5IQNA

Crystal structure of the e. coli type 1 pilus subunit fimg (engineered variant with substitution q134e; n-terminal fimg residues 1-12 truncated) in complex with the donor strand peptide dsf_sririrgyvr
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
132
structure length
132
Chain Sequence
AKPCTVSTTNATVDLGDLYSFSLMSAGAASAWHDVALELTNCPVGTSRVTASFSGAADSTGYYKNQGTAQNIQLELQDDSGNTLNTGATKTVQVDDSSQSAHFPLQVRALTVNGGATQGTIEAVISITYTYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Accelerating the Association of the Most Stable Protein-Ligand Complex by More than Two Orders of Magnitude.
pubmed doi rcsb
molecule keywords Protein FimG
molecule tags Cell adhesion
source organism Escherichia coli k-12
total genus 26
structure length 132
sequence length 132
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5iqnA00
2JMRA 4AV4A 4CSSA 3JWNE 2W07B 2UY6B 5F3FA 1N0LB 4XO8A 5FS5A 5ABZA 5F2FA 5FX3A 1KIUB 4X50A 4AVJA 4XO9A 5JQIB 3ZL1A 5LNEA 2JTYA 3JWNG 5AALA 5FLUA 2UY7B 1N12A 3SQBB 4AVKA 4XOEA 4XODA 4J3OH 2WMPB 4AVIA 4CA4A 3ZPDA 3BFQG 5LNGA 4AUUA 5CGBA 4XOAA 4AUJA 4AUYA 1QUNB 4AV0A 4AV5A 4X5RA 4J3OF 5IQNA 5IQMA 3RFZA 1KLFB 5AAPA 4X5QA 1TR7A 2VCOA 4BUQA 2J2ZB 4AVHA 1ZE3H 1UWFA 3ME0B 5AB1A 3ZL2A 3MCYA 4XOBA 1PDKB 4ATTA 4J3OG 2XG4B 4LOVA 4XOCA 5IQOA 5FWRA 3BWUF 3JWNH 2XG5B 3BFWA 4X5PA 4CSTA
chains in the Genus database with same CATH superfamily
1EXUA 1TJHL 1O7VA 3E6HB 1XR8B 3ML8A 3WLWD 3ZLQC 4DP5X 4OFDA 2AV1A 3GJFA 3LV3A 5GGSY 3VD0A 3L9YA 4M48L 2FJHA 3SDDA 3K8KA 1ZWIB 3TT3H 4ZG1A 2FBRA 3DWTA 4Z5RB 1OPGL 4F91B 5IWLA 4PV8B 4JFED 2BIOA 4ELME 4GW5A 3ABKB 1A3RH 4I2XE 5IMKA 5AW5B 1GZQB 2K9UA 1X9QA 4PCYA 4JFDD 4XMLL 1QI3A 5D7EA 1ZT1B 4R96B 2Q7AA 3DLQR 3MLSL 1GY2A 1P7KA 1Z9MA 2BOBA 3O2WL 2V7NB 4U31A 2ZX8A 1TKWA 1WTGT 3H55A 3V52L 4R7DA 3VD7A 4NKQB 3KPOB 3V55A 2EKJA 1D2OA 4KWUA 1E9PB 3MA9H 4AMXA 5H35A 1TJHH 5CEXA 1MHEA 2UY7B 3V6OE 3U6XS 3GDCA 1CYWA 4QGTA 2R39A 2Z4QB 4M48H 3PJLA 2WMPB 3CHQA 2J8UA 2VM9A 1RI8A 2GEQA 5E5RB 2XU9A 1Q94A 2PR9A 1OPGH 3AY2A 3I50L 3LKRA 3L54A 3FAWA 3NFNA 3U0PA 2XBZA 3II1A 1WO2A 4DVRH 2EVFA 4UU9B 4J3WA 4LLQA 4XMLH 1N5AB 1FCGA 3VGBA 3L2NA 3MLSH 3BH9A 5J9PB 3O2WH 3LS5H 3HRPA 4HIXL 3W9EA 5BV7B 3GC3A 3OMZA 4FQXB 5TDNB 3V52H 4U7SA 2X1QA 5ALBL 4IHOB 5E8PB 5FA4B 3SDCD 3SDAA 4BFFA 2EIJB 2ZKXA 4KVCL 4QRQB 3ZYOA 3O6KL 4EI5D 2RR3A 3OF6A 4BSWB 1CZ8L 1QI4A 1DVYA 1KB9J 3ABLB 1X4ZA 2CJTA 3TPUB 1ZEAL 3JZ7A 5JQHC 1TTAA 2KYIA 4P23A 5KW9L 1ID5I 2C9SA 3B3BA 3I50H 3MRLB 5DRZA 5F3BB 1N68A 1XL4A 2Y7QB 4HP5A 1QBMH 3NIGB 5HI4C 3JWDC 4Y2DD 5I76B 1IGMH 4YPGB 3UTSD 4HIXH 1O7DC 4UB0L 3U48A 2ICEC 5KS9A 5IM7A 4MNHB 1HU8A 1NGXA 1ZIBA 3ZT5A 4LDLB 2F2HA 1UASA 1U8MA 4JZJA 3O2DL 4KVCH 1ZPLA 4AZ8A 3O6KH 4JPVH 2BMKA 2BRRL 2O1AA 4ICXA 4OKDA 4WJG3 4NQQA 1PNDA 1SOQA 4KGJA 3IMTA 3SHSA 4YDLB 3IN0A 5DCCA 1SDDB 1X5AA 2XBTA 1QFWL 1ZEAH 4PJCF 5KW9H 1F3JA 1ZVHA 2I5YH 2XVGA 4TN9A 1VZHA 2AGJL 1U92A 2N1TE 4QXUL 4D0CB 2Z7UA 1DN2A 3HS0A 4M5SA 4X5WB 3ALPA 5AZUA 1JGDB 4D9LH 4HG4K 3VFVA 4BQCA 2AJ3A 4HH9A 3ULSB 1NGPL 4TS6A 4C56E 1XR9A 4JY4B 2AK4D 2ZOUA 5FYLL 5L0QB 3X11B 3GS7A 3MLXL 2NYYD 3O2DH 2GJJA 2N59A 3T1WA 4Q0XL 3RY5A 43CAA 4DNLA 2A4ZA 2BRRH 4IRSB 5E8EB 1IU1A 1TMQA 1DVUA 2UX6A 4GAAA 1RERA 2CWRA 3E7JA 1LILA 3LKOB 2V2WB 5LBGA 1G87A 5D2LA 2X7LA 1QFWH 1BBJB 3WO4B 4JFHE 4OCNC 2CXKA 3W81A 4UOW1 2QGEA 3FUNA 5I1KL 2AGJH 2WSDA 2VDNB 4QXUH 5EBGA 2DD8L 3CFBA 5ESVB 2DI9A 3TF7C 1MCJA 2G3MA 3EOAA 3FFCE 4DP2X 4WV1C 4J4PC 1AP2B 3QULB 1NGPH 3BUPA 3BSZL 2X89A 5FYLH 3QFDB 4WF7A 3RNQB 4XPFH 4I18A 4Y9BA 1G6VK 3QUHA 3KW8A 2QVKA 1DVZA 1MI5A 2XXMB 4CA4A 5I23A 4Q0XH 3QPXL 5GISL 3FMGL 1S3KL 2GPZA 2TAAA 3OHMB 4WW2C 1F2QA 3IXTA 4B9ZA 2WWMC 4OCSL 2J25A 4G7QB 5E4EC 2YPKB 4NQXA 2ERJC 4YFEA 3TJEL 1K85A 1N0XL 4ZMZA 1DLHB 1ZVSB 4Y9CA 5MENB 5I1KH 3HG1A 3CPLB 5CP7A 1A6UH 2DD8H 1ZDSA 4L1HA 2Z91A 3ARDB 4NPJA 5FHBL 4ZUVB 4DKFL 1KGJA 3HI1B 4HUMB 4CVUA 2O6EA 3OSVA 4NGHL 5F1OB 5IEKB 4H0GA 3WNPA 3SE3C 4X6FB 3BSZH 1GGBL 2VUYA 2YJQA 3T4AB 3V5KA 3PQYD 1IAKB 2VR9A 4BUGA 3BDYH 2H2SD 5IB5A 2OXGA 4F7MB 3QFGA 1SN0A 3HCVA 3QPXH 3FMGH 2L4OA 3MROA 5GISH 1ZGLP 3EZ8A 4OCSH 1LP9F 4JZOB 1ITBB 1BVLB 3TJEH 1N0XH 2JQAA 3O6FC 2J71A 3HZ3A 4FTVB 1KPVA 3QE5A 2E74C 4PJ7A 5EN3A 4OJDH 4Y19D 5DMIL 3TEWA 5FHBH 4DKFH 1PD1A 2GIXA 5J0BA 5BRZB 3PF2A 3AG2B 3MNVB 4ZQKA 4DOHB 1KB9K 4L8CA 1GGBH 4U05A 1BG9A 3MN8A 2QR0A 2CM6A 1ED3B 1CLYL 4I0PB 2OMZA 3MJWA 3ABGA 3MOAL 5FV2A 4FKKA 3GXMA 4UQBA 1CG9B 1UEYA 4GJTB 2P1YA 5JOFA 1TVBB 4I8DA 1M42A 1MY7A 2G2PA 3PWPA 3M88A 4LFHD 2ZONA 1RUPH 2C1PA 3DVNA 3VM5A 4F92B 3RY4A 1OAKL 3QNFA 3MNMA 2FB4L 4AH2B 1FNHA 4TSAL 2W65A 5DMIH 2HVJB 3VSVA 2XUWA 4QCIA 4KUZL 4JKWA 5IFHL 1HOEA 4XNZB 4PJDE 5D2NA 5HDWA 4I9XA 5GGTL 5BCAA 4ZO7A 3VNYA 1C12A 2WVTA 3BAJA 4NCC2 2BVQB 1CLYH 2ZG2A 5IB2B 1C5DB 2A4CA 1E5BA 1BM3L 3T5WA 2Z35B 3VI3A 3GWJA 4MCMA 3U46B 3DX1A 4HHAA 4Q56A 4QRUB 3DX9A 3RZCD 5C09B 4FTVE 3BZ4B 3FB6B 1OAKH 4J3OH 1R24B 3KL3A 1MCCA 3S5ZA 2FB4H 3FFDB 4AVIA 1ET5A 2VABB 3JTSA 4KK8D 4KUZH 5BRZE 4MLSA 1AHKA 1E5CA 3QJZA 2LAGB 3QJFA 1AO7D 1NSNH 2CBOA 3O41A 5GGTH 3LQZB 5BW7A 2D7QA 2O5XL 4P2QD 3C60C 4Y1SA 3C6EA 1BM3H 3B3IB 5HY9B 1JGEA 1JMZA 1G1OA 3EW3B 4IIQB 4I4WA 3HE6D 2FQGA 3MLVL 4I2XA 1EAPB 1EXGA 3ZJAA 4ELMB 4G8IA 3K0YA 1UVQB 4XGZB 2A9ML 4I0CC 3S4SA 1J0JA 2ENQA 4ALAL 3W39A 1DBKL 4P2OD 3ZSTA 2JXMA 1RL1A 2HG5A 1JGVL 4ZUTA 4FDWA 4JK0D 1S7UA 4HUXB 3V6OA 3BCFA 5E4AA 1PQZB 5BS0E 2NYZA 2OCFD 2Y1YA 5HJBA 3KZ8A 2O5XH 1I1FB 1MPAL 2P48B 2QLVB 4IGBA 4J6RH 2PP9A 2AJZB 4LLWA 5D8JL 3RDTB 4L9LB 5H2BB 4QRSA 1J10A 2FDBP 4LCCB 3IDYC 2P43B 4L9DA 1D5ZA 4FJ6A 2VN7A 5DQJB 1U3YA 2XWXA 3MLVH 1H6UA 4HPHA 2C26A 3H56A 2X9ZA 3QYCA 2OA9A 4AC4A 3OSKA 2A9MH 3CSTA 3FB5B 1T66C 4MD4A 3SJVA 5A3IC 1DBKH 4RMWA 1FL3A 4UQ3B 3VFRA 1RZGB 3S36X 3PL6A 1B4RA 1ANUA 4KTGA 5E2WL 4JJ5B 5GGSB 1JGVH 4DGYL 4V1DE 2WQUA 5EUOF 2OLDA 3EYVA 1XR8A 2G60L 3AUVA 4FQJL 3DV6B 3CFEB 1MPAH 5AOLA 2A9BA 3FHEA 4EBQH 5D8JH 2IVFC 4LVHC 5BZZA 3K4DA 2E7BA 1GYWA 3IDUA 5AVZB 1DQIA 3ULUF 4JPKL 4XP5L 5DSCB 3WXWL 4B9FA 3U6RB 1GZQA 2JJTC 3GZPA 4WU5A 4YAQB 4YSPA 1KDIA 4N2BA 4Q58C 2VOTA 2IAMA 1MJUL 1U4FA 4XO5A 3I6LD 2NY1D 2WOYA 3MRKB 2Z31C 4NNXB 4XX1G 1UGKA 3DSNB 2ESVB 3KPOA 1X5MA 2F53D 4DGYH 1FC2D 3ZKXB 4L37B 4Y4KA 1SN5A 1MQKL 5CZXC 2G60H 4ODWA 4F58L 2AZUA 3BLPX 3GMPB 2Z4QA 3QCTH 3ARFD 4Q2ZB 5HSFA 1AQHA 2NLJB 3IU4H 5E1AB 5FYJD 1DFBL 3DV4B 3GIVB 4DN4H 5EIIA 1WEJL 3KWWA 2FECI 4WW1A 2VAJA 4XP5H 3QDJB 4MVBD 4Y5YA 3KPTA 4Z3TA 4CC0A 5JIDA 4DGIH 3EF7A 2OR8A 2Y3AA 3GXDA 4NQUA 4MZIA 1N5AA 2B1HL 2YEQA 5CCGE 1XIWB 1MJUH 3VXMB 4XOAA 5DD1H 4C56A 5E8PA 4YWGL 4HWBL 4YDIL 2EDXA 4WFGD 8PAZA 1XGRA 4QRQA 3IS1X 4S1DC 2P80D 4F58H 4NQVA 4WHYH 4BSWA 3F5WB 1GGCL 1EVUA 1EHAA 5CF3A 4RZKA 3TPUA 2WAQA 1DFBH 3D5OF 3P4OB 1W72B 4KJQC 4Q4EA 1SVZA 1WEJH 3K4ZA 1NMCB 2BWIA 1Z1WA 4LLMA 5F3BA 5SWQB 3AU0A 2Y7QA 3DO3A 4PJCE 4NO5B 4FQQA 1H15A 4WFHE 2GUYA 3FFCA 1QTPA 3TASA 3W5MA 1XMWA 4H1LH 3BAEL 1Q4NX 2ESVE 2GSIB 3MLUL 4YWGH 2WQVA 4HWBH 4YDIH 4ZBJA 2OW6A 3EFDL 1ES0A 3T0VA 4QJ4B 1GGCH 4AIZB 5D7JD 1NAKL 2XN9E 3FN0L 3EOBA 5JHDE 3Q2VA 2AVGA 2Q8AL 1BQHA 2OP4L 2EYTB 2H1XA 4X7EC 4UM8B 2VLKD 2Q3XA 2H6PB 4J3VA 4MJ2A 2JKXA 1F3RB 1WZLA 2OULB 1JGDA 3T04D 1SDYA 2HT3D 4QHKJ 3VXME 2IFFL 1IBDA 4QXGL 3ULSA 3V0WL 4NFDA 1CDIA 1ZHBA 4FI8A 4TMPA 3BAEH 1GCFA 4OZGF 1ZDQA 2V4LA 1OQXA 4A55A 5AOIA 3I75A 1FYTB 2WSKA 3GMMA 4DK5A 1SY6L 3EFDH 5E8EA 2XQYG 1S7TB 2AQRA 4N6RB 2GI7A 3LKOA 2WUCL 3WMSA 1NAKH 2V2WA 1NDGB 2DQGL 4M29A 5IT2L 1V8HA 2OP4H 4F3FA 1L9OA 2DL2A 3MYZA 5A2AA 1JTPA 2AJUL 1A1OB 1JNNL 3D3VE 5ESVA 5ANHA 2L7QA 4PBXA 3MFFA 4I9WD 1L9TA 3F2LA 2IFFH 1YEFL 4QXGH 3V0WH 4OZIF 1G0XA 3EYUL 1MXGA 4JKMA 3VU1A 3DMMA 3GLZA 5CZRA 1NANH 4HF5L 2CLRB 1QATA 1VFBB 2W0KA 3IK2A 4PGCA 5GZND 5I1LA 1SY6H 3HZYB 1SXSA 4DP7X 2YPVL 1KZQA 4CJ0A 3K2MC 3ETSA 1CIUA 2WUCH 5E0FA 1Y07A 1KCBA 3B2VL 2VM3A 5IT2H 3ZE2B 5AG9A 5T3XD 4LIQL 4U1MA 5GGRY 1LP9E 1ZVSA 3DOHA 5LQBL 5MENA 4MZ3A 5DJAB 3LN5B 2AJUH 3BGMB 4ZYKB 2XC8A 5C8JB 4FMVA 5DD0H 1OAJA 3BZDA 3CK0L 2CO7A 3GSWB 3HI1A 2VXUH 3LIUA 4HKZB 5FGCE 2FHFA 4MBRA 5IEKA 1E8WA 4HIJA 4U6HB 4PJDA 4HOXA 5T5FL 3TONA 5GS1C 1ZLVH 3IJHB 4RMRA 5I2IB 5I5RA 4WNQB 1QLFA 4BGDA 4HF5H 4GLRI 1YEHH 4F7MA 2RCSH 1UCBL 1MCOL 2WIIB 4Z77B 2YPVH 4WSKA 1ZE3H 3DYPA 5L2KD 3WKML 1K4CB 3B2VH 1P4IL 2HJFB 1IIIA 2M8XA 2VQ1B 4HJ0C 1NAML 3AQYA 4FTVA 5LQBH 3PG2A 3FU6A 3H0TA 1DQTA 3VGFA 2G75A 3U2SA 4LQ1A 4NUGL 5BRZA 5D7SL 3LN4B 3P0GB 4X7SL 5GS3A 2YGPA 1JZJA 3F65A 5AOMA 5T5FH 3EYQD 4ODTL 4WJ5A 1UCBH 1A9BB 1MCOH 4ORZC 4WWKD 4MJID 1HXKA 5H37A 1UFGA 3LEYL 4XPBL 3S35X 3MJ8B 3WKMH 1TENA 3OC8A 3VXTA 1P4IH 3QQ9C 4OV6F 1WA2X 1J1PH 5L2JA 5CAYB 1RZKL 3K81A 1YEIL 2NZIA 3JV6A 4JFFB 4AYID 2HVJA 4NRXB 5MEOB 4L2YA 5C71A 1T4WA 2DM7A 5CLWA 3WTWA 3LHAA 1SJEA 4X7SH 4YC2B 2ZKWA 2ZUXA 5BS0A 1OGAD 4W6WB 4JO2L 2BVQA 4ODTH 2XA3A 5IB2A 2VDMB 1C5DA 2JKSA 3DKHA 1GC1C 3IE4A 3KPPA 3LEYH 4XPBH 4KZCA 3APDA 3PIQB 4ZAKA 3D4CA 3Q6FB 2W0PA 3KL5A 1KEGL 4HLJA 3TA3B 1KLFA 3BZ4A 2PXYC 1RZKH 2ZCHL 5CJXA 1R24A 2AW2A 2HJLB 3G6JB 4OUUB 5EU3B 3GSUB 1KCSL 4XOEA 3AMKA 2W60B 3B2UC 4TSBL 2KZKA 3CNKA 3HI6L 4N2FA 4UT6A 3FFDA 3UAEA 3VFMA 1SXZA 4RAHA 3D50A 1K3ZA 3BN3B 1UCTA 1NBVH 2DEWX 3B5GA 3ILQC 5CJQL 5F1NB 5KUMA 4TNGA 3LQZA 2OCJA 1NIDA 4JO2H 5G4NA 4YX2L 3GSRB 1RJYA 4PYGA 3ZZQA 4KRPD 3NSJA 3U36A 4ACTA 5HY9A 1QSEE 5BVJB 3CTTA 4K8RH 4IIQA 1CE1L 2D31B 3RY6A 1XSOA 2W9DL 1J9QA 1BMZA 2P5EB 1KEGH 2DDQL 5IB3B 2A0LD 2D7TL 4JFSA 4Z7VB 2H7WA 2ZCHH 4OM0H 1KCSH 4OFQA 3FQ2A 3HI6H 1JJUA 1FUNA 1UB5B 1MCDA 3P2DA 1WBZA 2H26B 4QHPA 5KTEH 5KOMC 5C0ND 1F11B 1JF1B 5CJQH 4NN7C 1NGWA 1UD6A 4PJIB 1LK3L 1PQZA 2FZ3B 4N5ED 1IKOP 4YX2H 1QBBA 1I1FA 3RWCA 3QIBC 3RDTA 3H9SD 5H2BA 4K23L 5EG6C 4L29B 4TOYL 3KGRA 4OQ1A 4XNMA 4LMQI 5DQJA 1CE1H 1EFXB 2ZUWA 4P5TA 2W9DH 5D7KE 5DQDH 5INCA 3T9WA 2DDQH 3ULUE 1BPLB 5JOPD 2D7TH 1T03L 1NOLA 1GTNA 3BFOA 3MNZA 4KNSA 1CFVL 1UWEH 4UQ3A 4FFYL 1EUUA 1I7TB 4R83A 5E24E 5DJYA 3FUJA 5GGSA 5IJVB 3R8BB 2Y7MA 2PCXA 3KLAA 3PV6A 1A6ZB 2R1XA 3DV6A 1LK3H 1WBYA 5EB9A 3A22A 2EKSB 2UZPA 1D5BB 1KB5B 3EF4A 4ONHB 1G7LB 3HI5H 4XZ4A 4K23H 3RAJL 3TBYB 1JL8A 3IWUA 3NCYP 2P3YA 4NCDA 4POZC 4TOYH 3FOLB 3KL0A 2YAQA 5DSCA 4QRFA 3O9WC 2DQHL 2E9GA 5FA3A 3U6RA 4EQ2A 3CUPB 4PJCA 3SDYL 4A39A 3S48A 1UZ8B 4PS7A 3GIZL 1T03H 5AW6B 3ZGIA 1RZQA 3FF7A 4JR9L 1CFVH 1CTMA 4OCLC 1OP9A 3SPCA 2L8AA 3ZL4L 2HN7B 3D52A 2GTZB 1S78D 3D0LB 3IMRA 4FFYH 3DSNA 2ESVA 5MI0C 4RSYA 2HLFD 2A6IB 2LTQC 3MRCB 5J3HC 3GMPA 5DJ8B 3KWUA 4FADA 2YFOA 4YXKL 4CDGC 1FVDB 2B08A 4KKRA 4DKAA 3GIVA 3DV4A 3EHBC 4HWEL 3RAJH 1LE9B 2XQBL 4FHKA 1IVLA 3F7QA 5E6RB 1CGUA 2AZAA 4R90L 3J27A 3T8XB 3L81A 3RL2B 3MLTA 2PTVA 4AM0B 2BM3A 2EDDA 2EXTA 3BH4A 3SDYH 1H3PL 4PSPA 3WO3B 2YWZA 4APQB 4JR9H 4Y2NA 3VXMA 5GZOD 1F8TL 1YG9A 5FYJL 4MNGB 3ZQ9A 5CGBA 4NO3B 1OB1A 1OWRM 4M1DL 3EH2A 2X5PA 3TBSA 2QHLA 3L13A 3MGTB 3V0GA 3RKPA 4H13C 4LESA 3B9EA 3MRIA 4AW4A 4YXKH 3P4OA 4FFWC 1W72A 4HWEH 1HHIA 4J5VA 2XQBH 3HMWL 1OXYA 5GGUB 1B6UA 3HG3A 3H2QA 3L6FA 1HE8A 1O9VA 5FR3A 3D3VA 1H3PH 4NO5A 2ARJQ 3II2A 1KWGA 7PCYA 3VWKB 3U1SL 2LLGA 1MUJA 2A6DB 1F8TH 2VQTA 2Y23A 5A2BA 1RZIB 3L3IA 5B4MC 3L5XL 4M1DH 2DWDA 1RULL 3FRPB 3RYMA 2J5WA 3T0ED 2CBPA 2Q86B 5JW4R 3ALXA 4AIZA 3FU3A 5I6LA 4FXKB 1A6PA 1XAUA 4IKLA 3SE4C 2EP6A 3BVDB 3HMWH 1NMBH 4MXVE 2YN3A 2EYTA 4JFYB 1LP9A 3GXTA 3G9VA 1AHWA 4KY1H 4UM8A 4WNSA 3U9UA 5I16B 1MREL 5ITBL 5EZOL 2H6PA 4JHBA 1NKOA 4MD5B 3QFJD 4JPWL 2J7LA 2BP0A 4OTXL 3PFQA 1X7QA 4DTGH 1PKOA 4JO1L 1N5YL 4MNGE 2O5NA 1R5VB 4PRHB 1V27A 3DIDA 3L5XH 1KEMH 1IX2A 5DZPA 2NXYC 4AT6B 2Y7OA 1L9QA 1M9WA 3RI5K 4IRJB 2E7MA 2X4SB 3IGFA 43C9A 4IOFD 1B88A 2BCKA 5IVZB 1INQB 5MHSD 1J8SA 1D5MB 1NDGA 2C7UB 2H2PD 4FNSA 3A0OA 3LY6A 4FNUA 4KHTL 2CJSA 2JVUA 4PRDB 1MREH 5ITBH 5EZOH 3ZE0B 5CN3A 2JE8A 4JPWH 1N8OE 3UO1L 4OTXH 1Z66A 4L4VB 1U3HD 3GEWB 4JO1H 1N5YH 1KIRB 2GB2A 4BSVA 1CDCA 3BN9C 3IMUA 5ID0B 3WJMA 3UAFA 1MLCB 5D93C 2C5DC 3G5VB 5DHXB 1IZJA 3H7BB 3ZHLA 1Q72L 1I1CA 2D7MA 5CIPA 2WXQA 4LO9A 4PRPB 4KHTH 2OKMA 1FN4A 2W88A 4IJ3B 2NXZD 2FSDA 1KJ3L 1P2CB 3VFPA 1HZKA 4HXBL 5C8JA 4IQHA 4K7FA 3KCPA 5EF1A 4E9RA 4ES9A 1JRHH 2ED9A 3GSWA 3QXAB 4JL2A 1DZ0A 3G5YB 4U1LA 3V4UH 1UHVA 4Q9CA 2AXFA 1G7PA 1PZSA 3BESR 4HPOL 4IK7A 4PRHE 1X3DA 1ITCA 2AJXL 5FC9A 4WNQA 2A9CA 4PBWD 1BZ9B 3SKOA 4KKBD 4OT1H 2JKNA 2JI1A 4LB8A 1J8HE 5SX4I 3JUZA 2VLRD 4G1MB 3D2UD 2XLLA 4N0CC 1CT8B 2AFNA 1EZLA 2PF6A 4LRNH 3B8SA 1WCQA 2HJFA 3AWGA 1S5HA 2QV2A 3SGEH 1H6EA 3B9AA 1OK0A 1KJ3H 3FU0A 5TQ0L 3ZE0E 1JYXA 3RWIB 1S9XB 2HZHA 4HXBH 2X1WL 4PJ8B 2C4XA 3BEWA 3LH8A 3K8MA 1P5UC 1Y1UA 4AQEB 3MNWB 4WDIA 1IGJA 1WK0A 3QEQB 1W8OA 4GKSA 1SN2A 3IDNB 3BC9A 4HPOH 2VDOL 2VLJB 3K6FA 1BZQK 1I85C 2AJXH 2R2BB 4KQ4L 4PRNB 1I8UA 4P46B 2BXYA 4TVPE 1NCBL 3T3PF 4X6CF 1QSEA 1SHWA 1XAKA 4YHMH 3MO1B 3AGWA 1GGYA 1YYLL 1QWHA 4X6BB 1O0VA 1U8OA 1WAEA 4LF3B 3VWJD 5TQ0H 2DOCA 3RGVB 3NZ8A 3HFML 1CFTA 3ZTNL 2BNRD 3QO0B 4MAYB 4NRXA 5MEOA 4AYBA 3PS6A 1SDAB 3MV8D 2IH1B 4RZCB 3NJVA 4L4TE 2R0LL 2WYIA 4RETB 2VDOH 3QEHA 5GRJL 5EEUA 4JRYB 4KQ4H 5EPMA 4D7PA 1VCAA 3FUFA 3MBEB 1W8EA 1ZHLB 3MV01 4ZX6A 1YY9C 2YC1B 5ABZA 1NCBH 3B1TA 1N64L 1TTCA 1ZLUK 4C58B 4W9LC 1VF5C 3OR7A 1IGCL 1S7RA 2F58L 4B96A 5CJOL 4GEIA 3EGSB 3MRHA 1WAAF 1E28A 3P73B 2N0MA 1NL0L 2AXHA 3Q6FA 3BUTA 1HS6A 2HLAB 4GXUN 4QWWC 4X9FA 3TA3A 4ZFOA 2Q7YB 4BHUA 3G6JA 3N1GC 2F54D 3N9GL 5D1XD 5HBBA 3F00A 2W60A 3U4AA 3HFMH 3ZTNH 4FYQA 4HUVB 1TVHA 2NY3C 3RVVC 1QVOA 3BAIA 4F7TA 1RURL 1WD8A 4ANWA 1CICB 2YS4A 5DT1L 4FQ1L 3H85A 5F1NA 4OI8A 2R0LH 3UAJD 5GRJH 1MFDH 1SJHB 3HZVB 3MRPB 3LKQB 3KYOA 1N64H 3WNNA 2IXQB 5JYMA 4X8GA 1IGCH 2LV4A 4HS3B 5CJOH 5AVWB 5D1QB 1E0OB 5C08E 2X9WA 1NL0H 5IBUG 4JFZL 1U93B 2LQRA 4MDIA 1TLMA 2ZT9C 2LVCA 1JV5A 3EFFB 4Z7VA 4IDJL 2EDOA 4B9JA 3N9GH 3SPVA 3S8FB 2MSPA 1NLDL 3DOSB 4PB0L 5TFSL 3PGCB 1NKGA 3RA7L 4DVBB 1UB5A 5F44A 2H26A 1T5WB 1RURH 2XG5A 3UMNA 3U7YL 1MVYA 4KDTC 4FQ1H 5DT1H 3WMQA 2ZP9A 4A04A 2FZ3A 3O4LB 5FDWA 3K2IA 1QPPA 4TYUA 3ME0B 1JVLA 5I74B 3ZL2A 1WHOA 2DJSA 2DMCA 1TVDA 5GRZA 3HE7D 5DQ9A 3QUZA 3LRGA 1PU0A 3D06A 3GTVA 4G6AC 4JFZH 4IBLT 3VXOA 2W0FB 4BUHA 3IT8D 4HZLA 2VXSH 5B8CC 3DARA 4LSRH 1DYZA 1NLDH 5MEPA 1G1KA 4PB0H 5TFSH 3RA7H 5HDOA 4ILDA 1UKSA 2XPZA 3ULUH 3U7YH 2Y6TE 3N0PB 3NJGA 2OX5B 3DRQB 2WK2A 4FLHA 3VXUD 2PO6B 2FHBA 2EKSA 1KB5A 4FQPA 1AQDA 1G7LA 3JTBA 5HDLA 3TBYA 3P4NB 4AXWA 5T1LB 5HYQB 3R7RA 4OZHF 3FOLA 3V8CA 4XC1H 3QG6B 2ZUYA 5F1IA 3GMRA 3A4DA 5DMYA 3CUPA 4OLXL 3DI2B 2KLTA 4DGVL 2IBBA 3VFUB 3C6SA 3EAKA 1RHHA 5FW8A 2IH3B 3W11D 3L8QA 2IH9A 4CKQA 1UZGA 3D0LA 3EJSA 4PJAF 4FHJA 1YEWA 2A6IA 1FORH 3J7HA 1CF8L 4RNRB 4WO4D 4R0LA 2DTSA 3O4LE 3BD4A 1P7HL 3TN0C 4N1CA 3I02B 1FVDA 1GCYA 4JZNA 1LE9A 5EZPA 1FH5L 3LKPB 4G8GE 1DSFL 3T8XA 1JF6A 1IARB 2FTAA 1VACB 4N3TA 4OLXH 4DGVH 2NNRA 5I8EB 5FB8B 1YUHA 3EO9H 3GTTA 1I7ZA 1CD8A 3NRPA 4HZ1A 4IRZL 4XN9A 2BERA 5G5DA 3CQQA 4IMKC 2PWDA 1B3IA 2MCPL 4MNGA 5LBSL 5AOKA 4DEPC 1IRAY 2L7UA 1FLTX 4XVJL 4Y16C 1CF8H 4H8HA 1HK6A 4BIKA 4F1ZA 4R97B 3PHQB 1LNUB 3DDFA 1G0YR 4X0KA 1DVTA 1DSFH 2R4RL 5GRWA 3I9AA 2C9XA 4D9RD 5FFOA 5SWSD 8FABB 1J7VR 3FH8A 3OHXA 2P7TA 4AKQA 4Y4FD 4X5XB 4ANXA 4FKEA 3VMPA 4D9QE 3VWKA 3MRRA 1PBYA 3HB3B 4IRZH 1NFAA 1BXAA 3WNKA 4F7PB 1RZIA 5LBSH 5D7IF 1TQSA 4ISVA 4X9GA 4P9HC 3V8OA 1NUFA 5CSZB 4XVJH 4YSSA 2WV3A 5JLZA 3FRPA 1A25A 4ZODA 3DUHA 3GUTA 1YUKB 2Q86A 3GBNL 3GSNA 3TWYA 2G30A 3FKUS 1BDYA 2R4RH 1YRKA 2VN3A 1ZLWK 3WUWB 4JFYA 3D7PA 5ISZE 1DEEB 2YXFA 2AERT 5FK9A 1XO8A 3DHMA 3GRBA 1SMDA 4MD5A 3B6SB 4F9PC 3P02A 5ADPL 3D0AA 2RTTA 3ZRSA 4LKCB 3HHMA 2PW2B 4H8PA 3T65B 2F5AL 4KI5D 1R5VA 4PRHA 4W70A 5LAPA 1L7TL 1JBJA 5DO8A 5BQDA 4AT6A 3JTTB 5AW0B 3AB0C 2D8KA 4BFEA 1J8HA 2A83A 3LS4L 3SDDC 3QH3B 5IVZA 1INQA 5CN2A 3ZMEA 1D5MA 4MASA 5I6MA 1GS6X 3WIIH 5IWLC 1Y6NR 1I3VA 2NY6B 1AS7A 5T3ZD 4IOSA 3OR6B 4GRLC 3U7WL 3O0RL 1D5XB 2LU7A 4YZFF 5I1IL 4KRLB 3CBJB 2X44D 4JMNA 3FCBA 1RFDL 2XY1A 3Q01A 3DGGA 2ZOWA 3G6AB 2PYFA 3R06B 3TBVB 5FIEA 4W1TA 3PP4H 3DXAB 1QFWM 2F5AH 2X4OB 4FJYA 1FNEB 4MNQB 2WN2A 5ID0A 4GRWF 2Y6SC 4Z7WB 5J11C 1MW2A 1MHPL 3L2LA 3G5VA 3C12A 2COVD 3RWJB 3BISA 4P59L 3LS4H 5G55A 4P4KD 1BYPA 5GGRA 3H7BA 4CNIB 3WHXA 4L8SC 3GSOB 2CDGB 1UENA 4A7GF 2DIEA 3U7WH 1TFHA 4Z7OB 3O0RH 5EEVA 3S88L 4H40A 1L0QA 4FFTA 1RFDH 5D70L 1JFQL 1K8IA 5DHVB 2Q0ZX 2CJ3A 3UMTA 1VKXB 4FFVC 3VQMA 4K73A 3S5LA 5IF0B 2VZVA 3ARED 4LK4A 4IKNA 2IDUA 4L4TA 3PWLA 2PWFA 1EX0A 4AV5A 3SDAC 4E9SA 4JVUA 2EEBA 1S7SB 1M2OA 3VTAA 2B3IA 3TBCA 1ZA3B 2A74B 2JIXD 4P59H 2MOVA 4LL4A 5IHZB 4ZMOA 3QIWA 4AMWA 3K46A 3PWJA 3S7GA 5D1ZI 4P23C 3T3PE 2VZTA 5J6SA 3BE1L 1SUJA 2AP2A 1WYJA 1UYWL 2XTJC 3ESVF 3FTWA 1XFPA 4I48A 4OFYD 5B1KA 4AVHA 4JUSA 4H1LB 2DV6A 5C9JB 4OCMC 5D70H 5KSAC 1JFQH 1ICTA 3RWIA 4PJ8A 2WCGA 4BDVB 1K3IA 5IMMA 1DVFD 4ADJA 4GW1B 4AQEA 1GKOA 5H37G 3IDNA 4MNQE 2UY6A 4IS6A 4MX7B 5HHXL 2WKLA 1M05A 5T1MA 2MPAL 4JZJC 3OKOB 4NAMA 1DQQA 1TMCB 1JWUA 4H2CA 2G9HB 3N43F 3C09C 3SDCB 5AWNH 1DJWA 3MO1A 1F6AA 5C08A 5GRYA 3HHSB 2E76C 3FO2B 4BFOA 4A37A 3FZUD 1PVHA 3BE1H 4JFXA 2J5LB 3UDWC 1E27A 1UYWH 4GAFB 3IGAA 4X6BA 1T0PB 4F5CE 2YAEA 5A2JH 5A2KH 1OIOA 4D0BB 3RTQA 3H6JA 3HS0C 4B50A 4NQSB 4JFEE 1MW1A 3QWRA 3T8MA 3CMOL 4B41A 2XZQL 4FI7A 4EDWH 4L3ED 4JFDE 4JHZA 5D5MF 4JRYA 3JUYA 1M7IA 5HHXH 2IPUK 2MPAH 3MBEA 4R4BA 3FSWA 3V0DA 3T2PA 2YQ3A 5BJTA 3MRGA 4NIKB 1UACL 2VTFA 2H0EA 4HFUL 4R4NC 1E5UI 3P73A 2P28B 2D7PA 4MA1B 2E7DA 2HLAA 4QAWA 3IF1B 1LL1A 2E56A 4U1GB 5IVXB 3SBQA 1OAQL 3MRNA 1IZKA 5LGKA 5F7HA 4HUVA 3CMOH 4HALA 1T3FB 5K9KA 2YMOA 5EU4B 1ASQA 1CICA 2NDFA 5I1HL 1MRDL 5C97A 4QRRB 1V54B 4OQTA 3CZEA 4I18C 3HZVA 1SEQH 4UT9A 7PAZA 3LKQA 3P4LA 3P54A 4EQ3A 2AK4B 1UACH 2DYRB 1X5GA 4PG9A 4YDZA 2FWLB 3EKCA 4HFUH 5D1QA 4Z1PA 4GW4B 5BOPA 5F71A 3ZDZF 1PDKA 2ZXAA 1A4BA 2WO4A 3F6IA 3WFHB 5D1ZD 5IJDC 1E2WA 3FT2A 1W0VA 4Z95L 1OAQH 4ZUSA 4CW1B 3AY4A 4W4OC 3DOSA 3NRQA 1WH0A 4DVBA 1KIPB 2H3KA 3EYOB 4LLYB 4EUPA 1T5WA 1OARL 4FN0A 5E56A 2A6KB 4OJFH 3C6LD 5I1HH 1MRDH 3PHOB 4NC1C 5IHWA 3FUKA 3O4LA 3UTSE 1QW9A 4MQ7B 3CJJA 2YPLD 3OB0H 3NP3A 2IDSA 3ME0A 4G8GA 1AAJA 1T2QL 4QHMB 4AV4A 4FQHA 2DF3A 4D94A 1C5BL 5TDPA 4KJPC 1PLBA 1VSCA 1DJXA 2G5UA 3EJCA 1VRSA 2QVIA 3EYSL 5FHAL 4Z95H 1DUZB 1KYAA 4U3HA 5DEGB 2VZ1A 3WN5C 3TL5A 3L3JB 4GIPD 5EBLA 3S37L 2MMXA 4KHXL 1OARH 4F2MB 1GGTA 1IM9B 1EV2E 4PJAE 2OX5A 1RK0A 5DFVD 2XDHA 1EJOL 5KVFL 5F7MC 3GK8L 5HVHC 1NAMB 1FNAA 1PY0A 5DVOA 1OF0A 3S3JA 2AK4E 3FF8A 1W6LA 1T2QH 2B4CL 1NFIA 1WZ1L 5E7FA 1C5BH 3G04B 3SD2A 5FHAH 1OTSC 2IBZY 3GRGA 1T20B 3W38A 3KLHD 3TWCH 2FRGP 3RIFF 3E0GA 4PGZA 4UTCA 1CI3M 3BD5A 2V2XB 2E27L 2J1KA 3VXRD 4HX1B 4KXCA 4B3VA 3WY2A 2D0FA 2XZCH 4PYHA 5DZOA 2OMNA 3CN4A 5EUKB 1AI1H 1RZFL 1EJOH 3O8XC 5EOCJ 5KVFH 3D85D 3GK8H 3WHE0 2X6AA 2Z8WC 2XIDA 5D4IA 5F7WC 4RGND 3LKPA 2UZXB 3PXLA 4JL1A 3MYJB 2UUDK 3FH5A 4CU6A 5ISZA 5I0WA 1WZ1H 1VACA 4QNPF 1G4MA 5FB8A 4AG4L 3CGTA 1TLKA 4OFIA 1RZ7L 4KROB 4M7LT 5EIQA 4HK3J 5DLLA 3SOBL 4CVXA 1MFBL 3UTZA 2FUQA 3RWDA 3UG4A 4ZMVA 2BSDA 4YK4C 5D7IE 5BW7C 1Y1DA 3E6FA 5EFIA 1RZFH 3FU5A 2YUVA 3PHQA 1G9ML 3UGUA 5L4JA 1MFMA 2SODB 4QUOA 5BRPA 2Y3NA 3PQYE 3B7YA 4XBGA 3SQOL 8FABA 2QADB 3QAQA 2O5ZL 2DRUA 4DO4A 5I1JL 4AG4H 2IGLA 2X3BA 4Q97A 4PLKD 2MKWA 3ESPA 3V6FA 3WS3B 4XTRC 4Y89A 1IFHL 1RZ7H 3RG1C 1YC8A 1MFBH 1C7TA 3P9LB 3FK3A 1NGYB 5K39B 4F8TA 5CSZA 3ROLA 2XWEA 4K3DL 4Y19E 5E6UB 4AYFA 4G6FD 5KZCD 4GXUM 4HGMA 3BWAB 4IGBC 2P44B 4UNTA 1W91A 3DVGB 1G9MH 2XVKA 4R7NA 3V4PB 1V3MA 1IAII 3HLAB 2CXGA 2X6MA 3WTTA 4P2QB 1J5OH 2ITDA 4KKCC 1DEEA 4WK4B 1FFQA 1YECL 3OKDA 4FG6C 3SQOH 3ZUCA 4YHLL 2BIMA 5F6HI 1VADB 2NY2D 4K5MA 1JERA 2O5ZH 1KN4H 2WLIA 3B6SA 5I1JH 5JA9A 3B7RL 4YZFE 5D96C 5AEAA 4OJAA 2JB5H 1B4TA 2PW2A 2E8YA 2Q2EB 3PWNA 3PL6C 1TTGA 2IMNA 1OL0A 4O4YH 3V6BR 3O3EB 2D2CC 2AEPL 3NPSC 5D9SA 4P2OB 3BLBA 4U1IB 3JZYA 4K3DH 1PCSA 1UA6L 4MRBA 1A7BA 2X09A 3LH9A 2NR6D 4ZFGL 3S6CA 3E8VA 5DS1A 1M1XB 2P8MA 5HDRA 5HHMD 3GMLA 5DUJA 1NEZA 3QYNA 1M7DB 2YGOA 4ELKB 1D5XA 1YECH 5CU5A 1U8IA 3BIBX 4YHLH 1WISA 3T2NH 5F88B 2HB0A 4MZ2A 2IAMC 3ES6A 4QYAA 5CMAA 1RQ5A 5B39B 4C4BA 1BZOA 3BRDA 2VIRB 4I7ZC 2GJ6B 4MNQA 1DVSA 2AEPH 4S2SA 3Q05A 3QHZL 4MDRA 4Y4KC 5J4MA 2XWTB 4CSPA 3RWJA 5CCJA 3QRBA 2IADA 1TJGL 1P4BL 3QJRB 2EUWA 2ZSWA 2AI0L 3FO1A 5F7EL 1A02N 1HWWA 4GRMA 1AO7E 2APXA 4MHHG 5LHDA 2HRPL 4P2QE 4Y5YC 1BHGA 2ZUSA 2MFNA 4PV9B 4XCYB 4F5CA 1Q9WB 2FAUA 3C87A 2ZE0A 4G42B 3ZYJA 5DHVA 4X99B 4N26A 4NT6B 4JFEA 1WC7B 4YBLC 1NCIA 1U3NA 4HMDA 5CLZA 4HAGA 4WI9A 1DDHA 2ZSVB 4JFDA 4R9HA 2ADIB 1LHZA 2QZ5A 1XVSA 4MXQC 3MR9B 2XIBA 4AUJA 1NH6A 5B3JF 3QHZH 1Q90A 4PWKA 1E2ZA 3QXVA 1TJGH 1P4BH 1IC7L 2F53B 5IHZA 2AI0H 5F7EH 3VO0A 3RVXC 4M3HA 2HRPH 1VFUA 5IB4B 2WQSA 1S7XB 5C9JA 2IBZX 1R3JB 3VI4E 3W57A 1JZ6A 3BIAX 1UUNA 3CAFA 3TO4D 1YPZF 4GW1A 4MMZA 4FQCL 5DHMC 2WBJC 2ZJSL 1LQSR 1PZ2A 2L04A 2XCMC 4MX7A 1Q0EA 2FEEI 4W9GC 3DX2A 4PMEA 3OKOA 3FHQA 1EBAA 3POHA 3DA0A 5D5ME 3D18B 1IC7H 3GO1H 4ENED 2HP4A 4KTDL 2FLRT 3APCA 1FZKB 3SDCA 3VFSB 3QVAA 5F9OL 4YNYB 1CURA 2ZWSA 3JWNH 3NSFA 3FQUA 2Z64C 5B21A 3L08A 1GW0A 2R2CA 2H0PA 3MJ7B 3GYRA 4D0BA 4HDIB 4U1JB 1BFOB 1T0NA 3BZ5A 2MCG1 2XWJA 4K7PL 4NQSA 5BOJA 3OXSB 1XF5A 4BZ1H 3MV9B 4WI0B 3KPRD 3CZFB 1E4KA 5DWUL 1YAIA 1ZE3C 4FQCH 4LCUB 2ZJSH 4RDBA 2DI7A 4WEBL 3STBA 4M7JL 4Y2DA 1SVBA 3NSDA 5TDOB 3UTSA 3I6LE 1DE4B 4XP4L 3CSFA 3ENEA 2H41A 4XRCA 2IAAC 2CPUA 3OXRB 4GB9A 1TTRA 2F53E 1JHKL 4K55A 2HVBA 4KTDH 5C1MB 1JP5A 4HD5A 2WYHA 1TZHB 5DA4A 4Y2OB 5F9OH 1YNLL 2N01B 3L9BA 4PUBL 1H0DA 5CJBA 1EGJA 3M8OL 3QK0A 5DEZA 5D7JB 1XSIA 5FOBB 3C2AL 3ZDZE 1B0RA 4MTMA 4X6DF 4K7PH 3VG9B 2B3RA 2CO3A 2H4EA 3D30A 1GA2A 4JM0A 1HXYA 4WEBH 5DWUH 4ZMTA 1EO8L 4M7JH 4N2MA 4PJAA 3DMMC 2RALA 3OAWA 5HYJD 4JGUA 3Q5YA 3NJJA 2XN2A 4XP4H 4KU1A 5E6ZA 3EOTL 1BEXA 2AK4A 4MCZB 2K78A 2WLJA 3CDGA 1D7CA 1JHKH 1JN6A 1AXTL 2UX7A 4WFGE 4G43A 5TE6L 2GK2A 4XCNB 2WTPA 1BYOA 4MJ6B 4C55A 4X80L 1YNLH 2JFCA 4PUBH 1AJ7L 4Y5XC 3M8OH 2E3VA 5HJGA 2CUMA 5DJXB 3WFHA 2VSDA 2DQEL 3C2AH 1JPGB 1AGDA 1ID2A 4Z0BH 4AUYA 4LLYA 3BUIA 3PHOA 3TGXA 1GS8A 5IQNA 1EO8H 3CHXA 1TQTA 3N44B 5KYNA 1R9FA 3V7AE 1CXIA 5F96L 3QUML 3EOTH 2VN5A 1NCWH 5IMOA 1RSFA 4RMUA 1AXTH 1T04A 1LMIA 4OLYH 4QHMA 4RMQA 3ULVD 2EUVA 1RLWA 3HRZA 2AQ3A 5TE6H 4X80H 4LGRB 4ZDHA 1DUYB 1HYRC 2WXOA 1AJ7H 3OKMA 1KUMA 3C5JB 2DM3A 3OAZK 4JDVB 1ZS8A 3ZDYB 1KBVA 1KPRB 2KZBA 2DQEH 3L5IA 3TZVB 2ZUQC 1AOZA 2O61B 5KYYA 5HI4D 3KLQA 2VLKE 2XJKA 4K8RC 2Y5TB 3MLWL 5IQOA 4NZ8A 5IY5B 5D7IA 1FC1A 2FO4B 2CHZA 4K71B 3RJOA 3QZMA 1TJXA 3G5XB 3SDXB 5F96H 1MI5D 1BXVA 1NAMA 2ZWYA 3BVVA 3Q8BA 3QUMH 4KJYB 4AYGA 1BM7A 3QDAA 4XCCL 4P06A 2FVNA 2BIQA 3PQYA 1CMOA 3COOA 5FUCE 1VENA 3DJTA 3ARGB 2BDNL 3ESNA 1KB3A 2DTMH 4NN6B 4PSRA 4MDJB 5L2KB 3JVFC 3CCHA 4S1RL 4UAOC 2VDOB 2R2EB 3HG1D 4QNPE 2FT6A 2ITFA 3L3HA 1RD6A 4S1SL 2Z1PA 1AFVL 2UZYB 4G9FB 4QPEA 3MLWH 2FL5A 1KYUA 3B56A 4Y19A 6CGTA 2W1NA 3ARYA 4JPIA 3DURB 3FT9A 5ECJE 2H45A 5DK3A 4QHNB 4I9WE 5DFAA 3BHBA 4QRPD 5DTFB 3O3AB 4QTHB 5IR1A 4LNRA 4JG1L 2BLFA 3FTVA 1LXMA 4XCCH 3MYJA 5ILTL 1T22B 2OTPA 1L0YA 1C08B 4ZAKC 3B9KC 2BDNH 1QO3B 4FEMA 4AQ8A 1WSST 4EIGB 5KSVB 5CJXC 2C8NA 3IJ7A 3QQ4A 4S1RH 4GG6F 2B2XL 4P3DB 5T3XE 1IBFA 5CHNB 3WNIA 4M1CD 1F41A 3HW7A 4S1SH 1ZIAA 2YXVA 1V7ML 1AFVH 3MBWB 4WY7L 3G7TA 2CQVA 3WNMA 3T1FA 3PPEA 5LGYA 3HIZA 5AYUL 5ILTH 1EPFA 2ICES 1TQCC 2DYPD 2BP8B 3QQ3A 1QUNB 1KTBA 4A7GA 4ZFZB 1MCPL 4WK2B 5E2TL 5L2KE 3QPKA 4XX5A 1T7ZA 2J57A 1UURA 3FRPG 3MUZ1 5DJCB 3WS3A 2MHAA 5J1TC 3FSVA 2B2XH 3RZCA 2O4EA 1F6FB 3L7EA 2X2IA 5KVDE 3P9LA 5AENA 5K39A 4ORGA 3ZKND 4O00A 4RFNB 4XI5D 3PAVA 5K9OA 3BQUB 3RURA 3BWAA 3DVGA 3V4PA 4FAAB 3FO9B 2CHNA 4NZFA 1SMAA 2C9VA 1AO7A 2WXLA 5M94B 4S0TD 3D0VB 4P2QA 1VJSA 5AYUH 1NC2D 4P5TC 5CEYA 4KRPB 2ZPKL 1KBPA 1SJMA 1GY1A 4MJIE 1MCPH 3O6FD 5E2TH 4MZRA 1WVZA 4GMTL 3DBXB 3HE6A 3HNVL 3EJYC 3BQVA 3LRSB 1Z9SA 3EJZD 4O02A 1MCQA 3QZBA 4IBTA 1T5KA 1OCOB 2NTFA 2QTEA 3KG5A 1UD4A 4PJFF 4P2OA 4BXSV 5BOZG 3GHPA 3T77B 5KVGL 4NS0A 1BMGA 2KPNA 1X7SA 4LSVL 1TCMA 2H3NA 2PCPA 1N9PA 3GLEA 4RBPK 1A3QA 1LO4L 2FIRT 1OGAE 2V0AA 3AJ7A 4H26B 3NIDF 4HIHA 3B7TA 2ZX5A 4PREA 1CD9B 4RFOH 2DICA 3H9SB 3WY1A 1FFPB 4GRWH 2ZPKH 4NSKA 1LO3L 3DHPA 2Y7NA 3BPNB 3MA7B 2CBQA 3GKWL 4GBXD 3VI4A 3FXIC 3MZGB 1IE4A 4GMTH 1WUZA 4LSQL 2AXGB 3HNVH 5D7HA 5B39A 5GS2H 2DAVA 2VIRA 1N0LB 1SOSA 4MS6A 3FQXB 2CA4A 1IMHC 2ADFL 4QEGA 1VEPA 1RHFA 2B59B 2J20A 4G9DB 4HA1A 2EEXA 4X7TB 5KVGH 5DUML 5D5MA 1PX3A 1RZPA 3GNML 2CKBB 4LSVH 2CIKA 2ROXA 5C0JB 3EG9B 1LMKA 1LO4H 1F1DA 4C59B 1JXKA 1MW0A 4HIEA 1AGBA 4LP5A 1XMEB 4PV9A 4XCYA 2EVGA 5EZLB 4GSRA 4G42A 2NY0B 1DDTA 1LO3H 1CCZA 3X14A 3GKWH 4LSQH 3BJ91 3WFBL 3SO3B 3CLFL 4NOBA 3UPAA 4X4ME 1TJIL 3QJVB 1JK8A 3GHEL 2ADFH 2VISB 1YPZE 1S8DB 3RUGB 1JGUL 1ZOXA 2IOMA 5DUMH 2B15A 2I32A 3ZYIA 4OY9A 3GNMH 5IUSA 2F53A 5D6CB 2GQHA 3U4KA 4PW4A 3C60D 4OGXL 4H5SB 1NMCC 2V5SA 1I4FA 1I9RL 3MTXA 3ARFA 2IG2H 4XP1L 2I25N 1OP3K 3AS2A 3H9SE 1S7XA 4BCXA 1CK0L 2YGNA 2HJKB 2R27A 5A6MA 4YL4A 3WFBH 3CLFH 2WTRA 2VJXA 3NEOA 3X1FA 1CLZL 1TJIH 1JG9A 3GHEH 4M02A 1PZ5A 1S7WA 2FH6A 5JOPE 2NT0A 4MD0B 2ARJA 5IW6B 5EEYA 4OFVA 3EBIA 4OZGB 3AQZA 1N70A 1SXNA 3VFSA 2XV3A 5L4FA 2YAMA 3QCUL 3LQAL 4OGXH 2P80A 2JKIS 2PCFB 1I9RH 3K5SA 3H53A 2F7RA 2QQNH 4ZX3A 1AHWC 4XP1H 1F4AA 3MCKA 3MJ7A 2BVOB 1CK0H 1FP5A 2VDPH 4HDIA 4ODXB 4U1JA 1QFHA 3F04A 2H9GB 1FL5B 2OYMA 1KTDB 4WI0A 5DLML 2RD0A 2A73B 5I82A 4MAUL 4XC3L 4X6DE 4FQXD 2VLMD 4LCUA 1CLZH 3AU1B 3QRGL 2R23B 5AD0B 5TDOA 4XBMA 1KXTA 3Q06A 2WGNB 1MDAA 3WNLA 4BH7A 3ELAT 3OXRA 1TO5A 2YD2A 1YNKL 1JIBA 1NCTA 2IC2A 3FC8A 1WWCA 3K1DA 1MIML 32C2B 1U8KB 1CDYA 3QCUH 4XT1C 3T0EB 5J6HB 3LDBC 3U0WL 4JHUA 3MZTA 3Q3GA 1ORQB 5D7JA 5F2FA 1Z9NA 1L9PA 9CGTA 2C34A 5AVSB 4AITA 2VLKA 4IEFB 4N24A 2EEFA 4MAUH 5GGVL 3QRGH 3QFJB 1HVXA 3VX1A 4AIEA 1IQDA 2Z31D 2EIMB 3ZHDA 1A7QH 2VRAA 3OMNB 1WHPA 4HV8B 2JTYA 5EIVA 4JO5A 4A2EA 1HKLL 2G2NA 4HXAL 4MCZA 4QY8B 3F62A 2YQ2A 2YOCA 5FLUA 4POUB 1HILA 1YNKH 2V9RA 3HBGA 5C7XL 4GEJA 4XCNA 1Z6JT 2Z4TA 3H2WA 1CXLA 8CGTA 4LAQL 3U4EB 5F89B 3K2KA 2AXJA 5F7DA 3QC5X 3D69A 1YQVL 3M7OA 1EHXA 2EECA 5EOCH 4U1NB 4Y5VA 1Z3GL 1KTLB 4TKWA 5INDB 4OLZH 3VJ6A 3CU7A 2NNXA 1MZZA 1Q9LB 3I6GA 4L8BB 5EO9A 4P2CG 3HUJB 2EDMA 4QXTB 5GGVH 4LSUL 4DERA 3QZLA 3GMNB 4KC3B 15C8L 3IRZA 4QXVA 1IO4C 1XGZA 2QVMA 1NINA 3QA3B 4JPQA 2DQCL 1HIML 1HKLH 3VACA 4BK8A 4S1DD 4HXAH 4IRSD 3TP4A 1GH7A 3UBXB 3B37A 5C7XH 2ATPB 2VXTL 3R19A 1ZLSL 4RRPA 5C6WH 5HHOB 3G08A 2JCCF 4LAQH 5GZNA 2J12B 5I26A 4KJQD 4JCLA 1QTYT 3AFLA 2D3VA 4JDVA 1YQVH 4Q6IB 3VD1A 1KPRA 3WAJA 1Z3GH 4I3GA 3RVWC 2O61A 1CF1A 4YBQD 4JDEA 4A6YL 2AQNA 3S37X 4NKMA 3ULAB 1WT5A 4LSUH 15C8H 4PGBB 1MFVA 3OJ2C 5F9DC 4ETYA 1WA1X 4RMVA 4XOCA 3SKUD 4YDVA 1HIMH 2ZXQA 5FO9B 3GM0A 4KJYA 4HK0A 2ROYA 2IALB 2NZ9C 3QJHA 5EORH 1ZLSH 3JWDL 2IF7A 4OAWA 4N9OB 2HTKC 2VLRB 2VSCA 5L2KA 5MHSE 2NY5H 3QS3A 5HHPB 2KL6A 5E8OA 2JELL 4HUWA 2YD0A 3ARDD 3QUXC 4A6YH 5IBLD 4YDJB 3VYOA 1ODUA 1G5AA 2UZYA 2YXMA 5F9WC 1NCUA 3V9EA 1NBYB 4XZUB 2OL3A 4OGAC 1RK7A 4KI5F 3DURA 2X4RA 1USZA 3O3AA 4KK6D 2C3VA 4NNPL 4QTHA 5J12C 4JG5A 1BA9A 2ICCA 2OPCA 4EN2A 4F20A 3IRCA 1KIUB 1QWUA 2EICA 1T22A 3JWDH 1C08A 1CL7L 2CRYA 2AAAA 2VAAA 3ULUC 4NCC1 4MJIA 4WWKA 1FH2A 2YBRB 5KSVA 4R6UA 1QSZA 2CLVB 1E40A 1SYSB 4YL9A 4LSPL 3FPXA 2R1WB 3E8UL 3HR5B 4FQLL 5CHNA 5DRWB 3GEFA 2ZXBA 1WFMA 5IJBC 1W0WB 1QX1A 1QABA 2X70B 2VJ0A 3C5ZC 5KG9B 1Z7JA 2J55A 1M1SA 3BD3A 4HIIB 4UTAA 3N55A 3Q44A 4WI3A 1XXFC 4I0PD 1OTUC 1H9VA 4UUJB 4NNPH 2GBTA 3QS2A 4YGVB 2XYBA 4XCFL 1ZV5A 4JFQB 1OGAA 5BO0D 1AGCB 2UVEA 1E9QB 2Z65C 3QI9C 1LO5B 5ACZB 1RVFL 1U8CB 1M7XA 3BH8B 2YQGA 1WFIA 2NY4C 2VLRE 3G5ZB 3LZPA 3BO8B 1SHSA 1KGIA 5DVLA 4E42A 4FQLH 5DDHB 3MUGA 3UJJL 5FYKL 1E4XI 1P84J 5D1XB 3SZKC 3WUWG 3PJSB 1A6TB 4X7FC 1HHGB 4XVSL 5I0VA 2VR7A 2R29L 3DJSA 1H6TA 1N8ZA 4GT0A 4PJFE 5CP3A 4HWZA 2BHZA 4RFEB 2OYKA 3IDMB 2BY2A 4XCFH 3WTVA 2DLEA 3ARRA 4QOKB 4PJGF 1QP1A 3QUZC 1RVFH 1VAHA 2PTTB 4OLWL 3BP6B 3BAWA 3H9HB 3NIDE 5C09D 3VRIB 4LGSB 3CFMA 1YNTB 5T33L 3LRSA 1NC4D 2P8PA 4X4MA 3K91A 3KPLA 4NZUL 1YPZA 5FYKH 1NEZG 2ICWB 4NHUB 4YEEA 5I17A 1IJNA 1MEXL 5EBWA 4XVSH 1HHJB 4G6ML 1R3HB 2BNRE 3IBOA 4UNVA 3BW9B 3HPLA 4GKOA 3MV8E 3NVQA 4IHBA 1OALA 3OBAA 5ALCL 4JCWA 4F7EB 4DKEL 4L8DB 1D5IL 3MRJB 3IDGB 5B7EA 4H26A 2X4TB 4PJ5B 3BZEB 3H9SA 2YSSB 1F6LL 4OLWH 4M3KB 5B3SB 5L4IA 1HHKB 3MA7A 4A63A 2DS4A 3QQ9D 5JUEL 3WAKA 3CFDA 3QR2A 1X9UA 2AXGA 2GTQA 3HE7B 3UGEA 5DZVA 3F7YB 4NQDB 4D8PB 1BSIA 1N0LA 4YUEL 2BHUA 1H5BB 1YEKH 4LVEA 4UZUA 2H3XC 4G9DA 1PIGA 1VFAA 2VB5A 5JA8B 1LEGA 2F54E 5D1XE 1RCYA 1MEXH 1RH8A 3OZLA 1PTZA 4G6MH 4R0LC 3NJFA 3L4CA 4O51B 1DO6A 2XVLA 2CKBA 5C0JA 1CVSC 1BAFL 3FSOA 5ALCH 4BK4A 1KWKA 4WEUD 1OT2A 3DNKA 4DKEH 4FA7B 1D5IH 5J1AA 3DIFA 1M6OB 3VXUB 4WUKL 4DAGL 1AIFB 1C8QA 3N5AA 1AE6L 3QRLA 5IQ7L 3L16A 1NCOA 1DBBH 1JNHA 1HOCB 2EDHA 2AV7B 3M17B 5JUEH 4B0MB 3NOIA 4JO8A 1T4KB 2PXYD 4WTWA 5DO2D 5C70A 2J2ZA 4WIQA 4WQOA 4X6DA 3WGVB 4KDWA 3PU7A 4YUEH 3ZTJH 4R2GB 4UOZA 2VL5A 3Q8CA 1KGXA 1S8DA 5EC2A 5C3IA 1FSKC 3NJIA 1JDAA 1HCFX 1KFAL 3VH8B 1Z3RA 5CSBA 3ILQD 4H1LG 1BF5A 1BAFH 1SEBA 1F3DJ 4NZDA 3RVTC 2UWEB 4KZEL 4FG0A 4CN6A 4L05A 1CFQA 4DZ8A 1BX2B 4WUKH 4DAGH 3NG5A 2WLNA 4DQOL 1L9SA 3OHXC 2TSAA 5DZLA 5IQ7H 1D9KB 2W92A 1EERB 3QXTA 1QBLL 3IE9A 2HJKA 4JN2A 1I7RA 1KXVC 4NUJB 1KBGL 4NI6A 4GIAA 4KZ0A 4AJWA 5DJ6B 2AS5M 4MD0A 2LGNA 3MDJA 1EEUA 5GZOA 3QUGA 1KFAH 5AB1A 2J6WA 2W59A 3T8VA 4A7QA 1WP6A 4KZEH 1FVCB 1NCNA 2ZNWA 3QIBD 1PPIA 2PCFA 3VXUE 3NN8A 3ZE1F 1YHPA 1Z5LB 3QDJD 4NXSA 5IW1A 3A4EA 2I07A 1BQLL 1RZJC 1X44A 2ZP8A 1KLUB 2BVOA 4XXCC 1BWMA 5MERB 1P84K 1QBLH 2H9GA 5SWSB 1FL5A 1KBGH 1XIWD 4UZGA 2XV2A 4QRBA 3AU1A 3LPWA 4HCRL 2V7HB 4Z6AT 1CC3A 4PLJC 1PG7X 4E41B 2HVKB 2NUPB 1A65A 2ZKMX 3TJHC 1CXEA 2RQEA 3RU8L 3SCMB 4UQ9A 2NCEA 32C2A 2UWEE 5JW3L 1U8KA 2PWHA 1COBA 3OB8A 3ATDA 1IBGL 4F7KA 3T0EA 2YD8A 3EO0B 4M4RB 1ORQA 1U8HA 3PWVB 1BQLH 4NO0B 3O9WD 3HC4L 1UFUA 4W68A 5I73B 4MHHI 5SV3A 4HWNA 5EZJB 3SY0A 5I1GL 5KSBE 1MJ8L 3EJQA 4IEFA 5ABDE 2XN0A 4XP6L 1QW8A 5FW6A 2WLKA 3V0IA 2K8MA 3QFJA 5F3HB 5F0MB 3QBTB 4HCRH 5HGAA 3SQRA 4KX9A 1MWAB 4JLRB 2NPLX 3V6ZB 1T0MA 1G6RL 2HX9A 3SD5A 4UWQB 3RU8H 1UWYA 4M93C 4N8UA 2VERN 2JK5A 3FU7B 5JW3H 4E5XB 1S3RA 2CDEA 4F9LC 4R7LA 1Q9OA 4KAQL 1IBGH 4P4RB 3SQBB 1I8IA 1TCRA 5F89A 1OO2A 3BVWA 1NFDB 3DGDA 1CU4L 5FKAB 3P2TA 2CGYA 2JCCE 3EDDA 4BH8B 2K4AA 3EJPA 2OR7A 3HC4H 4Z78A 4OZFA 1K72A 4F2FA 4D9RE 5SWSE 1J87A 5L8LB 3RVUC 4L8BA 3EH1A 5I1GH 4XAWL 4O5LH 4DP4X 5KOVC 2B16A 4ZMYA 1UD2A 4QXTA 1XT5A 4XP6H 3DI3B 1ML0A 1RUKH 3IJEB 4FLQA 3ARQA 2QDWA 1U3HA 1FYTD 1G6RH 2GJZB 3BGAA 1KY7A 3Q13A 3FT3A 1G4RA 1TIUA 5ITFB 4HD9A 3QIWC 1OP3H 4M03A 3TYGH 4TL4A 1KJMB 1Y18B 4KAQH 3OG6B 1BZ8A 4PJXF 4ESKA 2J56A 4JGMA 3QJQB 4P4KB 4J27A 1CU4H 4J3TA 4LPUA 4Q6IA 4TULL 4UOQA 4PJ8C 1U33A 3CD4A 3DX7A 4XVTL 1XCQB 2WYTA 2BW5A 1WFJA 3KPSB 4PGBA 2ID5A 2EZ0C 3OKNA 3AREB 5B4MD 2V3FA 5JNYB 3AITA 2J44A 3ARBB 5FO9A 4KI5E 3QUYB 4KNQA 1JWMB 1AZVA 4LGPB 2FWOB 2F7OA 3KPNA 2ALWA 5JIIA 1RP9A 3GRWA 2VLRA 4BHUI 3STZB 3D2UA 1NFDE 1WD9A 4XPGL 3GS0A 3LKSB 3RTQC 4PH8A 4XVTH 3GSVB 4N90D 5T3ZE 1ZK5A 2CPCA 4QAMB 4HT1L 4G83A 2NUTB 2P26A 4F27A 2YQBA 4EZMA 2FBOJ 3BZFB 1KCUL 1JF5A 4G11A 4G6JL 1FL6B 4LVNC 1P7BA 3GT6A 2J6EL 5CILL 1LK2B 3TVMC 4HC1L 4PJFA 1OF2B 4XMTA 2R69L 3MJ6A 4UAHA 2NXYD 2HFEB 2ZAIA 5HGDA 3B9VA 3MMEA 3CLEH 4LFHG 3QQDB 3AAZB 4E0RA 3VTTA 3QNYA 1LO0L 3QDMB 3V7MA 1I1AD 4JQIA 4NQEB 2BSBA 4HLEA 2W94A 5E51A 1CFSB 1MRCL 4F8QA 1Q9KB 4XPGH 4BWUA 1EJ6A 1A5FL 1SYSA 3NK4A 4Z7NB 3HR5A 1ZT7B 3MXVL 4PN6A 4HT1H 1JZDC 1T2JA 1KG0B 3VWJA 4LT7A 4IKIA 2UXGA 2XPYA 3TBWA 2X70A 4G6JH 4PRID 3TH4T 3TH2T 5KG9A 2BNRA 2J6EH 5CILH 4E9YA 4HC1H 2KDGA 1TXKA 3BN9D 3MV8A 3TNNA 2A9NH 1SBSL 2R69H 4YGVA 1KJ2L 1ZTMA 3LEXA 3OGCB 2VR6A 4M9PA 5IVNA 1AGCA 4L3CB 2YGVA 3BT2H 4OGYL 4URKA 4IBZA 5ACZA 1U8PB 4MB5A 4XWOD 1LO0H 4QO1B 3I2CL 5GGQL 3WDJA 4B0MM 3IBEA 4FFZL 4B9IA 1BF8A 2EXWC 2VSMB 3G5ZA 1MRCH 3ARVA 4PJGE 5KYWB 2GUOA 5L6YL 1BIIB 1A5FH 1JPTL 3AY4C 1DTUA 2VLLB 4JFFD 2ZG1A 1G7IA 1ZJBA 3MXVH 1TPXB 1A2YB 3JYBA 4H8VA 4MQSB 4R5XA 1DBAL 4XMVA 3RLSA 5D1XA 2F54A 3OZKA 1A6TA 4F57H 2X10A 4Y4HB 2VRQA 1FF5A 2JNZA 3EJUA 4TSCH 4KK9C 1SBSH 4RFEA 1RMFL 3IDMA 4M6NL 5I74C 1KJ2H 3UAJA 4HUKB 2YA0A 3U2JA 3QDGB 3AADB 4OGYH 1A7PL 1LDPL 3I2CH 3IFPA 5GGQH 4FFZH 4I1PA 1NCJA 2XQYK 4E9XA 4OZHB 2B1AH 3H9HA 5I0XA 2HT2C 2IJ0C 4MJHA 3SYQA 1JPTH 1YNTA 2BVTA 5EDXA 4O2FB 4BYHA 4ATTA 4Z7NE 2EDKA 4JQIH 5DI8B 3QUMB 3TEXA 1DBAH 3RX5A 2FR4A 4MMXB 4PP2A 5EBMB 3F85A 3BW9A 4RDQF 2BSRA 4YBHA 5FV1L 3TS8A 2OW7A 4OBRA 1RMFH 4L3EE 4M6NH 1OWWA 4FS0A 5CWSA 5B39G 1V55B 3IDGA 2X4TA 2BZCA 2VITA 1H19A 3BZEA 4OSUL 4PHZA 2YSSA 1A7PH 1HNFA 2J8UF 2Q76B 3B34A 4GI6A 4JY6B 4KRMB 3HMXL 2P5ED 1HHKA 4NKIH 5KJ4A 3T6VA 1O6SA 4IOIA 3EH4B 1VCBC 3HE7A 2F8XC 4D8PA 3IAPA 1H5BA 2WXGA 2EYRB 5ENWB 3GJEB 2YD3A 4JANB 5LNDA 1WWBX 1U0QA 3MUJA 5DHYA 1DJZA 1KGYE 1K6QL 2E9BA 5KVEL 4PCTA 3IJSB 4NHCL 2BHFA 4J12A 1M6OA 3VXUA 5BPPA 2B5IB 1AIFA 1FLRL 1NM4A 1EFXD 3I85A 4KK5D 4MCYB 5H94B 3NCFB 4OSUH 5DJ0A 3HMXH 1HOCA 4WHDA 4ANUA 1J1XH 2AV7A 1Q8MA 1K2DB 3TFKD 5JHLL 5I6XB 5A2FA 1NICA 2W9EL 1CTOA 1UUSA 4JRLA 5F6HJ 3BPOB 3IMBA 2E7CA 5C3TA 1B0IA 3RVVD 4GP8B 1GC1L 5SX4H 2Q10A 3UJTL 5KS9F 2QSTA 2JQMA 3VXRB 5AB0A 4WI5A 2E5EA 1OAUL 1IGIH 5KVEH 2UWEA 3WI9A 1PYWA 2XKUA 1N4XL 3ATEA 4WO4A 4DP9X 3F84A 2GTWB 1J8RA 1FLRH 2YPLE 4BINA 3ETBF 3OGOE 2QZQA 5CBEB 1ERNA 2F7IA 4R5TA 3L3KA 3ZE1E 3MRFA 4NUJA 5JHLH 2ZX9A 5KSBA 4ZPVB 4NQCD 5C0EB 2EADA 2W9EH 4XXDA 5D6DA 5TH2B 1JS4A 3LEVL 3GBMH 4X9HA 5BRQA 4AI7A 5C86A 1JXGA 2YA2A 3DUSA 3IFLL 1GC1H 4KO9A 4GQPH 3UL4A 4A7SA 3UJTH 5J1SC 1IL1B 4UNIA 2WWNA 5EEWA 2DB8A 3FTZA 2ZCLL 3C8KB 1OAUH 1T89A 2QT6A 3U2IA 2Y7SA 5FDYA 5KJ7E 1HFUA 5DD3L 5EOTB 2FHCA 3ULVF 5D2LF 2JCCA 3P2BA 2LE9A 1OHZA 4ZRGA 5SWSA 4WK0B 4APQD 4X0NA 1JZGA 4UM9D 4PWHA 5J5EA 4Z7IA 4NIYE 4Y4FA 3JSSA 3BX7C 1LEIB 3LEVH 3FB7B 2V7HA 2F08A 4OCXL 5FFGA 4G7SB 5AW8B 1ROCA 1HHHA 3IFLH 3W56A 3CFIC 4N2KA 2GG1A 2QQLL 3QHFL 5F9JA 2DI8A 3VXRE 4ZXBD 2FATL 2VQUA 4GRWB 3P9MB 2P24B 3W9DB 2VYRE 1BP3B 4G6FB 2VGLM 1KLGA 1JVOA 3EO0A 5DD3H 1EAQA 1GYCA 1KF9B 3ETBJ 4RGNE 1HINL 1G7MA 4LCWD 4UV4L 1WGOA 2V3DA 2OXHB 3L5HA 4K5OA 4TUJA 2EEDA 3MJ9L 2F7PA 2Z1KA 2GBAA 1PKQE 4M61B 3TEUA 4ZUWA 4FOMA 5CUSL 1C9SA 1MWAA 1R3IL 1E8XA 4OCXH 1JZIA 2WXNA 2F61A 3D25B 4PWIA 3APNA 2QQLH 2DWEB 4LNVA 4ANVA 1KXQE 3VFNA 3FU7A 4GFXA 5I1EL 2KZ1B 1EHKB 3WLWC 3SGJA 4BQ8A 3SKNB 4P4RA 1E5ZA 2WOBA 4JFTA 1NFDA 2GAZA 2C3HA 3GSQA 3P4MA 1HINH 1BVNT 2FUTA 4BH8A 1UT9A 4UV4H 5ANMB 5I9QC 5KBLA 2ADGB 4PJXE 1D6EB 1S9YA 3MJ9H 2XPGB 4NJ9H 3II3A 4PJ7F 2R1YB 1SLXA 2BSTA 3Q8AA 2HX7A 2X0VA 2RAMA 3DX6A 5JXED 1P7QB 4GP4B 2DWYA 1MCHA 5FM5M 1TU2B 4ANKA 4IRJD 4H8UA 4JQVA 3T0DA 4B95C 1D2PA 5ITFA 2AEQL 4G1EA 5I1EH 3QZNA 4I3SL 1KJMA 3DX0A 5HDBF 4F15C 4FEIA 5AVQB 4JG0L 4P4KA 3D34A 4DFIA 3KEHA 4RWHA 4J3UA 2FJSA 2Z6FA 1SLUA 4YLQT 4MMZC 3CVDA 4L4VD 1N6UA 4FXGB 1ULVA 3T6QC 3OJDA 4UDUA 3VGAC 1KTRL 2YKLL 5CCHE 4J2QA 4F33B 2JCWA 3AREA 5IV2B 3MUY1 3ARBA 3ARUA 1ZSDB 3RX7A 3SDCC 1JWMA 5ID1B 2AEQH 4EI5C 4I3SH 3JV5A 5B7FA 2JIXA 4LPXA 4PRPD 3GXIA 1A6AB 4YSEA 1CFNA 5HHME 3LKSA 5HHVL 1DQJA 3KWVA 5ANME 4M8QA 4N2OA 3SBPA 2VZ3A 4OFYA 2NUTA 4FQIL 2Y1AA 3BZFA 3IAQA 3D2TA 4NO2B 4Y2DC 3DRTB 4NKOA 3GM8A 1H9DA 3FQWA 1LK2A 2YKLH 3TO4B 1DVFA 3BAYA 1VA9A 1PY4A 4XCEB 5T3ZH 5BQ7B 3LPGA 2HFEA 1N7ML 1X5JA 4U1HB 1M9SA 3AAZA 4FKHA 2QGBA 1XGTB 4OJYA 4NYLA 1FZOB 5K9JL 1GSKA 4ODUB 1FG2B 2I27N 1U8JB 1NCHA 5GS0H 2ZYHA 1GMEA 1R3LA 1HSBA 1Q9KA 5A2LH 3ZVVA 1N2RA 5HHVH 1D7BA 4HYTB 4G70B 2YRBA 4LEEA 2FJUB 4FQIH 3VFWB 1KG0A 4QKTA 3E38A 1JD9A 2TRHA 3QEQD 3TV3H 4C83B 2VLJD 4JM2D 5DFTA 3HS9A 5JDJA 1QHOA 4P46D 2C3XA 3RPIA 3PV7A 2F74B 4L3EA 2FEDD 3IMSA 4RA0C 4BRJA 5IJKA 1N7MH 3ECWA 3PXJA 4LBAA 3OGCA 2ZD0A 2E9WA 4MJJA 2NYYC 1K4DB 1U8PA 2ATKA 5K9JH 4OI9A 1HE7A 1CLVA 2F8VA 5I5JA 2BFVH 3NAAL 1BIIA 1SQMA 2VLLA 3R1GH 1ZY9A 4TUOB 3RGVD 3U83A 3Q6GL 2NNAB 4MAYD 4X4KA 3L4WA 5KN5A 1A2YA 1EBPA 2IOOA 1QRKA 1W15A 5I24A 2XWCA 4Z7UE 4Y8AA 3BP4A 4PEEA 1WFTA 1ZHKB 4AGNA 4ECNA 1MIEH 1II4E 2GC4C 5HI5C 5ERWB 3UIYA 1ZTXL 3HRZC 2H32A 1U91B 2MWCA 2NW2B 4JDTL 4HAFA 3F12A 4LHUB 4AW7A 5ICUA 2ISDA 4NLAA 3NAAH 5FYLD 5AUMB 3ILEA 4O2FA 2YXWA 2VR5A 4M1GL 3LVEA 1EO7A 3Q6GH 5D1ZA 2P4AB 5KSAD 1EJ8A 2DM2A 3FYIB 4RQQB 1NCCH 4YFDB 3LCYA 4MMXA 1CICD 3F7VB 1XTLA 3ETTA 1FNSL 1AD0B 4KTYA 5CKGA 5EBMA 4D3CL 2DLIA 2AEIT 3KPRE 3L3OA 1FAKT 3LXAA 3C6LA 4NEHB 2A77L 3ILPA 3C9NB 3LKNB 4KKLC 4I3RL 1KXHA 4NKDA 2H2SC 5D1QD 2YPLA 2PP7A 5CR8A 3PYCA 1QKZL 2Q76A 4JDTH 4JY6A 4A6YB 2Z9TA 4IM8A 4RAVA 1OHQA 4M7KL 1C1EL 5FO7B 2OR9L 2X3CA 1A21A 1MLBB 3X12B 4M1GH 4BQ6A 3OVUB 2F15A 5ENWA 2GITB 4OCRL 2JV6A 2XQYA 5KBPA 3TEZA 3D39D 1FNSH 4W9ZA 5AKVA 2EIZA 4D3CH 1XZWA 1ASOA 3F01A 2ORBL 3V2AR 5IKCB 2A77H 4NM4L 3TBTA 1FFTB 4I3RH 5HYJE 4LARL 1C16A 4CU8A 4F80A 5H94A 1FE8L 2X4PA 4HFWB 4M5YL 1QKZH 3NTCL 3O45A 4NNYB 5D72L 4AQ8C 4HKBB 1GHFH 5BZDB 1PLGL 2E9IA 2N7BA 1AG6A 3GZKA 3NZSA 4M7KH 1C1EH 1T21A 2OR9H 4PWFA 3NIGF 3ZZSA 3ZDXB 4NN5C 2P47B 2CDFB 3CV5A 4OCRH 1CFMA 3TO2B 3V4VL 3WIHL 1BZ7B 5DRNA 2KLRA 3VXRA 2VUKA 2CO2A 4TRPL 2PO6D 1BQ5A 2ORBH 4LSDA 4UQEA 4KH2A 5ESQA 3DIVA 4NM4H 5T1LD 4MXWH 3QWOB 3A23A 4LARH 3UTOA 1ND0B 3D85A 3B9DA 1FE8H 3QSKB 4M5YH 1DQDL 3NTCH 5D72H 2OZ4A 1FFOB 3MRQA 3VB9A 5M95B 2OTWB 2RJMA 1PLGH 2EQDA 3ULVE 3LIZA 4L1TA 3TFBA 4WENB 1G7QB 5IIEA 3RZCC 1PKQA 5JHMA 4EVNB 3BJLA 4K5NA 4XMKH 4PGEA 3NIFB 3V4VH 1XGQA 3WIHH 1QR1B 4UBDC 5E2UL 1R5WB 3HVNA 1KXQA 5HPOA 3D48R 4KK8C 3C8KA 4WV1B 4P9ML 4YPJA 1I8MB 1JK9B 4J3OD 4BZ2A 3ROOB 3KBFA 5EOTA 4NDMB 1MI5E 2WXIA 2Y7LA 5E7BA 2NNFA 2JH2A 4N3UA 1U2YA 4AQAB 1CGWA 3IGUA 5I1DB 4PJXA 5K5YA 2FX9L 1NIEA 3HE6C 3IJ9A 4WW2B 2ZIDA 5B1JA 2DYPB 4L5FL 4U7MA 2AMUA 5E4EB 2E4TA 2XKNA 3RJQB 3WS6A 4EDXA 2ERJB 5HYIA 3HZKA 3HAEB 5C0IB 3ZDXE 1LEIA 4PRBB 1PZCA 3LPFA 4UT7L 1U3JA 3FTSA 4P2OC 3HG1E 3WJJA 5E2UH 5B7MA 3BIKA 4LPVA 1XCTB 4Z7QB 3P9MA 2P24A 2Z7WA 4P9MH 3W9DA 2HG0A 1KELL 2FSEB 3MQIA 4QRPE 4WUUB 4AM0Q 3BVNB 4YJZL 2AQ2A 4GKLA 1BOGA 4UV7L 2FX9H 3DETC 2QPUA 4PY8I 5DJZA 2DH3A 1NKRA 1YN6B 3HB3D 1OTSD 3HEIB 4L5FH 4EI6B 5I8CA 4GUOA 5KWYC 3O6FB 1MCEA 2LABA 4JFPB 3X1EA 4HMCA 2FLBT 2N0KA 4G8FB 4UT7H 3IVKA 2EE3A 1HEZB 2VMCA 1IGTB 2NX5B 2DWTA 3MLZL 5JDSA 4OZFG 3O8XD 4MWFA 1OSYA 4ZPTB 1JWSB 4IDLA 4BFNA 3CFKB 2NR6A 1EEYB 4E9VA 4ZFFA 1KELH 1HQ4A 1WGVA 2CRZA 1RUAL 5HDBE 4Y8DC 2QSQA 5ANMA 4UV7H 5E9DB 2YK1H 3T4YB 3MSPA 1OP5K 1L0PA 3IM1A 2XPGA 3SBWA 5DZAA 3UBXG 4UINL 4MA3B 1P5VB 2X6CA 4JRXB 3HJ0A 3GB7B 1S7QB 1JCKA 2VDKL 5ABAA 2NY1C 3QO1B 2G5RA 3UCQA 1TU2A 2E6QA 3QNZB 4BFJA 1FBIL 3VQ2C 1HAUA 1A9EA 3BYTA 5D2NE 3RJDA 1NIAA 4EF3A 3ARFC 3VXPB 5I75C 3A67L 4QF1A 5JPNC 1PF3A 4HSCX 2PR4L 4N8PA 1RUAH 5HJ3A 1LE5A 2J1ZA 5AKRA 3CDYA 3CVHH 3VD4A 4MVBC 1S2EA 5BMFL 4HLZH 4U3SB 1FZJA 1R4XA 4UINH 3FSAA 3DXAD 2JI3A 2WC7A 1RJLB 4JY5L 2F9BT 4LCYB 5HI3C 4F33A 3OKLA 2VDKH 3TCXA 5CFHA 1D3CA 4QKXB 3MCYA 3BUYB 1HESA 3NSCA 4IU2B 5F7BA 1FBIH 3MA9L 4JVPA 5ID1A 2XX0A 3DOIA 3O4OC 5ICZA 3I3BA 3DHUA 3A67H 1Q38A 2PR4H 2GK0B 3C60B 3PGFL 1UZ6E 3DPDA 3TF4A 4LXFA 2WVVB 4P9HL 5GJSL 1ADQA 2GT9B 1K5NB 3S3BB 2OMTA 5BMFH 3VRJB 4N0FB 4DVRL 1XWVA 2YD7A 3NCYS 1QACA 4MAZA 3DTXB 4NO2A 4FXLA 4JY5H 2WHVA 3BVUA 1JOIA 3B7UX 4Z7UA 3TO4A 1IFGA 3LS5L 4XCEA 2H6OA 4PCKA 4M62L 2DL9A 1F18A 3P11L 4EIZC 5EN2B 2PWEA 1EDYA 1XGTA 2Q8BL 2BWDA 2R0ZL 4ZOEA 4DKTA 1FZOA 1FG2A 4HHWA 4A67A 1U8JA 2JB6A 2OM5A 2CNYA 2EYSA 2XZAH 4KX8A 4XXWA 5D7JC 4ELMF 1UGNA 3ML9A 3PGFH 2AF2A 3X3GL 3U9PL 4P9HH 5GJSH 3IDYB 4Z3JA 4K94C 4YDMA 4N2GA 2Q6WB 2CH8A 3VFWA 1V3KA 3MOQA 3IXAB 1QBML 2XXCB 4XNAA 3M07A 5J7CC 3S3SA 3PCYA 3ZIMA 1IGML 2HT3C 3DDGA 4H25A 3KPRA 2RACA 3QIUD 1QLEL 3SJVE 5HHQA 1IAIL 2HUHA 5J8OA 4M62H 1GKEA 5CEZE 2NY5C 3P11H 2FJGB 3RFZC 3VVWA 5I66B 3MXWL 5DMKA 1DJIA 5FUCC 2R0ZH 2Q8BH 3IJYB 4JPVL 4P5KA 2IIJA 1FG9C 2BVEA 3ELQA 3PNWB 5TPWL 4Y5VC 4LVHB 3SE6A 1FV1A 4XHJD 4X4XB 4TUOA 3X3GH 3U9PH 2I5YL 1ETZB 1G6RB 1WIUA 4RGMC 1GTFA 2CUHA 3GJFH 4H4NA 5K69A 2WJ5A 1A1MB 3IU3A 3L3GB 5FAAA 4D9LL 2A99A 2VN4A 3UPRB 5SV4A 3DROB 1QLEH 1J9CT 1QD0A 1IAIH 3KGSA 4BFIB 1FNGB 1RAMA 2Z31B 2ALAA 1JYNA 2XTSA 5HYJA 3A4FA 3MXWH 3EGXB 4CAGA 4EXKA 4P57B 1U91A 3O3BB 4LEBA 5GZNC 5DYFA 3RVXD 3H42L 4Q6KA 1M2VB 5MEQB 1HDMB 1JCVA 2K45A 4AY0A 2VXQA 5KJRL 5TPWH 2FGZA 3KYMB 1BYNA 5C0CB 2LHAA 2VE6A 4HJUA 1U42A 4RQQA 1X9LA 1WT5C 3F7VA 1BQSA 1YVLA 3QG7L 4QRRD 3UTTB 2WBJD 1KV3A 3PY9A 4JJHA 3RWGB 4AEHL 4LDEB 4AGPA 1X5IA 1MHCB 3ZGHA 2OMWA 2VLME 3LKNA 1EVTC 1NBZB 5CD3B 1F4WL 4QMEA 2F5BL 3HN3A 4XPFL 1KENL 3FQ4A 3UCRA 2AJSL 3GQFA 1LQBC 4K9EC 1PY9A 1BGXH 2H6UA 3H42H 3O81A 5HGHA 5E1QA 4E9TA 1CQYA 2ZOKA 2VWEC 1MFEH 5KJRH 2FWSA 1BAGA 5FO7A 2Y22A 2OSLA 4IYKA 1MLBA 3D9AH 3X17A 3GSXB 2X4NB 1XGYL 4GQRA 4JMXA 5D7LB 3D6GA 3NIGE 1OW0A 4GG6B 3QG7H 1A6UL 1YMMB 1XDTT 1FHNA 3AM8A 4YHKL 4AEHH 1R46A 3UX9B 2J1XA 2NZ1A 1KPUA 4PVNA 1F4WH 2F5BH 1KENH 4K07A 3IKCA 1Z2KA 3BDYL 3EADA 3SYAA 2DQFB 2Y36L 2AJSH 4HFWA 4ZS7L 4NNYA 2VC2L 4WWKC 5CLYA 2XNAA 3R4RA 2DMBA 2OI9C 3VH8G 3FTUA 3OTTA 4XNUL 4P2RD 3KHQA 5IG7A 4B5ZA 4PJEB 4TLTA 3OG4B 3B8YA 5AAWA 1XGYH 4FLRA 3L9EA 4J8RA 4AQ1A 4U3XA 1BZ7A 1IM9D 1KBBA 2WP3