5IQYA

Structure of apo-dehydroascorbate reductase from pennisetum glaucum phased by iodide-sad method
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
211
structure length
211
Chain Sequence
b'VEVCVKAAVGAPDILGDCPFSQRVLLTLEEKKITYEMKLVDLSNKPEWFLKISPEGKVPVFNSGDGKWIADSDVITQVIEEKFPTPSLVTPPEYASVGSKIFPSFVKFLKSKDASDGSEKALLDELQALDEHLKAHGPYISGENVSAADLSLGPKLFHLQVALEHFKGWKIPENLTSVHAYTKALFSRESFVKTKPANQYLIAGWAPKVNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydroascorbate reductase
publication title Non-native ligands define the active site of Pennisetum glaucum (L.) R. Br dehydroascorbate reductase
pubmed doi rcsb
source organism Pennisetum americanum
molecule tags Oxidoreductase
total genus 61
structure length 211
sequence length 211
ec nomenclature ec 1.8.5.1: Glutathione dehydrogenase (ascorbate).
pdb deposition date 2016-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5iqyA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5iqyA01
3RBTA 1U88A 2VLVA 4DSSA 3QDNA 3M8NA 2H6YA 3ZTLA 2DJ2A 3G7YA 2FWEA 5CRWA 1B9XC 2HRAA 3KXOA 1CQHA 1XIYA 3FZ9A 4L0WA 1GWCA 3KTBA 5DQSA 4YQVA 1N2AA 1EGRA 4Q5NA 4AF2A 4IHUA 2YCDA 4PUAA 1ZCPA 3G7IA 5CNWA 3LWAA 3FHKA 2DJ0A 4JU5A 3SBCA 3ZVJA 3DGQA 3GH6A 4BVYB 4KSOA 5DBQA 5J41A 5CRHA 2YV7A 1SYRA 4QL9A 4BVXA 2KUCA 2WULA 2FGXA 4WXTA 1FG4A 1YEPA 4XS4B 3UL3A 4KDUA 3KIJA 4OCFA 3H1NA 3AY8A 4HEA2 3F8UA 3DVWA 3M0FA 6GSUA 1USBA 3ZMLA 1SKRB 5JWRB 3E3EA 3HHVA 2IPAA 4WKWA 2B7KA 2HRFA 2K8VA 3F9UA 5J5NA 3M3MA 3C73A 3HYPA 2H71A 2H1BA 5GSSA 2LNSA 2NVLA 3IBHA 1TOFA 1F3AA 2J23A 3VI5A 2ON7A 2R5GA 4WEYA 3WGXA 4LMVA 3DMLA 3FY7A 3ZFBA 3QFAC 2XHFA 4N0VA 2WZ9A 3D4MA 4DVCA 2VCWA 5G5EA 1KNGA 1XW5A 1JFUA 2R6KA 3VWWA 2HI7A 4IP6A 1PKZA 2C1YA 5IQYA 4FYCA 5DJLA 2RLIA 4ACSA 3LEFA 2H73A 1NW2A 4MF6A 1F9MA 1JZDA 1GRXA 3U6VA 1T8EB 5ID2A 3GL5A 3A2WA 5AGYA 1YF1A 1Z3EA 3C7MA 3F4RA 4OO5A 11GSA 4IP1A 3FR6A 2HLSA 4MF7A 1B8XA 1Q4JA 5G31A 4PX1A 1AUCA 1YDKA 3ZZXA 1ZYEA 1K3OA 4ECCA 5CREA 4GRFA 4N11A 1HNCA 4MZCA 2OA7A 1XZOA 3F6DA 5IMZA 3US3A 1OVNA 3FRCA 4GCIA 2B5YA 4ECJA 4RUVA 1XVWA 4CDOA 3WGEA 2CAIA 3GNJA 3DKSA 1QK8A 1U6TA 2YN1A 1A8YA 2O8VB 2HSMB 2K18A 3EU3A 4HQSA 4V2LA 4L0UA 1GSEA 3J7Yk 1QQ2A 4IELA 1V9WA 1Z7PA 2B5XA 4OFNA 1C72A 1YZXA 3J7Yb 4WBRD 5HFKA 1XWAA 4I8BA 1GULA 1GNWA 1HNBA 3RPNA 3DWVA 3ZIVA 1TK5B 3HA9A 4TN8A 1KBNA 4GSSA 2NDOA 5D96A 4DSQA 4XS6A 3I9V2 2B1LA 4GXZA 5JWOB 3M1GA 5ECHB 3ZFLA 3ZMKA 3N9JA 2JSYA 5DALA 4LL1B 4J56E 2J9HA 1EP7A 4J57E 2VOCA 5EPFA 4TKYA 3EMXA 2HT9A 2A2SA 2F8AA 3UOMA 4FH8A 5DCGA 1PX7A 3TB2A 3EYTA 4FIWA 2AV4A 1BAYA 3QOUA 3WT1A 1OE7A 4YAVA 2VCTA 4ML6A 2WFCA 3GL3A 2CX4A 5ECIB 2IMDA 2PUKC 2VD1A 4PGTA 1GLQA 3QD9A 2IN3A 2WJUA 1R5PA 4NV5A 3KH7A 3TRXA 2B7JA 1B9YC 2DIYA 2RM5A 3RHCA 2C80A 4YQUA 4IJ3A 1G6YA 1WPIA 1TW9A 3VURA 5D8IA 3D21A 2O89A 2KP1A 5ECOB 3F6FA 3IC4A 5IMAA 4ZILA 4HJMA 2HRNA 3O3TA 4E8HA 5D9WA 4EVMA 3GSSA 2EC4A 3A3TA 1K3LA 4IVFA 2O7KA 2X64A 4IGJA 19GSA 1XW9A 2RUFA 1PN9A 2OKAA 4KGIA 3VWUA 2V32A 4MH2A 5ECQB 2VCVA 5J9CA 3QAVA 1QUWA 4BL7A 4ZBAA 3IDVA 1HQOA 5J9BA 3IOSA 4HU9A 5ECLB 4PURA 5JCWA 4HDEA 1FB0A 3KP9A 2BJXA 4TVEA 4TR0A 1O73A 1EV9A 5ECMB 1GTAA 4MF5A 4X43A 1OC8A 3U5RE 1ERWA 2K6VA 3P90A 3P2AA 4GQFA 3UJ1A 3DEXA 1BJXA 4K9ZA 3MNGA 5D9TA 2IJYA 4ZXGA 1TXXA 5GAPD 6GSXA 4ILFA 3TKSC 1M0UA 1SJZA 2YNXA 1A2MA 4Z7XA 1K0DA 3CBUA 2F3MA 3CSHA 5JCGA 2LKUA 2DBCA 4OD7A 3GX0A 4MJCA 5B8AA 2FA8A 1FW1A 5EY6A 1PL1A 2JZSA 2O87A 1Z5YE 3KJYA 2F9SA 5HQPA 2DSAA 2JSZA 4NAXA 2MMZA 1DSBA 2WGRA 4ZB6A 2A4VA 2L57A 3HCZA 4POKA 1XWKA 3I43A 9GSSA 2B5EA 5DCHA 4AJ6A 4MPGA 1GH2A 1GSFA 1HYUA 4XS1A 4D73B 4GSNA 5ECKB 1ZOFA 4POLA 1BYEA 2C0FA 1QMVA 4MJBA 2GQLA 3ERWA 1IYIA 1Q98A 2IMEA 3PR8A 4ECBA 1OKDA 1A2LA 2VAFA 5KN3A 2QSIA 3ZRDA 4V2MA 1WMJA 3VWVA 2XBIA 4RI7A 3W8JA 4I97A 5H5QA 2AHEA 3DIEA 2PN8A 4ZIJA 4XRAA 3VLNA 1OYJA 2GSSA 3EC3A 22GSA 3ME8A 3BBYA 3QAGA 2R2JA 4IS0A 2N5FA 5ECRB 3A2VA 1LBKA 4ZBDA 2VM1A 5F8BA 4G0LA 1AAZA 3VPTA 4IBPA 1PSQA 1NHOA 4GWRA 4TR1A 1IYHA 4WF4A 1GSDA 18GSA 2WS2A 3TJKA 2M80A 1WIKA 5DAKA 1VF1A 1T4ZA 3I6AA 3W6GA 4BPYA 2CVKA 4PUFC 5F07A 3LFLA 1SL0B 2CVBA 3LGCA 1M2BA 2V6OA 3PINA 1R26A 3TKQA 3M9KA 1TRSA 5CRDA 3HZ8A 1QFNA 2TIRA 2XPEA 2UZ8A 4AGSA 2X8HA 2H6XA 3UMAA 2MZCA 1O7UA 3HY2A 1I9DA 1TRWA 5HFGA 3LYPA 4TOPA 3F4SA 4OCEA 1XFLA 2L6CA 1XW6A 2N5AA 2PGTA 3GIXA 4V1Ap 1O85A 2CQ9A 4JR6A 4OFMA 1K0NA 3IK9A 4ZL9A 1FO5A 1TP9A 4PQIA 5L71A 1TTZA 4G9HA 1X5EA 4FYBA 1MDKA 1XCCA 2H66A 3UEMA 5CYYA 2QGVA 3KZQA 2B3SA 2C3NA 3D4TA 4KX4A 1R7HA 3C1RA 3TKPA 3Q6OA 1UA5A 3QPMA 2PERA 4MJEA 3GYKA 2HRKA 1TK0B 5HR0A 3H4KA 2H75A 5IO0A 1NHYA 1S3DA 4MZWA 4X0XA 3TRPA 3ZVJD 1THOA 2WRTA 2D2ZA 3CYNA 2C0DA 2DIZA 1VRSD 3Q19A 2E2MA 4MP4A 2VL2A 3F3RA 5E59A 4USSA 1TRVA 1WOUA 2MYGA 2GQKA 3BCIA 4WR4A 2K8SA 1T1VA 2XBQA 2YJHA 4ZB9A 1TI3A 1N8JA 5INYA 2LS5A 3TKSA 1K0MA 1M99A 5C04A 1MTCA 3HJMA 2WDUA 2KLXA 4BWQA 2I81A 3M9JA 3HD5A 1UVZA 3CMIA 4PQ1A 2ES7A 2IFQB 2OBKA 5CAXA 4TXOB 3QAWA 2CV4A 1ZMAA 1TRUA 2HZFA 2EIQA 2L4QA 1G6WA 3GKMA 5IIZA 3FYGA 1DUGA 2YP6A 5ENUA 3IE3A 3KMOA 3OR5A 2E7PA 1VF2A 3GRXA 3QR6A 5HR1A 4JZQA 1O8XA 1TJDA 5IMDA 3E9JB 1XVQA 3UAPA 3VFIA 5D9XA 1XPVA 4MMMA 5J4UA 4ISDA 3DRNA 2VL3A 2PU9C 4IJIA 4RI6A 3IV4A 5IOXA 1W4VA 3RAZA 2AAWA 4L8EA 1MDJA 4MH3A 2FY6A 3F0IA 3SWLA 3TJJA 4KA0A 2EIRA 2V41A 1YKAA 1PMTA 2X8CA 2LNTA 2CA8A 1Y6EA 3S9FA 3IR4A 4ID0A 5G2ZA 1WP0A 3HZ4A 5EL8A 2YWNA 1XOBA 2LJAA 4HZ2A 4YH2A 3IAS2 2HQTA 2WB9A 3GTUB 3ERGA 2X8GA 4XCSA 3EINA 1SYXA 2V1MA 4PTSA 2LJKA 2LUSA 2VD0A 1GUMA 5D73A 4N30A 3G7JA 1X0RA 14GSA 1X5CA 3ED3A 5ECNB 1GUKA 1E6BA 3HVSA 3LJRA 4HU7A 5COHA 2GZZA 4POMA 5AISA 2YWIA 4HI7A 2M72A 5BMUA 4QQ7A 2JADA 1YEXA 3WGDA 4XS4A 3A2XA 3CRTA 5IO2A 1ERTA 4MPFA 3HKRA 2LRTA 1GSUA 4WBJA 2RIIA 5IMVA 3GSTA 1MD3A 4BWSA 1ERUA 1U3AA 3W8SA 4HOJA 1SK2A 4JRRA 4GF0A 2JU5A 1EOHA 3KMNA 4JE1A 4AJ7A 2I3YA 3CSIA 4LLRA 4BA7A 3I69A 2IWTA 4POBA 3TJFA 2H76A 2H70A 5AN1A 1BG5A 1ZYQB 2C3TA 2GS3A 1B48A 1K0CA 2REMA 3GKNA 2P31A 1A2JA 1PRXA 5LD0A 1FVKA 1EV4A 3EURA 1ZL9A 1SKSB 2O85A 3VK9A 1V58A 2VIMA 1MDIA 2L5LA 3O6TA 3O76A 1PD21 4WETA 5B6NA 1TI1A 1BX9A 1ABAA 2XPDA 3DD3A 3C8EA 1FOVA 2FUG2 1E2YA 1GTBA 4G0IA 1QXHA 5A4WA 4K8MA 3VWXA 2C3QA 3V1WA 4CW9A 2VLTA 1PA3A 3NOFA 4J2FA 5DVBA 1ST9A 4HJ2A 5E4WA 2PMTA 2LQQA 2M46A 2YANA 2H74A 4E8EA 2HZEB 4WF5A 3BOAA 2LV3A 1O8WA 1ZGNA 1F37A 2H72A 4QL7A 4PQHA 1NM3A 2H0IA 3FK8A 10GSA 1SL2B 1H75A 3KGKA 3GFKA 5CO3A 2YZUA 1OAZA 4KAEA 7GSSA 2VL2C 1EEJA 3GN3A 4EC0A 3CSJA 4V2NA 1Z9HA 4F9ZA 2HSMA 5FHIA 1GSSA 4RQRA 4O7HA 3D5JA 4O32A 4F0BA 2GQMA 4LL4B 3BJ5A 2HSYA 4DSSB 2VL9A 4H86A 1X5DA 1JHBA 4KH7A 2FWFA 4LA1A 3UBKA 1O6JA 5F05A 3FZ5A 2CZ2A 2GSQA 2H1DA 1B4QA 1PQNA 5H5RA 1F6MC 2YJ7A 4XHMA 1A0RP 4ZBBA 5ELGA 3WT2A 4DSRA 5GZZB 1MEKA 4HQZA 4NV2A 4BVXB 4K7NA 3HDCA 5AIXA 2YPMA 4G2EA 3MDKA 2ZUPA 5B6MA 1GNEA 4MK3A 3MSZA 4FQUA 2GGTA 2HRKB 2XC2A 3TOTA 2AB6A 1GTUA 3IA1A 5IOWA 1U87A 3CTGA 4F03A 3G9BA 4ECIA 4OO4A 3TUEA 1G0TA 1LU4A 2I1UA 1Z7RA 4G0KA 4L5OA 3EMPA 2KHPA 1J0FA 2HSNB 3JCML 2VCXA 2R4VA 3TJGA 1URMA 3LG6A 6GSYA 2G2QA 2R3XA 5F06A 5KN2A 3KCMA 2CVDA 1ILOA 2HNLA 4JBBA 2H0GA 4X1UA 1JLWA 5DQYA 3L9VA 3CXGA 4XRDA 5ID2B 1YY7A 1OE8A 2LRCA 1BQ7A 4Q5RA 2GT6A 2NTOA 2IIYA 1H4OA 1RK4A 2IMKA 2JZTA 3TDGA 3C1SA 1TK8B 2VCQA 4MABA 2ZNMA 3EU4A 3BCKA 1AXDA 2DMLA 3D0ZA 2GLRA 3IXRA 4FYUA 2PWJA 2VCZA 4I5QA 1FAAA 5GAND 1J9BA 4ULXA 3ZYWA 2GZYA 3GKXA 2C8UA 4IQAA 2X99A 1LJRA 3VI7A 1DE1A 4LMWA 1DBYA 2HE3A 3UBLA 2LJRA 1HD2A 3KTLA 2CT6A 1X9SB 1SD8A 2KOKA 4EUYA 3F63A 4F82A 4KSMA 4ZL7A 4NHWA 3TRQA 3GX8A 5LNKe 2LEGA 2CAQA 1XWCA 4RQXA 1U3IA 4P3YB 1K0AA 4KF9A 2H30A 4ZL8A 1K3YA 4EDZA 3LORA 2IL3A 4AJ8A 1GLPA 4N0ZA 2LRNA 2RM6A 1OC9A 1JLVA 1EP8A 3CRUA 5H5SA 3TJBA 4N10A 1G7OA 3FZAA 2OE0A 2OADA 2F8FA 1PKWA 1M7TA 5DALB 2TRXA 2N5BA 3P7XA 3DXBA 4D73A 2GZPA 2H1AA 2VUPA 1KTEA 2OE1A 5ABRA 4MDCA 3NIVA 5CP1A 3MAKA 1GSYA 2KP2A 2DJJA 4MJAA 3UVHA 4WR5A 4EE0A 3L0HA 1ERVA 2JACA 1M9BA 1Z6MA 2IMIA 3KM6A 5FWGA 4PNGA 2DJ1A 3BD2A 2AJQB 4K2DA 2JL4A 4F2IA 2MBSA 3LXTA 3R3EA 4KW6A 3L9UA 2B6MA 3GA4A 1ON4A 3GKKA 5G5FA 4O5RA 1X9MB 4CHSA 1O81A 2FD3A 2OJLA 1BEDA 1YQ1A 2E0QA 1T4YA 2FWGA 2C0EA 3NZNA 2JZRA 3WD6A 4V1Ag 4KUNA 3P8WA 3HXSA 17GSA 2CZ3A 4EKZA 2V6KA 4PNFA 1GTIA 5ECPB 3TOUA 3IRAA 3F4TA 2VLUA 1GSQA 3TKSE 1EOGA 3HJPA 4IKHA 1HNAA 4O92A 2VO4A 3H8QA 1A23A 4BL7B 4KCEA 2YWOA 1G7EA 1Z6NA 2R37A 3FR3A 5IPGA 4NWYA 1OC3A 2E2GA 2DC5A 1I5GA 4Q5QA 5HFIA 1EZKA 4TR4A 3DYRA 1SK0A 2MBTA 2BMXA 5ECSA 1XXUA 1TKDB 4KCAA 4HZ4A 3R2QA 2P0GA 2NPBA 4ZB8A 5G1KA 3E0UA 2NBSA 4TR3A 4EF0A 2I9HA 3PGTA 2G0FA 2OBIA 3ME7A 3ZITA 2AUVA 3QCPA 4KDXA 2FNOA 1UC7A 1W89A 3IAM2 4K0NA 4BVYA 3ZIJA 5IPHA 4NXIA 2I4AA 1AW9A 4IW9A 1AC1A 2H6ZA 5FT3A 2L59A 3WYWA 1SJIA 2LTKA 2A2RA 3GH9A 2ALBA 3PPUA 1F3BA 4I6XA 4HUAA 1R5AA 3APQA 2HFDA 4TXVA 5G30A 1VF3A 4MLYA 1A24A 5KN1A 2L4CA 5D9VA 3VPQA 5JWQB 1ACVA 1RW1A 3GURA 5D93A 3HVXA 3GUSA 3F3QA 1M2AA 3ZLPA 4HS1A 1PL2A 4FO5A 4XTSA 2QC7A 3ZL5A 1XWBA 4MA9A 3GV1A 1GUHA 3TCOA 2DJ3A 12GSA 2IFQA 1AIUA 1DE2A 2FLSA 3CTFA 2TRCP 3RDWA 2YOIA 5F0GA 4TXOA 3IPZA 1J08A 4XIHA 5GSTA 4EDYA 1NSWA 2PPTA 2PBJA 6GSSA 1FB6A 3C71A 4NHZA 3QMXA 3GHAA 1EEMA 1YF0A 1T7PB 1X9WB 2GSTA 4G19A 20GSA 4GLTA 1SD9A 3EWLA 1CQGA 13GSA 2L6DA 5DJMA 4MCUA 1XBSA 1V40A 1S3CA 3APOA 3KH9A 3D6IA 3IHQA 1AQWA 3KP8A 4TR1B 1M9AA 2GVPA 1YKCA 2IMFA 2C4JA 4ML1A 2CX3A 5DAKB 2F51A 3LYKA 1SJ6A 5LCZA 1THXA 4TW5A 2ON5A 2MMOA 2VM2A 3FZ4A 5KEJA 3FEUA 3HJOA 3L9SA 4Q5FA 2H01A 3GTUA 5JCUA 2P5RA 1T3BA 4KB3A 1RQMA 6GSTA 1WJKA 2HYXA 2PVOC 6GSWA 4F0CA 1TU8A 4EL1A 3FR9A 2DLXA 5G1LA 4MZBA 1GL8A 3ISOA 4L5LA 4DEJA 1Y25A 2B1KA 3KD0A 1F2EA 1JZRA 1YJ6A 1WE0A 1T00A 1M2DA 3LXZA 1VF4A 1K0OA 1R4WA 1V57A 2LQOA 3H93A 3KEBA 3UARA 1AQVA 1B4PA 5A4UA 4EO3A 1UN2A 4TRXA 4JR4A 1WRYA 2RUEA 1A8LA 3MWHA 5B7CA 1OKTA 1SU9A 1QGVA 1EWXA 3HVVA 2AYTA 2MMAA 1AQXA 1MD4A 1TDIA 5ELAA 4EXJA 1TU7A 2PVQA 1OC9B 2FCHA 5KN0A 1SK1A 2MMNA 3EE2A 1S3AA 2DJKA 4K0GA 1ZZYA 1SENA 2K9FA 5AIVA 3FKFA 8GSSA 3Q74A 3L78A 3QFBC 4JEDA 5HR2A 1A0FA 2P5QA 4OFTA 4K6XA 16GSA 2C0GA 4NPBA 5IMFA 1GP1A 3TKRA 1PX6A 3LSZA 2H19A 3D22A 5DDLA 2GDRA 4KDYA 1JZOA 4GQCA 3ZREA 4KE3A 2H8LA 2V2GA 2GTUA 4K7IA 2QKEA 2H0HA 2HSHA 4YQMA 2YV9A 4GTUA 2H1GA 3UIWA 4K1FA 5B8BA 5A5KA 2YWMA 1SKWB 4YAPA 1K0BA 2EIOA 2GT5A 1VGLA 1JZWA 1EGOA 1KEBA 2LSTA 3L4NA 3N5OA 2FA4A 2YZHA 4OWYA 1V98A 2Z9SA 2FHEA 1SL1B 1XWGA 5EVOA 3RHBA 1PGTA 3FW2A 3A5WA 4GSTA 5CRGA 2FWHA 5IM9A 5HR3A 3LQ7A 2ZCTA 1FVJA 3ERFA 3DVXA 4KNDA 4IQ1A 3H79A 2GSRA 5A4VA 1ML6A 5J3RA 3RPPA 1FHEA 3K8NA 4I2TA 2HZEA 1WWJA 3UVTA 3Q18A 1XOAA 4I2UA 4PXOA 3PH9A 3IC8A 5IMCA 3EVIA 4OMVA 4NMUA 4IN0A 3IK7A 2BTOT 4G10A 2DMMA 5C00A 2WCIA 2HXKA 2L5OA 3APSA 3GMFA 3TGZA 1V2AA 2OACA 6GSVA 4K7OA 2OE3A
chains in the Genus database with same CATH superfamily
3RBTA 1U88A 2VLVA 4DSSA 3QDNA 3M8NA 2H6YA 3ZTLA 4HSCX 2DJ2A 3G7YA 2FWEA 5BRTA 5CRWA 3EPTA 1B9XC 2HRAA 3KXOA 1CQHA 1XIYA 3FZ9A 4L0WA 1GWCA 3KTBA 5DQSA 4YQVA 1N2AA 1EGRA 4Q5NA 4AF2A 4IHUA 2YCDA 4PUAA 1ZCPA 3G7IA 5CNWA 3LWAA 3FHKA 2DJ0A 4JU5A 3SBCA 3ZVJA 3DGQA 3GH6A 4BVYB 4KSOA 5DBQA 5J41A 1YVLA 5CRHA 2YV7A 1SYRA 4QL9A 4BVXA 2KUCA 2WULA 5BMUB 2FGXA 4WXTA 1FG4A 1YEPA 4XS4B 3UL3A 4KDUA 3KIJA 4OCFA 3H1NA 3AY8A 4HEA2 3F8UA 2R0PA 3DVWA 3M0FA 6GSUA 1USBA 3ZMLA 1SKRB 1Y1UA 5JWRB 2O3EA 3E3EA 3HHVA 2IPAA 4WKWA 2B7KA 2HRFA 2K8VA 3F9UA 2WW3A 5J5NA 3M3MA 3C73A 3HYPA 2H71A 2H1BA 5GSSA 2LNSA 2NVLA 3IBHA 1TOFA 1F3AA 2J23A 3VI5A 2ON7A 2R5GA 2HSNA 4WEYA 4LMVA 3WGXA 3DMLA 3FY7A 3ZFBA 3QFAC 2XHFA 4N0VA 2WZ9A 3D4MA 4DVCA 2VCWA 5G5EA 1KNGA 1XW5A 1JFUA 2R6KA 3VWWA 2HI7A 4IP6A 1PKZA 2C1YA 5IQYA 4FYCA 5DJLA 2RLIA 4ACSA 3LEFA 2H73A 1NW2A 4MF6A 1F9MA 1JZDA 1GRXA 3U6VA 1T8EB 5ID2A 3GL5A 3A2WA 3LW9A 5AGYA 1YF1A 1Z3EA 3C7MA 3F4RA 4OO5A 11GSA 4IP1A 3FR6A 2HLSA 4MF7A 1B8XA 1Q4JA 5G31A 4PX1A 1AUCA 1YDKA 3ZZXA 1ZYEA 1K3OA 4ECCA 5CREA 4GRFA 4N11A 1HNCA 4MZCA 2OA7A 4PI0C 1XZOA 3F6DA 5IMZA 3US3A 1OVNA 3FRCA 4GCIA 2B5YA 4ECJA 4RUVA 1XVWA 4CDOA 2OT3A 3WGEA 2CAIA 3GNJA 3DKSA 1QK8A 1U6TA 2YN1A 1A8YA 2O8VB 2HSMB 2K18A 3EU3A 4HQSA 4V2LA 4L0UA 1GSEA 3J7Yk 1QQ2A 4IELA 1V9WA 1Z7PA 2B5XA 4OFNA 1C72A 1YZXA 3J7Yb 4WBRD 5HFKA 1XWAA 4I8BA 1GULA 1GNWA 1HNBA 3RPNA 3DWVA 2VKZG 3ZIVA 1TK5B 3HA9A 4TN8A 1KBNA 4GSSA 2NDOA 5D96A 4DSQA 4XS6A 3I9V2 2B1LA 4GXZA 5JWOB 3M1GA 1PFOA 5ECHB 3ZFLA 3ZMKA 3N9JA 2JSYA 5DALA 4LL1B 4J56E 2J9HA 1EP7A 4J57E 2WVZA 2VOCA 5EPFA 4TKYA 4E68A 3EMXA 2HT9A 2A2SA 2F8AA 3UOMA 4FH8A 5DCGA 1PX7A 3TB2A 3EYTA 4FIWA 2AV4A 1BAYA 3QOUA 3WT1A 2QA2A 1OE7A 4YAVA 2VCTA 4ML6A 2WFCA 2WW1A 3GL3A 2CX4A 5ECIB 2IMDA 2PUKC 2VD1A 4PGTA 1GLQA 3QD9A 2IN3A 2WJUA 1R5PA 4NV5A 3KH7A 3TRXA 2B7JA 2A4HA 1B9YC 2DIYA 2RM5A 3RHCA 2C80A 4YQUA 4IJ3A 1G6YA 1WPIA 1TW9A 3VURA 4QMKA 5D8IA 3D21A 2O89A 2KP1A 5ECOB 3F6FA 3IC4A 5IMAA 4ZILA 4HJMA 2HRNA 3O3TA 4E8HA 5D9WA 4EVMA 3GSSA 2EC4A 2DKIA 3A3TA 1K3LA 4IVFA 2O7KA 2X64A 4IGJA 19GSA 1XW9A 2RUFA 1PN9A 2OKAA 4KGIA 3VWUA 2V32A 4AKXB 4MH2A 5ECQB 2VCVA 5J9CA 1N25A 3QAVA 1QUWA 4BL7A 4ZBAA 3IDVA 1HQOA 5J9BA 3IOSA 4HU9A 5ECLB 4PURA 5JCWA 4HDEA 1FB0A 3KP9A 2BJXA 4TVEA 4TR0A 1O73A 1EV9A 5ECMB 1GTAA 4MF5A 4X43A 2WZSA 1OC8A 3U5RE 1ERWA 2K6VA 3P90A 3P2AA 4GQFA 2UV8G 3DEXA 3UJ1A 1BJXA 4K9ZA 3MNGA 5D9TA 2IJYA 4ZXGA 1TXXA 5GAPD 6GSXA 4ILFA 3TKSC 1M0UA 1SJZA 2YNXA 1A2MA 4Z7XA 1K0DA 3CBUA 2F3MA 3CSHA 5JCGA 2LKUA 2DBCA 4OD7A 3GX0A 4MJCA 5B8AA 2FA8A 1FW1A 5EY6A 1PL1A 2JZSA 2O87A 1Z5YE 3KJYA 2F9SA 5HQPA 2DSAA 2JSZA 4NAXA 2MMZA 1DSBA 2WGRA 4ZB6A 2A4VA 2L57A 3HCZA 4POKA 3IHGA 1XWKA 3I43A 9GSSA 2B5EA 5DCHA 4AJ6A 4ICYA 4MPGA 1GH2A 1GSFA 1HYUA 4YKGA 4XS1A 4D73B 4GSNA 5ECKB 1ZOFA 4POLA 1BYEA 2C0FA 1QMVA 4MJBA 2GQLA 3ERWA 1IYIA 1S4BP 1Q98A 3PR8A 4ECBA 2IMEA 1OKDA 1A2LA 2VAFA 5KN3A 2QSIA 3ZRDA 4V2MA 1WMJA 4FXYP 3CHXC 3VWVA 1SVLA 2XBIA 4RI7A 3W8JA 4I97A 4O5UA 5H5QA 2AHEA 3DIEA 2PN8A 4ZIJA 4XRAA 3VLNA 1OYJA 2GSSA 3EC3A 22GSA 3ME8A 3BBYA 3QAGA 2R2JA 4IS0A 1SVMA 2N5FA 5ECRB 3A2VA 1LBKA 4ZBDA 2VM1A 5F8BA 4G0LA 1AAZA 3VPTA 4IBPA 1PSQA 1NHOA 4GWRA 4TR1A 1IYHA 4WF4A 1GSDA 18GSA 2WS2A 3TJKA 2M80A 1WIKA 5DAKA 1VF1A 1T4ZA 3I6AA 3W6GA 4BPYA 2CVKA 4PUFC 5F07A 3LFLA 1SL0B 2CVBA 3LGCA 1M2BA 2V6OA 2WVXA 3PINA 1R26A 3TKQA 3M9KA 1TRSA 5CRDA 3HZ8A 1QFNA 2TIRA 2XPEA 2UZ8A 4AGSA 2X8HA 2H6XA 3UMAA 2MZCA 1O7UA 3HY2A 1I9DA 1TRWA 5HFGA 3LYPA 4TOPA 3F4SA 4OCEA 1XFLA 2L6CA 1XW6A 2N5AA 2PGTA 3GIXA 4V1Ap 1O85A 2CQ9A 4JR6A 4OFMA 1K0NA 3IK9A 4ZL9A 1FO5A 1TP9A 4PQIA 1M3IA 5L71A 1TTZA 3TU3B 4G9HA 1X5EA 4FYBA 1MDKA 1XCCA 2H66A 3UEMA 5CYYA 2QGVA 3KZQA 2B3SA 2C3NA 3D4TA 4KX4A 1R7HA 3C1RA 3TKPA 3Q6OA 1UA5A 3QPMA 2PERA 4MJEA 3GYKA 2HRKA 1TK0B 5HR0A 3H4KA 2H75A 5IO0A 1NHYA 1S3DA 4MZWA 4X0XA 3TRPA 3ZVJD 1THOA 2WRTA 2D2ZA 3CYNA 2C0DA 2DIZA 5J47A 1VRSD 3Q19A 2E2MA 4MP4A 2VL2A 3F3RA 5E59A 4USSA 1TRVA 1BF5A 1WOUA 2MYGA 2GQKA 3BCIA 4G01A 4WR4A 2K8SA 1T1VA 2XBQA 2YJHA 4ZB9A 1TI3A 1N8JA 5INYA 2LS5A 3TKSA 1K0MA 1M99A 1ZYPA 5C04A 1MTCA 3HJMA 2WDUA 2KLXA 4BWQA 2I81A 3M9JA 3HD5A 1UVZA 3CMIA 4PQ1A 2ES7A 2IFQB 2OBKA 5CAXA 4TXOB 3QAWA 2CV4A 1ZMAA 1TRUA 2HZFA 2EIQA 2L4QA 1G6WA 3GKMA 5IIZA 3FYGA 1DUGA 2YP6A 5ENUA 3IE3A 3KMOA 3OR5A 2E7PA 4EIPA 1VF2A 3GRXA 3QR6A 5HR1A 4JZQA 1O8XA 1TJDA 5IMDA 3E9JB 1XVQA 3UAPA 3VFIA 5D9XA 1XPVA 4MMMA 5J4UA 4ISDA 3DRNA 2VL3A 2PU9C 4IJIA 4RI6A 3IV4A 5IOXA 1W4VA 3RAZA 2AAWA 4L8EA 1MDJA 4MH3A 2FY6A 3F0IA 3SWLA 3TJJA 4KA0A 2EIRA 2V41A 1YKAA 1PMTA 2X8CA 2LNTA 2CA8A 1Y6EA 3S9FA 3IR4A 4ID0A 5G2ZA 4AI6A 1WP0A 3HZ4A 5EL8A 2YWNA 1XOBA 2LJAA 4HZ2A 4YH2A 3IAS2 2HQTA 2WB9A 3GTUB 3ERGA 2X8GA 4XCSA 3EINA 1SYXA 2V1MA 4PTSA 2LJKA 2LUSA 2VD0A 1GUMA 5D73A 4N30A 3G7JA 1X0RA 14GSA 1X5CA 3ED3A 5ECNB 1GUKA 1ZYNA 1E6BA 3HVSA 3LJRA 4HU7A 5COHA 2GZZA 4POMA 5AISA 2YWIA 4HI7A 2M72A 5BMUA 4QQ7A 2JADA 1YEXA 3WGDA 4XS4A 3A2XA 3CRTA 5IO2A 1ERTA 4MPFA 3HKRA 2LRTA 1GSUA 4PI2C 4WBJA 2RIIA 5IMVA 3GSTA 1MD3A 4AKIA 4BWSA 1ERUA 1U3AA 3W8SA 4HOJA 1SK2A 4JRRA 4AKGA 4GF0A 2JU5A 1EOHA 3KMNA 4JE1A 4AJ7A 2I3YA 3CSIA 4LLRA 4BA7A 3I69A 2IWTA 4POBA 5A34A 3TJFA 2H76A 2H70A 3MIXA 5AN1A 2DKHA 1BG5A 1ZYQB 2C3TA 2GS3A 1B48A 1K0CA 1M3JA 2REMA 3GKNA 2P31A 1A2JA 1PRXA 5LD0A 1FVKA 1EV4A 3EURA 1ZL9A 1SKSB 3RFRC 2O85A 3VK9A 1V58A 2VIMA 1MDIA 2L5LA 3O6TA 3O76A 1PD21 2R0CA 4WETA 5B6NA 1TI1A 1BX9A 1ABAA 2XPDA 3DD3A 3C8EA 1FOVA 2FUG2 1E2YA 1GTBA 4G0IA 1QXHA 5A4WA 4K8MA 3VWXA 2C3QA 4X4JA 3V1WA 4CW9A 5A1NB 2VLTA 2EFCA 1PA3A 3NOFA 4CY8A 4J2FA 5DVBA 1ST9A 4HJ2A 5E4WA 2PMTA 2LQQA 2M46A 2YANA 2H74A 4E8EA 5A5HB 2HZEB 4WF5A 3BOAA 2LV3A 1O8WA 1ZGNA 1F37A 2H72A 4QL7A 4PQHA 1NM3A 2H0IA 3FK8A 10GSA 1SL2B 1H75A 3KGKA 3GFKA 5CO3A 2YZUA 1OAZA 4KAEA 7GSSA 2VL2C 1EEJA 3GN3A 4EC0A 3CSJA 4V2NA 1Z9HA 4F9ZA 2HSMA 5FHIA 1GSSA 4RQRA 4O7HA 3D5JA 4O32A 4F0BA 2GQMA 4LL4B 3BJ5A 2HSYA 4DSSB 2VL9A 4H86A 1X5DA 1JHBA 4KH7A 2FWFA 3CQFA 4LA1A 3UBKA 1O6JA 5F05A 3FZ5A 2CZ2A 2GSQA 2H1DA 1B4QA 1PQNA 5H5RA 1F6MC 2YJ7A 4XHMA 1A0RP 4BIKA 4ZBBA 5ELGA 3WT2A 4DSRA 5GZZB 4A5PA 1MEKA 4HQZA 4NV2A 4BVXB 4K7NA 3HDCA 5AIXA 2YPMA 4G2EA 3MDKA 2ZUPA 5B6MA 1GNEA 4MK3A 3MSZA 4FQUA 2GGTA 2HRKB 2XC2A 3TOTA 2AB6A 1GTUA 3IA1A 5IOWA 1U87A 3CTGA 4F03A 3G9BA 4ECIA 5J4YA 4OO4A 3TUEA 1G0TA 1LU4A 2I1UA 1PN0A 1Z7RA 4G0KA 4L5OA 3EMPA 2KHPA 1J0FA 2HSNB 3JCML 2VCXA 2R4VA 3TJGA 1URMA 3LG6A 6GSYA 2G2QA 2R3XA 5F06A 5KN2A 3CWGA 3KCMA 2CVDA 4K5SA 1ILOA 4Z2RA 2HNLA 4JBBA 2H0GA 4X1UA 1JLWA 5DQYA 3L9VA 3CXGA 4XRDA 5ID2B 1YY7A 1OE8A 2LRCA 1BQ7A 4Q5RA 2GT6A 2NTOA 2IIYA 1H4OA 1RK4A 2IMKA 2JZTA 4MNNA 3TDGA 3C1SA 1TK8B 2VCQA 4MABA 4O5QA 2ZNMA 3EU4A 3BCKA 1AXDA 2DMLA 3D0ZA 2GLRA 3IXRA 4FYUA 2PWJA 2VCZA 4I5QA 1FAAA 5GAND 1J9BA 4ULXA 3ZYWA 2GZYA 3GKXA 2C8UA 4IQAA 2X99A 1LJRA 3VI7A 1DE1A 4LMWA 1DBYA 2HE3A 3UBLA 2LJRA 1HD2A 3KTLA 2CT6A 1X9SB 1SD8A 2KOKA 4EUYA 3F63A 4F82A 4KSMA 4ZL7A 4NHWA 3TRQA 3GX8A 5LNKe 2LEGA 2CAQA 1XWCA 4RQXA 1U3IA 4P3YB 1K0AA 4Z2UA 4KF9A 2H30A 3RGBC 4ZL8A 1K3YA 4EDZA 3LORA 2IL3A 4AJ8A 1GLPA 4N0ZA 2LRNA 2RM6A 1OC9A 1JLVA 2WVYA 1EP8A 3CRUA 5H5SA 3TJBA 4N10A 1G7OA 3FZAA 2OE0A 2OADA 2F8FA 1PKWA 4GDFA 1M7TA 5DALB 2TRXA 2N5BA 3P7XA 3DXBA 4D73A 2GZPA 2H1AA 2EFHA 2VUPA 1KTEA 2OE1A 5ABRA 4MDCA 1BG1A 3NIVA 5CP1A 3MAKA 1GSYA 2KP2A 2DJJA 4MJAA 3UVHA 4WR5A 4K2XA 4EE0A 3L0HA 1ERVA 2JACA 1M9BA 1Z6MA 1I1IP 2IMIA 3KM6A 5FWGA 4PNGA 5A34B 2DJ1A 3BD2A 2AJQB 4K2DA 2JL4A 4F2IA 2MBSA 3LXTA 3R3EA 4KW6A 3L9UA 2B6MA 3GA4A 1ON4A 3GKKA 5G5FA 4O5RA 1X9MB 4CHSA 1O81A 2FD3A 2OJLA 1BEDA 1YQ1A 2E0QA 1T4YA 2FWGA 2C0EA 3NZNA 2JZRA 3WD6A 4V1Ag 4KUNA 3P8WA 3HXSA 17GSA 2CZ3A 4EKZA 2V6KA 4PNFA 1GTIA 5ECPB 3TOUA 3IRAA 3F4TA 2VLUA 1GSQA 3TKSE 1EOGA 3HJPA 4IKHA 5KOXA 1HNAA 4O92A 2VO4A 3H8QA 3MYDA 1A23A 4BL7B 4KCEA 2YWOA 1G7EA 1Z6NA 2A2PA 2R37A 3FR3A 5IPGA 4NWYA 1OC3A 2E2GA 2DC5A 1I5GA 4Q5QA 5HFIA 1EZKA 4TR4A 2WW2A 3DYRA 1SK0A 2MBTA 2BMXA 5ECSA 1XXUA 1TKDB 4KCAA 4HZ4A 3R2QA 2P0GA 2NPBA 4ZB8A 5G1KA 3E0UA 4ZB7A 2NBSA 4TR3A 4EF0A 2I9HA 3PGTA 2G0FA 2OBIA 3ME7A 3ZITA 2AUVA 3QCPA 4KDXA 2FNOA 1UC7A 1W89A 3IAM2 4K0NA 4BVYA 3ZIJA 5IPHA 4NXIA 2EFEA 2I4AA 1AW9A 4IW9A 1AC1A 5KOWA 2H6ZA 5FT3A 2L59A 3WYWA 1SJIA 2LTKA 1S3RA 2A2RA 3GH9A 2ALBA 3PPUA 1F3BA 4I6XA 4HUAA 2O36A 1R5AA 3APQA 2HFDA 4TXVA 5G30A 1VF3A 4MLYA 1A24A 5KN1A 2L4CA 5D9VA 3VPQA 5JWQB 1ACVA 1RW1A 3GURA 5D93A 3HVXA 3GUSA 3F3QA 1M2AA 3ZLPA 4HS1A 1PL2A 1YEWC 4FO5A 4XTSA 2QC7A 3ZL5A 1XWBA 4MA9A 3GV1A 1GUHA 3TCOA 2DJ3A 12GSA 2IFQA 1AIUA 1DE2A 2FLSA 3CTFA 2TRCP 3RDWA 2YOIA 5F0GA 1XG8A 4TXOA 3IPZA 5J40A 1J08A 4XIHA 5GSTA 4EDYA 2R0GA 1NSWA 2EFDA 2PPTA 2PBJA 6GSSA 1FB6A 3C71A 4NHZA 3QMXA 3GHAA 1EEMA 1YF0A 1T7PB 2WW0A 3HMJG 1X9WB 2GSTA 2QA1A 4G19A 20GSA 4GLTA 1SD9A 3EWLA 1CQGA 13GSA 2L6DA 5DJMA 4MCUA 1XBSA 2O5VA 1V40A 1S3CA 3APOA 3KH9A 3D6IA 3IHQA 1AQWA 3KP8A 4TR1B 1M9AA 2GVPA 1YKCA 2IMFA 2C4JA 4ML1A 2CX3A 5J4VA 5DAKB 2F51A 3LYKA 1SJ6A 5LCZA 1THXA 4TW5A 2ON5A 2WVXB 2MMOA 2VM2A 3FZ4A 5KEJA 3FEUA 3HJOA 3L9SA 2X4AA 4Q5FA 2H01A 3GTUA 5JCUA 2P5RA 1T3BA 4W66A 4KB3A 1RQMA 6GSTA 1WJKA 2HYXA 2PVOC 6GSWA 4F0CA 1TU8A 4EL1A 3FR9A 2DLXA 5G1LA 4MZBA 1GL8A 3ISOA 4L5LA 4EIQA 4DEJA 1Y25A 2B1KA 3KD0A 1F2EA 1JZRA 1YJ6A 1WE0A 1T00A 1M2DA 3LXZA 3A5IA 1VF4A 1K0OA 1R4WA 1V57A 2LQOA 3H93A 3KEBA 3UARA 1AQVA 1B4PA 5A4UA 4EO3A 1UN2A 4TRXA 4JR4A 1WRYA 2RUEA 1A8LA 3MWHA 5B7CA 4K5RA 1OKTA 1SU9A 1QGVA 4Z2TA 1EWXA 3HVVA 2AYTA 2MMAA 1AQXA 1MD4A 1TDIA 2H1LA 5ELAA 4EXJA 1TU7A 2PVQA 1OC9B 2FCHA 5KN0A 1SK1A 2MMNA 3EE2A 1S3AA 2DJKA 4K0GA 1ZZYA 1SENA 2K9FA 5AIVA 3FKFA 8GSSA 3Q74A 3L78A 3QFBC 4JEDA 5HR2A 1A0FA 2P5QA 4OFTA 4K6XA 16GSA 2C0GA 4NPBA 5IMFA 1GP1A 3TKRA 1PX6A 3LSZA 2H19A 3D22A 5DDLA 2GDRA 4KDYA 1SVOA 1JZOA 4GQCA 3ZREA 4KE3A 2H8LA 2V2GA 2GTUA 4K7IA 2QKEA 2H0HA 2HSHA 4PHZC 2YV9A 4YQMA 4GTUA 2H1GA 3UIWA 4K1FA 5B8BA 5A5KA 2YWMA 1SKWB 4YAPA 1K0BA 2EIOA 2GT5A 1VGLA 1JZWA 1EGOA 1KEBA 2LSTA 3L4NA 3N5OA 2FA4A 2YZHA 1TXUA 4OWYA 1V98A 2Z9SA 2FHEA 1SL1B 1XWGA 4YKFA 5EVOA 3RHBA 1PGTA 4N3ZA 3FW2A 3A5WA 4CY6A 4GSTA 5CRGA 2FWHA 5IM9A 5HR3A 3LQ7A 2ZCTA 1FVJA 5A1NA 3ERFA 3DVXA 4KNDA 4IQ1A 3H79A 2GSRA 5A4VA 1ML6A 5J3RA 2X49A 3RPPA 1FHEA 3K8NA 4AKHA 4I2TA 2HZEA 5A5HA 1WWJA 3UVTA 3Q18A 3FMWA 1XOAA 4I2UA 4PXOA 3PH9A 3IC8A 1FOHA 5IMCA 3EVIA 4OMVA 4NMUA 4IN0A 3IK7A 2BTOT 4G10A 2DMMA 5C00A 2WCIA 3HVNA 2HXKA 2L5OA 3APSA 3GMFA 3TGZA 1V2AA 2OACA 6GSVA 4K7OA 2OE3A
chains in the Genus database with same CATH topology
3RBTA 1U88A 2VLVA 4DSSA 3QDNA 3M8NA 2H6YA 3ZTLA 2DJ2A 3G7YA 2FWEA 5BRTA 5CRWA 3EPTA 1B9XC 2HRAA 3KXOA 1CQHA 1XIYA 3FZ9A 4L0WA 1GWCA 3KTBA 5DQSA 4YQVA 1N2AA 1EGRA 4Q5NA 4AF2A 4IHUA 2YCDA 4PUAA 1ZCPA 3G7IA 5CNWA 3LWAA 3FHKA 2DJ0A 4JU5A 3SBCA 3ZVJA 3DGQA 3GH6A 4BVYB 4KSOA 5DBQA 5J41A 1YVLA 5CRHA 2YV7A 1SYRA 4QL9A 4BVXA 2KUCA 2WULA 5BMUB 2FGXA 4WXTA 1FG4A 1YEPA 4XS4B 3UL3A 4KDUA 3KIJA 4OCFA 3H1NA 3AY8A 4HEA2 3F8UA 2R0PA 3DVWA 3M0FA 6GSUA 1USBA 3ZMLA 1SKRB 1Y1UA 5JWRB 3E3EA 3HHVA 2IPAA 4WKWA 2B7KA 2HRFA 2K8VA 3F9UA 5J5NA 3M3MA 3C73A 3HYPA 2H71A 2H1BA 5GSSA 2LNSA 2NVLA 3IBHA 1TOFA 1F3AA 2J23A 3VI5A 2ON7A 2R5GA 2HSNA 4WEYA 4LMVA 3WGXA 3DMLA 3FY7A 3ZFBA 3QFAC 2XHFA 4N0VA 2WZ9A 3D4MA 4DVCA 2VCWA 5G5EA 1KNGA 1XW5A 1JFUA 2R6KA 3VWWA 2HI7A 4IP6A 1PKZA 2C1YA 5IQYA 4FYCA 5DJLA 2RLIA 4ACSA 3LEFA 2H73A 1NW2A 4MF6A 1F9MA 1JZDA 1GRXA 3U6VA 1T8EB 5ID2A 3GL5A 3A2WA 3LW9A 5AGYA 1YF1A 1Z3EA 3C7MA 3F4RA 4OO5A 11GSA 4IP1A 3FR6A 2HLSA 4MF7A 1B8XA 1Q4JA 5G31A 4PX1A 1AUCA 1YDKA 3ZZXA 1ZYEA 1K3OA 4ECCA 5CREA 4GRFA 4N11A 1HNCA 4MZCA 2OA7A 1XZOA 3F6DA 5IMZA 3US3A 1OVNA 3FRCA 4GCIA 2B5YA 4ECJA 4RUVA 1XVWA 4CDOA 2OT3A 3WGEA 2CAIA 3GNJA 3DKSA 1QK8A 1U6TA 2YN1A 1A8YA 2O8VB 2HSMB 2K18A 3EU3A 4HQSA 4V2LA 4L0UA 1GSEA 3J7Yk 1QQ2A 4IELA 1V9WA 1Z7PA 2B5XA 4OFNA 1C72A 1YZXA 3J7Yb 4WBRD 5HFKA 1XWAA 4I8BA 1GULA 1GNWA 1HNBA 3RPNA 3DWVA 2VKZG 3ZIVA 1TK5B 3HA9A 4TN8A 1KBNA 4GSSA 2NDOA 5D96A 4DSQA 4XS6A 3I9V2 2B1LA 4GXZA 5JWOB 3M1GA 5ECHB 3ZFLA 3ZMKA 3N9JA 2JSYA 5DALA 4LL1B 4J56E 2J9HA 1EP7A 4J57E 2VOCA 5EPFA 4TKYA 4E68A 3EMXA 2HT9A 2A2SA 2F8AA 3UOMA 4FH8A 5DCGA 1PX7A 3TB2A 3EYTA 4FIWA 2AV4A 1BAYA 3QOUA 3WT1A 2QA2A 1OE7A 4YAVA 2VCTA 4ML6A 2WFCA 3GL3A 2CX4A 5ECIB 2IMDA 2PUKC 2VD1A 4PGTA 1GLQA 3QD9A 2IN3A 2WJUA 1R5PA 4NV5A 3KH7A 3TRXA 2B7JA 2A4HA 1B9YC 2DIYA 2RM5A 3RHCA 2C80A 4YQUA 4IJ3A 1G6YA 1WPIA 1TW9A 3VURA 4QMKA 5D8IA 3D21A 2O89A 2KP1A 5ECOB 3F6FA 3IC4A 5IMAA 4ZILA 4HJMA 2HRNA 3O3TA 4E8HA 5D9WA 4EVMA 3GSSA 2EC4A 2DKIA 3A3TA 1K3LA 4IVFA 2O7KA 2X64A 4IGJA 19GSA 1XW9A 2RUFA 1PN9A 2OKAA 4KGIA 3VWUA 2V32A 4AKXB 4MH2A 5ECQB 2VCVA 5J9CA 1N25A 3QAVA 1QUWA 4BL7A 4ZBAA 3IDVA 1HQOA 5J9BA 3IOSA 4HU9A 5ECLB 4PURA 5JCWA 4HDEA 1FB0A 3KP9A 2BJXA 4TVEA 4TR0A 1O73A 1EV9A 5ECMB 1GTAA 4MF5A 4X43A 1OC8A 3U5RE 1ERWA 2K6VA 3P90A 3P2AA 4GQFA 2UV8G 3DEXA 3UJ1A 1BJXA 4K9ZA 3MNGA 5D9TA 2IJYA 4ZXGA 1TXXA 5GAPD 6GSXA 4ILFA 3TKSC 1M0UA 1SJZA 2YNXA 1A2MA 4Z7XA 1K0DA 3CBUA 2F3MA 3CSHA 5JCGA 2LKUA 2DBCA 4OD7A 3GX0A 4MJCA 5B8AA 2FA8A 1FW1A 5EY6A 1PL1A 2JZSA 2O87A 1Z5YE 3KJYA 2F9SA 5HQPA 2DSAA 2JSZA 4NAXA 2MMZA 1DSBA 2WGRA 4ZB6A 2A4VA 2L57A 3HCZA 4POKA 3IHGA 1XWKA 3I43A 9GSSA 2B5EA 5DCHA 4AJ6A 4ICYA 4MPGA 1GH2A 1GSFA 1HYUA 4YKGA 4XS1A 4D73B 4GSNA 5ECKB 1ZOFA 4POLA 1BYEA 2C0FA 1QMVA 4MJBA 2GQLA 3ERWA 1IYIA 1Q98A 2IMEA 3PR8A 4ECBA 1OKDA 1A2LA 2VAFA 5KN3A 2QSIA 3ZRDA 4V2MA 1WMJA 3VWVA 1SVLA 2XBIA 4RI7A 3W8JA 4I97A 4O5UA 5H5QA 2AHEA 3DIEA 2PN8A 4ZIJA 4XRAA 3VLNA 1OYJA 2GSSA 3EC3A 22GSA 3ME8A 3BBYA 3QAGA 2R2JA 4IS0A 1SVMA 2N5FA 5ECRB 3A2VA 1LBKA 4ZBDA 2VM1A 5F8BA 4G0LA 1AAZA 3VPTA 4IBPA 1PSQA 1NHOA 4GWRA 4TR1A 1IYHA 4WF4A 1GSDA 18GSA 2WS2A 3TJKA 2M80A 1WIKA 5DAKA 1VF1A 1T4ZA 3I6AA 3W6GA 4BPYA 2CVKA 4PUFC 5F07A 3LFLA 1SL0B 2CVBA 3LGCA 1M2BA 2V6OA 3PINA 1R26A 3TKQA 3M9KA 1TRSA 5CRDA 3HZ8A 1QFNA 2TIRA 2XPEA 2UZ8A 4AGSA 2X8HA 2H6XA 3UMAA 2MZCA 1O7UA 3HY2A 1I9DA 1TRWA 5HFGA 3LYPA 4TOPA 3F4SA 4OCEA 1XFLA 2L6CA 1XW6A 2N5AA 2PGTA 3GIXA 4V1Ap 1O85A 2CQ9A 4JR6A 4OFMA 1K0NA 3IK9A 4ZL9A 1FO5A 1TP9A 4PQIA 5L71A 1TTZA 3TU3B 4G9HA 1X5EA 4FYBA 1MDKA 1XCCA 2H66A 3UEMA 5CYYA 2QGVA 3KZQA 2B3SA 2C3NA 3D4TA 4KX4A 1R7HA 3C1RA 3TKPA 3Q6OA 1UA5A 3QPMA 2PERA 4MJEA 3GYKA 2HRKA 1TK0B 5HR0A 3H4KA 2H75A 5IO0A 1NHYA 1S3DA 4MZWA 4X0XA 3TRPA 3ZVJD 1THOA 2WRTA 2D2ZA 3CYNA 2C0DA 2DIZA 5J47A 1VRSD 3Q19A 2E2MA 4MP4A 2VL2A 3F3RA 5E59A 4USSA 1TRVA 1BF5A 1WOUA 2MYGA 2GQKA 3BCIA 4G01A 4WR4A 2K8SA 1T1VA 2XBQA 2YJHA 4ZB9A 1TI3A 1N8JA 5INYA 2LS5A 3TKSA 1K0MA 1M99A 1ZYPA 5C04A 1MTCA 3HJMA 2WDUA 2KLXA 4BWQA 2I81A 3M9JA 3HD5A 1UVZA 3CMIA 4PQ1A 2ES7A 2IFQB 2OBKA 5CAXA 4TXOB 3QAWA 2CV4A 1ZMAA 1TRUA 2HZFA 2EIQA 2L4QA 1G6WA 3GKMA 5IIZA 3FYGA 1DUGA 2YP6A 5ENUA 3IE3A 3KMOA 3OR5A 2E7PA 4EIPA 1VF2A 3GRXA 3QR6A 5HR1A 4JZQA 1O8XA 1TJDA 5IMDA 3E9JB 1XVQA 3UAPA 3VFIA 5D9XA 1XPVA 4MMMA 5J4UA 4ISDA 3DRNA 2VL3A 2PU9C 4IJIA 4RI6A 3IV4A 5IOXA 1W4VA 3RAZA 2AAWA 4L8EA 1MDJA 4MH3A 2FY6A 3F0IA 3SWLA 3TJJA 4KA0A 2EIRA 2V41A 1YKAA 1PMTA 2X8CA 2LNTA 2CA8A 1Y6EA 3S9FA 3IR4A 4ID0A 5G2ZA 4AI6A 1WP0A 3HZ4A 5EL8A 2YWNA 1XOBA 2LJAA 4HZ2A 4YH2A 3IAS2 2HQTA 2WB9A 3GTUB 3ERGA 2X8GA 4XCSA 3EINA 1SYXA 2V1MA 4PTSA 2LJKA 2LUSA 2VD0A 1GUMA 5D73A 4N30A 3G7JA 1X0RA 14GSA 1X5CA 3ED3A 5ECNB 1GUKA 1ZYNA 1E6BA 3HVSA 3LJRA 4HU7A 5COHA 2GZZA 4POMA 5AISA 2YWIA 4HI7A 2M72A 5BMUA 4QQ7A 2JADA 1YEXA 3WGDA 4XS4A 3A2XA 3CRTA 5IO2A 1ERTA 4MPFA 3HKRA 2LRTA 1GSUA 4WBJA 2RIIA 5IMVA 3GSTA 1MD3A 4AKIA 4BWSA 1ERUA 1U3AA 3W8SA 4HOJA 1SK2A 4JRRA 4AKGA 4GF0A 2JU5A 1EOHA 3KMNA 4JE1A 4AJ7A 2I3YA 3CSIA 4LLRA 4BA7A 3I69A 2IWTA 4POBA 5A34A 3TJFA 2H76A 2H70A 3MIXA 5AN1A 2DKHA 1BG5A 1ZYQB 2C3TA 2GS3A 1B48A 1K0CA 2REMA 3GKNA 2P31A 1A2JA 1PRXA 5LD0A 1FVKA 1EV4A 3EURA 1ZL9A 1SKSB 2O85A 3VK9A 1V58A 2VIMA 1MDIA 2L5LA 3O6TA 3O76A 1PD21 2R0CA 4WETA 5B6NA 1TI1A 1BX9A 1ABAA 2XPDA 3DD3A 3C8EA 1FOVA 2FUG2 1E2YA 1GTBA 4G0IA 1QXHA 5A4WA 4K8MA 3VWXA 2C3QA 4X4JA 3V1WA 4CW9A 5A1NB 2VLTA 2EFCA 1PA3A 3NOFA 4CY8A 4J2FA 5DVBA 1ST9A 4HJ2A 5E4WA 2PMTA 2LQQA 2M46A 2YANA 2H74A 4E8EA 5A5HB 2HZEB 4WF5A 3BOAA 2LV3A 1O8WA 1ZGNA 1F37A 2H72A 4QL7A 4PQHA 1NM3A 2H0IA 3FK8A 10GSA 1SL2B 1H75A 3KGKA 3GFKA 5CO3A 2YZUA 1OAZA 4KAEA 7GSSA 2VL2C 1EEJA 3GN3A 4EC0A 3CSJA 4V2NA 1Z9HA 4F9ZA 2HSMA 5FHIA 1GSSA 4RQRA 4O7HA 3D5JA 4O32A 4F0BA 2GQMA 4LL4B 3BJ5A 2HSYA 4DSSB 2VL9A 4H86A 1X5DA 1JHBA 4KH7A 2FWFA 4LA1A 3UBKA 1O6JA 5F05A 3FZ5A 2CZ2A 2GSQA 2H1DA 1B4QA 1PQNA 5H5RA 1F6MC 2YJ7A 4XHMA 1A0RP 4ZBBA 5ELGA 3WT2A 4DSRA 5GZZB 4A5PA 1MEKA 4HQZA 4NV2A 4BVXB 4K7NA 3HDCA 5AIXA 2YPMA 4G2EA 3MDKA 2ZUPA 5B6MA 1GNEA 4MK3A 3MSZA 4FQUA 2GGTA 2HRKB 2XC2A 3TOTA 2AB6A 1GTUA 3IA1A 5IOWA 1U87A 3CTGA 4F03A 3G9BA 4ECIA 5J4YA 4OO4A 3TUEA 1G0TA 1LU4A 2I1UA 1PN0A 1Z7RA 4G0KA 4L5OA 3EMPA 2KHPA 1J0FA 2HSNB 3JCML 2VCXA 2R4VA 3TJGA 1URMA 3LG6A 6GSYA 2G2QA 2R3XA 5F06A 5KN2A 3CWGA 3KCMA 2CVDA 4K5SA 1ILOA 4Z2RA 2HNLA 4JBBA 2H0GA 4X1UA 1JLWA 5DQYA 3L9VA 3CXGA 4XRDA 5ID2B 1YY7A 1OE8A 2LRCA 1BQ7A 4Q5RA 2GT6A 2NTOA 2IIYA 1H4OA 1RK4A 2IMKA 2JZTA 4MNNA 3TDGA 3C1SA 1TK8B 2VCQA 4MABA 4O5QA 2ZNMA 3EU4A 3BCKA 1AXDA 2DMLA 3D0ZA 2GLRA 3IXRA 4FYUA 2PWJA 2VCZA 4I5QA 1FAAA 5GAND 1J9BA 4ULXA 3ZYWA 2GZYA 3GKXA 2C8UA 4IQAA 2X99A 1LJRA 3VI7A 1DE1A 4LMWA 1DBYA 2HE3A 3UBLA 2LJRA 1HD2A 3KTLA 2CT6A 1X9SB 1SD8A 2KOKA 4EUYA 3F63A 4F82A 4KSMA 4ZL7A 4NHWA 3TRQA 3GX8A 5LNKe 2LEGA 2CAQA 1XWCA 4RQXA 1U3IA 4P3YB 1K0AA 4Z2UA 4KF9A 2H30A 4ZL8A 1K3YA 4EDZA 3LORA 2IL3A 4AJ8A 1GLPA 4N0ZA 2LRNA 2RM6A 1OC9A 1JLVA 1EP8A 3CRUA 5H5SA 3TJBA 4N10A 1G7OA 3FZAA 2OE0A 2OADA 2F8FA 1PKWA 4GDFA 1M7TA 5DALB 2TRXA 2N5BA 3P7XA 3DXBA 4D73A 2GZPA 2H1AA 2EFHA 2VUPA 1KTEA 2OE1A 5ABRA 4MDCA 1BG1A 3NIVA 5CP1A 3MAKA 1GSYA 2KP2A 2DJJA 4MJAA 3UVHA 4WR5A 4K2XA 4EE0A 3L0HA 1ERVA 2JACA 1M9BA 1Z6MA 2IMIA 3KM6A 5FWGA 4PNGA 5A34B 2DJ1A 3BD2A 2AJQB 4K2DA 2JL4A 4F2IA 2MBSA 3LXTA 3R3EA 4KW6A 3L9UA 2B6MA 3GA4A 1ON4A 3GKKA 5G5FA 4O5RA 1X9MB 4CHSA 1O81A 2FD3A 2OJLA 1BEDA 1YQ1A 2E0QA 1T4YA 2FWGA 2C0EA 3NZNA 2JZRA 3WD6A 4V1Ag 4KUNA 3P8WA 3HXSA 17GSA 2CZ3A 4EKZA 2V6KA 4PNFA 1GTIA 5ECPB 3TOUA 3IRAA 3F4TA 2VLUA 1GSQA 3TKSE 1EOGA 3HJPA 4IKHA 5KOXA 1HNAA 4O92A 2VO4A 3H8QA 3MYDA 1A23A 4BL7B 4KCEA 2YWOA 1G7EA 1Z6NA 2A2PA 2R37A 3FR3A 5IPGA 4NWYA 1OC3A 2E2GA 2DC5A 1I5GA 4Q5QA 5HFIA 1EZKA 4TR4A 3DYRA 1SK0A 2MBTA 2BMXA 5ECSA 1XXUA 1TKDB 4KCAA 4HZ4A 3R2QA 2P0GA 2NPBA 4ZB8A 5G1KA 3E0UA 4ZB7A 2NBSA 4TR3A 4EF0A 2I9HA 3PGTA 2G0FA 2OBIA 3ME7A 3ZITA 2AUVA 3QCPA 4KDXA 2FNOA 1UC7A 1W89A 3IAM2 4K0NA 4BVYA 3ZIJA 5IPHA 4NXIA 2EFEA 2I4AA 1AW9A 4IW9A 1AC1A 5KOWA 2H6ZA 5FT3A 2L59A 3WYWA 1SJIA 2LTKA 2A2RA 3GH9A 2ALBA 3PPUA 1F3BA 4I6XA 4HUAA 1R5AA 3APQA 2HFDA 4TXVA 5G30A 1VF3A 4MLYA 1A24A 5KN1A 2L4CA 5D9VA 3VPQA 5JWQB 1ACVA 1RW1A 3GURA 5D93A 3HVXA 3GUSA 3F3QA 1M2AA 3ZLPA 4HS1A 1PL2A 4FO5A 4XTSA 2QC7A 3ZL5A 1XWBA 4MA9A 3GV1A 1GUHA 3TCOA 2DJ3A 12GSA 2IFQA 1AIUA 1DE2A 2FLSA 3CTFA 2TRCP 3RDWA 2YOIA 5F0GA 4TXOA 3IPZA 5J40A 1J08A 4XIHA 5GSTA 4EDYA 2R0GA 1NSWA 2EFDA 2PPTA 2PBJA 6GSSA 1FB6A 3C71A 4NHZA 3QMXA 3GHAA 1EEMA 1YF0A 1T7PB 3HMJG 1X9WB 2GSTA 2QA1A 4G19A 20GSA 4GLTA 1SD9A 3EWLA 1CQGA 13GSA 2L6DA 5DJMA 4MCUA 1XBSA 2O5VA 1V40A 1S3CA 3APOA 3KH9A 3D6IA 3IHQA 1AQWA 3KP8A 4TR1B 1M9AA 2GVPA 1YKCA 2IMFA 2C4JA 4ML1A 2CX3A 5J4VA 5DAKB 2F51A 3LYKA 1SJ6A 5LCZA 1THXA 4TW5A 2ON5A 2MMOA 2VM2A 3FZ4A 5KEJA 3FEUA 3HJOA 3L9SA 2X4AA 4Q5FA 2H01A 3GTUA 5JCUA 2P5RA 1T3BA 4W66A 4KB3A 1RQMA 6GSTA 1WJKA 2HYXA 2PVOC 6GSWA 4F0CA 1TU8A 4EL1A 3FR9A 2DLXA 5G1LA 4MZBA 1GL8A 3ISOA 4L5LA 4EIQA 4DEJA 1Y25A 2B1KA 3KD0A 1F2EA 1JZRA 1YJ6A 1WE0A 1T00A 1M2DA 3LXZA 3A5IA 1VF4A 1K0OA 1R4WA 1V57A 2LQOA 3H93A 3KEBA 3UARA 1AQVA 1B4PA 5A4UA 4EO3A 1UN2A 4TRXA 4JR4A 1WRYA 2RUEA 1A8LA 3MWHA 5B7CA 4K5RA 1OKTA 1SU9A 1QGVA 4Z2TA 1EWXA 3HVVA 2AYTA 2MMAA 1AQXA 1MD4A 1TDIA 2H1LA 5ELAA 4EXJA 1TU7A 2PVQA 1OC9B 2FCHA 5KN0A 1SK1A 2MMNA 3EE2A 1S3AA 2DJKA 4K0GA 1ZZYA 1SENA 2K9FA 5AIVA 3FKFA 8GSSA 3Q74A 3L78A 3QFBC 4JEDA 5HR2A 1A0FA 2P5QA 4OFTA 4K6XA 16GSA 2C0GA 4NPBA 5IMFA 1GP1A 3TKRA 1PX6A 3LSZA 2H19A 3D22A 5DDLA 2GDRA 4KDYA 1SVOA 1JZOA 4GQCA 3ZREA 4KE3A 2H8LA 2V2GA 2GTUA 4K7IA 2QKEA 2H0HA 2HSHA 4YQMA 2YV9A 4GTUA 2H1GA 3UIWA 4K1FA 5B8BA 5A5KA 2YWMA 1SKWB 4YAPA 1K0BA 2EIOA 2GT5A 1VGLA 1JZWA 1EGOA 1KEBA 2LSTA 3L4NA 3N5OA 2FA4A 2YZHA 1TXUA 4OWYA 1V98A 2Z9SA 2FHEA 1SL1B 1XWGA 4YKFA 5EVOA 3RHBA 1PGTA 4N3ZA 3FW2A 3A5WA 4CY6A 4GSTA 5CRGA 2FWHA 5IM9A 5HR3A 3LQ7A 2ZCTA 1FVJA 5A1NA 3ERFA 3DVXA 4KNDA 4IQ1A 3H79A 2GSRA 5A4VA 1ML6A 5J3RA 2X49A 3RPPA 1FHEA 3K8NA 4AKHA 4I2TA 2HZEA 5A5HA 1WWJA 3UVTA 3Q18A 3FMWA 1XOAA 4I2UA 4PXOA 3PH9A 3IC8A 1FOHA 5IMCA 3EVIA 4OMVA 4NMUA 4IN0A 3IK7A 2BTOT 4G10A 2DMMA 5C00A 2WCIA 2HXKA 2L5OA 3APSA 3GMFA 3TGZA 1V2AA 2OACA 6GSVA 4K7OA 2OE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RBT A;  1U88 A;  2VLV A;  4DSS A;  3QDN A;  3M8N A;  2H6Y A;  3ZTL A;  2DJ2 A;  3G7Y A;  2FWE A;  5CRW A;  1B9X C;  2HRA A;  3KXO A;  1CQH A;  1XIY A;  3FZ9 A;  4L0W A;  1GWC A;  3KTB A;  5DQS A;  4YQV A;  1N2A A;  1EGR A;  4Q5N A;  4AF2 A;  4IHU A;  2YCD A;  4PUA A;  1ZCP A;  3G7I A;  5CNW A;  3LWA A;  3FHK A;  2DJ0 A;  4JU5 A;  3SBC A;  3ZVJ A;  3DGQ A;  3GH6 A;  4BVY B;  4KSO A;  5DBQ A;  5J41 A;  5CRH A;  2YV7 A;  1SYR A;  4QL9 A;  4BVX A;  2KUC A;  2WUL A;  2FGX A;  4WXT A;  1FG4 A;  1YEP A;  4XS4 B;  3UL3 A;  4KDU A;  3KIJ A;  4OCF A;  3H1N A;  3AY8 A;  4HEA 2;  3F8U A;  3DVW A;  3M0F A;  6GSU A;  1USB A;  3ZML A;  1SKR B;  5JWR B;  3E3E A;  3HHV A;  2IPA A;  4WKW A;  2B7K A;  2HRF A;  2K8V A;  3F9U A;  5J5N A;  3M3M A;  3C73 A;  3HYP A;  2H71 A;  2H1B A;  5GSS A;  2LNS A;  2NVL A;  3IBH A;  1TOF A;  1F3A A;  2J23 A;  3VI5 A;  2ON7 A;  2R5G A;  4WEY A;  3WGX A;  4LMV A;  3DML A;  3FY7 A;  3ZFB A;  3QFA C;  2XHF A;  4N0V A;  2WZ9 A;  3D4M A;  4DVC A;  2VCW A;  5G5E A;  1KNG A;  1XW5 A;  1JFU A;  2R6K A;  3VWW A;  2HI7 A;  4IP6 A;  1PKZ A;  2C1Y A;  5IQY A;  4FYC A;  5DJL A;  2RLI A;  4ACS A;  3LEF A;  2H73 A;  1NW2 A;  4MF6 A;  1F9M A;  1JZD A;  1GRX A;  3U6V A;  1T8E B;  5ID2 A;  3GL5 A;  3A2W A;  5AGY A;  1YF1 A;  1Z3E A;  3C7M A;  3F4R A;  4OO5 A;  11GS A;  4IP1 A;  3FR6 A;  2HLS A;  4MF7 A;  1B8X A;  1Q4J A;  5G31 A;  4PX1 A;  1AUC A;  1YDK A;  3ZZX A;  1ZYE A;  1K3O A;  4ECC A;  5CRE A;  4GRF A;  4N11 A;  1HNC A;  4MZC A;  2OA7 A;  1XZO A;  3F6D A;  5IMZ A;  3US3 A;  1OVN A;  3FRC A;  4GCI A;  2B5Y A;  4ECJ A;  4RUV A;  1XVW A;  4CDO A;  3WGE A;  2CAI A;  3GNJ A;  3DKS A;  1QK8 A;  1U6T A;  2YN1 A;  1A8Y A;  2O8V B;  2HSM B;  2K18 A;  3EU3 A;  4HQS A;  4V2L A;  4L0U A;  1GSE A;  3J7Y k;  1QQ2 A;  4IEL A;  1V9W A;  1Z7P A;  2B5X A;  4OFN A;  1C72 A;  1YZX A;  3J7Y b;  4WBR D;  5HFK A;  1XWA A;  4I8B A;  1GUL A;  1GNW A;  1HNB A;  3RPN A;  3DWV A;  3ZIV A;  1TK5 B;  3HA9 A;  4TN8 A;  1KBN A;  4GSS A;  2NDO A;  5D96 A;  4DSQ A;  4XS6 A;  3I9V 2;  2B1L A;  4GXZ A;  5JWO B;  3M1G A;  5ECH B;  3ZFL A;  3ZMK A;  3N9J A;  2JSY A;  5DAL A;  4LL1 B;  4J56 E;  2J9H A;  1EP7 A;  4J57 E;  2VOC A;  5EPF A;  4TKY A;  3EMX A;  2HT9 A;  2A2S A;  2F8A A;  3UOM A;  4FH8 A;  5DCG A;  1PX7 A;  3TB2 A;  3EYT A;  4FIW A;  2AV4 A;  1BAY A;  3QOU A;  3WT1 A;  1OE7 A;  4YAV A;  2VCT A;  4ML6 A;  2WFC A;  3GL3 A;  2CX4 A;  5ECI B;  2IMD A;  2PUK C;  2VD1 A;  4PGT A;  1GLQ A;  3QD9 A;  2IN3 A;  2WJU A;  1R5P A;  4NV5 A;  3KH7 A;  3TRX A;  2B7J A;  1B9Y C;  2DIY A;  2RM5 A;  3RHC A;  2C80 A;  4YQU A;  4IJ3 A;  1G6Y A;  1WPI A;  1TW9 A;  3VUR A;  5D8I A;  3D21 A;  2O89 A;  2KP1 A;  5ECO B;  3F6F A;  3IC4 A;  5IMA A;  4ZIL A;  4HJM A;  2HRN A;  3O3T A;  4E8H A;  5D9W A;  4EVM A;  3GSS A;  2EC4 A;  3A3T A;  1K3L A;  4IVF A;  2O7K A;  2X64 A;  4IGJ A;  19GS A;  1XW9 A;  2RUF A;  1PN9 A;  2OKA A;  4KGI A;  3VWU A;  2V32 A;  4MH2 A;  5ECQ B;  2VCV A;  5J9C A;  3QAV A;  1QUW A;  4BL7 A;  4ZBA A;  3IDV A;  1HQO A;  5J9B A;  3IOS A;  4HU9 A;  5ECL B;  4PUR A;  5JCW A;  4HDE A;  1FB0 A;  3KP9 A;  2BJX A;  4TVE A;  4TR0 A;  1O73 A;  1EV9 A;  5ECM B;  1GTA A;  4MF5 A;  4X43 A;  1OC8 A;  3U5R E;  1ERW A;  2K6V A;  3P90 A;  3P2A A;  4GQF A;  3UJ1 A;  3DEX A;  1BJX A;  4K9Z A;  3MNG A;  5D9T A;  2IJY A;  4ZXG A;  1TXX A;  5GAP D;  6GSX A;  4ILF A;  3TKS C;  1M0U A;  1SJZ A;  2YNX A;  1A2M A;  4Z7X A;  1K0D A;  3CBU A;  2F3M A;  3CSH A;  5JCG A;  2LKU A;  2DBC A;  4OD7 A;  3GX0 A;  4MJC A;  5B8A A;  2FA8 A;  1FW1 A;  5EY6 A;  1PL1 A;  2JZS A;  2O87 A;  1Z5Y E;  3KJY A;  2F9S A;  5HQP A;  2DSA A;  2JSZ A;  4NAX A;  2MMZ A;  1DSB A;  2WGR A;  4ZB6 A;  2A4V A;  2L57 A;  3HCZ A;  4POK A;  1XWK A;  3I43 A;  9GSS A;  2B5E A;  5DCH A;  4AJ6 A;  4MPG A;  1GH2 A;  1GSF A;  1HYU A;  4XS1 A;  4D73 B;  4GSN A;  5ECK B;  1ZOF A;  4POL A;  1BYE A;  2C0F A;  1QMV A;  4MJB A;  2GQL A;  3ERW A;  1IYI A;  1Q98 A;  2IME A;  3PR8 A;  4ECB A;  1OKD A;  1A2L A;  2VAF A;  5KN3 A;  2QSI A;  3ZRD A;  4V2M A;  1WMJ A;  3VWV A;  2XBI A;  4RI7 A;  3W8J A;  4I97 A;  5H5Q A;  2AHE A;  3DIE A;  2PN8 A;  4ZIJ A;  4XRA A;  3VLN A;  1OYJ A;  2GSS A;  3EC3 A;  22GS A;  3ME8 A;  3BBY A;  3QAG A;  2R2J A;  4IS0 A;  2N5F A;  5ECR B;  3A2V A;  1LBK A;  4ZBD A;  2VM1 A;  5F8B A;  4G0L A;  1AAZ A;  3VPT A;  4IBP A;  1PSQ A;  1NHO A;  4GWR A;  4TR1 A;  1IYH A;  4WF4 A;  1GSD A;  18GS A;  2WS2 A;  3TJK A;  2M80 A;  1WIK A;  5DAK A;  1VF1 A;  1T4Z A;  3I6A A;  3W6G A;  4BPY A;  2CVK A;  4PUF C;  5F07 A;  3LFL A;  1SL0 B;  2CVB A;  3LGC A;  1M2B A;  2V6O A;  3PIN A;  1R26 A;  3TKQ A;  3M9K A;  1TRS A;  5CRD A;  3HZ8 A;  1QFN A;  2TIR A;  2XPE A;  2UZ8 A;  4AGS A;  2X8H A;  2H6X A;  3UMA A;  2MZC A;  1O7U A;  3HY2 A;  1I9D A;  1TRW A;  5HFG A;  3LYP A;  4TOP A;  3F4S A;  4OCE A;  1XFL A;  2L6C A;  1XW6 A;  2N5A A;  2PGT A;  3GIX A;  4V1A p;  1O85 A;  2CQ9 A;  4JR6 A;  4OFM A;  1K0N A;  3IK9 A;  4ZL9 A;  1FO5 A;  1TP9 A;  4PQI A;  5L71 A;  1TTZ A;  4G9H A;  1X5E A;  4FYB A;  1MDK A;  1XCC A;  2H66 A;  3UEM A;  5CYY A;  2QGV A;  3KZQ A;  2B3S A;  2C3N A;  3D4T A;  4KX4 A;  1R7H A;  3C1R A;  3TKP A;  3Q6O A;  1UA5 A;  3QPM A;  2PER A;  4MJE A;  3GYK A;  2HRK A;  1TK0 B;  5HR0 A;  3H4K A;  2H75 A;  5IO0 A;  1NHY A;  1S3D A;  4MZW A;  4X0X A;  3TRP A;  3ZVJ D;  1THO A;  2WRT A;  2D2Z A;  3CYN A;  2C0D A;  2DIZ A;  1VRS D;  3Q19 A;  2E2M A;  4MP4 A;  2VL2 A;  3F3R A;  5E59 A;  4USS A;  1TRV A;  1WOU A;  2MYG A;  2GQK A;  3BCI A;  4WR4 A;  2K8S A;  1T1V A;  2XBQ A;  2YJH A;  4ZB9 A;  1TI3 A;  1N8J A;  5INY A;  2LS5 A;  3TKS A;  1K0M A;  1M99 A;  5C04 A;  1MTC A;  3HJM A;  2WDU A;  2KLX A;  4BWQ A;  2I81 A;  3M9J A;  3HD5 A;  1UVZ A;  3CMI A;  4PQ1 A;  2ES7 A;  2IFQ B;  2OBK A;  5CAX A;  4TXO B;  3QAW A;  2CV4 A;  1ZMA A;  1TRU A;  2HZF A;  2EIQ A;  2L4Q A;  1G6W A;  3GKM A;  5IIZ A;  3FYG A;  1DUG A;  2YP6 A;  5ENU A;  3IE3 A;  3KMO A;  3OR5 A;  2E7P A;  1VF2 A;  3GRX A;  3QR6 A;  5HR1 A;  4JZQ A;  1O8X A;  1TJD A;  5IMD A;  3E9J B;  1XVQ A;  3UAP A;  3VFI A;  5D9X A;  1XPV A;  4MMM A;  5J4U A;  4ISD A;  3DRN A;  2VL3 A;  2PU9 C;  4IJI A;  4RI6 A;  3IV4 A;  5IOX A;  1W4V A;  3RAZ A;  2AAW A;  4L8E A;  1MDJ A;  4MH3 A;  2FY6 A;  3F0I A;  3SWL A;  3TJJ A;  4KA0 A;  2EIR A;  2V41 A;  1YKA A;  1PMT A;  2X8C A;  2LNT A;  2CA8 A;  1Y6E A;  3S9F A;  3IR4 A;  4ID0 A;  5G2Z A;  1WP0 A;  3HZ4 A;  5EL8 A;  2YWN A;  1XOB A;  2LJA A;  4HZ2 A;  4YH2 A;  3IAS 2;  2HQT A;  2WB9 A;  3GTU B;  3ERG A;  2X8G A;  4XCS A;  3EIN A;  1SYX A;  2V1M A;  4PTS A;  2LJK A;  2LUS A;  2VD0 A;  1GUM A;  5D73 A;  4N30 A;  3G7J A;  1X0R A;  14GS A;  1X5C A;  3ED3 A;  5ECN B;  1GUK A;  1E6B A;  3HVS A;  3LJR A;  4HU7 A;  5COH A;  2GZZ A;  4POM A;  5AIS A;  2YWI A;  4HI7 A;  2M72 A;  5BMU A;  4QQ7 A;  2JAD A;  1YEX A;  3WGD A;  4XS4 A;  3A2X A;  3CRT A;  5IO2 A;  1ERT A;  4MPF A;  3HKR A;  2LRT A;  1GSU A;  4WBJ A;  2RII A;  5IMV A;  3GST A;  1MD3 A;  4BWS A;  1ERU A;  1U3A A;  3W8S A;  4HOJ A;  1SK2 A;  4JRR A;  4GF0 A;  2JU5 A;  1EOH A;  3KMN A;  4JE1 A;  4AJ7 A;  2I3Y A;  3CSI A;  4LLR A;  4BA7 A;  3I69 A;  2IWT A;  4POB A;  3TJF A;  2H76 A;  2H70 A;  5AN1 A;  1BG5 A;  1ZYQ B;  2C3T A;  2GS3 A;  1B48 A;  1K0C A;  2REM A;  3GKN A;  2P31 A;  1A2J A;  1PRX A;  5LD0 A;  1FVK A;  1EV4 A;  3EUR A;  1ZL9 A;  1SKS B;  2O85 A;  3VK9 A;  1V58 A;  2VIM A;  1MDI A;  2L5L A;  3O6T A;  3O76 A;  1PD2 1;  4WET A;  5B6N A;  1TI1 A;  1BX9 A;  1ABA A;  2XPD A;  3DD3 A;  3C8E A;  1FOV A;  2FUG 2;  1E2Y A;  1GTB A;  4G0I A;  1QXH A;  5A4W A;  4K8M A;  3VWX A;  2C3Q A;  3V1W A;  4CW9 A;  2VLT A;  1PA3 A;  3NOF A;  4J2F A;  5DVB A;  1ST9 A;  4HJ2 A;  5E4W A;  2PMT A;  2LQQ A;  2M46 A;  2YAN A;  2H74 A;  4E8E A;  2HZE B;  4WF5 A;  3BOA A;  2LV3 A;  1O8W A;  1ZGN A;  1F37 A;  2H72 A;  4QL7 A;  4PQH A;  1NM3 A;  2H0I A;  3FK8 A;  10GS A;  1SL2 B;  1H75 A;  3KGK A;  3GFK A;  5CO3 A;  2YZU A;  1OAZ A;  4KAE A;  7GSS A;  2VL2 C;  1EEJ A;  3GN3 A;  4EC0 A;  3CSJ A;  4V2N A;  1Z9H A;  4F9Z A;  2HSM A;  5FHI A;  1GSS A;  4RQR A;  4O7H A;  3D5J A;  4O32 A;  4F0B A;  2GQM A;  4LL4 B;  3BJ5 A;  2HSY A;  4DSS B;  2VL9 A;  4H86 A;  1X5D A;  1JHB A;  4KH7 A;  2FWF A;  4LA1 A;  3UBK A;  1O6J A;  5F05 A;  3FZ5 A;  2CZ2 A;  2GSQ A;  2H1D A;  1B4Q A;  1PQN A;  5H5R A;  1F6M C;  2YJ7 A;  4XHM A;  1A0R P;  4ZBB A;  5ELG A;  3WT2 A;  4DSR A;  5GZZ B;  1MEK A;  4HQZ A;  4NV2 A;  4BVX B;  4K7N A;  3HDC A;  5AIX A;  2YPM A;  4G2E A;  3MDK A;  2ZUP A;  5B6M A;  1GNE A;  4MK3 A;  3MSZ A;  4FQU A;  2GGT A;  2HRK B;  2XC2 A;  3TOT A;  2AB6 A;  1GTU A;  3IA1 A;  5IOW A;  1U87 A;  3CTG A;  4F03 A;  3G9B A;  4ECI A;  4OO4 A;  3TUE A;  1G0T A;  1LU4 A;  2I1U A;  1Z7R A;  4G0K A;  4L5O A;  3EMP A;  2KHP A;  1J0F A;  2HSN B;  3JCM L;  2VCX A;  2R4V A;  3TJG A;  1URM A;  3LG6 A;  6GSY A;  2G2Q A;  2R3X A;  5F06 A;  5KN2 A;  3KCM A;  2CVD A;  1ILO A;  2HNL A;  4JBB A;  2H0G A;  4X1U A;  1JLW A;  5DQY A;  3L9V A;  3CXG A;  4XRD A;  5ID2 B;  1YY7 A;  1OE8 A;  2LRC A;  1BQ7 A;  4Q5R A;  2GT6 A;  2NTO A;  2IIY A;  1H4O A;  1RK4 A;  2IMK A;  2JZT A;  3TDG A;  3C1S A;  1TK8 B;  2VCQ A;  4MAB A;  2ZNM A;  3EU4 A;  3BCK A;  1AXD A;  2DML A;  3D0Z A;  2GLR A;  3IXR A;  4FYU A;  2PWJ A;  2VCZ A;  4I5Q A;  1FAA A;  5GAN D;  1J9B A;  4ULX A;  3ZYW A;  2GZY A;  3GKX A;  2C8U A;  4IQA A;  2X99 A;  1LJR A;  3VI7 A;  1DE1 A;  4LMW A;  1DBY A;  2HE3 A;  3UBL A;  2LJR A;  1HD2 A;  3KTL A;  2CT6 A;  1X9S B;  1SD8 A;  2KOK A;  4EUY A;  3F63 A;  4F82 A;  4KSM A;  4ZL7 A;  4NHW A;  3TRQ A;  3GX8 A;  5LNK e;  2LEG A;  2CAQ A;  1XWC A;  4RQX A;  1U3I A;  4P3Y B;  1K0A A;  4KF9 A;  2H30 A;  4ZL8 A;  1K3Y A;  4EDZ A;  3LOR A;  2IL3 A;  4AJ8 A;  1GLP A;  4N0Z A;  2LRN A;  2RM6 A;  1OC9 A;  1JLV A;  1EP8 A;  3CRU A;  5H5S A;  3TJB A;  4N10 A;  1G7O A;  3FZA A;  2OE0 A;  2OAD A;  2F8F A;  1PKW A;  1M7T A;  5DAL B;  2TRX A;  2N5B A;  3P7X A;  3DXB A;  4D73 A;  2GZP A;  2H1A A;  2VUP A;  1KTE A;  2OE1 A;  5ABR A;  4MDC A;  3NIV A;  5CP1 A;  3MAK A;  1GSY A;  2KP2 A;  2DJJ A;  4MJA A;  3UVH A;  4WR5 A;  4EE0 A;  3L0H A;  1ERV A;  2JAC A;  1M9B A;  1Z6M A;  2IMI A;  3KM6 A;  5FWG A;  4PNG A;  2DJ1 A;  3BD2 A;  2AJQ B;  4K2D A;  2JL4 A;  4F2I A;  2MBS A;  3LXT A;  3R3E A;  4KW6 A;  3L9U A;  2B6M A;  3GA4 A;  1ON4 A;  3GKK A;  5G5F A;  4O5R A;  1X9M B;  4CHS A;  1O81 A;  2FD3 A;  2OJL A;  1BED A;  1YQ1 A;  2E0Q A;  1T4Y A;  2FWG A;  2C0E A;  3NZN A;  2JZR A;  3WD6 A;  4V1A g;  4KUN A;  3P8W A;  3HXS A;  17GS A;  2CZ3 A;  4EKZ A;  2V6K A;  4PNF A;  1GTI A;  5ECP B;  3TOU A;  3IRA A;  3F4T A;  2VLU A;  1GSQ A;  3TKS E;  1EOG A;  3HJP A;  4IKH A;  1HNA A;  4O92 A;  2VO4 A;  3H8Q A;  1A23 A;  4BL7 B;  4KCE A;  2YWO A;  1G7E A;  1Z6N A;  2R37 A;  3FR3 A;  5IPG A;  4NWY A;  1OC3 A;  2E2G A;  2DC5 A;  1I5G A;  4Q5Q A;  5HFI A;  1EZK A;  4TR4 A;  3DYR A;  1SK0 A;  2MBT A;  2BMX A;  5ECS A;  1XXU A;  1TKD B;  4KCA A;  4HZ4 A;  3R2Q A;  2P0G A;  2NPB A;  4ZB8 A;  5G1K A;  3E0U A;  2NBS A;  4TR3 A;  4EF0 A;  2I9H A;  3PGT A;  2G0F A;  2OBI A;  3ME7 A;  3ZIT A;  2AUV A;  3QCP A;  4KDX A;  2FNO A;  1UC7 A;  1W89 A;  3IAM 2;  4K0N A;  4BVY A;  3ZIJ A;  5IPH A;  4NXI A;  2I4A A;  1AW9 A;  4IW9 A;  1AC1 A;  2H6Z A;  5FT3 A;  2L59 A;  3WYW A;  1SJI A;  2LTK A;  2A2R A;  3GH9 A;  2ALB A;  3PPU A;  1F3B A;  4I6X A;  4HUA A;  1R5A A;  3APQ A;  2HFD A;  4TXV A;  5G30 A;  1VF3 A;  4MLY A;  1A24 A;  5KN1 A;  2L4C A;  5D9V A;  3VPQ A;  5JWQ B;  1ACV A;  1RW1 A;  3GUR A;  5D93 A;  3HVX A;  3GUS A;  3F3Q A;  1M2A A;  3ZLP A;  4HS1 A;  1PL2 A;  4FO5 A;  4XTS A;  2QC7 A;  3ZL5 A;  1XWB A;  4MA9 A;  3GV1 A;  1GUH A;  3TCO A;  2DJ3 A;  12GS A;  2IFQ A;  1AIU A;  1DE2 A;  2FLS A;  3CTF A;  2TRC P;  3RDW A;  2YOI A;  5F0G A;  4TXO A;  3IPZ A;  1J08 A;  4XIH A;  5GST A;  4EDY A;  1NSW A;  2PPT A;  2PBJ A;  6GSS A;  1FB6 A;  3C71 A;  4NHZ A;  3QMX A;  3GHA A;  1EEM A;  1YF0 A;  1T7P B;  1X9W B;  2GST A;  4G19 A;  20GS A;  4GLT A;  1SD9 A;  3EWL A;  1CQG A;  13GS A;  2L6D A;  5DJM A;  4MCU A;  1XBS A;  1V40 A;  1S3C A;  3APO A;  3KH9 A;  3D6I A;  3IHQ A;  1AQW A;  3KP8 A;  4TR1 B;  1M9A A;  2GVP A;  1YKC A;  2IMF A;  2C4J A;  4ML1 A;  2CX3 A;  5DAK B;  2F51 A;  3LYK A;  1SJ6 A;  5LCZ A;  1THX A;  4TW5 A;  2ON5 A;  2MMO A;  2VM2 A;  3FZ4 A;  5KEJ A;  3FEU A;  3HJO A;  3L9S A;  4Q5F A;  2H01 A;  3GTU A;  5JCU A;  2P5R A;  1T3B A;  4KB3 A;  1RQM A;  6GST A;  1WJK A;  2HYX A;  2PVO C;  6GSW A;  4F0C A;  1TU8 A;  4EL1 A;  3FR9 A;  2DLX A;  5G1L A;  4MZB A;  1GL8 A;  3ISO A;  4L5L A;  4DEJ A;  1Y25 A;  2B1K A;  3KD0 A;  1F2E A;  1JZR A;  1YJ6 A;  1WE0 A;  1T00 A;  1M2D A;  3LXZ A;  1VF4 A;  1K0O A;  1R4W A;  1V57 A;  2LQO A;  3H93 A;  3KEB A;  3UAR A;  1AQV A;  1B4P A;  5A4U A;  4EO3 A;  1UN2 A;  4TRX A;  4JR4 A;  1WRY A;  2RUE A;  1A8L A;  3MWH A;  5B7C A;  1OKT A;  1SU9 A;  1QGV A;  1EWX A;  3HVV A;  2AYT A;  2MMA A;  1AQX A;  1MD4 A;  1TDI A;  5ELA A;  4EXJ A;  1TU7 A;  2PVQ A;  1OC9 B;  2FCH A;  5KN0 A;  1SK1 A;  2MMN A;  3EE2 A;  1S3A A;  2DJK A;  4K0G A;  1ZZY A;  1SEN A;  2K9F A;  5AIV A;  3FKF A;  8GSS A;  3Q74 A;  3L78 A;  3QFB C;  4JED A;  5HR2 A;  1A0F A;  2P5Q A;  4OFT A;  4K6X A;  16GS A;  2C0G A;  4NPB A;  5IMF A;  1GP1 A;  3TKR A;  1PX6 A;  3LSZ A;  2H19 A;  3D22 A;  5DDL A;  2GDR A;  4KDY A;  1JZO A;  4GQC A;  3ZRE A;  4KE3 A;  2H8L A;  2V2G A;  2GTU A;  4K7I A;  2QKE A;  2H0H A;  2HSH A;  4YQM A;  2YV9 A;  4GTU A;  2H1G A;  3UIW A;  4K1F A;  5B8B A;  5A5K A;  2YWM A;  1SKW B;  4YAP A;  1K0B A;  2EIO A;  2GT5 A;  1VGL A;  1JZW A;  1EGO A;  1KEB A;  2LST A;  3L4N A;  3N5O A;  2FA4 A;  2YZH A;  4OWY A;  1V98 A;  2Z9S A;  2FHE A;  1SL1 B;  1XWG A;  5EVO A;  3RHB A;  1PGT A;  3FW2 A;  3A5W A;  4GST A;  5CRG A;  2FWH A;  5IM9 A;  5HR3 A;  3LQ7 A;  2ZCT A;  1FVJ A;  3ERF A;  3DVX A;  4KND A;  4IQ1 A;  3H79 A;  2GSR A;  5A4V A;  1ML6 A;  5J3R A;  3RPP A;  1FHE A;  3K8N A;  4I2T A;  2HZE A;  1WWJ A;  3UVT A;  3Q18 A;  1XOA A;  4I2U A;  4PXO A;  3PH9 A;  3IC8 A;  5IMC A;  3EVI A;  4OMV A;  4NMU A;  4IN0 A;  3IK7 A;  2BTO T;  4G10 A;  2DMM A;  5C00 A;  2WCI A;  2HXK A;  2L5O A;  3APS A;  3GMF A;  3TGZ A;  1V2A A;  2OAC A;  6GSV A;  4K7O A;  2OE3 A; 
#chains in the Genus database with same CATH topology
 3RBT A;  1U88 A;  2VLV A;  4DSS A;  3QDN A;  3M8N A;  2H6Y A;  3ZTL A;  4HSC X;  2DJ2 A;  3G7Y A;  2FWE A;  5BRT A;  5CRW A;  3EPT A;  1B9X C;  2HRA A;  3KXO A;  1CQH A;  1XIY A;  3FZ9 A;  4L0W A;  1GWC A;  3KTB A;  5DQS A;  4YQV A;  1N2A A;  1EGR A;  4Q5N A;  4AF2 A;  4IHU A;  2YCD A;  4PUA A;  1ZCP A;  3G7I A;  5CNW A;  3LWA A;  3FHK A;  2DJ0 A;  4JU5 A;  3SBC A;  3ZVJ A;  3DGQ A;  3GH6 A;  4BVY B;  4KSO A;  5DBQ A;  5J41 A;  1YVL A;  5CRH A;  2YV7 A;  1SYR A;  4QL9 A;  4BVX A;  2KUC A;  2WUL A;  5BMU B;  2FGX A;  4WXT A;  1FG4 A;  1YEP A;  4XS4 B;  3UL3 A;  4KDU A;  3KIJ A;  4OCF A;  3H1N A;  3AY8 A;  4HEA 2;  3F8U A;  2R0P A;  3DVW A;  3M0F A;  6GSU A;  1USB A;  3ZML A;  1SKR B;  1Y1U A;  5JWR B;  2O3E A;  3E3E A;  3HHV A;  2IPA A;  4WKW A;  2B7K A;  2HRF A;  2K8V A;  3F9U A;  2WW3 A;  5J5N A;  3M3M A;  3C73 A;  3HYP A;  2H71 A;  2H1B A;  5GSS A;  2LNS A;  2NVL A;  3IBH A;  1TOF A;  1F3A A;  2J23 A;  3VI5 A;  2ON7 A;  2R5G A;  2HSN A;  4WEY A;  4LMV A;  3WGX A;  3DML A;  3FY7 A;  3ZFB A;  3QFA C;  2XHF A;  4N0V A;  2WZ9 A;  3D4M A;  4DVC A;  2VCW A;  5G5E A;  1KNG A;  1XW5 A;  1JFU A;  2R6K A;  3VWW A;  2HI7 A;  4IP6 A;  1PKZ A;  2C1Y A;  5IQY A;  4FYC A;  5DJL A;  2RLI A;  4ACS A;  3LEF A;  2H73 A;  1NW2 A;  4MF6 A;  1F9M A;  1JZD A;  1GRX A;  3U6V A;  1T8E B;  5ID2 A;  3GL5 A;  3A2W A;  3LW9 A;  5AGY A;  1YF1 A;  1Z3E A;  3C7M A;  3F4R A;  4OO5 A;  11GS A;  4IP1 A;  3FR6 A;  2HLS A;  4MF7 A;  1B8X A;  1Q4J A;  5G31 A;  4PX1 A;  1AUC A;  1YDK A;  3ZZX A;  1ZYE A;  1K3O A;  4ECC A;  5CRE A;  4GRF A;  4N11 A;  1HNC A;  4MZC A;  2OA7 A;  4PI0 C;  1XZO A;  3F6D A;  5IMZ A;  3US3 A;  1OVN A;  3FRC A;  4GCI A;  2B5Y A;  4ECJ A;  4RUV A;  1XVW A;  4CDO A;  2OT3 A;  3WGE A;  2CAI A;  3GNJ A;  3DKS A;  1QK8 A;  1U6T A;  2YN1 A;  1A8Y A;  2O8V B;  2HSM B;  2K18 A;  3EU3 A;  4HQS A;  4V2L A;  4L0U A;  1GSE A;  3J7Y k;  1QQ2 A;  4IEL A;  1V9W A;  1Z7P A;  2B5X A;  4OFN A;  1C72 A;  1YZX A;  3J7Y b;  4WBR D;  5HFK A;  1XWA A;  4I8B A;  1GUL A;  1GNW A;  1HNB A;  3RPN A;  3DWV A;  2VKZ G;  3ZIV A;  1TK5 B;  3HA9 A;  4TN8 A;  1KBN A;  4GSS A;  2NDO A;  5D96 A;  4DSQ A;  4XS6 A;  3I9V 2;  2B1L A;  4GXZ A;  5JWO B;  3M1G A;  1PFO A;  5ECH B;  3ZFL A;  3ZMK A;  3N9J A;  2JSY A;  5DAL A;  4LL1 B;  4J56 E;  2J9H A;  1EP7 A;  4J57 E;  2WVZ A;  2VOC A;  5EPF A;  4TKY A;  4E68 A;  3EMX A;  2HT9 A;  2A2S A;  2F8A A;  3UOM A;  4FH8 A;  5DCG A;  1PX7 A;  3TB2 A;  3EYT A;  4FIW A;  2AV4 A;  1BAY A;  3QOU A;  3WT1 A;  2QA2 A;  1OE7 A;  4YAV A;  2VCT A;  4ML6 A;  2WFC A;  2WW1 A;  3GL3 A;  2CX4 A;  5ECI B;  2IMD A;  2PUK C;  2VD1 A;  4PGT A;  1GLQ A;  3QD9 A;  2IN3 A;  2WJU A;  1R5P A;  4NV5 A;  3KH7 A;  3TRX A;  2B7J A;  2A4H A;  1B9Y C;  2DIY A;  2RM5 A;  3RHC A;  2C80 A;  4YQU A;  4IJ3 A;  1G6Y A;  1WPI A;  1TW9 A;  3VUR A;  4QMK A;  5D8I A;  3D21 A;  2O89 A;  2KP1 A;  5ECO B;  3F6F A;  3IC4 A;  5IMA A;  4ZIL A;  4HJM A;  2HRN A;  3O3T A;  4E8H A;  5D9W A;  4EVM A;  3GSS A;  2EC4 A;  2DKI A;  3A3T A;  1K3L A;  4IVF A;  2O7K A;  2X64 A;  4IGJ A;  19GS A;  1XW9 A;  2RUF A;  1PN9 A;  2OKA A;  4KGI A;  3VWU A;  2V32 A;  4AKX B;  4MH2 A;  5ECQ B;  2VCV A;  5J9C A;  1N25 A;  3QAV A;  1QUW A;  4BL7 A;  4ZBA A;  3IDV A;  1HQO A;  5J9B A;  3IOS A;  4HU9 A;  5ECL B;  4PUR A;  5JCW A;  4HDE A;  1FB0 A;  3KP9 A;  2BJX A;  4TVE A;  4TR0 A;  1O73 A;  1EV9 A;  5ECM B;  1GTA A;  4MF5 A;  4X43 A;  2WZS A;  1OC8 A;  3U5R E;  1ERW A;  2K6V A;  3P90 A;  3P2A A;  4GQF A;  2UV8 G;  3DEX A;  3UJ1 A;  1BJX A;  4K9Z A;  3MNG A;  5D9T A;  2IJY A;  4ZXG A;  1TXX A;  5GAP D;  6GSX A;  4ILF A;  3TKS C;  1M0U A;  1SJZ A;  2YNX A;  1A2M A;  4Z7X A;  1K0D A;  3CBU A;  2F3M A;  3CSH A;  5JCG A;  2LKU A;  2DBC A;  4OD7 A;  3GX0 A;  4MJC A;  5B8A A;  2FA8 A;  1FW1 A;  5EY6 A;  1PL1 A;  2JZS A;  2O87 A;  1Z5Y E;  3KJY A;  2F9S A;  5HQP A;  2DSA A;  2JSZ A;  4NAX A;  2MMZ A;  1DSB A;  2WGR A;  4ZB6 A;  2A4V A;  2L57 A;  3HCZ A;  4POK A;  3IHG A;  1XWK A;  3I43 A;  9GSS A;  2B5E A;  5DCH A;  4AJ6 A;  4ICY A;  4MPG A;  1GH2 A;  1GSF A;  1HYU A;  4YKG A;  4XS1 A;  4D73 B;  4GSN A;  5ECK B;  1ZOF A;  4POL A;  1BYE A;  2C0F A;  1QMV A;  4MJB A;  2GQL A;  3ERW A;  1IYI A;  1S4B P;  1Q98 A;  3PR8 A;  4ECB A;  2IME A;  1OKD A;  1A2L A;  2VAF A;  5KN3 A;  2QSI A;  3ZRD A;  4V2M A;  1WMJ A;  4FXY P;  3CHX C;  3VWV A;  1SVL A;  2XBI A;  4RI7 A;  3W8J A;  4I97 A;  4O5U A;  5H5Q A;  2AHE A;  3DIE A;  2PN8 A;  4ZIJ A;  4XRA A;  3VLN A;  1OYJ A;  2GSS A;  3EC3 A;  22GS A;  3ME8 A;  3BBY A;  3QAG A;  2R2J A;  4IS0 A;  1SVM A;  2N5F A;  5ECR B;  3A2V A;  1LBK A;  4ZBD A;  2VM1 A;  5F8B A;  4G0L A;  1AAZ A;  3VPT A;  4IBP A;  1PSQ A;  1NHO A;  4GWR A;  4TR1 A;  1IYH A;  4WF4 A;  1GSD A;  18GS A;  2WS2 A;  3TJK A;  2M80 A;  1WIK A;  5DAK A;  1VF1 A;  1T4Z A;  3I6A A;  3W6G A;  4BPY A;  2CVK A;  4PUF C;  5F07 A;  3LFL A;  1SL0 B;  2CVB A;  3LGC A;  1M2B A;  2V6O A;  2WVX A;  3PIN A;  1R26 A;  3TKQ A;  3M9K A;  1TRS A;  5CRD A;  3HZ8 A;  1QFN A;  2TIR A;  2XPE A;  2UZ8 A;  4AGS A;  2X8H A;  2H6X A;  3UMA A;  2MZC A;  1O7U A;  3HY2 A;  1I9D A;  1TRW A;  5HFG A;  3LYP A;  4TOP A;  3F4S A;  4OCE A;  1XFL A;  2L6C A;  1XW6 A;  2N5A A;  2PGT A;  3GIX A;  4V1A p;  1O85 A;  2CQ9 A;  4JR6 A;  4OFM A;  1K0N A;  3IK9 A;  4ZL9 A;  1FO5 A;  1TP9 A;  4PQI A;  1M3I A;  5L71 A;  1TTZ A;  3TU3 B;  4G9H A;  1X5E A;  4FYB A;  1MDK A;  1XCC A;  2H66 A;  3UEM A;  5CYY A;  2QGV A;  3KZQ A;  2B3S A;  2C3N A;  3D4T A;  4KX4 A;  1R7H A;  3C1R A;  3TKP A;  3Q6O A;  1UA5 A;  3QPM A;  2PER A;  4MJE A;  3GYK A;  2HRK A;  1TK0 B;  5HR0 A;  3H4K A;  2H75 A;  5IO0 A;  1NHY A;  1S3D A;  4MZW A;  4X0X A;  3TRP A;  3ZVJ D;  1THO A;  2WRT A;  2D2Z A;  3CYN A;  2C0D A;  2DIZ A;  5J47 A;  1VRS D;  3Q19 A;  2E2M A;  4MP4 A;  2VL2 A;  3F3R A;  5E59 A;  4USS A;  1TRV A;  1BF5 A;  1WOU A;  2MYG A;  2GQK A;  3BCI A;  4G01 A;  4WR4 A;  2K8S A;  1T1V A;  2XBQ A;  2YJH A;  4ZB9 A;  1TI3 A;  1N8J A;  5INY A;  2LS5 A;  3TKS A;  1K0M A;  1M99 A;  1ZYP A;  5C04 A;  1MTC A;  3HJM A;  2WDU A;  2KLX A;  4BWQ A;  2I81 A;  3M9J A;  3HD5 A;  1UVZ A;  3CMI A;  4PQ1 A;  2ES7 A;  2IFQ B;  2OBK A;  5CAX A;  4TXO B;  3QAW A;  2CV4 A;  1ZMA A;  1TRU A;  2HZF A;  2EIQ A;  2L4Q A;  1G6W A;  3GKM A;  5IIZ A;  3FYG A;  1DUG A;  2YP6 A;  5ENU A;  3IE3 A;  3KMO A;  3OR5 A;  2E7P A;  4EIP A;  1VF2 A;  3GRX A;  3QR6 A;  5HR1 A;  4JZQ A;  1O8X A;  1TJD A;  5IMD A;  3E9J B;  1XVQ A;  3UAP A;  3VFI A;  5D9X A;  1XPV A;  4MMM A;  5J4U A;  4ISD A;  3DRN A;  2VL3 A;  2PU9 C;  4IJI A;  4RI6 A;  3IV4 A;  5IOX A;  1W4V A;  3RAZ A;  2AAW A;  4L8E A;  1MDJ A;  4MH3 A;  2FY6 A;  3F0I A;  3SWL A;  3TJJ A;  4KA0 A;  2EIR A;  2V41 A;  1YKA A;  1PMT A;  2X8C A;  2LNT A;  2CA8 A;  1Y6E A;  3S9F A;  3IR4 A;  4ID0 A;  5G2Z A;  4AI6 A;  1WP0 A;  3HZ4 A;  5EL8 A;  2YWN A;  1XOB A;  2LJA A;  4HZ2 A;  4YH2 A;  3IAS 2;  2HQT A;  2WB9 A;  3GTU B;  3ERG A;  2X8G A;  4XCS A;  3EIN A;  1SYX A;  2V1M A;  4PTS A;  2LJK A;  2LUS A;  2VD0 A;  1GUM A;  5D73 A;  4N30 A;  3G7J A;  1X0R A;  14GS A;  1X5C A;  3ED3 A;  5ECN B;  1GUK A;  1ZYN A;  1E6B A;  3HVS A;  3LJR A;  4HU7 A;  5COH A;  2GZZ A;  4POM A;  5AIS A;  2YWI A;  4HI7 A;  2M72 A;  5BMU A;  4QQ7 A;  2JAD A;  1YEX A;  3WGD A;  4XS4 A;  3A2X A;  3CRT A;  5IO2 A;  1ERT A;  4MPF A;  3HKR A;  2LRT A;  1GSU A;  4PI2 C;  4WBJ A;  2RII A;  5IMV A;  3GST A;  1MD3 A;  4AKI A;  4BWS A;  1ERU A;  1U3A A;  3W8S A;  4HOJ A;  1SK2 A;  4JRR A;  4AKG A;  4GF0 A;  2JU5 A;  1EOH A;  3KMN A;  4JE1 A;  4AJ7 A;  2I3Y A;  3CSI A;  4LLR A;  4BA7 A;  3I69 A;  2IWT A;  4POB A;  5A34 A;  3TJF A;  2H76 A;  2H70 A;  3MIX A;  5AN1 A;  2DKH A;  1BG5 A;  1ZYQ B;  2C3T A;  2GS3 A;  1B48 A;  1K0C A;  1M3J A;  2REM A;  3GKN A;  2P31 A;  1A2J A;  1PRX A;  5LD0 A;  1FVK A;  1EV4 A;  3EUR A;  1ZL9 A;  1SKS B;  3RFR C;  2O85 A;  3VK9 A;  1V58 A;  2VIM A;  1MDI A;  2L5L A;  3O6T A;  3O76 A;  1PD2 1;  2R0C A;  4WET A;  5B6N A;  1TI1 A;  1BX9 A;  1ABA A;  2XPD A;  3DD3 A;  3C8E A;  1FOV A;  2FUG 2;  1E2Y A;  1GTB A;  4G0I A;  1QXH A;  5A4W A;  4K8M A;  3VWX A;  2C3Q A;  4X4J A;  3V1W A;  4CW9 A;  5A1N B;  2VLT A;  2EFC A;  1PA3 A;  3NOF A;  4CY8 A;  4J2F A;  5DVB A;  1ST9 A;  4HJ2 A;  5E4W A;  2PMT A;  2LQQ A;  2M46 A;  2YAN A;  2H74 A;  4E8E A;  5A5H B;  2HZE B;  4WF5 A;  3BOA A;  2LV3 A;  1O8W A;  1ZGN A;  1F37 A;  2H72 A;  4QL7 A;  4PQH A;  1NM3 A;  2H0I A;  3FK8 A;  10GS A;  1SL2 B;  1H75 A;  3KGK A;  3GFK A;  5CO3 A;  2YZU A;  1OAZ A;  4KAE A;  7GSS A;  2VL2 C;  1EEJ A;  3GN3 A;  4EC0 A;  3CSJ A;  4V2N A;  1Z9H A;  4F9Z A;  2HSM A;  5FHI A;  1GSS A;  4RQR A;  4O7H A;  3D5J A;  4O32 A;  4F0B A;  2GQM A;  4LL4 B;  3BJ5 A;  2HSY A;  4DSS B;  2VL9 A;  4H86 A;  1X5D A;  1JHB A;  4KH7 A;  2FWF A;  3CQF A;  4LA1 A;  3UBK A;  1O6J A;  5F05 A;  3FZ5 A;  2CZ2 A;  2GSQ A;  2H1D A;  1B4Q A;  1PQN A;  5H5R A;  1F6M C;  2YJ7 A;  4XHM A;  1A0R P;  4BIK A;  4ZBB A;  5ELG A;  3WT2 A;  4DSR A;  5GZZ B;  4A5P A;  1MEK A;  4HQZ A;  4NV2 A;  4BVX B;  4K7N A;  3HDC A;  5AIX A;  2YPM A;  4G2E A;  3MDK A;  2ZUP A;  5B6M A;  1GNE A;  4MK3 A;  3MSZ A;  4FQU A;  2GGT A;  2HRK B;  2XC2 A;  3TOT A;  2AB6 A;  1GTU A;  3IA1 A;  5IOW A;  1U87 A;  3CTG A;  4F03 A;  3G9B A;  4ECI A;  5J4Y A;  4OO4 A;  3TUE A;  1G0T A;  1LU4 A;  2I1U A;  1PN0 A;  1Z7R A;  4G0K A;  4L5O A;  3EMP A;  2KHP A;  1J0F A;  2HSN B;  3JCM L;  2VCX A;  2R4V A;  3TJG A;  1URM A;  3LG6 A;  6GSY A;  2G2Q A;  2R3X A;  5F06 A;  5KN2 A;  3CWG A;  3KCM A;  2CVD A;  4K5S A;  1ILO A;  4Z2R A;  2HNL A;  4JBB A;  2H0G A;  4X1U A;  1JLW A;  5DQY A;  3L9V A;  3CXG A;  4XRD A;  5ID2 B;  1YY7 A;  1OE8 A;  2LRC A;  1BQ7 A;  4Q5R A;  2GT6 A;  2NTO A;  2IIY A;  1H4O A;  1RK4 A;  2IMK A;  2JZT A;  4MNN A;  3TDG A;  3C1S A;  1TK8 B;  2VCQ A;  4MAB A;  4O5Q A;  2ZNM A;  3EU4 A;  3BCK A;  1AXD A;  2DML A;  3D0Z A;  2GLR A;  3IXR A;  4FYU A;  2PWJ A;  2VCZ A;  4I5Q A;  1FAA A;  5GAN D;  1J9B A;  4ULX A;  3ZYW A;  2GZY A;  3GKX A;  2C8U A;  4IQA A;  2X99 A;  1LJR A;  3VI7 A;  1DE1 A;  4LMW A;  1DBY A;  2HE3 A;  3UBL A;  2LJR A;  1HD2 A;  3KTL A;  2CT6 A;  1X9S B;  1SD8 A;  2KOK A;  4EUY A;  3F63 A;  4F82 A;  4KSM A;  4ZL7 A;  4NHW A;  3TRQ A;  3GX8 A;  5LNK e;  2LEG A;  2CAQ A;  1XWC A;  4RQX A;  1U3I A;  4P3Y B;  1K0A A;  4Z2U A;  4KF9 A;  2H30 A;  3RGB C;  4ZL8 A;  1K3Y A;  4EDZ A;  3LOR A;  2IL3 A;  4AJ8 A;  1GLP A;  4N0Z A;  2LRN A;  2RM6 A;  1OC9 A;  1JLV A;  2WVY A;  1EP8 A;  3CRU A;  5H5S A;  3TJB A;  4N10 A;  1G7O A;  3FZA A;  2OE0 A;  2OAD A;  2F8F A;  1PKW A;  4GDF A;  1M7T A;  5DAL B;  2TRX A;  2N5B A;  3P7X A;  3DXB A;  4D73 A;  2GZP A;  2H1A A;  2EFH A;  2VUP A;  1KTE A;  2OE1 A;  5ABR A;  4MDC A;  1BG1 A;  3NIV A;  5CP1 A;  3MAK A;  1GSY A;  2KP2 A;  2DJJ A;  4MJA A;  3UVH A;  4WR5 A;  4K2X A;  4EE0 A;  3L0H A;  1ERV A;  2JAC A;  1M9B A;  1Z6M A;  1I1I P;  2IMI A;  3KM6 A;  5FWG A;  4PNG A;  5A34 B;  2DJ1 A;  3BD2 A;  2AJQ B;  4K2D A;  2JL4 A;  4F2I A;  2MBS A;  3LXT A;  3R3E A;  4KW6 A;  3L9U A;  2B6M A;  3GA4 A;  1ON4 A;  3GKK A;  5G5F A;  4O5R A;  1X9M B;  4CHS A;  1O81 A;  2FD3 A;  2OJL A;  1BED A;  1YQ1 A;  2E0Q A;  1T4Y A;  2FWG A;  2C0E A;  3NZN A;  2JZR A;  3WD6 A;  4V1A g;  4KUN A;  3P8W A;  3HXS A;  17GS A;  2CZ3 A;  4EKZ A;  2V6K A;  4PNF A;  1GTI A;  5ECP B;  3TOU A;  3IRA A;  3F4T A;  2VLU A;  1GSQ A;  3TKS E;  1EOG A;  3HJP A;  4IKH A;  5KOX A;  1HNA A;  4O92 A;  2VO4 A;  3H8Q A;  3MYD A;  1A23 A;  4BL7 B;  4KCE A;  2YWO A;  1G7E A;  1Z6N A;  2A2P A;  2R37 A;  3FR3 A;  5IPG A;  4NWY A;  1OC3 A;  2E2G A;  2DC5 A;  1I5G A;  4Q5Q A;  5HFI A;  1EZK A;  4TR4 A;  2WW2 A;  3DYR A;  1SK0 A;  2MBT A;  2BMX A;  5ECS A;  1XXU A;  1TKD B;  4KCA A;  4HZ4 A;  3R2Q A;  2P0G A;  2NPB A;  4ZB8 A;  5G1K A;  3E0U A;  4ZB7 A;  2NBS A;  4TR3 A;  4EF0 A;  2I9H A;  3PGT A;  2G0F A;  2OBI A;  3ME7 A;  3ZIT A;  2AUV A;  3QCP A;  4KDX A;  2FNO A;  1UC7 A;  1W89 A;  3IAM 2;  4K0N A;  4BVY A;  3ZIJ A;  5IPH A;  4NXI A;  2EFE A;  2I4A A;  1AW9 A;  4IW9 A;  1AC1 A;  5KOW A;  2H6Z A;  5FT3 A;  2L59 A;  3WYW A;  1SJI A;  2LTK A;  1S3R A;  2A2R A;  3GH9 A;  2ALB A;  3PPU A;  1F3B A;  4I6X A;  4HUA A;  2O36 A;  1R5A A;  3APQ A;  2HFD A;  4TXV A;  5G30 A;  1VF3 A;  4MLY A;  1A24 A;  5KN1 A;  2L4C A;  5D9V A;  3VPQ A;  5JWQ B;  1ACV A;  1RW1 A;  3GUR A;  5D93 A;  3HVX A;  3GUS A;  3F3Q A;  1M2A A;  3ZLP A;  4HS1 A;  1PL2 A;  1YEW C;  4FO5 A;  4XTS A;  2QC7 A;  3ZL5 A;  1XWB A;  4MA9 A;  3GV1 A;  1GUH A;  3TCO A;  2DJ3 A;  12GS A;  2IFQ A;  1AIU A;  1DE2 A;  2FLS A;  3CTF A;  2TRC P;  3RDW A;  2YOI A;  5F0G A;  1XG8 A;  4TXO A;  3IPZ A;  5J40 A;  1J08 A;  4XIH A;  5GST A;  4EDY A;  2R0G A;  1NSW A;  2EFD A;  2PPT A;  2PBJ A;  6GSS A;  1FB6 A;  3C71 A;  4NHZ A;  3QMX A;  3GHA A;  1EEM A;  1YF0 A;  1T7P B;  2WW0 A;  3HMJ G;  1X9W B;  2GST A;  2QA1 A;  4G19 A;  20GS A;  4GLT A;  1SD9 A;  3EWL A;  1CQG A;  13GS A;  2L6D A;  5DJM A;  4MCU A;  1XBS A;  2O5V A;  1V40 A;  1S3C A;  3APO A;  3KH9 A;  3D6I A;  3IHQ A;  1AQW A;  3KP8 A;  4TR1 B;  1M9A A;  2GVP A;  1YKC A;  2IMF A;  2C4J A;  4ML1 A;  2CX3 A;  5J4V A;  5DAK B;  2F51 A;  3LYK A;  1SJ6 A;  5LCZ A;  1THX A;  4TW5 A;  2ON5 A;  2WVX B;  2MMO A;  2VM2 A;  3FZ4 A;  5KEJ A;  3FEU A;  3HJO A;  3L9S A;  2X4A A;  4Q5F A;  2H01 A;  3GTU A;  5JCU A;  2P5R A;  1T3B A;  4W66 A;  4KB3 A;  1RQM A;  6GST A;  1WJK A;  2HYX A;  2PVO C;  6GSW A;  4F0C A;  1TU8 A;  4EL1 A;  3FR9 A;  2DLX A;  5G1L A;  4MZB A;  1GL8 A;  3ISO A;  4L5L A;  4EIQ A;  4DEJ A;  1Y25 A;  2B1K A;  3KD0 A;  1F2E A;  1JZR A;  1YJ6 A;  1WE0 A;  1T00 A;  1M2D A;  3LXZ A;  3A5I A;  1VF4 A;  1K0O A;  1R4W A;  1V57 A;  2LQO A;  3H93 A;  3KEB A;  3UAR A;  1AQV A;  1B4P A;  5A4U A;  4EO3 A;  1UN2 A;  4TRX A;  4JR4 A;  1WRY A;  2RUE A;  1A8L A;  3MWH A;  5B7C A;  4K5R A;  1OKT A;  1SU9 A;  1QGV A;  4Z2T A;  1EWX A;  3HVV A;  2AYT A;  2MMA A;  1AQX A;  1MD4 A;  1TDI A;  2H1L A;  5ELA A;  4EXJ A;  1TU7 A;  2PVQ A;  1OC9 B;  2FCH A;  5KN0 A;  1SK1 A;  2MMN A;  3EE2 A;  1S3A A;  2DJK A;  4K0G A;  1ZZY A;  1SEN A;  2K9F A;  5AIV A;  3FKF A;  8GSS A;  3Q74 A;  3L78 A;  3QFB C;  4JED A;  5HR2 A;  1A0F A;  2P5Q A;  4OFT A;  4K6X A;  16GS A;  2C0G A;  4NPB A;  5IMF A;  1GP1 A;  3TKR A;  1PX6 A;  3LSZ A;  2H19 A;  3D22 A;  5DDL A;  2GDR A;  4KDY A;  1SVO A;  1JZO A;  4GQC A;  3ZRE A;  4KE3 A;  2H8L A;  2V2G A;  2GTU A;  4K7I A;  2QKE A;  2H0H A;  2HSH A;  4PHZ C;  2YV9 A;  4YQM A;  4GTU A;  2H1G A;  3UIW A;  4K1F A;  5B8B A;  5A5K A;  2YWM A;  1SKW B;  4YAP A;  1K0B A;  2EIO A;  2GT5 A;  1VGL A;  1JZW A;  1EGO A;  1KEB A;  2LST A;  3L4N A;  3N5O A;  2FA4 A;  2YZH A;  1TXU A;  4OWY A;  1V98 A;  2Z9S A;  2FHE A;  1SL1 B;  1XWG A;  4YKF A;  5EVO A;  3RHB A;  1PGT A;  4N3Z A;  3FW2 A;  3A5W A;  4CY6 A;  4GST A;  5CRG A;  2FWH A;  5IM9 A;  5HR3 A;  3LQ7 A;  2ZCT A;  1FVJ A;  5A1N A;  3ERF A;  3DVX A;  4KND A;  4IQ1 A;  3H79 A;  2GSR A;  5A4V A;  1ML6 A;  5J3R A;  2X49 A;  3RPP A;  1FHE A;  3K8N A;  4AKH A;  4I2T A;  2HZE A;  5A5H A;  1WWJ A;  3UVT A;  3Q18 A;  3FMW A;  1XOA A;  4I2U A;  4PXO A;  3PH9 A;  3IC8 A;  1FOH A;  5IMC A;  3EVI A;  4OMV A;  4NMU A;  4IN0 A;  3IK7 A;  2BTO T;  4G10 A;  2DMM A;  5C00 A;  2WCI A;  3HVN A;  2HXK A;  2L5O A;  3APS A;  3GMF A;  3TGZ A;  1V2A A;  2OAC A;  6GSV A;  4K7O A;  2OE3 A; 
#chains in the Genus database with same CATH homology
 3RBT A;  1U88 A;  2VLV A;  4DSS A;  3QDN A;  3M8N A;  2H6Y A;  3ZTL A;  2DJ2 A;  3G7Y A;  2FWE A;  5BRT A;  5CRW A;  3EPT A;  1B9X C;  2HRA A;  3KXO A;  1CQH A;  1XIY A;  3FZ9 A;  4L0W A;  1GWC A;  3KTB A;  5DQS A;  4YQV A;  1N2A A;  1EGR A;  4Q5N A;  4AF2 A;  4IHU A;  2YCD A;  4PUA A;  1ZCP A;  3G7I A;  5CNW A;  3LWA A;  3FHK A;  2DJ0 A;  4JU5 A;  3SBC A;  3ZVJ A;  3DGQ A;  3GH6 A;  4BVY B;  4KSO A;  5DBQ A;  5J41 A;  1YVL A;  5CRH A;  2YV7 A;  1SYR A;  4QL9 A;  4BVX A;  2KUC A;  2WUL A;  5BMU B;  2FGX A;  4WXT A;  1FG4 A;  1YEP A;  4XS4 B;  3UL3 A;  4KDU A;  3KIJ A;  4OCF A;  3H1N A;  3AY8 A;  4HEA 2;  3F8U A;  2R0P A;  3DVW A;  3M0F A;  6GSU A;  1USB A;  3ZML A;  1SKR B;  1Y1U A;  5JWR B;  3E3E A;  3HHV A;  2IPA A;  4WKW A;  2B7K A;  2HRF A;  2K8V A;  3F9U A;  5J5N A;  3M3M A;  3C73 A;  3HYP A;  2H71 A;  2H1B A;  5GSS A;  2LNS A;  2NVL A;  3IBH A;  1TOF A;  1F3A A;  2J23 A;  3VI5 A;  2ON7 A;  2R5G A;  2HSN A;  4WEY A;  4LMV A;  3WGX A;  3DML A;  3FY7 A;  3ZFB A;  3QFA C;  2XHF A;  4N0V A;  2WZ9 A;  3D4M A;  4DVC A;  2VCW A;  5G5E A;  1KNG A;  1XW5 A;  1JFU A;  2R6K A;  3VWW A;  2HI7 A;  4IP6 A;  1PKZ A;  2C1Y A;  5IQY A;  4FYC A;  5DJL A;  2RLI A;  4ACS A;  3LEF A;  2H73 A;  1NW2 A;  4MF6 A;  1F9M A;  1JZD A;  1GRX A;  3U6V A;  1T8E B;  5ID2 A;  3GL5 A;  3A2W A;  3LW9 A;  5AGY A;  1YF1 A;  1Z3E A;  3C7M A;  3F4R A;  4OO5 A;  11GS A;  4IP1 A;  3FR6 A;  2HLS A;  4MF7 A;  1B8X A;  1Q4J A;  5G31 A;  4PX1 A;  1AUC A;  1YDK A;  3ZZX A;  1ZYE A;  1K3O A;  4ECC A;  5CRE A;  4GRF A;  4N11 A;  1HNC A;  4MZC A;  2OA7 A;  1XZO A;  3F6D A;  5IMZ A;  3US3 A;  1OVN A;  3FRC A;  4GCI A;  2B5Y A;  4ECJ A;  4RUV A;  1XVW A;  4CDO A;  2OT3 A;  3WGE A;  2CAI A;  3GNJ A;  3DKS A;  1QK8 A;  1U6T A;  2YN1 A;  1A8Y A;  2O8V B;  2HSM B;  2K18 A;  3EU3 A;  4HQS A;  4V2L A;  4L0U A;  1GSE A;  3J7Y k;  1QQ2 A;  4IEL A;  1V9W A;  1Z7P A;  2B5X A;  4OFN A;  1C72 A;  1YZX A;  3J7Y b;  4WBR D;  5HFK A;  1XWA A;  4I8B A;  1GUL A;  1GNW A;  1HNB A;  3RPN A;  3DWV A;  2VKZ G;  3ZIV A;  1TK5 B;  3HA9 A;  4TN8 A;  1KBN A;  4GSS A;  2NDO A;  5D96 A;  4DSQ A;  4XS6 A;  3I9V 2;  2B1L A;  4GXZ A;  5JWO B;  3M1G A;  5ECH B;  3ZFL A;  3ZMK A;  3N9J A;  2JSY A;  5DAL A;  4LL1 B;  4J56 E;  2J9H A;  1EP7 A;  4J57 E;  2VOC A;  5EPF A;  4TKY A;  4E68 A;  3EMX A;  2HT9 A;  2A2S A;  2F8A A;  3UOM A;  4FH8 A;  5DCG A;  1PX7 A;  3TB2 A;  3EYT A;  4FIW A;  2AV4 A;  1BAY A;  3QOU A;  3WT1 A;  2QA2 A;  1OE7 A;  4YAV A;  2VCT A;  4ML6 A;  2WFC A;  3GL3 A;  2CX4 A;  5ECI B;  2IMD A;  2PUK C;  2VD1 A;  4PGT A;  1GLQ A;  3QD9 A;  2IN3 A;  2WJU A;  1R5P A;  4NV5 A;  3KH7 A;  3TRX A;  2B7J A;  2A4H A;  1B9Y C;  2DIY A;  2RM5 A;  3RHC A;  2C80 A;  4YQU A;  4IJ3 A;  1G6Y A;  1WPI A;  1TW9 A;  3VUR A;  4QMK A;  5D8I A;  3D21 A;  2O89 A;  2KP1 A;  5ECO B;  3F6F A;  3IC4 A;  5IMA A;  4ZIL A;  4HJM A;  2HRN A;  3O3T A;  4E8H A;  5D9W A;  4EVM A;  3GSS A;  2EC4 A;  2DKI A;  3A3T A;  1K3L A;  4IVF A;  2O7K A;  2X64 A;  4IGJ A;  19GS A;  1XW9 A;  2RUF A;  1PN9 A;  2OKA A;  4KGI A;  3VWU A;  2V32 A;  4AKX B;  4MH2 A;  5ECQ B;  2VCV A;  5J9C A;  1N25 A;  3QAV A;  1QUW A;  4BL7 A;  4ZBA A;  3IDV A;  1HQO A;  5J9B A;  3IOS A;  4HU9 A;  5ECL B;  4PUR A;  5JCW A;  4HDE A;  1FB0 A;  3KP9 A;  2BJX A;  4TVE A;  4TR0 A;  1O73 A;  1EV9 A;  5ECM B;  1GTA A;  4MF5 A;  4X43 A;  1OC8 A;  3U5R E;  1ERW A;  2K6V A;  3P90 A;  3P2A A;  4GQF A;  2UV8 G;  3DEX A;  3UJ1 A;  1BJX A;  4K9Z A;  3MNG A;  5D9T A;  2IJY A;  4ZXG A;  1TXX A;  5GAP D;  6GSX A;  4ILF A;  3TKS C;  1M0U A;  1SJZ A;  2YNX A;  1A2M A;  4Z7X A;  1K0D A;  3CBU A;  2F3M A;  3CSH A;  5JCG A;  2LKU A;  2DBC A;  4OD7 A;  3GX0 A;  4MJC A;  5B8A A;  2FA8 A;  1FW1 A;  5EY6 A;  1PL1 A;  2JZS A;  2O87 A;  1Z5Y E;  3KJY A;  2F9S A;  5HQP A;  2DSA A;  2JSZ A;  4NAX A;  2MMZ A;  1DSB A;  2WGR A;  4ZB6 A;  2A4V A;  2L57 A;  3HCZ A;  4POK A;  3IHG A;  1XWK A;  3I43 A;  9GSS A;  2B5E A;  5DCH A;  4AJ6 A;  4ICY A;  4MPG A;  1GH2 A;  1GSF A;  1HYU A;  4YKG A;  4XS1 A;  4D73 B;  4GSN A;  5ECK B;  1ZOF A;  4POL A;  1BYE A;  2C0F A;  1QMV A;  4MJB A;  2GQL A;  3ERW A;  1IYI A;  1Q98 A;  2IME A;  3PR8 A;  4ECB A;  1OKD A;  1A2L A;  2VAF A;  5KN3 A;  2QSI A;  3ZRD A;  4V2M A;  1WMJ A;  3VWV A;  1SVL A;  2XBI A;  4RI7 A;  3W8J A;  4I97 A;  4O5U A;  5H5Q A;  2AHE A;  3DIE A;  2PN8 A;  4ZIJ A;  4XRA A;  3VLN A;  1OYJ A;  2GSS A;  3EC3 A;  22GS A;  3ME8 A;  3BBY A;  3QAG A;  2R2J A;  4IS0 A;  1SVM A;  2N5F A;  5ECR B;  3A2V A;  1LBK A;  4ZBD A;  2VM1 A;  5F8B A;  4G0L A;  1AAZ A;  3VPT A;  4IBP A;  1PSQ A;  1NHO A;  4GWR A;  4TR1 A;  1IYH A;  4WF4 A;  1GSD A;  18GS A;  2WS2 A;  3TJK A;  2M80 A;  1WIK A;  5DAK A;  1VF1 A;  1T4Z A;  3I6A A;  3W6G A;  4BPY A;  2CVK A;  4PUF C;  5F07 A;  3LFL A;  1SL0 B;  2CVB A;  3LGC A;  1M2B A;  2V6O A;  3PIN A;  1R26 A;  3TKQ A;  3M9K A;  1TRS A;  5CRD A;  3HZ8 A;  1QFN A;  2TIR A;  2XPE A;  2UZ8 A;  4AGS A;  2X8H A;  2H6X A;  3UMA A;  2MZC A;  1O7U A;  3HY2 A;  1I9D A;  1TRW A;  5HFG A;  3LYP A;  4TOP A;  3F4S A;  4OCE A;  1XFL A;  2L6C A;  1XW6 A;  2N5A A;  2PGT A;  3GIX A;  4V1A p;  1O85 A;  2CQ9 A;  4JR6 A;  4OFM A;  1K0N A;  3IK9 A;  4ZL9 A;  1FO5 A;  1TP9 A;  4PQI A;  5L71 A;  1TTZ A;  3TU3 B;  4G9H A;  1X5E A;  4FYB A;  1MDK A;  1XCC A;  2H66 A;  3UEM A;  5CYY A;  2QGV A;  3KZQ A;  2B3S A;  2C3N A;  3D4T A;  4KX4 A;  1R7H A;  3C1R A;  3TKP A;  3Q6O A;  1UA5 A;  3QPM A;  2PER A;  4MJE A;  3GYK A;  2HRK A;  1TK0 B;  5HR0 A;  3H4K A;  2H75 A;  5IO0 A;  1NHY A;  1S3D A;  4MZW A;  4X0X A;  3TRP A;  3ZVJ D;  1THO A;  2WRT A;  2D2Z A;  3CYN A;  2C0D A;  2DIZ A;  5J47 A;  1VRS D;  3Q19 A;  2E2M A;  4MP4 A;  2VL2 A;  3F3R A;  5E59 A;  4USS A;  1TRV A;  1BF5 A;  1WOU A;  2MYG A;  2GQK A;  3BCI A;  4G01 A;  4WR4 A;  2K8S A;  1T1V A;  2XBQ A;  2YJH A;  4ZB9 A;  1TI3 A;  1N8J A;  5INY A;  2LS5 A;  3TKS A;  1K0M A;  1M99 A;  1ZYP A;  5C04 A;  1MTC A;  3HJM A;  2WDU A;  2KLX A;  4BWQ A;  2I81 A;  3M9J A;  3HD5 A;  1UVZ A;  3CMI A;  4PQ1 A;  2ES7 A;  2IFQ B;  2OBK A;  5CAX A;  4TXO B;  3QAW A;  2CV4 A;  1ZMA A;  1TRU A;  2HZF A;  2EIQ A;  2L4Q A;  1G6W A;  3GKM A;  5IIZ A;  3FYG A;  1DUG A;  2YP6 A;  5ENU A;  3IE3 A;  3KMO A;  3OR5 A;  2E7P A;  4EIP A;  1VF2 A;  3GRX A;  3QR6 A;  5HR1 A;  4JZQ A;  1O8X A;  1TJD A;  5IMD A;  3E9J B;  1XVQ A;  3UAP A;  3VFI A;  5D9X A;  1XPV A;  4MMM A;  5J4U A;  4ISD A;  3DRN A;  2VL3 A;  2PU9 C;  4IJI A;  4RI6 A;  3IV4 A;  5IOX A;  1W4V A;  3RAZ A;  2AAW A;  4L8E A;  1MDJ A;  4MH3 A;  2FY6 A;  3F0I A;  3SWL A;  3TJJ A;  4KA0 A;  2EIR A;  2V41 A;  1YKA A;  1PMT A;  2X8C A;  2LNT A;  2CA8 A;  1Y6E A;  3S9F A;  3IR4 A;  4ID0 A;  5G2Z A;  4AI6 A;  1WP0 A;  3HZ4 A;  5EL8 A;  2YWN A;  1XOB A;  2LJA A;  4HZ2 A;  4YH2 A;  3IAS 2;  2HQT A;  2WB9 A;  3GTU B;  3ERG A;  2X8G A;  4XCS A;  3EIN A;  1SYX A;  2V1M A;  4PTS A;  2LJK A;  2LUS A;  2VD0 A;  1GUM A;  5D73 A;  4N30 A;  3G7J A;  1X0R A;  14GS A;  1X5C A;  3ED3 A;  5ECN B;  1GUK A;  1ZYN A;  1E6B A;  3HVS A;  3LJR A;  4HU7 A;  5COH A;  2GZZ A;  4POM A;  5AIS A;  2YWI A;  4HI7 A;  2M72 A;  5BMU A;  4QQ7 A;  2JAD A;  1YEX A;  3WGD A;  4XS4 A;  3A2X A;  3CRT A;  5IO2 A;  1ERT A;  4MPF A;  3HKR A;  2LRT A;  1GSU A;  4WBJ A;  2RII A;  5IMV A;  3GST A;  1MD3 A;  4AKI A;  4BWS A;  1ERU A;  1U3A A;  3W8S A;  4HOJ A;  1SK2 A;  4JRR A;  4AKG A;  4GF0 A;  2JU5 A;  1EOH A;  3KMN A;  4JE1 A;  4AJ7 A;  2I3Y A;  3CSI A;  4LLR A;  4BA7 A;  3I69 A;  2IWT A;  4POB A;  5A34 A;  3TJF A;  2H76 A;  2H70 A;  3MIX A;  5AN1 A;  2DKH A;  1BG5 A;  1ZYQ B;  2C3T A;  2GS3 A;  1B48 A;  1K0C A;  2REM A;  3GKN A;  2P31 A;  1A2J A;  1PRX A;  5LD0 A;  1FVK A;  1EV4 A;  3EUR A;  1ZL9 A;  1SKS B;  2O85 A;  3VK9 A;  1V58 A;  2VIM A;  1MDI A;  2L5L A;  3O6T A;  3O76 A;  1PD2 1;  2R0C A;  4WET A;  5B6N A;  1TI1 A;  1BX9 A;  1ABA A;  2XPD A;  3DD3 A;  3C8E A;  1FOV A;  2FUG 2;  1E2Y A;  1GTB A;  4G0I A;  1QXH A;  5A4W A;  4K8M A;  3VWX A;  2C3Q A;  4X4J A;  3V1W A;  4CW9 A;  5A1N B;  2VLT A;  2EFC A;  1PA3 A;  3NOF A;  4CY8 A;  4J2F A;  5DVB A;  1ST9 A;  4HJ2 A;  5E4W A;  2PMT A;  2LQQ A;  2M46 A;  2YAN A;  2H74 A;  4E8E A;  5A5H B;  2HZE B;  4WF5 A;  3BOA A;  2LV3 A;  1O8W A;  1ZGN A;  1F37 A;  2H72 A;  4QL7 A;  4PQH A;  1NM3 A;  2H0I A;  3FK8 A;  10GS A;  1SL2 B;  1H75 A;  3KGK A;  3GFK A;  5CO3 A;  2YZU A;  1OAZ A;  4KAE A;  7GSS A;  2VL2 C;  1EEJ A;  3GN3 A;  4EC0 A;  3CSJ A;  4V2N A;  1Z9H A;  4F9Z A;  2HSM A;  5FHI A;  1GSS A;  4RQR A;  4O7H A;  3D5J A;  4O32 A;  4F0B A;  2GQM A;  4LL4 B;  3BJ5 A;  2HSY A;  4DSS B;  2VL9 A;  4H86 A;  1X5D A;  1JHB A;  4KH7 A;  2FWF A;  4LA1 A;  3UBK A;  1O6J A;  5F05 A;  3FZ5 A;  2CZ2 A;  2GSQ A;  2H1D A;  1B4Q A;  1PQN A;  5H5R A;  1F6M C;  2YJ7 A;  4XHM A;  1A0R P;  4ZBB A;  5ELG A;  3WT2 A;  4DSR A;  5GZZ B;  4A5P A;  1MEK A;  4HQZ A;  4NV2 A;  4BVX B;  4K7N A;  3HDC A;  5AIX A;  2YPM A;  4G2E A;  3MDK A;  2ZUP A;  5B6M A;  1GNE A;  4MK3 A;  3MSZ A;  4FQU A;  2GGT A;  2HRK B;  2XC2 A;  3TOT A;  2AB6 A;  1GTU A;  3IA1 A;  5IOW A;  1U87 A;  3CTG A;  4F03 A;  3G9B A;  4ECI A;  5J4Y A;  4OO4 A;  3TUE A;  1G0T A;  1LU4 A;  2I1U A;  1PN0 A;  1Z7R A;  4G0K A;  4L5O A;  3EMP A;  2KHP A;  1J0F A;  2HSN B;  3JCM L;  2VCX A;  2R4V A;  3TJG A;  1URM A;  3LG6 A;  6GSY A;  2G2Q A;  2R3X A;  5F06 A;  5KN2 A;  3CWG A;  3KCM A;  2CVD A;  4K5S A;  1ILO A;  4Z2R A;  2HNL A;  4JBB A;  2H0G A;  4X1U A;  1JLW A;  5DQY A;  3L9V A;  3CXG A;  4XRD A;  5ID2 B;  1YY7 A;  1OE8 A;  2LRC A;  1BQ7 A;  4Q5R A;  2GT6 A;  2NTO A;  2IIY A;  1H4O A;  1RK4 A;  2IMK A;  2JZT A;  4MNN A;  3TDG A;  3C1S A;  1TK8 B;  2VCQ A;  4MAB A;  4O5Q A;  2ZNM A;  3EU4 A;  3BCK A;  1AXD A;  2DML A;  3D0Z A;  2GLR A;  3IXR A;  4FYU A;  2PWJ A;  2VCZ A;  4I5Q A;  1FAA A;  5GAN D;  1J9B A;  4ULX A;  3ZYW A;  2GZY A;  3GKX A;  2C8U A;  4IQA A;  2X99 A;  1LJR A;  3VI7 A;  1DE1 A;  4LMW A;  1DBY A;  2HE3 A;  3UBL A;  2LJR A;  1HD2 A;  3KTL A;  2CT6 A;  1X9S B;  1SD8 A;  2KOK A;  4EUY A;  3F63 A;  4F82 A;  4KSM A;  4ZL7 A;  4NHW A;  3TRQ A;  3GX8 A;  5LNK e;  2LEG A;  2CAQ A;  1XWC A;  4RQX A;  1U3I A;  4P3Y B;  1K0A A;  4Z2U A;  4KF9 A;  2H30 A;  4ZL8 A;  1K3Y A;  4EDZ A;  3LOR A;  2IL3 A;  4AJ8 A;  1GLP A;  4N0Z A;  2LRN A;  2RM6 A;  1OC9 A;  1JLV A;  1EP8 A;  3CRU A;  5H5S A;  3TJB A;  4N10 A;  1G7O A;  3FZA A;  2OE0 A;  2OAD A;  2F8F A;  1PKW A;  4GDF A;  1M7T A;  5DAL B;  2TRX A;  2N5B A;  3P7X A;  3DXB A;  4D73 A;  2GZP A;  2H1A A;  2EFH A;  2VUP A;  1KTE A;  2OE1 A;  5ABR A;  4MDC A;  1BG1 A;  3NIV A;  5CP1 A;  3MAK A;  1GSY A;  2KP2 A;  2DJJ A;  4MJA A;  3UVH A;  4WR5 A;  4K2X A;  4EE0 A;  3L0H A;  1ERV A;  2JAC A;  1M9B A;  1Z6M A;  2IMI A;  3KM6 A;  5FWG A;  4PNG A;  5A34 B;  2DJ1 A;  3BD2 A;  2AJQ B;  4K2D A;  2JL4 A;  4F2I A;  2MBS A;  3LXT A;  3R3E A;  4KW6 A;  3L9U A;  2B6M A;  3GA4 A;  1ON4 A;  3GKK A;  5G5F A;  4O5R A;  1X9M B;  4CHS A;  1O81 A;  2FD3 A;  2OJL A;  1BED A;  1YQ1 A;  2E0Q A;  1T4Y A;  2FWG A;  2C0E A;  3NZN A;  2JZR A;  3WD6 A;  4V1A g;  4KUN A;  3P8W A;  3HXS A;  17GS A;  2CZ3 A;  4EKZ A;  2V6K A;  4PNF A;  1GTI A;  5ECP B;  3TOU A;  3IRA A;  3F4T A;  2VLU A;  1GSQ A;  3TKS E;  1EOG A;  3HJP A;  4IKH A;  5KOX A;  1HNA A;  4O92 A;  2VO4 A;  3H8Q A;  3MYD A;  1A23 A;  4BL7 B;  4KCE A;  2YWO A;  1G7E A;  1Z6N A;  2A2P A;  2R37 A;  3FR3 A;  5IPG A;  4NWY A;  1OC3 A;  2E2G A;  2DC5 A;  1I5G A;  4Q5Q A;  5HFI A;  1EZK A;  4TR4 A;  3DYR A;  1SK0 A;  2MBT A;  2BMX A;  5ECS A;  1XXU A;  1TKD B;  4KCA A;  4HZ4 A;  3R2Q A;  2P0G A;  2NPB A;  4ZB8 A;  5G1K A;  3E0U A;  4ZB7 A;  2NBS A;  4TR3 A;  4EF0 A;  2I9H A;  3PGT A;  2G0F A;  2OBI A;  3ME7 A;  3ZIT A;  2AUV A;  3QCP A;  4KDX A;  2FNO A;  1UC7 A;  1W89 A;  3IAM 2;  4K0N A;  4BVY A;  3ZIJ A;  5IPH A;  4NXI A;  2EFE A;  2I4A A;  1AW9 A;  4IW9 A;  1AC1 A;  5KOW A;  2H6Z A;  5FT3 A;  2L59 A;  3WYW A;  1SJI A;  2LTK A;  2A2R A;  3GH9 A;  2ALB A;  3PPU A;  1F3B A;  4I6X A;  4HUA A;  1R5A A;  3APQ A;  2HFD A;  4TXV A;  5G30 A;  1VF3 A;  4MLY A;  1A24 A;  5KN1 A;  2L4C A;  5D9V A;  3VPQ A;  5JWQ B;  1ACV A;  1RW1 A;  3GUR A;  5D93 A;  3HVX A;  3GUS A;  3F3Q A;  1M2A A;  3ZLP A;  4HS1 A;  1PL2 A;  4FO5 A;  4XTS A;  2QC7 A;  3ZL5 A;  1XWB A;  4MA9 A;  3GV1 A;  1GUH A;  3TCO A;  2DJ3 A;  12GS A;  2IFQ A;  1AIU A;  1DE2 A;  2FLS A;  3CTF A;  2TRC P;  3RDW A;  2YOI A;  5F0G A;  4TXO A;  3IPZ A;  5J40 A;  1J08 A;  4XIH A;  5GST A;  4EDY A;  2R0G A;  1NSW A;  2EFD A;  2PPT A;  2PBJ A;  6GSS A;  1FB6 A;  3C71 A;  4NHZ A;  3QMX A;  3GHA A;  1EEM A;  1YF0 A;  1T7P B;  3HMJ G;  1X9W B;  2GST A;  2QA1 A;  4G19 A;  20GS A;  4GLT A;  1SD9 A;  3EWL A;  1CQG A;  13GS A;  2L6D A;  5DJM A;  4MCU A;  1XBS A;  2O5V A;  1V40 A;  1S3C A;  3APO A;  3KH9 A;  3D6I A;  3IHQ A;  1AQW A;  3KP8 A;  4TR1 B;  1M9A A;  2GVP A;  1YKC A;  2IMF A;  2C4J A;  4ML1 A;  2CX3 A;  5J4V A;  5DAK B;  2F51 A;  3LYK A;  1SJ6 A;  5LCZ A;  1THX A;  4TW5 A;  2ON5 A;  2MMO A;  2VM2 A;  3FZ4 A;  5KEJ A;  3FEU A;  3HJO A;  3L9S A;  2X4A A;  4Q5F A;  2H01 A;  3GTU A;  5JCU A;  2P5R A;  1T3B A;  4W66 A;  4KB3 A;  1RQM A;  6GST A;  1WJK A;  2HYX A;  2PVO C;  6GSW A;  4F0C A;  1TU8 A;  4EL1 A;  3FR9 A;  2DLX A;  5G1L A;  4MZB A;  1GL8 A;  3ISO A;  4L5L A;  4EIQ A;  4DEJ A;  1Y25 A;  2B1K A;  3KD0 A;  1F2E A;  1JZR A;  1YJ6 A;  1WE0 A;  1T00 A;  1M2D A;  3LXZ A;  3A5I A;  1VF4 A;  1K0O A;  1R4W A;  1V57 A;  2LQO A;  3H93 A;  3KEB A;  3UAR A;  1AQV A;  1B4P A;  5A4U A;  4EO3 A;  1UN2 A;  4TRX A;  4JR4 A;  1WRY A;  2RUE A;  1A8L A;  3MWH A;  5B7C A;  4K5R A;  1OKT A;  1SU9 A;  1QGV A;  4Z2T A;  1EWX A;  3HVV A;  2AYT A;  2MMA A;  1AQX A;  1MD4 A;  1TDI A;  2H1L A;  5ELA A;  4EXJ A;  1TU7 A;  2PVQ A;  1OC9 B;  2FCH A;  5KN0 A;  1SK1 A;  2MMN A;  3EE2 A;  1S3A A;  2DJK A;  4K0G A;  1ZZY A;  1SEN A;  2K9F A;  5AIV A;  3FKF A;  8GSS A;  3Q74 A;  3L78 A;  3QFB C;  4JED A;  5HR2 A;  1A0F A;  2P5Q A;  4OFT A;  4K6X A;  16GS A;  2C0G A;  4NPB A;  5IMF A;  1GP1 A;  3TKR A;  1PX6 A;  3LSZ A;  2H19 A;  3D22 A;  5DDL A;  2GDR A;  4KDY A;  1SVO A;  1JZO A;  4GQC A;  3ZRE A;  4KE3 A;  2H8L A;  2V2G A;  2GTU A;  4K7I A;  2QKE A;  2H0H A;  2HSH A;  4YQM A;  2YV9 A;  4GTU A;  2H1G A;  3UIW A;  4K1F A;  5B8B A;  5A5K A;  2YWM A;  1SKW B;  4YAP A;  1K0B A;  2EIO A;  2GT5 A;  1VGL A;  1JZW A;  1EGO A;  1KEB A;  2LST A;  3L4N A;  3N5O A;  2FA4 A;  2YZH A;  1TXU A;  4OWY A;  1V98 A;  2Z9S A;  2FHE A;  1SL1 B;  1XWG A;  4YKF A;  5EVO A;  3RHB A;  1PGT A;  4N3Z A;  3FW2 A;  3A5W A;  4CY6 A;  4GST A;  5CRG A;  2FWH A;  5IM9 A;  5HR3 A;  3LQ7 A;  2ZCT A;  1FVJ A;  5A1N A;  3ERF A;  3DVX A;  4KND A;  4IQ1 A;  3H79 A;  2GSR A;  5A4V A;  1ML6 A;  5J3R A;  2X49 A;  3RPP A;  1FHE A;  3K8N A;  4AKH A;  4I2T A;  2HZE A;  5A5H A;  1WWJ A;  3UVT A;  3Q18 A;  3FMW A;  1XOA A;  4I2U A;  4PXO A;  3PH9 A;  3IC8 A;  1FOH A;  5IMC A;  3EVI A;  4OMV A;  4NMU A;  4IN0 A;  3IK7 A;  2BTO T;  4G10 A;  2DMM A;  5C00 A;  2WCI A;  2HXK A;  2L5O A;  3APS A;  3GMF A;  3TGZ A;  1V2A A;  2OAC A;  6GSV A;  4K7O A;  2OE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...