5IQNA

Crystal structure of the e. coli type 1 pilus subunit fimg (engineered variant with substitution q134e; n-terminal fimg residues 1-12 truncated) in complex with the donor strand peptide dsf_sririrgyvr
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
132
structure length
132
Chain Sequence
AKPCTVSTTNATVDLGDLYSFSLMSAGAASAWHDVALELTNCPVGTSRVTASFSGAADSTGYYKNQGTAQNIQLELQDDSGNTLNTGATKTVQVDDSSQSAHFPLQVRALTVNGGATQGTIEAVISITYTYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein FimG
publication title Accelerating the Association of the Most Stable Protein-Ligand Complex by More than Two Orders of Magnitude.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Cell adhesion
total genus 26
structure length 132
sequence length 132
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5iqnA00
4X5PA 4BUQA 2UY6B 3ZL2A 1KLFB 4X50A 3ZPDA 4XOEA 1KIUB 4X5RA 2W07B 5CGBA 3JWNH 1PDKB 5ABZA 3RFZA 5IQOA 3JWNG 4XOAA 4AV5A 4AUYA 4AUJA 3ME0B 3BWUF 5JQIB 4CSTA 2UY7B 5FWRA 4LOVA 4AV4A 4AUUA 4X5QA 1UWFA 2XG4B 4CSSA 4ATTA 5AB1A 3ZL1A 5F3FA 4AVIA 3BFWA 4J3OG 3JWNE 4XO9A 1N0LB 3BFQG 2JTYA 5FX3A 1QUNB 5FS5A 4AV0A 4XOCA 5LNEA 2J2ZB 2JMRA 2XG5B 4AVHA 4AVJA 4J3OH 5AALA 5FLUA 1ZE3H 2WMPB 1N12A 4XO8A 4XODA 4XOBA 1TR7A 4J3OF 5AAPA 5IQNA 2VCOA 3SQBB 5IQMA 3MCYA 5LNGA 5F2FA 4AVKA 4CA4A
chains in the Genus database with same CATH superfamily
3C8HA 3GSRB 4KXBA 3TEUA 2QHRH 4JN2B 2ENJA 3DMMB 3WMPA 3OLGA 3PPEA 3UBXI 4JDTL 2KMWA 4DF9A 1DO5A 2LW3A 4E9LA 3MZGB 7PAZA 2XY2A 2YAFA 1CDUA 1IC5L 4E9TA 3H8NA 4HFWA 1MFNA 1NBZA 3L5XH 1WICA 5GGRY 4R8WL 2QKIB 3CVBA 3MMEA 1G7MB 1GGYA 4HK3N 1O7DC 1T03L 1FO0B 1XGTA 1PJ9A 1HJBC 3ECBA 4FFVD 4G7QB 3MRRB 1X5XA 2LFGA 3KNBA 1Z3RA 3QXDB 4Y4KC 2LQRA 3RKDD 3FQXB 4JY6A 2EXWC 1B4LA 3WNJA 1FO0L 4P3CH 2D31B 4BQ9A 3TYFB 3PWUA 3ZTNH 3CDGB 3VXUA 5DHVA 1X5FA 2PPCA 1VENA 2HX8A 4MSWA 4Y16D 3JWDL 3TIDA 1XD1A 3WTUA 3GHBH 3HLKA 5BZXA 5JW5A 1A8ZA 4KAQL 4IMKC 1HIML 3VRLF 3E6FB 2F8IA 4RFNB 4UANA 5E24E 3NP4A 1BZ9B 3CXHK 5B8CB 3DARA 3L3IB 2FBJH 3B8SA 4PUBH 1EGJA 5EBLB 2YMXH 1A22B 3U4BL 1K2DA 2Z7UA 4Z7OF 1MRCL 1JP5A 1VDGA 1OLZA 3ARPA 4CNIA 1A1NB 1L9SA 3S96B 1S3RA 4KQ3L 4QY8B 3L48A 2ATPB 2Z1KA 3HUJA 3AT9A 5DVKA 3TNNB 4E5XG 4U1MB 5FYKE 4K3EL 5KUMA 4XRCA 1P2CA 2A9AA 3P3TA 5FW8A 2HMIC 4F7KA 4NKQB 4DSYA 3GNMH 5J57B 1MFVA 4PPTA 1GKEA 3EDFA 2QGBA 5HDBF 3KHQA 2BY0A 5JPMB 3UO8B 3PP4L 3FB6A 1OAUH 2YA0A 4AVJA 4Z7VA 3O6FA 3GJFK 3AXIA 1BAGA 3CZEA 2CRMA 3QG6A 1TZOA 2FHFA 1CD1B 1GJWA 3NCCB 5AOJA 1ES0A 5L7XH 2QKIC 2ZX7A 5DD5H 1J0ZA 3HEIB 3T0DA 1NOLA 5HSFA 4X5XA 4O2CB 3VXMB 4MAYB 1AZVA 3IMTA 1GGIL 3IFNH 5EHFA 4OD3L 2Y22A 4X9HA 5F7BA 3VGAB 4A2EA 1AIZA 2MNJB 1DJYA 2ENYA 4HKXB 3IFLH 4N2EA 4L8BA 4RSYA 1E3ZA 5CZRA 4OGXH 2X89D 1E90A 4EN3A 1TQTA 2RHEA 3MRPB 2DWEA 1NIEA 5C09B 3FQTA 3NESA 4LDLB 2DN7A 5HVHC 2BS71 3FU7A 1TU2B 1FJ1B 1P6AB 2JCCE 4GAFB 3V4PA 4PSPA 2NW2B 2IOIA 1ZEAL 4FQ2H 4XNYL 1DUZB 2LR4A 4J3SA 4AH2B 1CB4A 3MTRA 4N9GB 3ULVH 3RVVC 1QRNA 1CE1L 3WS3A 2P24A 5HHPA 3QZPA 1AS6A 4QRTB 4H8QA 4F7TA 3H85A 4FQLL 2EICA 3UJJH 1ETJA 5I16B 3RURA 1U3HB 3VUAA 3B9EA 1H3UA 2OMWB 1NKGA 4LNVA 1C16B 4IOFD 4PREB 3DGCR 3LZLA 4KY1L 1M7XA 3GSWB 2D7MA 3RWFB 4I1NB 1U8NB 3FCBA 4NO3B 2Q7YB 2Q8BL 3DBSA 2IWFA 5LQBH 3LRSB 1T83C 3TJEH 2VQ1B 4F8OA 3EOBA 4NGHH 3WLWC 4OTXH 3F62A 5SX4H 2BC4B 2X6CA 4L3ED 4NRYB 4HISA 2WVVB 5A2LH 1H15A 1AY1L 2AMUA 3LN4A 1Z9PA 3PFQA 5CINL 2CD0A 1RZFL 4HS8L 1SJHA 2XWTB 3E3QC 1L0XA 1N6UA 4JRYA 4XBGA 1A2YB 4JCWA 1SJMA 4JM2A 3DX7B 1BJ1J 1MCQA 4OFYA 4W9JC 4EKXA 3WL9A 1C9SA 2IBGA 2WAHA 2PF6A 4Y16A 5KJRL 4JQVA 3NACH 4Z18A 1Z5LB 3MRBA 4NFBA 2X6BA 4PQXA 4JCLA 5AQ0A 1I3RA 1T1ZB 1PKQB 3OPUA 5IVOA 3RWJA 1JHKH 3KDMA 3EDDA 4W93A 1HOCB 1LQSR 4MA3B 3SDXE 5IEKA 3MLYL 3KPSB 4W81A 5EEZA 1JV2A 2F0CA 3FB8B 3L17A 2IGLA 1HNFA 5B1JA 2DD8L 2EXYC 4OIBA 1IC7H 2FWSA 1BX2B 2R1WA 4NXKA 4YXLL 1J9RA 2YFNA 1C08B 1E9OA 1KB9J 2J8UE 3ARBB 3F6LA 3QISA 3ARFA 5DRXB 5DJCA 3RWIA 3SO3B 3BZEB 2GFBB 3SQRA 4XNZB 1JHLL 3FU9A 5FO9A 1OXYA 2C26A 1PG7W 3QUMH 3V52L 2FGZA 2AMGA 1WS7A 3P9MB 3GJEA 1WE5A 3EJSA 3VWKB 5JPNB 3TFKC 2ODIA 1J8KA 3VFPB 1AXIB 3B2VH 3JVGC 1WBYB 1KN4H 5B39G 3VW3L 4X7DC 1IFRA 4IS6A 4XNUL 1CXLA 2DWTA 1DEEA 2X70B 5JIHA 3EOAA 3MRQA 3FQRB 1FBIH 1JPGB 3WFDH 2CJUL 4R7LA 4DPRA 1SXCA 3FB7A 3QCVH 1UZ6F 4XCCL 1XGPA 4PBXA 5T1LB 1IC4L 1TJIH 3C6LA 4MJIE 2WLJA 2DQIH 3MUUA 3F8UB 1IAMA 1ETA1 2OSYA 5AYUL 5GGVH 2MFNA 5H94A 4BWTA 1AHWB 1J0YA 1DUYB 1U36A 4AIXA 3E1F1 2B9BA 3ZU8A 4E0RA 5AW0B 4JFTA 2OMUB 3KYMA 3ZKSD 4WTWA 2QMKA 3PUUA 4OW6A 3QI9C 3G7TA 4TF4A 3PAUA 3NYKA 1K4CB 3N06B 4KX9A 3WLBB 5I5JA 5KTEL 1F5WA 1MW0A 4HGKC 3HR6A 4LEXL 5DVLA 1CL7I 2R2EB 1CGXA 2PUQT 4LBEB 4M5TA 3PIQB 2D7PA 2HJLB 2XYCA 4LEBA 2IH3A 4MDIB 1U95A 4L05A 2PXYA 4NC0B 4ZJ9A 3GMOB 5FYLH 3HG1D 4LPWA 5BZDB 1S7UB 3MLWH 5HYJE 4JB9L 4FADA 4GIPD 3U7YL 3HNSH 4DQOL 5HI5D 4HAFA 2D2CC 1F6AA 3CZSA 4ADGA 1HT6A 3CQQA 1L0QA 3SDYL 3GT6A 1JI1A 4XNXH 4XNMB 3INOA 4XMKH 4NZFA 1EZSA 3L3OA 5IB3B 3T0EC 2O6PA 1P4LB 4XPBH 1JL8A 3PAVA 3BFQG 2WUCH 4AGMA 2HN7A 3PPSA 4YHYB 3VWKC 4M7JH 4QDGA 3V4UL 4ZPTA 2ARJQ 4D94A 5I1JH 4MJ2A 3Q3GB 1OL0A 3RVTC 3IYLW 5FA4A 2XN9E 1UWEH 4H4NA 1QWNA 2IFFH 4PFEA 1AG0A 3K46A 1AHMA 3TT3L 3C12A 4FYRA 2CLRA 2XLLA 4LCYB 4XP4L 2HKFH 5FUOL 5GIRB 3TT1H 4LPXA 2VERA 4M43H 1U2HA 1HHGB 5DRNA 3LNEA 1QBLH 3HUJF 1K9TA 4OIAA 1UZ8B 2ROYA 3PWVA 2AV1B 1Q90A 3I3EA 4URTB 3SBQA 3IMVA 2RB8A 4LGSB 3C5ZB 1TQCB 2H0PA 4YO0A 3NFNA 2BVOB 4MZ3A 4K9EH 4Y5XB 1P7HL 2QTEA 3DX3A 2KZ1B 4RAUA 4UTBA 4DAGL 1MOEA 5MEQB 1LEGB 4PV1C 1CQYA 4X9BA 4Z7VF 1C8PA 4ODXA 3DSFH 1A4JB 1QYGL 1OGAA 2Y1AA 3DX8B 2UXFA 4ABWA 2AW2A 4W4OC 5FYJH 3PP3H 1DSYA 1PG7X 4K7PY 2E9GA 3VGEA 1OPOA 3BPNC 3H6JA 3CFQA 15C8L 3ME0A 4LLDA 3WU1A 1JXDA 4JM4L 3RVXC 3D4ZA 1W15A 2G2RB 3FFCD 3OC5A 5J9PB 1T89C 4KOBA 3LS4L 1NIAA 4FQXC 4I0PB 3CZJA 4XVSH 2RBLA 7FABL 1YNLH 2W9EH 1H19A 2R0WH 3WTYA 5L2KE 1BFVL 3PRZA 3QUYA 2CHXA 1MAML 3NRPA 4P2RA 4F93B 2WHVA 4YHYC 3QZLA 2H6PA 5I8EA 5DD1H 3RZCB 3VXSA 1OO2A 4JE4B 4MHHG 2VM4A 3ESVF 2R8SH 5ERWB 4CSSA 4OZ4B 1TDQA 1K8IB 1VGEL 3GBNL 3SHSA 3GK8L 1RZGB 3GKWH 1WAEA 1NDGA 2BCKA 4QHNB 4IGBC 4JHAH 4WV1C 3IXAB 3SDDC 4BE6A 5I30L 5AL8A 1W0WA 4I87A 3OKLA 1MVYA 4BXSV 3H56A 2LVCA 2ZYIA 4GMTH 4BFGA 1D5RA 5ID0A 4GG8A 4JL2A 4UIKL 1CVRA 5DWPA 3HHRB 5DJ6B 1KGUA 1NFAA 5I8CB 3MJ9H 2R4RH 1NQBA 4ALAH 5L88H 1K5NB 4Y5XC 4XOCA 5J5EA 3OZLA 3TO4C 5BNXD 3P1VA 3PU7A 3OAYK 1RUPH 3PAYA 3O6ML 1F2QA 2VL5A 2A6KB 2PPAA 1CK0H 3LKOB 4YUEL 4D0DB 1NGQH 3F58L 1G4RA 3BUBA 3KPNB 4P46B 2AS5M 4E41B 5F89A 1V3MA 1HN1A 3N04A 1A7OH 4WI0B 4B96A 4JM2F 4Z3FA 2IALA 2VMCA 1ERNA 1OY3B 3BQUA 1EXUB 3BEVA 3OQRA 4Y1TA 1PSKL 1CLCA 3EUDA 1DHKA 4N6RA 4OCNC 5KSBB 5EU5A 5TFSH 4UQ3A 4DK5A 3X17A 1HILB 4S1QH 3NCFB 3VQMA 4L4TA 3MRIB 3GWJA 4HCIA 1C5DB 4U0RC 3H7BA 4F9PC 5L4FA 1MY7A 3MNWA 2F54B 3DUUB 1AGCB 4EI5B 4XMVA 2FATL 3KS0H 1TETL 3FTZA 3QO1B 3FPYA 4KRMB 1A6AA 3QQ9C 3QXTA 1CG9B 1WT5C 2XBTA 5D1ZI 2AERT 4YVNA 2MCPL 1M56B 4HZLB 2Y5TA 1IBDA 1NC2A 2PMZA 4QHKI 5DZVA 2IAMD 5GS1A 1N18A 5D7KD 5T1KD 1D3CA 4PRBA 3ZGHA 1H3TA 4S0HA 4RZCB 1JPEA 5HGHA 4JR9L 3VSTA 3Q6GL 3GJFA 3WN6A 5DYOA 1XIWD 2IDQA 1LO5B 4MYWB 3SD2A 1TCRA 5DWUH 3GO1H 4PTTB 2X9ZA 3U48A 5C0GA 1UD2A 5HGDB 5TQ2L 3LNIA 2BSRA 1AOHA 3O0RL 4UOJA 5IW1A 3RU8H 3W0WB 2DKMA 2WXKA 3DX0A 1ONQA 4H5SB 3TBWB 3LQZA 3PREA 2VLRE 4WO0A 1KJ2A 5F6HJ 1LO0L 1KGXA 1U8KB 4Y8DC 1WJ3A 3MBXL 5CWSB 4BKLA 3KPPA 3MJ8B 2CIIB 3QIBB 4A2DA 2QGEA 5J11C 5AKVA 3JQOB 1R19A 2ZAIA 3L7FB 3VFRA 4HKJB 5AB1A 3EJPA 2WZ0A 3V0WH 1NDMA 1OOAA 4KJQC 2EDKA 4QWWC 3VH8B 2WLIA 5ESQA 4ES9A 4S1RL 3N1PC 4TLKA 2XIBA 4N5UA 4D3CL 2DLTA 4MWFB 5KZCB 2GK0A 1J05B 5JA9A 1G4MA 1MQ8A 4KKLD 3I3DA 1WG3A 3L4YA 3O3BB 2DQUL 3O8XB 4KI5E 5CFAA 3BH4A 2IH1A 2Q2LA 5DURD 1QSEB 4XVJL 5E9NA 2X4SA 4MDJA 3T8VA 2ZZUT 4X0NA 2ZCZA 5I9QB 4I3RL 4K73A 4GRLD 3OAZK 3CVDA 2CMRH 3MRJA 3UACA 4X99A 2BP3A 1EHAA 1TQBB 1CMOA 2ZAGA 3QCUL 2GTWA 2ICEB 4MLIA 5KANI 2FJFA 3KL3A 4PJIB 4I7ZC 4DPAX 4H20L 3HRZA 1TOXA 1GZHA 2FE0A 2MOGA 4YXKH 4DKEH 1I8IA 1XGQB 1SEQL 4U6TA 2DEYX 4TM9A 4FQHB 3EGXB 1R3HB 1FVCB 4GQ9H 1A4AA 1P4BL 2C3GA 3IE4A 4ISVB 4L1TA 2NR6C 3DHUA 1JZDC 4HIXL 3ZHFA 5GS2D 4IBVA 2OJEB 3OKEB 4LKCB 3W57A 1H3PH 3DVGB 1I3UA 4NZTH 4Y5VA 1KIPA 1SUJA 3TVMB 1IQWH 3R8QA 3T65B 2ZOLA 5F7EL 4KU1A 4PV9A 5IMOB 2O61A 1HKFA 4F7CB 3P2BA 3EOTL 3AAZA 3QQ3A 5HY9B 1FVEA 4FLQA 2EO9A 3RWDA 5HJBA 4YPGA 5D72L 5HJ3A 2GAZB 4HEPG 1QKZL 1INQA 1YECH 4EE2A 5C08E 1S9YA 4ZMLA 4YHPB 2PCYA 3OG4B 5K9JH 3EJYD 2X4TA 4IU2B 5F71A 3M17A 4WGVB 2WLNA 4PG2A 1BVLA 4XC3L 4AMKH 4JO8A 4BELD 2JI1A 2DMKA 1EZVX 5DS8A 3SKMA 2BWIA 2OI9C 4LCCB 4NCDA 4EIZC 2G30A 2EDQA 1R3IL 3S35X 3FN0L 1KF9B 1MJJB 5L9DH 5JHLH 3TEYA 2EZ0D 3DHMA 1EUTA 3PDOB 3BMWA 5J12B 4H40A 1HK6A 3TH4T 4QXGH 2D7TH 4PGEB 4XPAL 2G60H 2JXMA 5B1CA 1RK0B 1MCWM 5GJSH 1JZEA 2XZAH 4RETB 4N8VB 1EJ6A 1MIEH 1BQHB 4B41A 1UADC 4YGVA 4YSQA 4UTAH 3BLPX 3Q5TA 1PVHA 2RALA 5BRQA 2ICEC 4KZEH 3AY4C 1GS8A 1MREH 4ODVH 4QRQB 3MRDB 2FO4A 2QSQA 3WS6C 4Z1PA 1U93A 2YC1A 1EEYA 1IBBA 5E8EA 1IGTA 4KZDL 5KOVC 4HT1L 2P8LA 1XF3A 2NNAA 5TDNA 3FUMA 3ECWA 1JPSL 4F3FB 4FABL 5IEHA 2EXWD 1JOIA 5IQ7L 4H25A 2R23B 3N0PB 1YYLH 1B0IA 4RMBA 3H54A 3PFUA 3TVMC 4J3BA 3FU3A 3OV6A 1BIHA 1AZZC 4NBYB 2E27L 2QVKA 2WW8A 4MXVF 3S48A 4U6VL 1T22A 4JY5L 1JK8A 1IB5A 2NOYA 1KIQB 3GRBA 5E94A 5HHNA 3OG6B 3NABH 1LO4H 1EFQA 3QS3A 1NGPL 5B1JC 2YRBA 3FTUA 3KPQA 3JUYA 3S8WA 3P9LA 4BDVA 1H3GA 2VDKB 3WD5L 3QXWA 4GRLA 3GXDA 2ADFL 1XGYL 2I27N 1OD9A 5ID1A 4NUJA 3U7AA 1YMMB 4U1HB 4JRFA 3T4YB 4PGJA 4P5TC 4WFFE 4GOSA 5FO7A 2DJUA 1INEL 3FHAA 3L1EA 3QUZC 4JRXB 1EZUA 1E8XA 4JFHE 1NLBL 3A4AA 2HMID 1UWGH 4PD4J 4K71B 1OGPA 3LMJH 1QNZL 4M03A 2CWRA 5JQHC 1Q0YH 4OFPA 5KS9E 1IT9L 3EH1A 4EDXA 1SN2A 1IFHH 5A1AA 2UZYB 5CEXB 5E4EB 5KYYB 2P46B 1KBWA 2Y23A 3HC0A 4TQIA 3QAZC 4TVPE 5FYKL 4NO0A 1KBPA 4YDLB 2J44A 1MJUL 5HJDA 1XH0A 2PYED 2QHLA 5E95B 3WUWA 1PNDA 1BXXA 1NIDA 3QFDB 4JKMA 3GGWB 1ZLDA 3VSUA 1R1CA 1I8AA 2X1QA 2EE0A 4ODUA 5JLZA 2UVEA 4KMLB 2EIBA 3BH9A 5CLXA 2W0KA 4NWTH 3ROOA 2WWMC 1OF0A 3BKMH 4WEBH 5ITBL 2X2JA 2AZAA 3OF6D 4TQPA 1R34A 4DH2A 4TSBL 4ERSH 1CO1A 1S9WA 3OM3B 2WCGA 5DD6A 5KYXB 4L3CA 3FYIB 3M8OL 4MB1A 4F27A 1YMHA 3LKQA 3MPCA 5FWRA 1ZV5A 1IUZA 4UZUA 1D9KA 3T77B 3I2CL 3OX8B 1NLDL 3V6ZB 4QHLB 2BVEA 4X6FA 2KH2B 3SB3A 3NA9H 3BWZA 4LL4A 5DZPA 5EZIL 1UM4H 1DFXA 2JCCB 1GCFA 4NXSA 1QUPA 2OQJA 4NO5B 4ADIA 5JHDB 5EU3B 2D3NA 5GISH 1EEUA 1M2OA 1MY5A 2CJSA 3RVVD 2AEOA 2OTUA 3BAYA 4YIQB 3RZWA 4MD0A 2VN4A 3EOYG 3FONB 3DURA 4ODBD 3MNZA 4MKTA 1KT2B 5IJKC 3RI5K 3BAEL 4A66A 4L4VD 3HB3C 4HMCA 3QZWB 3EYSL 2IEPA 3WEXA 5GSVA 1B2WL 4WCYH 3MXVH 4EXKA 2WANA 3H2QA 4MXWH 5AW8B 5CGMA 4IRJC 2WUBH 1JXGA 3E7JA 4N86A 3HI6H 5D7IA 3CHOA 4F7PA 2WP3O 3MLVH 4AQAA 4FQJH 1MPAH 1G6RH 3IVKB 1OAXL 4W9KC 5DMKB 4WNJA 3UPAA 2NUTB 3O4LA 6PCYA 3V4VB 2FH6A 1AGBA 4H8VA 4XNQA 3HOGA 5AVTB 4A2LA 3ZE1E 5KVGL 4JG0H 4QCIB 4OV5A 1R5IB 3NQKA 1BF2A 4OZFG 1MUJB 3RWHA 1SXBA 4Q8BA 4TL4A 2W59A 5KWYC 4JUSA 4XO8A 1T20B 3RWEB 2VQ4A 3V4VL 4S1SL 2XQYK 1YN7A 4OLZH 3KAAA 4K3JL 3FFDA 3OSVA 4PJDA 5TGBA 3VXMD 3S88L 1EA9C 1F4WH 3EGSB 3R18A 5J6HA 1M1XB 2JKWA 2NNXA 1QI4A 5GRJL 4HHWA 3QJOA 4JHWH 5E2VH 4CU6A 1NIFA 1UT1A 2D0FA 3SDXB 4FXKB 4ELMA 3AC0A 2NNCA 1BQ5A 1ZK5A 2EXYD 2WXHA 5C09D 1PU0A 3MV01 5CU5A 3IXTA 3KJ6L 5ILTL 1TZIA 4BA0A 1UM5H 4JPVH 5JIDA 3Q1SL 2DIAA 4ONGL 4UV4H 2EDJA 2FEEL 5EOQL 3QWNA 5IHWA 2J8UB 2AEQH 4I3SL 4MD5B 4B9GA 2EDFA 2TRYA 4AOFA 4MB3A 3UG5A 1KJ3H 3OZ9H 5GGRB 4HUVB 3LPPA 3TFKD 3GMNA 1WGOA 3U7WH 2HH0L 1ZRUA 3GSRA 3CC1A 3UYOD 2CK2A 4JN2A 3DMMA 4Y7OC 3WTTA 1O6SB 1PMYA 5DUML 5C0BD 5LXGH 3PY9A 2L04A 4PSRA 4URKA 4HD9A 4O2FB 4DGYL 3U2JA 1KGYE 1M7DB 4ZT1A 3U0WH 3A23A 1G7MA 4AEHH 1U91B 1FO0A 4MJIB 1UJ3C 4ZS6C 5C1MB 3OGOE 1UURA 4FXLA 5C6PB 1JDAA 3WNNA 1AQKH 1J5OL 5E4AA 5CSZB 2QFRA 2IDTA 2FLRT 1F02I 1PCXA 1DDHB 1KEML 3QXDA 4LDOB 4MXQD 4P2CG 4XPFL 5GGTA 3SDAA 3ZKMC 4ORGB 1PAZA 1YY8B 3RB5A 1KB5H 1R17A 3FQXA 4WUKL 2F7IA 5ALBH 4D0CB 3DPBB 1JWSB 1S9KC 4N3UA 4I77H 1QSFA 3TYFA 4L29B 3CDGA 4KMTH 4N2LA 5ISZE 2KQMA 4XP5H 4V1DA 4LT7A 5I71C 4W9EC 2BM3A 5EBWB 3CDYA 4YDVA 2X38A 3KH4A 4R2GB 4ZG1A 3D3VE 5IGXH 1BZ9A 2OJZH 5B8CA 4P48A 3WYRA 5ICXB 2VAJA 4PLNC 2VO8A 1ADQH 3L3IA 4ZMAT 3LXBA 1U8QA 2WB1A 4RWYL 3KPSD 2ZP9A 4XH2B 4LPCA 5IW6B 5HYJB 2BSSB 5K59F 3KLQA 4NQDB 2EUZA 4KZCA 1AZCA 3OJMB 1A1NA 3S96A 4QY8A 3AABA 2ATPA 3TNNA 2AKRB 4P05A 5EZPA 2ZUUA 3T0ED 1HHJB 2G3NA 2VRAA 4K2UH 1WAPA 3T5WA 2CA4A 3FBKA 3VXRA 3X13A 3VWKD 1KXQE 2G3MA 4J6IA 3MFGB 4XP1H 5CFHA 5JPMA 1GGCH 4HCRA 1DQDL 1PPIA 3IDMA 4LARL 5HHOE 1KCLA 2FX8H 3SQBB 2XN9B 4FCAA 4QRSB 3BYYA 2X87A 1QAWA 5KAQG 1CD1A 3OVUB 4ZPVB 3NG5A 4AYGA 2VO5A 3NJKA 3DX9B 3EBGA 3ISWA 4JPWH 3L1FA 2UY6B 4ZUSA 4O2CA 1L9RA 5KVFE 3VXMA 4MAYA 4FQIH 4F15C 1I3GL 3CPUA 2R27A 2ZJSL 3AU1B 5C0EB 5C7XH 3RTLA 1AVAA 1YPZE 1UA6L 3HZKA 3NIFF 4Q6IC 4HKXA 1AC0A 5IIEB 2DQJL 2NY1C 3O41B 1AGEA 3CFTA 3HE6C 5EUOF 3TN0C 5ITFB 3RJOA 3MRPA 6TAAA 1E50A 1NAMB 1HFUA 5HBBA 2V17H 5KANG 2HUHA 4AUJA 1TU2A 3FRUA 1FJ1A 4DPBX 1AQ8A 1XCXA 2JCWA 2CK0L 4MA1B 3FUNA 4BZ2H 2O1AA 4AH2A 2YD5A 3UPRB 2Y5QA 5A16B 1FIEA 1ACXA 3DWTA 3EBHA 1IV8A 3B1TA 4QRTA 5ANME 3DVNB 2E7MA 5I6LA 5I16A 3INUL 3GIZH 4UINH 1U3HA 4RFOL 4CN6A 1A7BA 3HKZA 3LX9A 2IOMA 3FMGH 3FRPG 1C16A 32C2B 4PREA 3MLTA 4IJ3C 3GSWA 1WITA 1UQSB 3KLDA 3ZKNC 3RWFA 4FQXD 1W6WA 3MLSL 1BA9A 1U8NA 5C71A 5KBDA 1YYCA 3SD5A 1FNEA 4GRWF 1DDTA 3W2DL 2VQ1A 4EXPX 5FCUL 2DIBA 1ZHKA 35C8L 2FGWH 2BC4A 1KFGA 3CFCH 1INDH 1QFWI 4LHUG 2DEXX 3ARGB 2KQNA 4AT6B 4OFVA 1U8LA 2VQTA 3QHZL 2A74B 2I26N 4ONFL 1FCGA 1A2YA 1H3XA 2XFXB 1E28B 2G5BB 3AREB 3BDBA 3DX7A 4POUB 4XZ4A 3SE4C 4IGBD 4AVHA 3U4EB 4YC2B 3KLKA 3IJEB 3IKCB 5FV1L 1Z5LA 3GKZA 5EULV 3SDDD 1TVDA 5CAYB 4B9PA 4TN9A 1PKQA 4JO1H 2VDOH 4LSSH 3BT0A 4A7VA 5D1XE 3RUGE 4ACPA 1HOCA 4MA3A 4HV8A 2O5NA 2X4PA 1BXAA 4KTDH 3UTPE 2WIMA 5D7IF 4H8UA 4ZTOL 3ETBJ 1X44A 2QSVA 4Z0XB 1BX2A 1KENL 2P43B 4F57L 1MEXH 4OQTH 2OYMA 4X4MA 3BZEA 3ARBA 3VD7A 4J1UB 4HLZG 5D70H 4N2KA 5DRXA 1F1GA 5EZOL 4JUTA 2OCJA 2GFBA 3K2IA 4MA1C 4BGDA 1KB9K 2NY7H 3DTUB 4QMEA 5DS2A 4HXBL 1TJHL 4JKKA 4M5SA 4LNRB 4PRHE 4BUQA 4KV5E 4H0GA 3VFPA 4YHLL 5E8DL 2IADB 2AXGA 1CF1A 4HWNA 4KPHL 2YAEA 4OGAC 2CZNA 4M7LT 4P2OB 3FHEA 2BOCA 1WBYA 4HWEL 4HX1B 4IHOA 3MGOA 3SQOH 1JZ8A 4PJDF 1U3YA 2COVD 1DANT 3MKKA 2YR3A 2H6OA 2Z31B 3FQRA 3WHE0 5IKCB 4HLZH 4MBOA 4I0PD 5T1LA 4FA8A 2L8AA 2QPSA 2ZUTA 2IPTH 3L9RA 5LGHH 3RIFK 4OLVL 1AHWA 3UBXB 4LLVB 5F0PB 4KNSA 3QQ9D 4J6RH 1Q8MA 1WVZA 2ICCA 4ZYKA 2B2XL 2GIMA 2OMUA 4IDJH 1MWAB 3ARGC 1F8TH 2K0RA 4NM8H 5LG6A 4GYBA 1N6QL 2OULB 2EIKB 3IFPA 1K4CA 2F1AA 3HZVB 1G7LB 3WLBA 2A74C 3K0YA 4N2FA 4JFFE 1KBKA 1MCPH 2GJ6D 3GLAA 3W1ZA 4AG4H 1T1XB 4LRNH 1I7RB 2R2EA 4ZZFA 5HI4C 4LBEA 3PQYA 3OSKA 2WZ6A 1OP9A 2BIQA 1KPUA 1COBA 1AO7E 1ICTA 1MCEA 1MWAL 2R2HB 3BFWA 3PIQA 3RDTB 4QPEA 1EXHA 4GKLA 3BEWB 1D5MA 1M2VB 1JNNL 1J1XL 3GMOA 1CDHA 3HMWH 1Q0XH 2FAUA 4HWBL 4FJ6A 3NN8B 2XWEA 2VLRB 3I9GH 1Z5HA 5F7FA 2IQ9H 1NL0H 4PI2A 5LDUA 3FXIC 2XVLA 4G6FB 5IB3A 3OGCA 4HAGA 1P4LA 4PB9H 3WFBL 4OF6A 4NYLA 3ARZA 4Y2DB 4KJQD 3BISA 5ACZA 2JMRA 4PH8A 4U7MA 4MJ6B 4E41D 4G7VL 3NDZE 1E4XH 1X7QB 4PLJC 4ZK8A 3NCJH 5EF2A 3KCPB 2VN3A 4R7NA 3SPIA 2HG5B 4G3YL 4NQUA 5IJDC 1ZGLB 3KBHE 2WLMA 2C1PB 3RY5A 4ZD3H 3AROA 4QHKJ 2X2UA 5I5RA 3FC8A 2NCMA 5ICUA 1CTNA 4PMEA 3FKUS 4Z6AT 3QH3B 4G7RB 1FGNH 4TNGA 4ZAKB 4FX5A 4LLQB 4QO1B 5GIRA 4EI5D 1EBAA 5L0QC 2F1EA 3ESNA 4QUOA 1HHGA 3VFUB 1F11B 4Q0XH 5AW3B 1PAMA 1UZ8A 2VZ1A 4QRPD 2PP9A 5I1GL 2AV1A 1PL3A 4OLUH 4GINA 3UROR 2B0SL 2XTSA 2FH8A 3C5ZA 2UWEE 4M62L 3C60B 3L08A 2QKSA 1K4DB 4YSCA 2BVOA 1PZ2A 2J4WL 2NR6D 4DK3A 1SN5A 3ZGIA 4Z7NE 2E46A 3EW3B 1UKSA 1FNAA 1WFNA 4MA8L 3TWCL 5IJBC 1YEEL 2CKNA 3FS9A 4JKPH 2IJ0C 2IAND 3HAEG 1J0HA 3L9YA 4QGTA 1A4JA 2NXYC 2XQYA 3ATDA 3HJEA 4HDIA 4LCWD 4K7PL 3W0WD 1I8LA 3SODB 5FGBA 2VXTH 3BXNA 3ZHDA 3UAAA 3G5VB 4WFGD 5F88B 4FQQB 3UJTL 1KY6A 3U1QA 1HHHB 3QIBD 2ED7A 5I8KL 2Q10A 5EU7C 3DK0A 4NPYA 2G2RA 1E3FA 1JV5A 4QYOA 2QQLH 5E2TL 5C08B 2YPVH 3W39A 2VYRE 3ARUA 1OKEA 1HL8A 4HZAA 1TCMA 4PVLA 2X6VA 1G1YA 3V6OA 1DBBH 4LVOB 4N2HA 4B5ZA 1MZYA 4BZYA 3FAWA 3G08B 4PTUB 3LZPA 3NCYS 4Y9CA 4OF3A 3RZCA 1TXKA 5J7CC 1OGTA 4FXGB 1SVCP 1W72A 2PPDA 1OTUC 1S9XB 2CBQA 3O8XD 4OZ4A 3B34A 1WFUA 4KKRA 4EKJA 1RZGA 4NWUH 1FE8L 5SWSA 1V5JA 5BJTB 4K23H 1RMFH 1MDAA 1NFIB 4ZAKC 5J89A 4KRNA 1NZRA 5DYFA 3IXAA 3K4DA 4Y4HB 2W80C 3PHOB 3BVDB 3LHPL 1ZVHA 2HWZL 2VZUA 5F9WB 1PZDA 1IGFH 1XF4B 2C9PA 4ZFOB 4OKVB 4CSPA 1U2CA 3UTZB 1HHIB 1MFAL 5DJ6A 3ULUH 1RUML 4TOYL 1RQ5A 5DZJA 5LBSL 3C60C 5I8CA 5KSAB 1ZGLP 1G9EA 5I24A 1K5NA 3HJ0A 4OM1L 3JWOC 1FIGH 2Q7AA 5C3IA 2MTAA 4ZFOL 1KMGA 2VXQL 3O9WC 5C8JA 2WXNA 4U3SB 1TR7A 4PCKA 2A6KA 3VD2A 2VCOA 1NBCA 3H2PA 3TVMD 3KPNA 4P46A 1PY0A 1ANUA 4XWGH 5CILH 1CPUA 4ZOEA 5KSBA 4HEME 5TPWH 4H8WH 2YD7A 3TA4D 3FZUC 1GHFH 1HILA 3COOA 3WENA 5HD8C 4FNSA 3P4OA 3DRTB 3BZ5A 2AEWA 4FCHA 2F54A 1WFIA 4X7SL 5JXAL 1R0AL 3RX8A 4EI5A 3EHBB 4P5TD 3QUGA 3QUZD 5C0CE 1CDCA 1E4WL 2OMYB 3QO1A 4AMXA 1CG9A 2CCVA 1J1OL 4K8RL 4MRCA 1CGSL 3CHQA 4FXGC 2KDGA 4HZLA 2W0LA 4J28A 4XI5C 5AAWC 4EIUA 1K5WA 1NUNB 3S34L 1W16A 4JFUA 1Q1JH 5C0AD 1MHPH 4NQXB 4PJHA 5KS9B 5AW2B 5D93B 3A67H 4JQIL 2N4IA 1JGLL 1LO5A 4RH4A 3D2UA 4PTTA 1EZVY 1FYTE 3HCVB 3OAUH 4F37K 3X1GA 4G6JH 1OAQH 5HGDA 1SVZA 4IOSD 4NKMB 1TTAA 1EVTC 2Y7SA 3RBSA 4RGNE 4NRZB 1QQDB 3MN8A 2O26U 5C07D 2NQDA 3TBWA 2GYSA 4IBSA 1YC7A 2WWMD 3MUHL 4P9HC 4WUUE 1U8KA 5JMOC 5DK3A 4QD2E 5CWSA 4ZUUA 3FO0L 3MJ8A 1W80A 1GGTA 2CIIA 3GBDA 3QIBA 1Z32X 4PRPA 5EC2B 1ML0A 3AUWB 4D9QE 3G6DH 1ILSA 1KTRL 2Q7NA 4HGMA 4HKJA 2X10A 1AKPA 3R7QA 1CXFA 4YWGL 4QT5A 4EPSA 4QTFA 1QFOA 3VH8A 4WF7A 5BO1H 3EXJA 4XCYB 1JSYA 1DSFL 1UEYA 3WI9A 3EJQA 2VXSH 1G9HA 2JB6B 1DQQB 1J05A 1A6WH 1RZ7L 1SDYA 4YX2L 1C5BH 2HT4D 3ELAT 5B4MD 2PO6C 1DJWA 4H0IA 2A73A 3VXTB 1QSEA 1J0KA 4OLWH 4K8RC 5BRPA 3GMRB 3E9UA 3UOAB 1GYVA 1LK3H 2ZKMX 4JRLA 4UDUA 5IBTL 1JZ7A 1YMMD 2ZCLL 3HB3D 3HS8A 3I9IA 3O3EB 2ZG1A 2PPFA 1Y1UA 2E7HA 1L6XA 4CAGA 1HSAB 4JRXD 1KCRL 1CF8L 1W8OA 3FTGB 3HC2A 5IK3B 4IRJD 4HMDA 3CHRA 3LAFA 3CGTA 4JMNA 3TBVB 2P52A 2TAAA 2VWEE 2ZCHL 4J8QA 3RWGA 4LLUB 4FQHA 4Z5RB 1R3HA 3RX9A 1TZHA 2LU7A 4TTDD 4UBDC 5FA3A 1NDTA 1ZVSA 3CLEL 4PJ9C 4QLWA 4E68A 4FG6D 5GPRA 2LHAA 1DFBH 1Y7VA 4F9LC 3ZE1B 4LLWB 4PS4H 1YA5A 12E8H 3EBAA 3DVGA 2XACC 4MNHB 3N9GL 2F61A 3Q06A 2UZIH 2QQKH 1CT8B 5LGJB 3MROB 3Q48A 3BMVA 5IMOA 2YA1A 4QXWA 4YK4B 1YC8A 5HY9A 5F3HB 5JOPD 2Y69B 4OZIE 4PP1D 4AE0A 4FLHA 4XBMA 5FWQA 2GAZA 4J3WA 3GLEA 4K94L 3FU5A 5MERA 4PG9A 3B2DC 3EYOA 3H3PL 4YHPA 4JDVB 3ZT6A 3LSOB 2NX5D 4YQXL 3WTWA 3NJFA 3BH8B 4HH9B 4IU2A 3SE3A 1I1AC 1Q9WB 3UPCA 5AKSA 4TQEH 3HBPA 2NTFB 4LCCA 5AZEL 3CC5A 5JHDD 5E1QA 1MJJA 1N5YL 4DESA 1KTBA 3PDOA 1BQLL 1X5JA 2K70A 5IESL 1OM9A 3FUEA 5B38A 4JFOB 4YDIL 4NT6B 4KFMA 4KDWA 3P4MB 3P0YL 1FUNA 4TPRH 5HVFB 1PTZA 2APXA 4FTVB 1H5BC 1RK0A 3QORC 3ZXAC 4N8VA 1MCIA 4PJ5D 1TFPA 1YUKB 2YZ1A 1W6LA 3CFDB 2J6EA 3AB0C 1WTLA 5MI0C 4LCUA 1NCWH 3VG9B 4QRQA 5TDOB 3WY4A 1RK7A 4ZS6D 1FDLL 2ADIB 1NGWB 4NSKB 4AMWA 3P11L 1ND0A 2QR0B 4X8JB 4KNQA 2BXZA 2VISB 5JIIA 4Z7WE 3ZKMD 3LIZH 3IN0A 4A39A 4M1GH 3DOIA 5LCVH 5E8OB 3S8FB 4RIRB 5AKRA 3LZQA 1GGBH 3OLDA 4L1DA 2R23A 5IT2H 3K6IA 3BWUC 1ECZA 4BWWA 3BVNB 4EJ1C 5BV7B 3MCLL 1WBZB 3FT3A 2VR6A 4L8SB 4MAUL 4U1NB 5CN1A 2KS0A 2WWKT 5ISZB 3FQWB 3WIFB 2ZUSA 2WWNA 3WSQH 4AQEB 4FZ8L 4ONHB 2H8PA 4FA7B 1A7PL 1SBSL 3D3VB 3NRQA 1TEYA 2C4FT 5BV7L 3WBDA 2NUPB 1GSMA 4YHIB 4XMWA 3IF1A 4RBPH 4UCFA 4P9MH 1KFAH 1SF3A 1AGDA 4KUZL 1MRDL 1F3JB 1FFQA 5JIMA 3L8QA 2W1NA 4HBCH 4LSQL 4PJ7E 2ICES 1BOYA 1O0VA 4GAGH 3EGDB 4NQVB 3U9PH 3BKCL 4HHGA 3DROB 4GUOA 1FRGL 1J5DA 1MVFA 2UZYA 1X9QA 2LAAA 3X3GH 5KYYA 1HEZB 4BQCA 3B9VA 2YGPA 4HU2A 5D1ZB 1TLMA 4OFQA 5DO2D 3CIQA 4OI8A 3GC3A 4UV7L 5KSBF 1VFUA 3GGWA 3M1CA 3BKYL 2WLKA 3SGJA 1UUNA 1UD8A 4JNXA 3L1OL 2D7NA 2VAAB 4ADJA 2MPAH 3CMOH 3WDIA 3P30H 3IU3A 4W9ZA 3OPZL 3UP6A 1CZ8L 1BAFH 1QFUH 2PNDA 1YPZB 1BEYH 2NY1D 2C7FA 2NQCA 1YEWA 3HE6D 5KYXA 3ORJA 2I9TB 3T77A 3VRJB 5D1QE 3OX8A 3MJ7A 3V6ZA 4QHLA 5B3JE 5KVFL 2JCCA 3G6AB 2YK1L 1KCBA 5DFTA 2ED9A 4OCLC 1FNSH 5EU3A 4N2OA 4R2GD 5TK4A 2KZBA 1UYWL 4Q4IA 4X9FA 3QAQA 2PW2B 1B0WA 4EIGB 4GPVA 5CR1A 2PP7A 4Y9FA 2YUXA 3S6CA 4YIQA 3RB7A 3FONA 5DFVD 5ANMB 5HYJD 1RZQA 1KT2A 1MN4A 2LTQB 3I74A 4NQDD 5IHLB 3U0TB 1ZANL 1JZ5A 2D9CA 3TNMA 1FL6B 1EZLA 4ILDA 1DBKH 1ZE3C 2BVQB 5CZXD 4AI7A 5AALA 3QDHA 3ZKND 4YHOL 1BM3H 4Q52A 3GS7A 3GZKA 4KROC 4R4FH 1XL6A 2Y24A 2GJZA 1CFVL 1YEFH 5CMAB 3SGKA 1MFMA 3IDNB 3QPQC 4S1DD 4PRIE 1Z0MA 3IVKA 3GSNB 2NUTA 1ZXKA 3VJ6B 3V4VA 4LVHB 5A2FA 4Z95L 4LPVA 3KJ4C 5DTFB 3LKNB 1HESA 1IAII 5EEXA 1OANA 5IB2B 1WUNT 1F58H 2XN9D 2P80D 5D6DC 1CICB 4MMZB 5AW5B 3SZKC 4YVUA 1MUJA 3HC4H 1WP6A 2YPKA 4DP6X 2VLJA 1HS6A 3GSNL 3QHFH 4XAKD 3GIVB 4AVKA 5LUMA 1MCDA 3RWEA 1P5VB 4MQ7A 1YLBB 3UTTD 4RISH 4RQQB 2VABB 3FDWA 4J8RB 5CEZE 5CHNB 1M1XA 5H35B 3ZSTA 4PJIF 4QIRA 4ZX3A 4YDJB 2O5XL 5I73C 3SDXA 4FXKA 4HWUA 2NQ3A 4JFDE 4XT1C 5DQDH 5E00B 1WGVA 3K4AA 1F4YH 3L3JA 4ENEC 2TRHA 4PJBB 3JTSB 2J8UA 1JERA 2P7TB 4IYKA 5IBLD 3CH1B 4MD5A 3SGDI 3KWUA 2O5ZL 1YO4A 2OL3B 3FUFA 5GGRA 2QGDA 3JVFC 4HUVA 3DNKA 4KRPC 2GTZA 2NZIA 4PRAB 3HFFA 1JVKA 3KPMA 5F3BB 4ZXBB 3HE7B 1S7RB 3H9HB 4M5YH 4AKOA 3AWFA 1E8ZA 4D7PA 2VZTA 2DQTL 3BSZL 1L9OA 2OL3L 5ETUB 4N0CC 1IFGA 4O2FA 5DHVH 2BHZA 3LRHA 4GSDH 3CV5A 3IJHA 4LXFA 3RGVB 1THAA 1U91A 4MJIA 4GUQA 4I8DA 4UOZA 2ISDA 2QLYA 1IBGL 4AW7A 2D03L 2PTUA 3ILDA 1DQTA 2D3LA 2AAAA 1RIHL 2VM9A 4M6OL 4J5VA 1R5VB 4JO3H 4HLJA 1EGJH 1HYSC 1Z2KA 2UZXB 3ARGD 1KXVA 4NJ9H 2FEJA 1YY8A 1YEGH 1SMDA 4LIQH 2VNCA 4PY7B 3BLBA 4XB3A 4D0CA 1MIMH 1CICC 3CVHB 1JWSA 2MSPA 1XCTB 4NQCB 4UAOC 3ARED 1RSYA 2BNUB 3OKMA 4KDTC 2FSEB 1HINL 1XH3B 4YHMH 4M7KL 3MV8E 4WHYH 1JS4A 2J72A 5HI4D 3CSTA 4M3HA 4HIIB 2CGRL 5EBWA 3ULSB 3AM8C 5T3ZE 5I76B 3ABLB 2V5MA 1JGVL 4OAWB 3MC0A 1AO7B 3JWNC 3U6RB 3WNMA 3IJYB 3K2KA 3CVHL 1MCHA 4ZTPH 4XMTA 5L4MA 3CJJA 4PJ8C 4G1EB 5I1KL 1KOAA 4XH2A 2BSSA 2YD9A 2BIOA 5ESVA 3U46B 3AVEA 1BFSA 2B20A 4EZLA 4WI2A 2AKRA 3CN1A 2APBA 3D25B 1IC0A 3IDYB 3BGFC 1F2XK 2EDDA 1CU4L 4FL4B 2Q20A 2BDNL 3GQFA 5HP5A 3LZFH 2D4FA 5D7LE 3BN3B 4A2HA 1AZUA 3AG1B 5ADPH 5DUPH 1NFDE 2IIJA 5AOMA 2H3XC 1OP5H 1HI6A 1R3LB 4GI6A 4NP9A 3HE7C 4LO9A 2BHFA 4JFSA 5CGBA 3SQBA 3STZA 1FH5H 2WTPA 2XN9A 3D87B 1A6VL 4R4BB 3VYPA 5I19H 3IFOA 4G8GE 4ZPVA 3O4OC 3V4PH 3DHJA 5GRUH 4HPYH 4QTIH 1RURL 3QO0A 3DX9A 1G7PA 3QGVA 1PD6A 2AK1H 3GI9H 1WS8A 3CFIC 4IBUA 5DA0B 2VXVH 3AU1A 5C0EA 1Z0NA 4GXUN 2CLVB 2B5IB 4BXVA 2EDMA 2OA9A 3NFSL 4NUMA 1VCAA 1RUQL 4PW4A 1NGZB 5IIEA 1OT2A 4ZFFB 5LO7A 4UT9A 3STLB 1XB6A 1IJ9A 2B9AA 2ZX5A 5I1LB 3F7YB 1X5LA 4DKFL 2UWEB 3IJSB 5DHXB 1NAMA 2OYLA 2OR9H 4P59L 1T5XB 5LBVA 3AGVA 1USQA 3WE1A 2R7EA 2GKIA 1MI5D 2O4EA 3V5KA 4OCRH 3FO1A 3UPRA 1BP3B 4PJGB 3RDTD 3UYRH 3C75A 4AENB 5A16A 5JDJA 2NXYD 1KGIA 2BINA 4Q9BA 5CIPA 2JVUA 4YBLB 2YWZA 5CP7A 3DVNA 1D5IH 4JJOA 2VLRD 4YHKH 2QBWA 3UXFA 2D4DA 1NCGA 5FXCH 5TTRA 3DX6B 32C2A 1CJYA 5DUJA 4OVUA 5FFOA 3SKJL 4G6FD 3ZYIA 5KW9L 3X14A 1CDBA 4Y2DD 5D7JA 2OZ4L 2Z93B 5L2KA 3OB8A 4NO2B 3TZVA 2XJKA 4MQSB 3LXUX 4MNGE 2JF1A 4KQ4L 3WGUB 3IDJB 2CNYA 4G5ZL 2JCCF 4FZEH 4O58L 1OTUD 5F7DB 4NN7B 3TV3H 3MLZH 4KI5D 3NAAH 2ENPA 1SFDA 2JJTA 4F7EB 5HGAA 3HAEB 2XFXA 1E28A 3F7VA 4UIMB 4ZAKD 1KIRB 3U4EA 3WN5A 1PZ5A 5I5MA 4YFEA 2EDWA 2D73A 3IJEA 3IKCA 5AVVB 1B3JA 3ATFA 3R1GH 4OB5H 5KOMC 5DFWH 2EABA 2HKHL 2J43A 3DHPA 4ODHL 1TFHA 4ZO7A 2B5IC 1OB1A 3PWPD 2IGFL 4LSPH 4FYTA 4Y9GA 4EO5A 4HFUL 4XN9A 3C60D 1MSPA 1D7FA 1IZKA 1OHQA 3VGHA 1DJGA 2AJXL 5EOCJ 2BVPA 1A65A 1AYRA 4J1UA 1BVNT 1K3ZA 1NCCH 2QHRL 4DJMA 1GS6X 5CD3B 2XZZA 3BUPA 1UGKA 1I7ZB 3R4DA 5AAMC 4CGUB 2A4EA 4MJHA 1J1PH 3IS1X 4LNRA 1TQUA 3L5XL 2IADA 1MHHA 1BZEA 4P2OA 5FGRA 3M7OA 2Y7LA 4HX1A 1Q38A 1UWXH 2ZQKA 1JYNA 1MLCB 3FSVA 1MCWW 3PL6A 2Z31A 4UB0L 3LY6A 5HD8D 1R46A 1LO3H 1D2OA 1RZIB 2ERJB 2PWHA 2GBTA 1F3DH 3SDXF 5DMGD 4WFHE 3D1MC 5J56B 1DQVA 4P3CL 4Y4FB 3DUSB 3UBXA 3SDCC 1PG7L 3MODH 4LLVA 3ZTNL 4TLSA 3MHZA 5C0CB 2A6IB 5AW4B 5KVEE 1Z1WA 4IM8A 1JPFB 3V9CA 2EILB 2J8UF 4XI5D 3ARDB 3GHBL 2KKQA 5CUSL 1NCUA 4GQPH 5EIIG 2ESVE 3HZVA 1G7LA 2EEDA 3VWJB 3T71A 4YSSA 1CGVA 1RXLA 2AQNA 2CQVA 4HWBA 1QPPA 2IC2A 2W91A 3QW9A 1JUFB 2FBJL 2VM3A 4Q9RH 3QNZB 1PZAA 1I4FB 3WIAA 1T1XA 2FRGP 1I7RA 2MCG1 1QEXA 1T0OA 4Y4HD 4JGJA 1JK9B 2JLLA 3A6OA 3O2WH 2R2HA 3RDTA 4L9LB 2I60H 3N40P 3ZTJH 3BEWA 1M2VA 4OZHE 4NM4H 1F3RB 1GOFA 3NN8A 2OMXB 2VLRA 1J5IA 4UQEA 4WUUB 2NW3B 5KSAD 4P23B 3AS2A 1VZGA 3VTAA 4KVCH 1O5DT 2F18A 1OAUL 1IM9D 2HP4A 2NY3C 4AK2A 5E2JA 2W65B 4L3EE 4OJFH 4Y2DA 4U2YA 4PWEA 3S4SB 5AAPA 2DQDL 4HUUB 1LWRA 4MJ6A 4Z3GA 1X7QA 1E6JH 3BWAB 3KCPA 4JM0A 2HG5A 4N20A 1N4XL 3HLAB 4WKZA 3NJHA 1ZGLA 3GEWB 3ARTA 2NY0C 2PO6D 2C1PA 1C12B 3IFNL 4K8RD 1JGDB 5GRXG 5HHMD 4AJVA 3ARXA 3UL4A 3F12B 3R06B 2ERJC 4UTBH 3IFLL 4MDRA 1JZGA 4QO1A 1OAKL 2PR9A 3EHBD 4GIAA 1DSWA 3E2HB 2D7OA 2X4UA 2WXFA 4TKWA 4R5XA 4Y4FC 3QRGH 1AHKA 4XPTH 3RX7A 4WFFD 3VFUA 4FHJA 2CBOA 2HLAB 4JFHD 5DJDB 5IROC 3CK0H 3GB7A 3OHXC 1CI5A 2NY6B 5EEYA 3MOAH 5HPOA 4DNLA 5IWLA 3L4TA 1BLNB 2NCEA 3QB7C 3U4KA 1A7NH 4UBDD 4BKSC 1K4DA 4PJ9D 1XEUA 1SOQA 1PLGL 3B56A 4XMXA 5D2NB 4OT1L 1XH1A 2PR4L 4NC1E 3U36B 3ASNB 3KLLA 3SGJC 1KN2H 2VDPH 4NQED 1L5GB 3D4YA 3SZ6A 1EFXA 3M6DA 3HR5A 2DLFH 5FHBH 3G5VA 4G80B 1EVUA 5F88A 3TIEB 4FQQA 4YEFA 2VR3A 3NZ8A 5LQBL 1HHHA 4P99A 1S7QB 3TJEL 3VGDA 2MH4A 4NGHL 3SPGA 1F97A 4OTXL 5INDB 4OZIB 4XO9A 1FSKC 1M6OB 1MQKH 3LXCA 5C08A 3QDMD 4ZMYA 1I1AD 3IDIB 4TTGA 5CLWA 1KPRA 4B9YA 1BGXH 4QKTA 2QADC 3HZ3A 1YZZA 2K6ZA 2O6EA 5A2KH 3G08A 1CR9L 2RJMA 1W91A 4ZUVA 2FDBP 2XWDA 4WWKC 3NACL 1IL1A 3HZMB 4MXVE 1L3WA 1S9XA 3HFMH 3K6NA 1HC1A 4LSDA 2XG5B 5FFLA 3A4FA 4FERA 2UX6A 3ELQA 1AE6H 2CJTA 4LBAA 5BJTA 1RFDH 4JO2H 1P84J 3BO8B 3QORD 4K5MA 4KTGA 1NFIA 1PBYA 3HG1E 4BM7A 4XXWC 3ULVC 2XWBB 4U2ZA 3E2HC 4DN3H 1WTGT 4Y4HA 1IC7L 3T6VA 2ROXA 4G7YH 1YEHH 4ZFOA 1P6FA 1Z9LA 1PY4A 4HEPA 5JXEC 1WZ1H 3CVCA 5JQ6H 3C5SA 2YJQA 3RFZB 5KN5B 5KSAA 5JR1H 4GO6B 1KXHA 3QWQB 1OP3K 1NSNH 5D2NC 1ZK9A 2J20A 5E99H 1F00I 3B2VL 2WTOA 5BRZE 3N85H 4P4KA 6FABL 1KN4L 4V33A 2VH5H 4NS0A 2ZWLT 3WFDL 1OAZH 2BJML 1CQKA 3QCVL 1SMAA 2HVJB 3QXUA 1YRKA 4FRWA 1WRFA 4DGIH 3WJLC 1AI1H 1VA9A 4JDEB 2AXJA 4ZMXA 5D7SH 2DQIL 4QRUB 4YH6A 5GGVL 3VFWB 3KVDD 4K3GA 1OARH 5E5LA 4JZOB 3S9DB 3QPXH 3P54A 3X11B 4MMXB 3GJFH 3IRCA 5F7UA 2HFGH 4AL8H 4UOQA 3QEQE 2OCFD 2XN1A 5I1CH 1JYXA 1L7IH 2KLSA 1CLYH 4PGCB 4U1SB 2A99A 1KBGH 2Z64C 4JQIA 1BOGB 2OMYA 4H88H 5KBLA 4GSUA 4PJ7B 1T2QL 3BI9X 3ZIYA 1JFHA 4L0PB 1M42A 4QXUL 2E3VA 1TQSA 1X4YA 1FFNB 1JF6A 1T66D 2CGZA 3A21A 1P4IH 4WY7L 2HAZA 4NQXA 5B22A 5KS9A 1UOKA 2FT6A 4FTVD 2CXKA 4EZKA 4PGDB 1A9BA 1XGUB 2YEQA 4FC3E 3WY3A 2NYZA 1TKWB 3B37A 2F68X 3MVSA 4NRXB 4YL4A 4AYMC 6CGTA 5DDHB 4TULH 5BVJA 2B14A 1YAZA 3D4CA 3HCVA 4YSAA 3NVQA 2ATAA 3S35L 3MRMB 5CJOH 3EO9H 1WBXB 4NKMA 5EF0A 4XMKL 3OMZA 4N22A 3FFCE 2H9GB 1QQDA 2A9ML 4NRZA 5JZ7C 2J2ZA 4L1BA 2V5YA 1BBJA 3PGCB 3QQDB 2BXYA 4MGXA 4BZ1L 1EUUA 5F21B 2F8VA 1QHQA 2VKXA 4PW3A 4TNVF 4YFLI 5EC2A 4LASL 2HUEA 2XXMB 2YQ3A 1UWEL 5DLLA 3B3IB 2IFFL 1VFAB 3UJIH 5D1QB 3DDFA 3JUZA 3MNDA 4NBZB 1PZBA 4XCYA 5ISZD 4ELDA 3TA3B 3RPBA 1EHXA 2HKFL 4XPGH 4QHMB 1DQQA 4BFIB 1WCBA 3TT1L 3L3GB 1C8QA 4UQBA 4YSUA 3VXTA 1QBLL 1QA9B 4MJ5B 1BJMA 2XKUA 2E7LC 4N9OB 3GMRA 3D33A 5FM5M 3CFJB 2V3DA 4JHVA 3NZHH 4KNUA 1UD3A 4IEFB 4LQFH 3O3EA 5E9AA 3VAEA 1RULH 3DLQR 3RTQC 4K9EL 5T3XH 2VW6A 4KROD 3FTSA 3GZOA 1UOLA 1DVFC 4HWZB 3DSFL 1Q9KB 2DQHL 3FB5B 2FX9L 4PRIB 1A4BA 4LOEA 1M53A 3L4UA 4M7ZC 4WW2B 2XN0A 4ENZA 4LLWA 1H6UA 4LU5H 25C8H 2OK0L 1IGYB 2C9XA 1Z66A 1M4KA 1GYUA 3EDJA 4AZUA 3OWEA 4KI5F 5K69A 4MNHA 4F5CE 5KSVB 3KM2A 1V3KA 4HULB 4IU3A 1DP0A 1PYWB 4XVSL 1QG3A 1CT8A 5LGJA 3IJ9A 1YNLL 2W9EL 2R0WL 2DDQH 3DTDA 1F1DA 2P47B 2W95A 3MCG1 1DZBA 5F3HA 3H9SD 3CN2A 4KITB 2HRGA 4OSUH 4NP4H 2H2PD 5DD1L 2H45A 4EAEA 1CN4A 1UD4A 1XTMA 5DK2B 3HG5A 5G55A 2QSCL 4YHNB 3BH8A 4HH9A 4JFDB 1Q9WA 4ENED 1QASA 3SPJA 2FIRT 4DVBA 2V5SA 3NTCH 1FF5A 3GKWL 5FKAB 4GO9A 3TA3C 1GZQB 5KJ4A 3V5HB 5CEZL 4JHAL 3GUTA 1PFOA 5L6YH 1ED3B 4CRPA 4KRPD 1IVTA 2BSTB 3L3DB 4JFOA 4HOWA 2VDQB 1HL5A 1FPTH 2EYSB 4PCSA 3P4MA 4OZFA 4R5TA 3FULA 5HDOA 5A2CA 1SVBA 4OM0H 3HG4A 5K59E 2BNQB 1BVKB 3DA0A 3FNKA 1FV1B 1URLA 3Q5YA 5KUKA 4JW3A 2BVTA 2KL6A 5AB2A 1C5CL 4YOKA 5L88L 4OD1H 5J3HC 4X5WA 3SGEI 5DT1L 3QCTH 2ARWA 4QRFA 3J2PA 2VDQL 3UZEA 4D9RE 1RUPL 5TDOA 4L1SA 2ZT9C 2ADIA 3V5DA 4MVBC 1CK0L 1NGWA 1N26A 3QIUB 4NSKA 4RMTA 1T0NB 2QR0A 4X8JA 1NGQL 3MBWA 5GGUB 1HDMB 2YN3A 4S2SB 2VISA 2WM0A 4AQ1B 3UAJA 2XQBL 1FNGB 3LNDA 1NCDL 1A7OL 2FX7H 1HYSD 1TVHB 4IMLB 4TUUA 4WW2C 1GGUA 5E8OA 4AEEA 1TENA 2Y1VA 2ZYSA 4RIRA 5AVYB 1CICD 3WUWG 1EIBA 3O3UN 4FG2A 1WBZA 4L8SA 4LPUA 5TFSL 4ABVA 4HJTA 2GK2A 4RLDA 4S1QL 4U1NA 1PFCA 3ILEA 4F8PA 4GQQA 3FQWA 3MV8B 2V2TB 2GC7C 4AQEA 5F8RC 2B1HH 3PXLA 5IMKB 1UCTA 1D5ZA 3JV5A 2P48B 1P1ZB 3D3VA 4UUJB 1QLEB 5H8DA 3VM5A 3GF8A 3C08H 1NUDA 4PJ8D 2CDGB 4TQHA 2NUPA 4YHIA 2QMJA 4JEGB 4XCEA 2ZSWB 4AV5A 1OB0A 2HJKA 5EUOE 1KGCD 1F3JA 1BPVA 1JIBA 1RZJH 1P7QD 2H26B 3KPOB 1L7TH 1QLEL 1ZTXE 4HIHB 5ESAB 5FYJU 4CC1A 5HDRA 4UYQA 4PJ6A 3OR7B 2CDEA 4ALAC 3H9ZA 5EEWA 4A7GA 3EGDA 5HJGA 5I0ZA 1RVFL 1H6EA 4GKNA 5D7LB 1KXQA 4J3XA 1UWFA 3RU8L 2YXVA 1NFDB 4DWHA 4JL1A 3AQZA 3PL6C 3HE7D 1HEZA 3BP5B 5T8IA 1JZ4A 4ZNEE 4AXWB 5D1ZA 4GRWH 5HHOA 1N0XH 2ZX6A 3UTQB 1ZD6A 1AQMA 2JJUA 4QOKB 3VNZA 5I1IH 3ARVA 5EO0B 5I1EH 4G8GB 1K3IA 5D71H 1AJ7H 1RU9H 2EINB 5HYQB 1A4KB 1QVOA 3DKHA 4UQ2B 4ZUTA 1QHPA 3QIUC 3F83A 1M3JA 4MQXC 3WTSA 4WRLA 4XVOA 2Q3ZA 4AQ1C 1KB3A 1S7VB 2DL2A 3CD4A 1YPZA 4FGMA 4RX4D 3CMGA 4ZW3A 2Q2EB 2BP8B 3POHA 3I6KB 4KGJA 2VITA 2H2SC 2I9TA 1IQDB 2VW4A 4NQCD 3KXFE 1HQ4B 3VRJA 5FB8A 5JW4Q 3OR6B 1TYRA 4HETA 4UAHA 3UTSD 5CCGE 2FB4H 1KUMA 5KS9F 5KBNC 1DBMH 3MQIA 3G6AA 3VXOB 1IU1A 3Q5OA 1PZUB 3H3BC 4LP5A 2CMRL 1GJIA 2DTML 2QFPA 5FIEA 4WU5B 3Q1EA 4POZC 2PW2A 9CGTA 3FSOA 4PJXB 3G5YB 4WEUD 5DJ0B 5ANMA 2HLFC 4NFCA 4WSJA 4YXKL 4DKEL 4I2XE 1O7DE 3BAIA 4I13B 2RA1A 2VUYA 4PHZA 2D2OA 1EQWA 4UYPA 1FL6A 4GQ9L 1QZNA 3WO3B 2BVQA 3P3YA 1JPTH 3Q2LA 1R5WB 3MOBL 2HT2C 2WQRA 3UBFA 2DH3A 3S3JA 5GZNC 1WZAA 2BFVH 5D9SA 5IM7B 5CMAA 5C3TA 2FJGB 4NIYE 1QLRB 3ZL4L 3C87A 3HNTH 3IDNA 1CGTA 4OBRA 2WBWB 1H3PL 4C4KT 1TG8A 3GSNA 4LOFA 2DRUA 5TF1L 3VJ6A 1GPOH 1IQWL 4MNGB 3UGEA 3LKNA 3KR3H 1JHTB 4XOEA 3BN9C 1X5HA 3EYVB 5IB2A 1N10A 2Y2TA 3MUGA 3RVWC 4ZOAA 3LDBB 4R26L 2GW5A 4MMZA 3RBGA 5CGYD 3EJJX 4YS4A 4HC1A 1BZ7B 1SLUA 1P5VA 2X44D 1O7VA 3O0LA 5K9JL 1QSVA 4RQQA 4AMKL 2WCSA 5F7HA 1PX4A 5DJZB 5BVPL 4J8RA 2DLHA 1VEPA 2AJUH 5CHNA 3FRPA 2UUDH 5D1XA 3RUGA 4YDJA 4LLAA 5L9DL 5JHLL 4MJJA 4AYBA 1ZS8B 4GQZA 3VSVA 3CG8A 3DIDA 4JFED 3T1WA 1TTFA 3BW9B 2KLRA 5CKGA 4X4YA 2R29A 4X6EB 4QXGL 3MLUH 2CM6A 3JTSA 1IM3D 2CBMA 1A6ZB 2G60L 3T8MA 1EHKB 1FO0H 1FZJB 3CH1A 3ZE1F 4UTAL 3BSZA 5HVGB 3JXAA 3A6BL 1ZHNB 3RAJH 2EYRB 2ORBH 2Q6WB 2GSIB 2PYEE 3MRCA 4PRHA 1H8LA 3U1PA 5E8PA 3WO4C 4KZEL 5GGTH 3OXSA 4ODVL 4GUPA 4PRAA 1TF4A 3MRFB 4KAQH 1HIMH 2FBOJ 1TTRA 1I8MB 4ZXBA 1OAYH 2ZE0A 3AGWA 4X42A 5E6IC 1S7RA 4AJYV 3L54A 1HL9A 3H9HA 4X0KB 1IO4C 4HH8A 3N1FC 3ZRCC 2BLFA 5ETUA 3QUXA 2P4AB 3U4BH 1J9SA 1PLAA 1TZ8A 2FQDA 2X9YA 4GS7C 3RGVA 1GY1A 4YLBA 4GW4B 2YGNA 3ETBF 3PUCA 1YYLL 2JJVA 3B1UA 1HXMA 1A5FL 4CMMA 1SQMA 5AYQA 4JFPB 1U6AH 2UZXA 2H0EA 5F6IC 2WIIA 3QJHB 4I18B 2NMSA 2XKSA 5IB4B 1A3LL 4LVNC 1OSEA 2HTLC 2ESVB 4WEEA 3PP4H 1XCTA 2BW4A 5MEND 3NABL 1N7MH 3BT2L 5E6RB 2FSEA 4GJTB 4JFFA 1FFPA 1XH3A 4LVEA 4N28A 4AKPA 3B9KC 5HYSB 2W92A 3PG2A 3ULSA 5I76A 2YQBA 2EUWA 4OAWA 1AO7A 4L4VE 2BWDA 1YY9C 1CVSC 4HCRH 5K39B 2WZPA 4OZHB 5JW3L 5H2BB 4ZMTA 3DI3B 3GXNA 3KDPB 3ZJAA 2YRZA 4OD3H 3A6CH 4FI7A 1FZKB 4JMXA 4GLRH 1Q0YL 4P4KC 3OAZH 3QJSB 5E70A 1SHXA 1IFHL 1W0YT 3D25A 4KK6C 1CLVA 1SHMA 5I0XA 1A9EA 5EIVA 4HKBA 2XT1B 5TE7H 1J5HA 3GI8L 4MCYB 5DJYA 5AZUA 4CJ1A 3E3QE 1ZEAH 3D0VA 4HJSA 1JTTA 1ZDQA 4CSTA 2YKLL 2NY0D 4NWTL 3WEMA 1CE1H 3FN3A 3BKML 4R4BA 1S9VB 2N7SA 4K15A 4AKQA 2XG4B 5K1VA 4ATTA 4MNQD 4DETA 1JBJA 3MO1B 4AC4A 1MG2C 3CSPA 1BVNP 1KY7A 2JNZA 3QWRA 4KY1H 4Y4FD 4N6QA 2DYPA 3L3HB 5C09E 1XB8A 5C0CD 3NA9L 1OSZB 1EX0A 1Z3GH 1IAOB 4XBPB 2CLVA 4KTEH 2V9TA 2BRQA 1JG9A 3G5ZA 3ML8A 1NGZA 1CD0A 4ZFFA 1S2EA 5GISL 3H1ZA 1ULVA 5I1LA 3RL1B 3F7YA 3LRLA 4A7GF 2UWEA 3IJSA 2FLBT 4PW9A 5I0WA 3NJXA 1WAAE 4KKPA 4XX5A 4NFDA 5TH2B 1PD0A 5CINH 4OFDA 1OTSC 1RJZB 1NA8A 4HS8H 3K4ZA 4HCGA 3O3AA 3FTYA 5E6ZA 4XN1A 2V2XA 5C0BE 1MFDH 4A68A 5MEOB 4WCYL 4DN4L 4MXWL 4CBZA 2WUBL 3CCHA 1IEAB 4Z0BH 1YNTB 3BGMB 1ACZA 2CU9A 3NGBB 3WJJA 4YPJA 4GKSB 4FQJL 1CD8A 5DJ2B 1IKOP 2FR4B 4GT7A 3DX6A 3KPTA 3ZKXB 2JKSA 2QZ5A 3EH3B 2P44B 1YPZF 4CU8A 3G6JA 3S8GB 2EYTA 2ZOUA 3BP4B 2QADD 3ROLB 1D6EA 1RHHB 1H6TA 3NSDA 4NO2A 3D05A 5EMYA 3W5NA 3IDJA 4P3DB 4HHAB 4ODTL 4L4JA 4U33A 4WWKD 3V52H 1WWWX 1SXAA 5I28A 5F7DA 4CU7A 1EMTL 2Q76B 4U6XA 1GVIA 1T0PB 5IHHA 1RJYA 1UEMA 4F7EA 3HAEA 2X3BA 4O2EB 5ABAA 2X4OB 5E2VL 2N1KA 4UIMA 5KAQF 1KIRA 2CUIA 3KHOA 4YNYB 3ULVD 4XO5A 3D85A 3KPSE 4L2LA 4U1KB 1HEJC 3BZ4B 3J7HA 2CJUH 3LB6D 3UGXA 4EUPB 4XCCH 4JQXA 3VE0A 2ZXAA 4UV4L 4FYSA 1EXGA 2C9SA 4U1JB 4ZX6A 5AYUH 4J3VA 5JXED 3MBEB 4L5FH 2ITDA 3T0EE 1ZHLB 3IWVA 5HPMA 2H3NB 1KJ3L 3BX7C 2MPVA 4NHCL 5F8QC 1NPJA 1BECA 2IWGA 1WEJL 4YL9A 1HXKA 2QJDA 3U7WL 1WYJA 4HG4J 1SLVA 2PCFB 3W9EB 3TONA 5CD3A 4ODWB 1NBVH 5F96H 5BRZB 2X41A 1I7ZA 2VDNB 1FFTB 3EFFB 5FFGA 2LT9A 3LEXA 2VN7A 3NJMA 4PP2B 3WEBA 3DXAD 1KB5B 3U0WL 1H0DB 3MSPA 4AEHL 3JV0A 5HHVH 2CUHA 2LLNA 3ISRA 1AQKL 1MLCA 5JDSA 4B60A 2VDNL 4JB9H 2XWJB 3HVDA 4WW1B 4HEMA 3ZKXC 5AENA 3U7YH 4M8RA 4DQOH 4D8PA 1RZIA 4NQSB 3RUGF 1KB5L 1NANH 2QPDB 1NKOA 3QEQB 3SDYH 3QFJD 4N90D 3VDCA 1SLWA 4L37B 4MZIA 3HS0A 3DUSA 4FQPA 4I77L 2B4CH 2XA8H 3G5WA 5C0CA 2A6IA 4PJBF 3NK4A 1T21B 1JPFA 2AK4D 1HQRA 2IG2L 4M02A 3WFHB 5C86A 3ARDA 2RFXA 3S98A 5C7ZA 3V4UH 5B1AB 3RYMA 1JNJA 4EDWL 3EIFA 3QEUB 2OJZL 1XSJA 3MR9A 4ZS7L 3VWJA 4CADB 1DQIA 1ADQL 5F1OB 4KV5F 1JUFA 1MCRA 1ZE3H 1KGJA 3BYTA 1HH6B 3QNZA 1I4FA 4G8EB 5A3IC 4YXHH 1LWHA 4DQAA 1FYTA 4L9LA 2Z6FA 4MTMA 3QG7H 5FO2A 4XP4H 4E9RA 5FUOH 2YD3A 4DERA 1Y0LA 5CBEB 5JZ7D 1JRHI 4PB0L 1YYMH 4K2UL 5EB9A 3QSKB 3UEZA 2OMXA 4WUUA 2NW3A 4ZQKA 4P23A 1AR1C 5L4IA 4WO4C 2XI9A 2HSIA 2FWOB 4KK5C 3RRQA 2WGXA 1GGCL 2A83B 1X4ZA 1SYVB 2WVTA 3N42B 2Q86B 3QT2A 4EVNB 3IGAB 2W65A 2ZOKA 1S5HB 2FX8L 5BZWB 5LAXB 3IDGB 5ES4B 4HUUA 1R47A 3W56A 2GJPA 3BWAA 2DMHA 1QRKA 1I7TA 1XCQB 4JPWL 3BD4A 3HLAA 2C7UB 3EKCA 2K9UA 4YSRA 1J0IA 3VQ1C 1C12A 4FQIL 2BH0A 3FT4B 5C7XL 3TX4A 1N64L 5BMFH 5CF3A 1U42A 2FVNA 3F12A 3R06A 15C8H 3OKKB 2WXGA 3MRHA 3ZBMA 1UGNA 1V7MH 2K1MA 3BUYB 4WDIB 1TSRA 3ABKB 3APFA 3B2MA 5FYLD 2A3TA 3PE9A 3RTQD 3VFGH 3LS4H 1KCUH 2AXFB 2GITA 7FABH 4PJAE 3RA7H 3FUKA 2Y7QB 2OSLB 2X0UA 1MAMH 1BLNA 4M8VA 2FEEI 1G94A 1SGKA 2JKXA 2OMNA 4B9FA 1E5CA 3PJSB 3IAQA 1TITA 3Q8AA 1S3KL 5DEGB 1JWUB 1LILA 1VGEH 3GBNH 3GIZL 3MLRL 3U36A 3UIZA 4DOHB 2BHYA 2WAQA 1L5GA 1KTDB 3FMGL 5A2IH 2CDFB 1GZPB 2KZWA 3P0VH 3ES6B 2VN5A 4HSQA 2Y06H 4G80A 1W72H 3TIEA 3W9DB 3APMA 2G4EA 3FPXA 4GXFA 4V11A 2ARJB 2FGWL 1X3DA 2BSDA 4OZIA 1U8CB 2KPNA 1INDL 1ZMYA 3LEYL 1UJTA 3IDIA 2XNAB 2ZUYA 4HIPA 1SHWA 2UWEF 1TO4A 1ZA6B 3VRIB 3TA3D 5EF3A 4KJWD 5T1KB 4D8OA 3O6MH 2XN2A 3KM1A 4F2ME 3MYJB 3OLIA 4Z7NF 2Y07L 2GJ6E 3HZMA 4B6ZA 4JDZB 4DP2X 2CO4A 1MFEL 3EF4A 2DJ4A 4HK3J 4M8UA 3BRDA 1XSKA 2D3JA 3AG4B 1PSKH 1YG9A 3MU3A 4O9HH 3UDWA 5CD5C 1J9CT 2XWBA 1DVQA 2YBGA 4MLSA 1MVUB 3PABB 2F8OA 5J3HD 2VR4A 4LRIA 1MEXL 1S5IL 4OQTL 1F90L 3C6EA 3NBNA 3V79C 2HA1A 1ZTMA 2QSTA 4U3CA 2NY7L 4MVBD 2W07B 5DHYA 5CM1A 2XICA 3N40F 4GSQA 3RFZA 1KTJA 4PRID 5KN5A 1SZNA 1ASQA 2YO3A 2Y5EA 4Z7WA 4E41E 2RQ8A 1K72A 5DQJB 1JTPA 3KWWB 3U2IA 1A6UL 4FFYL 4H26B 3SQOL 1I1YA 3CZFB 2L7QA 3C6SA 4JR9H 1D7BA 3CLFL 3N2JA 4X8GA 5TF0A 4P04A 3FCTB 3UBHA 2HVJA 2HZHA 2Q1EA 2W8CA 2M8XA 3IT8D 4UM8B 3CIAA 2E9BA 5DS1A 2IPTL 1I9JH 3CFKB 4QRUA 5TQ2H 3O0RH 1IAKB 4JZOA 3X11A 3P4NB 1B0GB 3DYMA 3ZR5A 1TQWA 2NZ9C 3V0DA 4HOMA 4IDJL 5JNYB 1F8TL 3VFSA 4NM8L 3HMXA 4QRPE 4TLUA 5IFAH 1HH9B 4M8QB 3FO9B 4IKIA 4O4YH 1NPUA 1MHEB 4PGCA 4P2QD 3T2OA 4OLYL 2JB5L 4HUXB 1BOGA 1AP2A 4HF5H 2HG0A 1MCPL 4AG4L 1KCVH 1Z9MA 2KBGA 4LRNL 3PWJB 5FUZL 1UH2A 4OCWL 3KGUA 1ZLWK 2CPCA 4ZO9A 2FWLB 1XF2B 3ZLQC 3HPLB 1K8DA 3DRQB 2IANE 3Q0HA 3T3MB 4KKCC 1OCOB 1Q0XL 3W0WE 2BNQD 2EEAA 4LCWE 5CN3A 4RGMC 4IIQB 4PGDA 1XGUA 3SE9H 1TKWA 4WFGE 4BZ1A 2NT1A 1TTCA 1M7IB 1ZTXL 4XVJH 3NIGE 5DDHA 3NEOA 2IQ9L 3F7KA 3SPVB 4XNBA 1NL0L 4P5MB 4I3RH 3MRMA 4XVUD 1X5MA 2DZEA 1SYSA 4L8CB 3F7QA 1G9NH 2H9GA 2RACA 3QQXA 1NFKA 1I82A 4PJEE 3QCUH 1MG3C 2EDXA 3QIUD 2BSBA 4MQXD 3PGCA 3QQDA 2VMFA 4HOXA 5KBKA 5F7KC 1B2YA 4RRPG 4N5EC 5IR1B 4NN5C 4NZUH 4OLXH 1FH2A 2X12A 2R69A 2H2SD 3TBBA 1P4BH 5E5UB 2B15A 1P5UB 3B3IA 4ZD3L 1VFAA 1LYQA 4XCNB 4RVBA 1CD9B 3KXFB 5D1QA 5FOJA 3D18A 3U2SB 2G9HB 1RHFA 4HIXH 1M05B 2O6CA 3MV8D 1M7UA 3AG2B 4WJKB 4QHMA 4M3JA 4BFIA 2HFEB 5GS3A 3FUIA 3L3GA 3CHSA 4POZD 2MQCA 2V3FA 1FC1A 5F7EH 1QR1B 1AGFB 4MJ5A 3BUQA 4CILA 2HLFD 3R0NA 4LLMB 4ETQA 3CFJA 5EFIB 3EOTH 1OAJA 1DO6A 1BQKA 1RL1A 2A7BA 1DANU 4FE9A 4IEFA 4KKZA 2DY2A 3ZZSA 4KKNA 2HT2D 1BJ1H 1DLHB 4DUVA 2VDRB 3GBMH 5GGQH 1F13A 4Y4KB 4BH8B 2IXQA 1JZHA 2JKRM 2JIXB 2BSED 1Q9KA 1OW0A 3FB5A 5J1TC 4PRIA 1R3IH 3DYPA 2I07B 3BN9D 1TZGH 4IIQC 3LN9A 3RVWD 2JKIS 2VDRL 1BQHG 3BD5A 4BK5A 3LPFA 2RGSA 2WWKO 3JTBA 3E80A 1KNOB 1UVQA 4QOKD 5DXWA 2A38A 3N1QC 5KSUB 1QEWB 3I75A 4G8GD 5ALCL 4CGTA 2H4EA 2QQLL 3IMWA 4IKLA 1X4XA 1WC7B 2YPVL 2YD2A 4OLEA 2P26A 1WDAA 2ZOTA 3BE1L 1M6UA 3V0VB 4PLKC 2WBJA 1G6VK 2WZAA 3CFEA 2V33A 1JNLL 4AE1A 2CHWA 4JFYB 4WTXA 2KYIA 4WQOA 1AKJB 1A1MA 5DK2A 1OD7A 2JJSC 3GMQA 4YHNA 4IOIB 4JFDA 1FHNA 5INCB 4BQBA 2J6EH 1NEPA 4Z7QE 1E43A 4JBSA 4NWUL 4WI4A 5FKAA 4X80H 5IQ7H 5C0AE 1GZQA 5G4MA 1RMFL 3FSWA 5GHWH 3V5HA 4JGNA 3QNFA 2DMGA 3M88A 1ED3A 2PTTB 4TUOB 4A2FA 2Z65C 3L4VA 4GKZB 3QDGD 4NNXB 4WVRA 2BSTA 3L3DA 3U1SH 2PYEB 2WMPB 2EYSA 1OSYA 5IJVA 1MW2A 3AFLA 1A14L 4U6VH 1JPST 4PR5B 1BVKA 5E6ID 4JZJC 5C07E 4A7UA 1FV1A 1AD0B 2VLLB 5BW7C 1XDTT 4YZFE 2EJ1A 5E6UB 5LAPA 4H1LG 4JZNB 3SYCA 2AEPH 3F85A 5FGSA 3WD5H 1NBYA 4OZIF 1CFBA 1XGYH 3MJGX 2APVA 4IRSA 3SJVD 1RI8A 1JCVA 1T0NA 3NCBB 5GGUA 1PKOA 4S2SA 1XGRB 2P45B 5HVHB 1FNGA 1KLFB 3Q9PA 1KWKA 1TVHA 4IMLA 3EFDH 5FHAL 1D5BB 2VDKH 2ZX9A 4X98A 5BXFB 1FC2D 2FNWA 2HJFB 1IT9H 2HTLD 4G5AA 4HMEA 1JMXA 4BHUI 1WLHA 2UXTA 3ATEA 3M46A 2FEDC 3CHPA 1DCLA 5FYKH 3QEHB 2DV6A 3MV7D 5FOBB 3MV8A 1WV7T 3MA7B 3PWNB 5IMKA 2B8OT 3W11C 3QR0A 1YMME 4DO5A 2BIMA 4L4VB 4XC1H 4JRXE 4IBLT 5DZOA 5EPMB 4ZFZB 3T4AA 5C0DB 4WK0B 1E5AA 4KXZH 4NKOB 2ZSWA 5ITBH 4TSBH 3HG2A 5JW4R 1JYWA 4GBXC 2ZXCA 3GINA 1MHPL 3HTLX 3M8OH 4KK6D 4Y19D 1Z9SA 3A67L 3QRLA 2H26A 3KPOA 4QKXB 5ESAA 4Z7WF 3ULUC 3T3PE 2ZP8A 2YUVA 2JFCA 4K4KA 5TDPA 4F91B 1HOEA 5A6IA 5GRVL 3OAUL 5DHEA 4GUCA 5EZIH 5D7LA 1MRFH 5D96C 5CP3A 4UILL 5AOLA 1NFDA 2E74C 3X3FL 2LFEA 3ZDZE 1BD2D 3BP5A 3D6GA 4RFEB 4MMYB 3SE8H 4AXWA 4G9FB 4ANWA 4JFVA 4M4PA 3QZWG 3UTQA 1Q9LA 2J7LA 4BSJA 3KL0A 1IGIH 5JOPE 1SLXA 3N44B 1ACYH 3F05A 4Q56A 1VFOA 2X1XR 1XF1A 3BAEH 3BSGA 3G6DL 3GLZA 4G8GA 4L3FA 4YR6B 3T1FB 4X9IA 1O9VA 1SJEB 1FNFA 1A4KA 3K2UH 4U6HB 3EYSH 4FQCH 4WFHD 5CCHE 3BD3A 2W38A 4UQ2A 4H8WC 4G82A 2NX5E 5KBPA 4D0BB 4J4PA 1T1WB 3CZKA 1ZHBB 2WXIA 3GRWL 5BO1L 3UCQA 4M48L 3L81A 1S7VA 2VXSL 2EE9A 2BP8A 4PJ7F 2QV2A 4X6BB 1A6WL 2VSMB 1OAXH 3I6KA 5JHDE 2YS4A 4IRZH 1OCWH 1PLBA 2ESVD 5GZOC 2WSPA 5GRWA 1F45A 2XX1A 3OR6A 1WZMA 2PCPB 4OLWL 3QXVA 1OTSD 3TU6A 3VXOA 3WAKA 2YWYA 5ICZB 1UENA 2LVEA 2QVFB 3ASOB 3CVIH 2MKLC 3BESR 4KKBD 3QIWC 4PJ5E 1YEDA 1BFOB 3V4VH 4N8CL 5C0BB 2P49B 3G5YA 5KVGE 4C56B 4ETYA 3B5HA 3VVWA 1HZLA 3LIUA 3FCSB 4NOFA 5DK0A 4KUCF 2O5YH 3CUPB 3GXPA 3LHAA 4B7LA 3O2DA 3GEFA 4QF1A 2DQGH 5EA0L 5TE6L 1R5WA 1JI2A 3NQIA 5IVNA 2I32A 2YXMA 2XQ0A 1DFBL 2YGVA 3B8YA 5IQLA 3VXQA 2YAHA 1TMCB 1BZQK 4PS4L 4PWJA 5ILTH 5IM7A 1CDIA 4DGWC 12E8L 3QI9B 2XVGA 4F58H 1AXTL 4G7SB 3RHWF 4I3SH 1VEOA 3ZMRA 3FOMB 1W2KT 4MNGA 4BFJA 2OFQA 1JHTA 5B3JF 2QQKL 4FFWC 3EYVA 4LOVA 4AGOA 4XCFL 2R83A 3ETSA 2X2IA 2HH0H 2PWDA 4H7VA 5F7LB 3SY0B 3SCMC 1TPXB 5EDSA 2RH0A 1E2ZA 5K9KB 5CEYB 5C6TH 1OZUA 3NOIA 1FN4B 5B3SB 4WJ5B 3J07A 1E4KC 2AC0A 4TQEL 1G7HB 5HDQL 2AFNA 2HFTA 3IJ8A 4BGLA 2AJZB 3BPCB 1DQLL 4BE5A 2M2DA 1G0XA 5HDBB 3T0EB 2GVYA 3HC3H 1J5OH 4YBHA 3TTYA 1QWHA 1UACH 4XXCA 4OCSL 4GRMB 1VACB 3EH4B 4XPFH 5JUEL 1YUHA 4TPRL 4X6EA 3SSGA 4BQ6A 4UDTB 2WKLA 1R75A 1FZJA 5IHUL 4HOZA 1JGIA 4AM0Q 3FT9A 1G1KA 1ZHNA 2P3YA 5EZJB 2Q6WA 2GSIA 2X5PA 4RAVA 1WIUA 5I66B 3T8XB 5I6OA 1DQJA 1NCWL 3MRFA 3RGHA 1I8MA 1TIUA 1DZ0A 4WHTB 3AS3A 4Q7DA 4X8XA 3VQ2C 1IGML 4AYID 4APQB 4I9XA 4Y88A 2P5WB 1J8HB 2NY2B 3WTXA 1RP9A 3UH8A 2GBUA 1DCEA 3LIZL 1HCZA 4UT6A 4XHJD 4M1GL 5LCVL 1N8ZA 2WNWA 4GKOA 2YQGA 2BY1A 3V0IA 2K78A 1O9ZA 3GS4A 1T5WB 3IDXH 4GW4A 1DJXA 5EORL 1PNCA 3D4GA 2LV4A 4NNPL 5IT2L 3MYZA 2X89A 4HUKB 3D34A 3QJVB 4JHBA 1R6VA 1IIKA 4JFPA 1AQDB 4G70B 3SYQA 3I6SA 2H0FA 3T2QA 1LQBC 4BYHA 3QJHA 4I18A 3QJUB 4QHUB 2ESVA 5D5ME 2W88A 4TQ8A 1DQDH 1OV8A 3V4LA 2XCMC 2B59A 1XWVA 5HHQB 1X7SA 4NQTA 3F00A