 4F27A 3K91A 4QNPE 4BZ2A 1LO4H 3W2DL 1QEWB 5I0DA 4GW5A 4TULH 2B15A 2UZYA 5CJOL 4ACTA 3O2DH 4AQ8A 4K3GA 2ZP9A 1SBBA 4DP0X 1D5BB 5D7KE 4PJHB 3FQNB 2VDOH 5MEPB 5DWUH 5FHAH 5CUSH 1M2VB 1KSRA 3A6CL 4DFHA 1E9PB 5H37G 2P5WE 4URKA 3HW7A 1WT5C 4L4VA 2B59A 3DX6A 1JE6A 4DVBB 3RZCA 1QFHA 3F84A 4PJ5D 4LEXH 5I6KA 3PDGA 5KBDA 1PVHA 4HPHA 4WV1A 6PCYA 4DN4H 2V2WB 2F7IA 2C9XA 1JK8B 3QORC 2J3SA 2WQUA 4NPYB 4TL4A 4HCFA 3D25B 4Z7VB 2DRUA 1I85A 1SHMA 1SF3A 3WN5A 4YLBA 1P5VA 1H6UA 3U4BH 3GMMA 4WHTB 4K5MA 2L4OA 2J6EH 2J1ZA 2J72A 2FL5B 2DQIH 4E0RB 3S2CA 3H42L 4Y16D 4HCRL 4B9GA 2IDQA 1WA0X 3A3YB 3FSWA 5DTFB 3U7WH 3E6FA 4W9KC 1E27B 4GEJA 2I24N 1SMDA 3NFNA 2EADA 4WI7A 3C5ZD 3STLA 4G1MB 5DVMA 2G2NA 1UH4A 3PG2A 3GSNA 3DX2A 4DK6A 3EUDA 3EGDB 2FT6A 3KWWB 1KXQE 2X6UA 1IC7L 1KJ2H 1SHXA 2BVQA 2QSCH 4Z7UB 4YBHA 4FQXD 5D4JA 4FTVA 2X4QA 4WKXA 4Q2ZA 5CZRA 3J2PA 3G5XB 1FO0B 3GO1L 1NIBA 3O8XA 1ZVNA 1JI2A 3MUHL 3SJVA 1M05B 3CFBA 3HC3L 1RUMH 4DPRA 5LGHL 1NLDL 2G2PA 3KPRD 1S7WA 3WEAA 1FNSH 1CZ8L 1UUNA 2H3XC 1KELH 5IHUL 2DIAA 3R19A 2E9IA 4ZUTB 5EF0A 5H4YA 3UAAA 3ZO9A 4HWNA 4XBPA 3FO0H 3MXWL 5CD5C 2R0LH 1GZQA 2ARWA 2FTAA 5FB8B 1EVUA 1MFVA 4FZEH 1RU9H 5TE7L 3JWDH 1PGRB 4FXKC 3HZYB 4LNRA 4E5XB 4CUCA 3BXNA 1YMHB 1XSKA 4HUMB 2BIQA 5GGVY 5EU7E 1I9IH 3QULB 1JWSB 1F42A 4K15A 3WY4A 1JIBA 2UUDH 3KEDA 3IFPB 3LS5L 4GRWE 2A1WH 4APQB 1WZKA 4PRID 2RH0A 2OAAA 2P9RA 3MX0A 3GZOA 5K69A 1BFVL 4GXFA 2VR8A 2MQGA 2VT0A 1GYWA 3P3TA 1ZS2A 3CX5J 5JPMC 3AWGA 4QT5B 2OCJA 1NC2A 4R90L 3FB5A 2NY7L 4KU1A 1Z9NA 1QFWM 3CSGA 3EZ8A 3CZNA 3LRLA 2VR6A 1UKQA 3P0VH 4LSDA 5TDPB 1VACA 1JWMA 3MOAH 3IXAA 4NZDA 3ZDZB 3NSXA 4QJ3B 3WMPA 2C5DC 3LQZA 5DMKA 3G6AB 2F8IA 1V7NL 4D9QE 4YLQT 5E5UB 3DGGA 2ZD0A 3A6CH 1O6SB 3MCLL 3CMOL 3FUFA 3FCTA 3PRZA 3KCWA 4GQ9H 3ROLB 1MZYA 1B4TA 2EILB 5DI8B 5DQDL 3TN0C 5ETUB 5FO7A 3VFSB 2ZX9A 4QRRA 2D2OA 5KBKA 1R19A 3HR5B 3VQLA 2VCOA 2P8PB 4NZTL 1KWGA 4DGYL 4AQEA 1G1YA 5I0VA 4JY5H 4N8CL 1QP1A 3WEXB 1K5NB 1XF4B 1K8IB 4ZXBB 2N59A 5C0NC 4MSWB 4FJZA 4RDBA 2FRGP 1MF2H 2OZ4H 5AKSA 3DIFA 2A6KB 3GJEA 4L37A 2AXWA 5D7LB 2ATKA 5IMMA 3SE4C 3WBDA 4J8QA 3AS3A 5G5DB 1YPZB 4LBEA 2WIIB 2QQNH 2BLFA 3BP5A 1TCRB 3RWFA 3KYMB 5CJ5A 3BVTA 1ZHNA 1QRKA 2VR3A 3B3IA 1J5IA 2DQCH 1FG2A 1MFDH 2VM9A 3C6EA 3DO7B 1QHOA 5I1HL 2YGNA 4PGZA 5KANI 3UJIL 5I74B 2E7LA 3RFZC 5C0RH 3ENEA 4XOEA 1GYCA 4I48A 5JTWA 8CGTA 3SE8L 1M3IA 2N1KA 2KLSA 4L8CA 4WV1B 3CSPA 4B50A 3QPKA 3APFA 4L29A 3G04A 3NJMA 3FC8A 2R1WB 4HGWA 3IWVA 1ZLVK 6TAAA 3ELAT 1KBWA 3HG1E 4FZ8L 2NUTB 1LMKA 3QIWA 1JZ7A 3LHAA 3ILPB 2UY6A 1YVLA 3ARRA 4L1TA 5F7DB 5B39A 3WU1A 3X1NA 4J4PC 3V7AG 4XMZA 3WUWA 1UXSB 4YX2L 4JCMA 3B3IB 2M83A 5EO9B 5DA4A 1D5BA 1UWXH 1CZ8H 3K5SA 3HBZA 1RD6A 5SWSA 4AQOA 4GW5B 1YEKH 1XGUA 4XAWL 4NRXB 4NQTA 4U1IB 5AZ2H 4N2BA 3V0AC 3X1EA 4HLZG 1KXVC 3QDMB 3PXJA 3AY4A 3R0MA 1O5PA 2DI9A 3ERXA 3PL6A 1A5FL 3VCLA 3UX9B 3S37L 5CLXA 4RZCA 3SDAD 3QO0B 4JHWL 3B6SB 3V6OA 2BMKA 2ADJB 1MN4A 4PS3A 3II3A 1S3KL 4WHDA 1AZVA 1J9RA 4LSRL 2GQHA 3ZDZF 2OYMA 4U6YB 2IH8A 1F86A 3O3DB 4O2EA 5IEHA 3HN3A 1OZUA 2JFCA 3WFEL 3DYMA 3LDBB 3JWNH 2OMNA 4KXAA 5ENWB 1EAPA 3T2QA 3RTQD 3IF1A 4WNJA 1OT2A 3KPOB 3I50L 3B9KC 5C07D 4ZFGL 2LU7A 2OXHA 1FC1A 4M48H 2I32A 4JFEA 5DURD 4ZT1A 3VI4E 1T21B 3IM1A 4Q6KA 3S88H 5I1AB 2WTRA 1OGTA 3FUDA 1ZT4A 4KRPB 4XWGL 1QFWH 2X2IA 1RUQH 3U9PL 4MXWL 4M8QA 1I9RL 4KH2A 2QADB 5HYSA 1TVDA 4G1EA 4H1LA 5CSGA 3V6ZB 3UZVB 5DT1L 3L4XA 3CN3A 5FEBA 4JLRA 2WUBL 1VB9A 4IMKC 5I1EL 1F45A 1M4KA 3IRCA 4XMUA 1KEML 1M6OA 1MNUL 4DO6A 1S7SA 1ZV2A 4ZUUA 2HB0A 2ICES 4UT6A 4IRZA 3CU7A 3D87B 1KB5L 4CSSA 4LASL 5TDNA 4BK8A 5JW5A 4TQEL 1QFOA 1J8HB 4RAUB 2YLKA 4GI9A 2C4XA 5E70A 1CXLA 4JHBA 4OJDH 3FB6B 1O7DE 2PW1A 3B8SA 3FQRB 1I1AC 3FQTB 1NEPA 1OL0A 1PJ9A 1I9JH 4Y1AD 4MS8C 1XMWA 1RH8A 4OF5A 4EF3A 5HHPA 3JSSA 3LKSB 5E2WL 2WBJC 4P3DB 1T66D 2E7BA 4G80A 4Y2LA 3HNSH 2O6EA 3X13B 5K5YA 3VW3H 2GFBB 2Z34A 4Q4EA 4AYFA 4G7YH 1U2CA 1YQVL 2G9KA 4X6EA 4XPTH 5J1TC