5IRCD

P190a gap domain complex with rhoa
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
178
structure length
170
Chain Sequence
IRKKLVIVGDGACGKTLLIVNVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho GTPase-activating protein 35
publication title Deciphering the Molecular and Functional Basis of RHOGAP Family Proteins: A SYSTEMATIC APPROACH TOWARD SELECTIVE INACTIVATION OF RHO FAMILY PROTEINS.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 55
structure length 170
sequence length 178
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ircD00
1MRSA 2SHKA 2CNWD 4QBIA 3P27A 5GJBA 3W6NA 4HZIA 2R6GA 3OE7A 2R6AA 1ZYUA 5JWOA 4D0GA 2IL1A 1KK1A 2ZI7A 3OIUA 1JEDA 1ZMXA 1T5LA 2C77A 1IN6A 3CF2A 4ON9A 5D3MA 5JRZA 1TNDA 3MD0A 4LJ9A 2W6JA 2CE7A 4WIAA 4KITB 5HKKD 4TMXA 1DOAA 2O52A 2XSZA 5FTJA 1JR3D 2EYUA 1GNQA 4QBGB 1G5TA 4XD7A 3GEHA 1XJQA 3A1UA 3CNLA 3SJCA 3VQTA 3EZ6A 1EFTA 4I1VA 4Q9KA 5FOUA 5E95A 5EE5B 5GJWC 3U7EB 2IEYA 2XJ9A 3BGWA 2RMKA 2PL3A 4Q4JB 2IX3A 3EZFA 3HR7A 2CL7X 5KTYA 4DSOA 5EXSA 3T35A 5KUTA 2IYRA 2BCJQ 3LVRE 2H1LA 1T3SA 3SEAA 2AD1A 4A4DA 5C4GB 2MMCA 3ZVMA 2EFEB 4IOMA 3U3OA 1MOZA 3AP2A 4QXAA 2FPLA 4OJKA 2C2HA 4DT1B 4IJMA 1R7RA 1K6MA 1DPFA 4GBMA 4M1YA 2HF8A 5FL7A 1E0AA 4MYTA 5FR1A 4DCSA 4MKIA 3DZ8A 2OFXA 2P2LA 3LA6A 2J0VA 3RABA 4WZBE 3IEUA 2XOKD 1QHHA 3C4JA 5D3QA 5A5GA 2Q9CA 1Q1BA 1O3YA 2MSDB 1A2KC 2FWRA 1OPXA 1YHNA 3QBTA 4LY6A 4AG5A 3B1VA 3ZS9A 4AD8A 4IXNA 1D2NA 3QF7A 3FDIA 1RRCA 5L3SB 2CHVA 1WBBA 1XCMA 2ZJ8A 1R8QA 1VHLA 1J8MF 2B8TA 1ZNXA 3CRRA 3MLEA 3SOPA 4PHFA 4PSAA 4KLNA 5GVRA 1KGDA 5TARA 2PZGA 4EPVA 4YXWD 2E1RA 1H8EA 1E9DA 1W44A 2H16A 4MKGA 3TSWA 5FTNA 5EP4A 4LZZA 2ONKA 1FP6A 2RGAA 3RRYA 4N1AA 3BB4A 4BFTA 1SXJA 2GEDA 5E7MA 1H65A 4KHZA 3H4MA 4BASA 4D0LB 2RAPA 4IDNA 2H17A 3B13B 4EPXA 4URVR 4EJSB 1QRAA 3BFVA 3OAAA 1W0KA 3AKCA 1E79D 1E2GA 1E94E 2JJ1A 4CEIA 4D81A 4LJ7A 2V6JA 3EIHA 3B1ZA 4A8JB 2QUZA 2J0SA 2ORWA 2GBLA 3WNCA 2MSCB 5HZKA 1N0VC 2J3EA 2FPMA 3AH8A 3N5CA 1XMVA 4HLDA 1AJEA 1M2OB 5KOYA 3E5HA 4PFSA 5JEDA 1TADA 1N6KA 4IFEA 1SXJC 4V0KA 4OQLA 5BWMA 3ZS8A 3THWA 1NY6A 3J81k 4MA4A 1Z2CA 2MSEB 3ZVNA 2EFHB 3N70A 2W6JD 4JBXA 4NL4H 3NDBB 4PO1A 2FFHA 1DE0A 3GPLA 3HJNA 2QSZA 2XSZD 1XTIA 1NIPA 1UDWA 5CLLA 1AQYA 2HXYA 3L2OB 3M0EA 4L9SA 4E5UA 4D4MA 1ZAKA 3AP1A 2BMEA 1GKUB 3KXIA 4XD7D 5FUYA 1CJKC 2FFBA 5SZKB 1AGPA 2GBLC 4G5QA 4P4UA 4Q5IA 4HAVA 1JR6A 1N5LA 4U7DA 4IVQA 1P9WA 1Z22A 4PHHA 1VIAA 1JEEA 2WTUA 1VG8A 1GFIA 2KSQA 1X1RA 3IBYA 4JL5A 1Z29A 4LBWA 1PUJA 1SXJE 2F9MA 3V9PA 4PTLA 4RJLA 2ECKA 2Q0HA 1XP8A 2VP5A 2GXQA 2ZRNA 4W5HA 5G3YA 2I1QA 3W34A 2XXAB 2E87A 4DWJA 4G3XA 3SU8A 2CBZA 4MYUA 4OQMA 2VHQA 3VR3A 5B30A 2V1XA 1CBUA 1OHHA 3QPVA 3VX4A 2BV3A 3D8BA 2FF7A 4TL9A 3VR1A 4B43A 1B23P 1W0JA 3KKQA 3L0IB 1TQ4A 5FL7D 3G0HA 2J7PD 2ZSAA 2VSXA 1J8YF 4NZYA 4LX0A 5DNYB 4BLPA 2PMKA 3IGFA 5TB5A 3KTAB 5FOSA 2B8WA 1YZKA 4RVCA 2GKSA 2IT1A 2ZI5A 821PA 1R0YA 1KTVA 1O87A 1SVMA 4FINA 2ZJAA 2VH5R 1LB1B 4JLDA 3PJRA 3U4QA 4C2UA 1FTNA 3BS4A 2P67A 4BEJA 5KYKA 3OIWA 2QA5A 3PITA 5P21A 4F38A 4OQXA 2ZXUA 4AWXA 4TWZA 1KSJA 2WAXA 4A0GA 4TLDA 3FTQA 1OIXA 1OH8A 2D3WA 4ARZB 1H8ED 4C7OA 5CB6A 1XMIA 3CPHA 5DI3A 5HCNA 1JQJC 2IS2A 2OLKA 3SFZA 1NN1A 5JZVA 1OXVA 4C0JA 4JLMA 2OBLA 1G19A 2BKEA 4QOSA 5F98A 3TVTA 1EK0A 5LB4A 1UPTA 3U6BA 3IILA 1SXJD 3BXZA 2WKPA 4WXRA 2O5VA 2VHUA 4URZR 1I4LD 2FGJA 2ZR9A 2IEZA 3WMGA 3FB4A 1FNNA 2ORVA 3OAAD 4TLBA 1IXZA 1W0KD 4R71A 6Q21A 4PZLA 3GJ3A 4PO9A 1HY3A 1XEXA 3E2IA 4FW9A 4LHWA 4Q7JB 4FCVA 2JJ1D 1DEKA 3IQWA 4TZ0A 1GIAA 4URYR 1EWRA 3UG6A 3CM0A 1KMHA 2R6CA 5D3MB 3PUYA 2PEYA 5CLQA 1E2NA 1KO8A 4ZDKA 3AUYA 1FPMA 2EWVA 2ZJYA 3RLFA 2OM2A 4HDQB 4LV8B 3I5YA 4QJ4A 4RD6A 1L2TA 1FZQA 4ZDWA 2HCJB 3V4FA 2IYXA 1A1VA 2CL0X 4OI2A 3R9IA 1TMKA 1N3BA 4LPKA 1CP2A 2BMJA 4LBYA 2XZPA 4B47A 2QMEA 3NG1A 3AVTA 1UKYA 2FEMA 3TUIC 3WP0A 1OW3B 2GCPA 4QNRA 2ZRHA 2HCBA 2X2EA 2B7CA 3AKDA 5EUQB 3SHFA 3LWNA 4BZPA 4V0LA 3KKOA 2VHTA 5L3RA 3DOFA 3TQFA 2J0QA 4WAUA 3OIVA 5C1BA 2YC4C 1CRQA 3WRXC 4D4LA 4LHZA 4RD1A 1R5NA 3ZDQA 421PA 4HATA 3VR4A 5C2JB 3EWAA 1M7HA 3AF0A 2NTYC 3EZ2A 2P6UA 4JLKA 4IKEA 3HPQA 2WV9A 3M6AA 3IEVA 3D3QA 2O8FA 4C0BA 3CW2A 3KDSE 3CR8A 4BFWA 1DAGA 4B33A 2OG2A 3AVOA 4ZKDA 1OYWA 4AY2A 2HF9A 5L8VA 2BBTA 1TEXA 3X1DA 2O0JA 1Q57A 1BYUA 5AJWA 3NIBA 2FFAA 2IS6A 5JWHA 1M7BA 4FXPA 1P73A 4NP6A 5FTKA 2IYYA 2IXEA 4OHXA 1QHHB 3QVVA 2IK8A 3SYKA 4BFSA 4GMDA 4BFXA 1ZD1A 5SZIA 1C1YA 2V3CC 3TUJC 1UEJA 4HEJA 3REGA 3PR1A 3TBKA 2LKDA 4QKQA 3SI7A 4DUGA 1ZU4A 1ZC4A 3LX8A 1R6BX 2I3BA 2VP4A 2ORIA 4Q7KA 1SKYE 2WMNB 3I1FA 4ZI2A 3REFA 1T4GA 3ECCA 2OESA 5GVSA 2D4HA 5EP3A 1VYVA 2GF9A 5CK4A 3LW7A 2FPKA 2YKGA 4AKIA 2NOAA 1OYYA 3U61B 1E98A 3ADDA 2ZR7A 4MKHA 3DHWC 1SXJB 3ADKA 3ZZTA 2YWGA 2PZEA 2QZ4A 3H86A 4N0DA 3MSXA 2C99A 1EFRD 2JLSA 1GZSA 3KQHA 2GJ9A 5F9FA 2J0UA 4FN5A 4KFUA 5BN5A 1GAJA 3OHMA 5HPYB 4CT4B 1KZGB 1WXQA 4Q48A 1M74A 4PSKA 1QZXA 3AVYA 4CEIB 1BMFA 1TQ6A 2BIFA 2FN4A 3BERA 4G5SA 3TAHA 3T1QA 2DY1A 1E9EA 3DKPA 1MH1A 1OKKA 2KBFA 5G41A 4DSUA 2XB4A 1NBMA 1FUKA 1E2EA 4EQ6B 3I8XA 4FMBB 4M53A 1KOFA 2FSIA 2WJHA 1HT1E 1YR6A 2GXSA 3AF1A 4DCNA 1Z6YA 3CO5A 3FYHA 4M1WA 4AYTA 4IDPA 2FFQA 1WDTA 4Z8XA 4OK3A 1CU1A 2PCJA 2FEOA 4II7A 5DHFA 5DO9A 2YWEA 4ESHA 2QN6A 4GP7A 2DFKB 3EARA 3A58B 4BE7B 2YWFA 2BCGY 3W3ZB 5B64A 3AUXA 2ZJZA 2JCSA 4BZXA 1Q1EA 4NKRA 3WYAA 4L5BA 4QJ3A 3ND9A 3KJGA 1Q21A 4Y0AA 4HI0E 1VDZA 2ZI9A 3KX2A 4GNKA 1EX7A 3U7HB 3BD9A 1S4QA 2AX4A 4G01B 1E69A 3VMFA 4XVUA 1E9SA 2RGNA 2OBNA 1P60A 3AVWA 1OE0A 1HA3A 4A2PA 3EA0A 1XD2A 2VTKA 2CHQA 1E1QA 2ZRIA 2ZJ5A 1YVDA 1FNMA 2Q3MA 3NDPA 4RD4A 1DTSA 2DPXA 3FGNA 3I73A 2RB4A 3EPHA 1G7SA 4KU4A 4U5XA 2TMKA 1CULC 1R0ZA 3L0OA 1UJ2A 2F43A 4JVNA 5KSZA 1GRQA 1RW4A 1Z07A 2IUTA 2C04A 4TL8A 1NBME 1XZPA 5HZHA 4Q9JA 3FHOA 3CWQA 4BFVA 3I62A 2C98A 1HQYE 1GP2A 1U0JA 1A2BA 2AFHE 1JAHA 1YZUA 1IM2A 3LO5A 4UXIA 1RRFA 4CEJA 3C15C 1P4SA 4X8LA 5TXGA 2ZRLA 3B78A 1Q44A 4JMPA 4P0TA 2Z5FA 2QNRA 3X1ZA 4IRUB 4X8HA 1WRBA 2FSHA 2ZE7A 1W5SA 3CZQA 4DIDA 1E0JA 1E32A 1NJGA 1U90A 2GEVA 3O8BA 4RCZA 1E9BA 1KK0A 3FHCB 3W8NA 2CEAA 1VTKA 2H5EA 3RS5A 4TMTA 4UXHA 1QHNA 3GMTA 4C2TA 3U4QB 1E9FA 1LNZA 4MGKR 4DUGD 1ETUA 3Q9LA 2YYZA 3IQXA 3NBYC 4TYNA 3VKGA 3CX6A 4OI1A 8OHMA 2C96A 3ICEA 1VCOA 1ZNWA 1KMQA 3LXRA 2CCKA 4DIEA 3P4YA 5JCZA 4JKYA 5H8WA 4ERNA 4M1TA 4C7OB 1A5TA 1UKZA 4LUCA 1YE8A 5DI3B 2CVFA 1Z6GA 3C7KA 4O2LA 1GRNA 4OK5A 2J41A 1TUEA 4A1FA 3DL0A 5AR1A 1QG2A 5CB8A 1J90A 2CXXA 2HXSA 3EWSA 1CXZA 2REBA 4C30A 3CIOA 1Z8FA 3QEJA 1Z0KA 4PAOA 4E22A 1T8TA 3U3MA 1XRJA 4S35A 3CPEA 4LJYA 1T0JB 3MUFA 1Z0FA 4P31A 3SQWA 4Q4AA 4R98A 2H8KA 2AR7A 2KBEA 2W2XA 3SN6A 2ODEA 1HH4A 1BMFD 2IBMA 3I32A 2HLDD 1KMHB 3LX5A 2O8DA 1OKKD 2NG1A 4IDHA 3K0AA 3QPWA 5H68A 1QVRA 1MO6A 1X8LA 3CF6R 1S1CA 2VEDA 3THXA 2G83A 1EGAA 4I1OA 2WJGA 4XWAA 2CJWA 3LBHA 1T0HB 3VHXA 1DAFA 5FBVB 4YMSA 1G3MA 1I2MA 3C14C 4URXR 2ZANA 1GL7A 2OT3B 3Q3JB 2I1VB 2ZEJA 3B82A 4QGGA 2QRZA 4QGFA 1KDOA 5CJ2A 1ZVQA 2G3YA 5AUQA 2R62A 5JHHB 1SKYB 1EESA 1UKVY 2VA8A 3EC1A 3QENA 3QXSA 4I81A 4H1UA 2A5GA 4AKHA 3K70C 4TMWA 2EFDB 3TIFA 2A7QA 1ONBA 2GJAA 1RPZA 3K8YA 2K5UA 3IIJA 2FSFA 2J59A 2XJ4A 4IFBA 3WBJA 1JJ7A 2OCYC 5DSZA 1VCIA 4Z51A 2LKCA 5C4MA 1XTKA 2GCOA 5J4YA 3NVAA 1E9CA 2CE2X 4LGMA 1E1QD 1VHTA 2OHFA 4NH0A 5G3ZA 4BQSA 2ZM5A 4XH9B 3TW4A 2O8FB 1Z3IX 2BVNA 1MV5A 4M1SA 1KHTA 1E3MA 2REXB 1J2JA 1W46A 4DXAA 2BJVA 2D74A 3NH9A 1XBTA 4GRAA 1G18A 1DO2A 1Q1ZA 2EW1A 2G6BA 1NG9A 1ESMA 1KI1A 4GOKA 3O8RA 2ZJBA 3ZQJA 3SJBA 5G40A 3RS2A 4WOPA 4CRWB 1R4AA 5DN6A 4KO8A 2W83A 4DEXA 3L8ZA 2WZQA 2IWHA 1S2MA 3TUZC 4B6FA 2D7DA 5JWRA 3FVQA 3NBFA 1LF5A 4AK9A 5B57C 2W00A 3L43A 3DEFA 2JIZD 4R2HA 5DE3A 1UADA 5SZHB 3LV8A 1MO4A 1XTQA 4GOXA 3UATA 3QXJA 4YMTA 4W5WA 3IBGA 1NI3A 1N2CE 3LVQE 5TV2A 3RRMA 5FUWA 1N6RA 2GJSA 4OYHA 3CUEF 1ZJ6A 4DLUA 5CM8B 1TF2A 5EXTA 4A6PA 2QP4A 4OHWA 3W5JA 3RC8A 5J47A 4RD2A 5FH9A 2DCUA 2J0UB 1QHYA 2IYVA 4G1UC 4LC1A 4US0R 1NN5A 3T12A 1NKSA 5FUVA 3L82B 4C0QC 4Q1BA 5AUPB 2C8VA 1L7VC 2ZVQX 4QG7A 2FE4A 3EC2A 1DBSA 2O8EA 4KBFA 4PC3A 1JXOA 1VCMA 2ZSEA 4TTRA 5JRJA 3MCAA 4M8NE 2VP9A 3TSZA 2PJZA 1G7RA 1E4VA 3HR8A 2CK3A 4U02A 3SFVA 4MGYR 2ZUBA 3IUYA 4DHEA 1BKDR 1NIJA 2GXAA 1WQ1R 4OHZA 1G4UR 3K9HA 1DVRA 3UWOA 2WWYA 1CRPA 5LBIA 3TSOA 5EJEA 3K70D 4Q4LA 2WBLC 2OXCA 4TSFA 1P2SA 1FOEB 1HEIA 1F6BA 1KO4A 3NXSA 3PEYA 3VFDA 2GJKA 3ZGXA 5JI2E 1EXMA 1P9RA 3IO5A 4D26A 1E2KA 1ZM2A 3K0EA 2GXUA 3DM9B 4AURA 3MRSA 3OFND 4Q4HA 3U6KA 1RIFA 2O8BA 2WOOA 1DAEA 2C95A 2PT7A 3BBPA 4PPFA 3FMPB 3P20A 5LD2B 2AHOA 4B73A 1F3OA 2A5JA 1KO1A 1UFQA 1XD2B 2D2FA 1NRJB 1X86B 4HDOB 4WA7A 1XTSA 4EKDA 3GJ7A 5J4LA 1RFLA 1MO3A 3LH5A 4HLCA 3UMRA 4M2LA 4A6XA 5CYPA 4B74A 2AD5A 4PAQA 4N0EA 4F4IA 4BZQA 4IOKA 4BECA 2F43B 4A92A 4JLBA 4JLNA 2IYSA 4RFSA 1W4AA 4GZMA 3AF3A 2C9YA 4HAYA 2G88A 3BFXA 1RE0A 3QI2A 2ASEA 4XVRA 4CVNA 2YV5A 3ZIAA 1KI4A 4B76A 1VECA 2QGNA 1H8HA 2F1RA 3A4MA 3I4LA 1ZNZA 1N6HA 3RVBA 3EZ9A 1N6LA 1A7JA 2Z4RA 3KJIA 3WBKA 1II8A 2BBOA 3A4LA 3MG9A 4R9UC 2QQEA 5DN6D 1G7CA 4KSBA 4NPHA 1LY1A 1C9KA 3B9PA 3B5JA 5IF9A 521PA 1U0HC 2Q6TA 1VG0B 1R5OA 5FL3A 1G4AE 1S9HA 1Y3AA 2HJGA 2UZIR 5EUMA 1NMXA 2H92A 2C9OA 5JMTA 1PUIA 2ODBA 3B7GA 5KPDA 3I61A 2QT0A 2QL6A 3T06B 4AYWA 2OCPA 4QGAA 2RGXA 4YMVA 3KQNA 1G8GA 2B21A 1Z0DA 1T8UA 2GEUA 2IA5A 4PX9A 4QL3A 4QC2A 3T15A 3QJYA 2QENA 4D6PA 1KI2A 1QG4A 3BWDD 3SBDA 4F4JA 4RKEA 3TLXA 1YQTA 3AVVA 3WNDA 4Q01A 2WIBA 1Q3TA 1XF9A 3Q7QA 2UZ3A 4NCJA 4Q4AB 3U5ZB 4CZ2A 2BHRA 4B48A 4D4KA 4ZI3A 4L4UA 3LW8A 5E7IA 2FDCA 1JPJA 2JLVA 2O8DB 3KKNA 2F1IA 4O25A 4Q1AA 3K0AB 2ZU6A 3TNFA 3IHWA 2CK3D 2BBSA 3KL4A 4POAA 3K70B 1GNRA 4DSTA 3OE7D 3THXB 1W1WA 2KB0A 1XPRA 2CJWB 2WSMA 3FFBA 4JLVA 3JZAA 2F55A 1G16A 4IHQA 1PLLA 3MMPA 1Z6XA 4K46A 4TSFD 2AXNA 3OEHA 1J99A 1G20E 2BWJA 4MDFA 3K1JA 2JLUA 2ZUCA 1P2TA 4Q9IA 3BE4A 3GJ8A 2RGBA 1OB5A 3RRNA 1VIYA 1XEWX 3CF0A 4ITRC 1P2UA 5DIFA 3PEWA 3GLHA 3WRYC 4EPTA 3ASZA 2OSBA 1TU4A 1G21E 3B1YA 4A82A 4PQRA 4FIDA 1R0WA 2WICA 1AN0A 1E2QA 2GCOB 1KIMA 2PEZA 3RRZA 2RGCA 2A9KA 2ODNA 3QXCA 1IJEA 4AYXA 4PSVA 1UF9A 3MWJA 4RCYA 1SVSA 3RSLA 4PO8A 4QGHA 4DDWA 2A2ZA 2GESA 1QHGA 3TJZA 4B2PA 2WM9B 4OI4A 5KSOA 4D25A 4DVGA 2IS1A 3QE0A 2V4ZA 1ZUHA 1PVOA 3SE0A 1QHXA 3UXMA 1U99A 3BC1A 4PPGA 3Q8XB 4LJ6A 3UPUA 4RD0A 4MGIR 2LWIA 1KAOA 2B92A 2NO9A 3HU2A 1P5ZB 3KJHA 1WMSA 3QIAA 1FUUA 1H8HD 1CTQA 2CCJA 4Q1CA 2AK3A 2Q9AA 3CLVA 1SKQA 4URUR 1UKEA 5CK5A 1NJFA 2QMUA 3ZD7A 2J87A 1XXHA 1YR9A 3KFXA 2XNDA 2V54A 3PVSA 1W2GA 2RCNA 1F2UA 4X8MA 3BB3A 2IYZA 2VP6A 1E9RA 3PXGA 3GLHE 5KPJA 3QKSA 3Q5DA 2BMFA 3KKPA 1M1YE 3L0SA 2P6NA 3OF5A 2A5FA 5BXQC 1RZ3A 3PUXA 2P0EA 3ASYA 4LHXA 1OJLA 2P6RA 3VNVA 2HT1A 2P3SA 4UNNA 3NHBA 1Q12A 2GA8A 4LBZA 5E3HA 1WF3A 2WIAA 3B1WA 1QBKC 1ZINA 3CX7A 2O8EB 1AQUA 1P6XA 3AGQA 2AK2A 4ESVA 4JZKA 3A6PC 2WJJA 1JQLB 1G5RA 2IHBA 5B58C 1WP9A 1K5DA 3GJXC 4ZKEA 1G5PA 1KY2A 1KJWA 4O2RA 2J45A 4TMVA 4BUJA 3K53A 3DKVA 4UNSA 2FZLA 3AKYA 3BOSA 5EE9A 3SS8A 2VRWA 1YJ5A 1RKBA 1D9XA 1R5BA 1RRPA 4QJ5A 4ZIRA 5BYKA 3K0SA 3SDZA 4B3XA 2MMGA 1AS3A 4HZUA 3DZDA 5AWFC 3LBIA 1XXHE 2FG5A 4DCUA 3X1WA 5EXPA 2RH5A 1J70A 1W5TA 2VLIA 4HDCA 1AKYA 2O8CA 3TH5A 1NN0A 1FP7A 4L16A 1EG7A 1NL3A 1NVVQ 3FE2A 4LCBA 3OEHD 4Q4HB 4OHYA 1KJZA 2O8BB 2ZRAA 1E6CA 4D82A 2FSGA 5K8LA 4P4TA 4MRSA 2RHDA 2OCBA 5FUXA 3MAAC 2BJWA 2NPIA 1E2JA 2R8RA 4MRNA 4TQAA 5EXXA 1UM8A 1DS6A 3RYTC 4JBYA 2DR3A 1IN7A 4ZPXA 2CDNA 2XNSA 1VMAA 3IHLA 4KCGA 5TY0A 4TMZA 1MO5A 3PUZA 1ELOA 1WA5A 4UQOA 2Z43A 2YHSA 2IWRA 3UK6A 4RFSB 1YRBA 3R20A 3U7FB 1A4RA 4XSGA 3S1AA 1PZNA 1Z28A 1Z5ZA 3HYTA 5AJYA 4MDEA 5IK2A 4LI0A 1HTWA 4LV5B 221PA 2XITA 2CLSA 1UBCA 2OAP1 4LYAA 3SYNA 3VR6A 3QG1A 4M4SA 1M8PA 3WHLA 2W58A 4GZLA 1OHHD 2PX0A 3O47A 1TU3A 1II8B 2QAJA 3GD7A 3FHTA 2IXGA 1W0JD 2QTHA 2QPOA 3E70C 3KUDA 1VG1A 1HQCA 3AKEA 1HURA 4JYBA 3HYRA 3CH4B 1XCPA 4J0QA 2ZYWX 3EX7C 3M4YA 3JVUA 2X2FA 4Z1MA 4F91B 1DAMA 1N6PA 2OXRA 3WP1B 4AI6A 1G3RA 4PAMA 1CJTC 1ZM4A 2BKUA 1OXSC 2EFGA 2PX3A 3AVQA 4A15A 1Q20A 1DADA 5L3QA 4MRRA 1OH5A 3B1XA 3H84A 1JJVA 2ONJA 5JSZA 5KNBA 3RNLA 4CGZA 3H1TA 1R10A 2IYTA 4PZZA 1AZTA 4TLCA 3U60B 2VQSA 4CDGA 2AFIE 2ZVPX 3WMEA 2PMDA 4FCTA 4MH0R 3SJAA 3RANA 4E03A 3GJ0A 3LBNA 3QNUA 1PLJA 1ESNA 1Z06A 3KUCA 1E4YA 4U00A 2ZS8A 3K0FA 4LK2A 1ANKA 3A4NA 4FMDF 3D7MA 3X2SA 4Z54A 4Q18A 5EP1A 3WMFA 3FKQA 4OK6A 3THWB 4KVGA 2O0KA 2ZU0C 3LQQA 5FI1B 2ZI6A 3KZ1E 4HB2A 4WVFA 3CR7A 3VR2A 5KDDA 2W0SA 3U7GA 4CYMA 4DDUA 1IHUA 2E9SA 2Z6VA 4US2R 2WWIA 2WOJA 3AF4A 3MGCA 3GLIA 3GCGA 3R8FA 2GZHA 2QP9X 3GLGA 1P3JA 2D2EA 2J46A 2YVUA 3L8YA 4KFTA 4BLOA 3U3KA 3GLHB 2H57A 2GK6A 4EFLA 4ASUA 4JJKA 1GDDA 2QP3A 3IPXA 1Z2AA 4NMMA 4AG6A 1KI3A 4CW7A 5AUOB 4WZ6A 1W36B 2WAYA 2VSOA 5FPYA 1FMLA 3LRPA 5LDDC 1EFUA 2ZI3A 3T1OA 4ACBA 4RD3A 2IW3A 2QBYA 3ZZ0A 4FI3C 2YZ2A 2OFOA 2REOA 3VU9A 1KK2A 1N5KA 5J5CA 3T1TA 3RS3A 1MRNA 1ZIPA 4KSCA 2N1BA 1Z0IA 4HB3A 5FBWB 1BS1A 1OIWA 2A3RA 1US8A 4XSHA 5HE9A 3TR5A 1KO5A 1NF3A 4JT4A 4D0NA 5ELXA 4QBHA 2VHJA 2ZE5A 4XOIA 4D4JA 2RGNC 5IK2D 1VPLA 2HT6A 1E96A 3ADBA 5LD2C 4JLAA 2L0XA 1T9HA 1KI6A 3EXAA 5JS7A 2EYQA 3R9XA 2EWWA 1LW7A 2GVDC 2J9RA 3A36A 2F1JA 1KDTA 2DYKA 2WWGA 2ZJ2A 3EPLA 2QI9C 1W4BA 4F4CA 1XXHB 2QPTA 3IDQA 2EU8A 4MRPA 4LC0A 3GLIE 2QPAA 1AS2A 4M1MA 4EFMA 1MKYA 3VKHA 3GLGE 5GJCA 4LWZA 1TQ2A 1F2UB 3NBZC 1II9A 4PQFA 5FOTA 2ZR0A 2GVZC 3QKSB 1ZC3A 4PZYA 5EE1A 3ETLA 2B6HA 4KYUA 4L8GA 4HUTA 4FWTA 2XEXA 4RY2A 4DT1A 2QSYA 4K8OA 4Z1MD 5IT5A 1KSHA 1NLYA 1IN8A 2JDIA 4TYYA 1W4CA 2CVHA 1XU4A 2X77A 3TAUA 1EX6A 4URWR 1SZPA 4DB4A 2GRJA 2YWHA 2GF0A 4S2EA 1D2EA 2P5TB 1RJ9A 2WJIA 2QORA 1G8PA 3QOFA 2ZETA 2JLYA 3R8CA 4Z8YA 5M04A 3B6EA 5EE3A 3SR0A 4CEHA 1JAIA 3D6TB 4JL8A 1KYIA 4KFRA 2DHRA 3R9WA 3LLMA 3GJ5A 1G6OA 1XEXB 1TQDA 2HDNB 1ZD8A 1CF4A 1N6OA 2ZITA 1DAKA 2UKDA 2ZUDA 4HZUB 4AC9A 3P4XA 2ZRKA 1E1RA 1FMJA 5KNDA 2C03A 1ZU5A 1NBMD 3N2EA 2WHXA 2KI5A 3WYFA 5AJZA 4XVQA 4MRVA 1CKEA 3QSYA 4ZDJA 1Q1QA 3AQ4A 4UNRA 4Q03A 2DFNA 1S3SA 2ANCA 3CBQA 4EAQA 2CNWA 4TLEA 3QF4A 4M9XA 3EG5A 1JPNA 2R44A 3DVLA 3M1IA 4UKDA 1FX0A 2DBYA 3IKJA 4BLTA 1DELA 4G5OA 4NCIA 2ZYVX 1N5IA 1HE1C 5BN3A 1C4OA 1XB2A 5J40A 4LYJA 1AM4D 2D06A 3VNUA 1X8JA 2XX3A 2WJYA 2QM8A 1GWNA 5HKKA 4QM6A 5B2ZA 3QPUA 4JYCA 5KDOA 3K9GA 2JLRA 2VYFA 2AXPA 2QAGA 2DFTA 4M9SA 3QUSA 1GOTA 3NTUA 1IONA 1CJVC 1CLUA 2G1JA 3K0CA 5EZ5A 3SYLA 1XZQA 1VYTA 2ATXA 2C5LA 1T3HA 2JJ8A 4ZDIA 2AKYA 1OXXK 4WZAE 3AF2A 2OO7A 2WWWA 3QKUA 4ILEA 1YRAA 2QE7A 4MGZR 4PHGA 2OV2A 2QAGC 2J7KA 4OQNA 4MYHA 1U9IA 1W48A 1XEFA 3IIKA 5EP2A 2R6FA 2JLXA 5DYIA 2FA9A 3K0CC 2OBMA 1E2HA 1QVAA 1OH7A 3W6PA 1BIFA 4DJTA 5AJVB 4DLXA 1E2PA 3L0PA 1LTQA 4QHYA 1FQJA 1WE2A 4UJ5A 1T3LA 5KU1A 1P9NA 1XPOA 1JI0A 3RS0A 3Q7PA 4MQBA 4AKEA 5LB2A 3KQUA 4Y0VA 2ZRJA 3KKMA 2ZIAA 3LDAA 4LV6A 2BC9A 3B85A 4DCTA 2D62A 5DLQC 2JDID 1E0SA 3T5GA 1U9IC 2BDTA 3K09A 3AGPA 2ATVA 3CX8A 3GQBA 2IF0A 4M9ZA 3NH6A 1U94A 4A0HA 2Q9BA 4TT3A 4WBSA 1DAIA 1P62B 2VSFA 3DMNA 5KNCA 2KWIA 2PJRA 2I4IA 3W9YA 1OV4A 1OH6A 4IVPA 1WCV1 2ZRFA 2ZSBA 1ZM3A 3K0FB 3LD9A 1XTRA 1YZLA 4Q21A 5FBLB 5CM9C 3DMDA 1FW6A 2BOVA 2AWOA 2ZYUX 3IPYA 2FV8A 1DG1G 4GPTA 2QTVB 1GG2A 3UG7A 2R9VA 3CRW1 3CNOA 2W6IA 2GZAA 3E1SA 2YOHA 3K09C 1XX6A 2QT1A 2YOGA 4YMWA 4DB2A 1E1RD 1W47A 4NYMQ 3CZPA 3QG5A 3B2EA 1S8FA 3C5CA 4DCVA 3DO6A 2ANBA 1KY3A 3GLIB 5DYGA 4B71A 3TMKA 1Z08A 3GLGB 3BRWD 4PC2A 5FOWA 1N6IA 2G0NA 4AKGA 2GILA 4NYJQ 3NHAA 4BLRA 2N46A 3SZRA 3WNBA 4QM7A 4A2QA 4DLSA 1DARA 4HLQB 4JS0A 3CRQA 2QBYB 2HYIC 1XTJA 4NONA 2ZREA 1GL6A 1I2DA 3VU9B 2GJ8A 4PQYA 3DDCA 1HV8A 4NDZA 2ZS9A 4XIGS 2IUUA 3KB2A 1NMYA 1NSTA 4YC7A 1EFHA 2W2VA 2OFWA 1EWQA 1SHKA 4KV9A 4MKFA 2CLCX 1US8B 1CIPA 3CWZA 3PENA 4JLPA 2WJVA 2DWQA 2DFLA 2QM7A 5EQTA 3IO3A 1JALA 4DEYA 2QG6A 2JJ2A 4NCHA 4CEJB 4DLYA 1N0UA 3W5IA 3TR0A 1KI6B 2GETA 4IOLA 2F3RA 4JVLA 4KVAA 1ZNYA 4F7WA 4BPBA 4NCKA 1P75A 1TF5A 1E2DA 1COWA 4IEEA 1Q3HA 4EPWA 2A5DA 2QE7D 4JL6A 1XNJA 5JI3E 4XTRA 4XTCS 3O8DA 2XZOA 1DO0A 4JVMA 1NVVR 2WKQA 1LF0A 1YR8A 4JSYA 3HU3A 1N6NA 4ZCIA 2F7SA 4HLUA 1FFHA 1HUQA 5FI0B 5C18A 1OT3A 2NO7A 3RAPR 3OESA 1DAHA 1E2FA 2P65A 4CT5A 1BO6A 4GDFA 4NU0A 2QQ0A 1L4YA 4UNQA 2YC2C 4C4PA 1D2MA 3U44A 2J7PA 1GILA 1QF9A 1UBFA 1JB1A 2FJUA 4KI0A 2IC5A 5FFMA 3WXMA 1JECA 1CS4C 4TTPA 3QXXA 4RSGA 1ODFA 3UWKA 4HUQA 4GFDA 2CLDX 1RJ9B 4A2WA 4LBVA 5CYOA 2JA1A 5IRCD 2OZEA 4HLUC 4M0LA 3BORA 1F2TA 4EIWA 4TTQA 4CEHB 5EZ6B 4V02A 2JAQA 3CB4A 3VHLB 4RKFA 2IYUA 4TT3D 2ODWA 1AK2A 4FMCF 4XJXA 5DISB 3CRMA 2JASA 2RGGA 1T91A 3GFOA 2N42A 2V9PA 2QU8A 1NN3A 1XFAA 2NO1A 4KBGA 4Q66C 5K8UA 4ZCMA 4B2IA 3CRVA 2JLQA 2IS4A 1G3UA 4OL0A 2JATA 3G82C 4JT2A 3WHKA 4LSGA 3V00A 4Q7MB 3UKDA 1LS6A 4DLTA 2ZQ5A 4B34A 5TMPA 2WWXA 3EPJA 1NP6A 2W6ID 5E4FA 4YONB 2FMXA 4HAXA 4O0MA 5BW8A 4JIMA 4DLZA 2UVQA 4LJ8A 2WWFA 2B7BA 1P72A 2Z4SA 2XTZA 3CPJB 3THOA 3TVDA 3W90A 1UAAA 3ZD6A 4TYWA 1GKIA 2NZJA 3QF4B 4PANA 5C46F 1BOFA 5FOXA 1XEWY 3WY9A 2KE5A 2V1UA 4AIIA 4HB4A 1FX0B 5K8TA 2V7QA 3NC0C 3NWJA 3HP1A 4FMDB 1SULA 1JNYA 1NVUQ 4FD2A 3VTKA 1NVXQ 2V55B 2NZ8A 2XTMA 5F9HA 2AN9A 2RKOA 3W3AA 4QRHA 2VP0A 3BH0A 2BEJA 5ANRB 2NPFA 1SVLA 4C0SA 1Z47A 1OIVA 4V03A 3HPRA 4EQ6A 3AEZA 2Z0MA 4I1SA 2BEKA 2DWOA 2PLFA 4EDHA 3MWYW 2QAGB 1GRRA 3KFVA 4B3CA 2CCGA 1NLZA 3UANA 1X3SA 2X19A 3ZH9B 1VCNA 3T34A 2WVJA 3G5UA 1KZ7B 1SGWA 3TQCA 3BAFA 2YJTD 1KSFX 3LY5A 1IN5A 1GUAA 2ZRDA 4PXAA 1XCGB 2JJ2D 3QEOA 5LPNA 2WWHA 4P33A 1W36C 1G6HA 5J4KA 4CF7A 4JSTA 5FR2A 3UIEA 4LJ4A 3ZIAD 1G41A 1G7TA 4DLRA 1IN4A 2ZRCA 1COWD 3F3YA 4R7ZA 5IDVA 4M9QA 1ZBDA 4XWOA 2ZPTX 5TDHA 3C5HA 4I99A 3BH6A 3AP3A 5AJXA 1KO7A 1G3QA 4BGDA 1G291 2H18A 1KI8A 2X1VA 1ZM7A 4QNMA 1Z6TA 3MWKA 3NEJA 1VYUA 2J1LA 2FZ4A 2LCFA 4D2IA 3V4RA 4V0NA 3KJEA 3TE6A 1W4RA 5AK0A 3KB1A 3F0TA 2XTNA 2YOFA 3FOZA 3R7WA 4Q1EA 2WSSA 1NKTA 1F5NA 1PLKA 5JEEA 2QTFA 4GSYA 2G1KA 5HR5A 3VKWA 5JJKA 1U0LA 1LS1A 1AKEA 2BM0A 3KQLA 2KJQA 3ZLJA 3IIMA 1UDXA 2ZYTX 4TYPA 2J5XA 2F9LA 2F3TA 2WPDA 2Y8EA 5DI9A 1N5JA 4YMUA 2GAAA 3ADCA 5DH9A 2CL6X 3QQ5A 4OHVA 4P32A 1SVIA 5BQ5A 5A4JA 2R65A 3THYA 3QBVA 4LHVA 4BFUA 2FGKA 2IYQA 1IJFA 4G0NA 4MUBA 2R6DA 3D31A 1D6JA 2VIIA 1AIPA 3BH7A 3T5DA 3PIRA 4B32A 2AL7A 1ZCBA 1U8ZA 3BK7A 3QKRA 3TGPA 1G8YA 1GNPA 2RHMA 2ZRBA 4B3BA 1EFRA 4GOJA 4HSEA 4NYIR 5JECA 1NLFA 1YZQA 2R2AA 1D5CA 1PJRA 4QFMA 4F93B 1QHIA 1OB2A 1TPZA 4W7SA 1OLOA 1G8HA 3SJZA 4A36A 1AA9A 4PC6A 3H2YA 3Q72A 3JZMA 4B44A 5GADl 2FOLA 2V7QD 1TL7C 4US1R 1P7CA 3PQCA 4YDSA 1AGRA 3KXKA 4ZCLA 4M22A 1Z0AA 1E99A 1OFIA 4B3GA 4NE2A 2EFCB 4M1OA 1KI7A 3I72A 4ZO4A 2JGNA 1IY0A 1BH2A 1N0WA 1W36D 2FNAA 2ZE6A 2QY9A 1RC8A 1XD8A 4TQUS 1P2VA 2YINC 1Q0UA 3AB3A 2Q3FA 4HAZA 5CIQA 1QHSA 1JXMA 4DZZA 1E2IA 1I4TD 3I92A 1RYHA 2V8OA 1Y63A 3W8RA 2VO1A 3ZZUA 1XMJA 1GL9B 3RS4A 2VBCA 4UNPA 2RGDA 2V6IA 5H1YA 4BFZA 3EPKA 2VF8A 4H9GA 1B0UA 5JJLA 3RSOA 1HYQA 3LAWA 3TK1A 4PPQA 5JBQA 3Q5EA 4HAUA 4IVRA 2BMDA 2IHYA 3GJ4A 3HWSA 4TL6A 1G1MA 1I4DD 2GNOA 1IQPA 3AV0B 3MJHA 1M6NA 4OJQA 3CH5A 1ZCAA 1KAGA 2GK7A 4H1VA 2HEIA 4CIDA 1CR2A 2ERYA 2PCLA 3CONA 4B75A 2PT5A 1UBEA 4V0MA 3X1YA 1JBKA 3QY0A 2XZLA 3I5XA 1M34E 1P61B 3JVVA 2ZSFA 1X8KA 4X8OA 3AVXA 1F60A 2GZDA 1D9ZA 1E0KA 2XNDD 2XAUA 3PCRB 4LJAA 4NHOA 3U44B 1M7GA 1W7AA 1OFHA 5KSYA 1G17A 4LPSA 1AS0A 4TZ6A 4M1KA 2G0TA 2G77B 2GAOA 4W5JA 2W2TA 3KQKA 3PFIA 2FU5C 2ZSDA 4LDJA 3SNHA 2BM1A 2WSSD 4HUQB 4KODA 4QBFA 4PHTA 4TQ9A 5UKDA 5FTLA 1GSIA 3FWYA 3EZ7A 3VAAA 2ZAOA 3VX3A 2ZAMA 1F2TB 1RYFA 2Q21A 2PBRA 5HCIA 4DKXA 4PC7A 4ZV4A 3CNNA 1TUIA 3C8UA 4NCNA 1G64A 4TYQA 2VPPA 4FCWA 4GMXA 1IXRC 1OF1A 3I8SA 2WPDD 4WW0A 4EPRA 4O3MA 2WMOB 3B9QA 2GWHA 1IBRA 1G9XA 4A0FA 4PPNA 4K81B 1F48A 5KO2A 1T6NA 1YZNA 4M21A 4P4SA 3GLFA 4RZ2A 1TTTA 2O0HA 4MUAA 5FBQB 3GFPA 4QHTA 2OUKA 4OQFA 1CEEA 1NY5A 2Q3HA 3TKLA 4IOJA 4V0ME 1CR4A 1U8AA 4MITA 4XWKA 1Z63A 2FH5B 3GFTA 1XWIA 3LQRA 3A1SA 3WYGA 3BJIC 5CITA 1SQ5A 4JKIA 5CIWA 1MABA 3OZXA 3FPAA 1MT0A 5JHGB 1G8FA 3A1TA 1KKMA 4B6EA 2XGJA 2ZRGA 3U3JA 1GKYA 4I1UA 3B60A 3DPUA 5CDFA 2EVWX 4W9MC 2HLDA 5JJIA 4ABYA 2FX3A 4IDQA 3BB1A 4C0KA 4JJZA 1YZGA 3MWLA 1U81A 4TN1A 3MJRA 4DBLC 1L8QA 4B2LA 3PEVA 4BWYA 1V5WA 4BFYA 1EFCA 2ZS7A 4YLGA 4P3YA 3FFAA 1II0A 3NBXX 3U3RA 5TVKA 1L4UA 4DSNA 1X6VA 4EPYA 4I4LA 2A30A 4G5RA 1NSFA 5G53C 2YNMA 2QMOA 4L9WA 3ICQB 4JBWA 2QEQA 3I3SR 3PG5A 4Q7LA 2GTPA 1TEVA 5HTKA 1R8SA 1GTVA 4Q9LA 1CJMA 3GLFE 1Z83A 3P32A 3X1XA 4A9AA 1XD9A 3BFKA 3CKLA 4Q02A 1KNQA 4GL2A 2NO6A 4LRWA 1IOZA 1FL9A 4LYHA 4LYFA 3T1VA 2ZRPA 2VHCA 4NYMR 3HDTA 4MYCA 3ND8A 3NEYA 1DG3A 1LFDB 4NBSA 2IF2A 5KDLA 2C78A 4Q4JA 5AUNB 3LLUA 1J7KA 1SHZA 2X8AA 3C16C 3FMOB 3H0KA 4Q19A 4TMKA 5JFGA 4E07A 4Q00A 1Z6AA 2ZRMA 3ZJYA 2DB3A 2QMHA 1ZUNB 3EW9A 1CR0A 1LV7A 1NG1A 4IXMA 3ZYCA 4NYIQ 5CDFE 3QXHA 4TL7A 4NYJR 5FPTA 1R0XA 1U98A 4UXJA 1BYIA 3ZVLA 1CJUC 2F6RA 4KXFB 1SVOA 3R7WB 1XJCA 3DOEA 3FMFA 5DGXA 3A1VA 4OI0A 2PLRA 1KSGA 3RS7A 1WBDA 1G3IA 4PC1A 2DWPA 1TAGA 4HB0A 3K9NA 5FTMA 1W2HA 4UJ3A 3UMSA 4A0RA 2OCAA 1GITA 2EQBA 3SBEA 1QDEA 2GDJA 4DDVA 1ZW6A 4C3ZA 1FTSA 3PV0A 1GM5A 2ZE8A 3K9LA 2IXFA 1A82A 3NKVA 2NGRA 3GJ6A 5JS8A 3KXLA 2CMKA 2JIZA 3PUWA 3OEEA 4F92B 1KJYA 3EIQA 1MR3F 3OIYA 3THYB 1YU9A 4OBEA 2G9NA 3ZQ6A 1YR7A 1K8RA 1Z0JA 1CR1A 1XDBA 5A0FA 4RFVA 3LFUA 2OLJA 4FWIB 3B8HA 2W0MA 4KAXA 5L3VA 5FPSA 2ZJOA 5KSPA 2NQ2C 5L3SA 1U8YA 4BEBA 4IW3B 2ERXA 4KYIB 3FKSA 5FPHA 4ZIRB 3PUVA 3QKRB 4BRWA 1RVDA 1KDRA 4G5GA 721PA 3TW8B 1S9DA 3C41J 3T61A 4C0AC 3UMFA 3AVUA 1IY2A 4FMCB 4Q9HA 2IUSA 3SHWA 2O8CB 1ZD9A 4N3NA 2PH1A 1IAQA 1R2QA 3O8CA 4YQFA 1XJ0A 4TLAA 4OKSA 2VF7A 1OXTA 1YKSA 4C0LA 5J4VA 4R2IA 5BN4A 1OFTA 4EJSA 621PA 1AZSC 3FMIA 3AVPA 5E7JA 2GHIA 3LNCA 2A5YB 5GJVC 1SVWA 1OFUX 3A1WA 3RWMB 4ASUD 4A8JA 4BLSA 4BLQA 1XMSA 2F1HA 4DLWA 1OSNA 3GEEA 1U2RA 1ZUIA 1N25A 2D7CA 2ZTSA 4ACAA 4JVSB 1JR3A 3RC3A 2A78A 1YZTA 2OEPA 5IHPA 3OFNA 3F5FA 3S1AB 4EJSC 4DRZA 2OE2A 2Z83A 1LVGA 1KDPA 3QVUA 2NIPA 3EAQA 4Q1FA 4KJZA 4Q1DA 5DHAA 3RWOA 5FBRB 4A8JC 2AWNA 4Q47A 1RRGA 5HE8A 4D80A 5JCPA 2HV8A 1VG9B 1GVNB 1NVWQ 1IXSB 3HU1A 2JLWA 3QKTA 3SQXA 3GEIA 4DC9A 4LOAA 4WXPA 4YDHB 5EE0A 2IYLD 3RDPA 5K8IA 1KK3A 2QGZA 1ZRHA 5FOVA 2ZI4A 4B3DA 1X1SA 1IY1A 1FQKA 4HAWA 1S0UA 2H7VA 3Q85A 4GI7A 3EA5A 5CJPA 1KKLA 5BYJA 2NO0A 4QHSA 4E09A 2XXAA 4B35A 2ZROA 3NC1C 1T5IA 3ONWA 1TF7A 1E9AA 3SC3A 4EUNA 4L15A 1V43A 2OILA 1Q22A 5JLJA 5L3QB 2HJVA 4LHYA 2BBWA 5SZJA 4RZXA 5FPKA 4KLZA 2VL7A 2QROA 2XOKA 4GP6A 2WKRA 1D8TA 1JR3E 1ZIOA 3U2QA 1S1MA 4DLVA 5JSZB 3GP8A 2PZFA 2C9CA 4V0OA 2IYWA 2VP2A 3AM1A 1S96A 2HUPA 2JEOA 3KTAA 5J4HA 1ZM9A 1KNXA 1UBGA 4C0HA 1NNEA 2HYDA 2CHGA 4DDTA 4GT1A 1ZP6A 1VKJA 3EIEA 3OEED 4IEIA 1E2MA 1KI9A 2AKAB 4JLOA 1W49A 4P4SB 2P5SA 3GLFB 2JLZA 4HYYA 3A8TA 2XB2A 4RZ3A 1TX4B 4YXWA 4C9BA 2NMVA 3BIFA 1SVKA 4LJ5A 4EFNA 3MFYA 3FKSD 3VR5A 121PA 1HE8B 2RGEA 3F8TA 5H70A 1OXUA 1E2LA 4RZUA 1K5GA 3LXXA 3P1JA 4KFSA 4NTZA 3TRFA 4ARZA 3W6OA 4BRUA 1PV4A 3P26A 1MABB 1UEIA 3DM5A 2GCNA 3RHFA 1WB9A 5F2EA 3PEUA 4B3FX 1NMZA 3EASA 2QRNA 4JLJA 3A37A 3N2IA 1XPUA 5KHOC 5F3WB 1S3GA 2OAQ1 1HT2E 4PR0A 1E79A 3ZVRA 4IDOA
chains in the Genus database with same CATH superfamily
4RMIA 1ZJ5A 3BIOA 2SHKA 4QBIA 4X1OA 1G98A 3P27A 3QUTA 5CD9A 5GJBA 3EYAA 3QYPA 1IY8A 1P0FA 4DCGA 4TQGA 3DF9A 3AUTA 2R6GA 4V24A 4EYQA 1RP7A 2XMZA 5LBTA 3JWGA 1EBUA 1VRWA 3IUBA 4BP3A 4UM7A 3AR4A 1TPYA 1JEDA 4K6FA 1ZMXA 3LC0A 1TECE 2ST1A 3ENQA 1EBFA 1SXHA 3M4ZA 1IN6A 3ZLVA 5ESXA 1YKFA 4A2CA 3MD0A 4GNRA 4BXOB 2Y67A 2C2XA 2VEOA 2EC5A 1YACA 3BN3A 3REQA 5IYZB 4YJ2B 4KITB 1DOAA 3LL7A 1ORWA 3FPBA 1G42A 4O4HF 1JR3D 2BHLA 2EYUA 1J0EA 2DPHA 2Q5IA 4PGHA 3GEHA 1XJQA 4IH9A 4OYLA 1C1XB 4IHJB 3TRHA 4MTLA 3VO1A 1EFTA 2VKTA 2Y27A 4L57A 5FOUA 3RYFB 5E95A 3U7EB 1GKKA 2IEYA 4HY3A 2CF6A 1OJ7A 1OLSA 2I4OA 2PL3A 4JI1B 1M2WA 4EMUA 2J9GA 4C88A 5EXSA 4UREA 4P53A 3X0DA 3NUQA 1ND5A 4CKXA 3CUVA 1AUVA 4XFKA 1PQWA 3TQQA 1T3SA 5CB4F 2BZ1A 2BP7B 3WDKA 1I14A 1Z4QA 2QX8A 2B83A 4CMJA 2HDOA 2WTNA 3BEDA 3R41A 2X58A 1B1CA 3C8MA 2H5JA 3ON5A 1YQDA 3PRHA 4PVCA 3EEOA 1MW8X 1WLSA 4FIZA 3FTNA 1MX3A 4DUYB 3FLBA 3MT7A 4OJKA 2DZDA 3LTNC 4DT1B 4FNOA 3C24A 1E3EA 3H11A 3INTA 4UDOA 1R7RA 1K6MA 3RJTA 4N3AA 2HF8A 1GT6A 4H17A 2AN3A 1E5DA 3HDQA 1E0AA 3X1KA 1Y9EA 2FP3A 2PIAA 2YRWA 3IQZA 4I55B 5FR1A 1Z13A 3M4NA 1QVZA 3OT1A 2QG4A 4O1HA 4XUCA 5EJGA 4DCSA 1WZIA 5KYXB 5KQMA 3KLNA 2X8LA 3RABA 2YDYA 3HQ4O 5D3QA 4WKCA 1Q1BA 4AZ0A 1O3YA 1RJGA 1O0BA 2FWRA 5HILA 1YHNA 1I3OA 4KDFA 1J0DA 4M49A 1V41E 2V6MA 2RC6A 1GRVA 3ZS9A 4X20A 1B6TA 4O4JF 4UEWA 4AIRA 1D2NA 2I33A 4AKTA 1W8IA 3FDIA 3QF7A 2A9QA 4RVNA 1CF9A 2ZJ8A 4H6VA 4EA9A 5AW7A 1MC4A 1OILA 1QX4A 2FX2A 1CP3A 5EZYB 2FN8A 1XR3A 4KLNA 4EPVA 4FYKA 1FLNA 2H16A 3KTDA 5JXWA 4ADSG 3HB9A 3K2BA 3TSWA 5FTNA 3ZYZA 1F0KA 1ODJA 5E8RA 3E81A 4LZZA 2ONKA 4FFNA 3VR5D 4C5AA 4KXVA 4GKKB 3B6JA 4C0WA 3G8BA 3L1UA 1WVGA 1XWWA 2HDWA 3W5SA 4HVTA 4ZVSA 4OQDA 3BA6A 5I51A 3V8EA 5E7MA 2XA2A 4N6OA 4IEFB 2OCLA 4EGCB 1G5IA 2P4QA 5BN4B 3UICA 4EPXA 1XVAA 1V8OA 1OZFA 1QRAA 2CMGA 3CUKA 3OAAA 5KZMB 2HK7A 3ODPA 5F7XA 2VJYA 4E12A 3PGA1 1IBMB 2XQJA 4DQKA 2RGWA 1QGZA 1NUSA 2JJ1A 3CKYA 4OV6B 1L4GA 2NVUA 1ECJA 4BU0A 4LJ7A 2NP7A 3WNCA 3OBBA 4IQFA 1XMVA 4KR9A 4IV0A 5A4IS 1AJEA 4CLRB 1ZKDA 3NPMA 1VHWA 5DOZA 3E5HA 2FQWA 2LBPA 1D5WA 4XX1A 2TYSB 3IELA 3PFFA 4FHFA 4IFEA 1PQPA 1NF2A 3BHJA 4OQLA 3CYFA 3ZS8A 3U16A 3NM4A 3THWA 2IEIA 4CV0A 1FJGB 2MSEB 5JJCA 3BJRA 3NT5A 3OQIA 1GGEA 2W6JD 2CSUA 3Q0IA 4NL4H 4S05A 4PO1A 3L02A 4LF8B 3NDBB 5BQOA 3ZHXA 4WKBA 1TQ8A 2QSZA 1AKQA 4OP1A 4WGFA 3RYFA 1UDWA 3LYLA 5CLLA 2XRFA 3VDXA 2J9YB 4XJTA 3IAM1 3DLIA 4D4MA 1M33A 4AKSA 5JV5A 1ZAKA 2AZMA 3COZA 1X7YA 3ET5A 3O2QB 4XD7D 1CJKC 2FFBA 4J0DA 4CMBA 3PCXA 2A0WA 5H16A 1FDIA 2I65A 1WUTA 3OG9A 1WJGA 4P4UA 3UKJA 5TMDA 1EI9A 1CFJA 1XZGA 4HAVA 4U7DA 5AW8A 1Z22A 3KOMA 1JEEA 1XGKA 1UXHA 4JQCA 4ARUA 1X1RA 3IBYA 1K0UA 4JL5A 2UZAA 4QXOA 4LBWA 3ILSA 1EWKA 2XWJI 2I7CA 3ANLA 3HI4A 3COYA 4POOA 2Q0HA 5J43A 3SNKA 2VP5A 2GXQA 1V16A 1RT9A 1J24A 1U1IA 3A4TA 2BDUA 4C6HA 3Q3EA 3W34A 5BPHA 4BNWA 1J0AA 1RAAA 5BV2P 1ZN8A 4G3XA 4WK4B 1ORIA 2J07A 2VDUE 5B30A 1DBPA 3MUEA 4JGIA 2C2WA 3FF4A 4M98A 4ZOQI 2GMWA 3ZDCA 2IDJA 2X0JA 1RI3A 4MWTA 4PZAA 1NUPA 4KMRA 2FR8A 1O6ZA 1IB0A 2D1SA 3BZBA 3D8BA 4YRFA 4NFSA 1B23P 2CLLB 3KKQA 3L0IB 3QBDA 4J7XA 4LY3A 5FL7D 2ZSAA 5LMNB 2VSXA 3IJRA 1OGIA 2I8AA 3JQAD 3V2UA 1SZDA 3SGLA 5JISA 3WK9A 3OO1A 4J49A 3IGFA 2XMPA 4X94A 4ND8B 3CZCA 4RVCA 4NSNA 1EWYA 5DP2A 2NYVA 2HIGA 4QQRA 3N07A 2GKSA 1QE0A 4GOND 4BTVA 1V1JA 1EM8A 4F3CA 4L0QA 5JCJD 3DZBA 3JQGA 5K3EA 2VHXA 3C3JA 3IOEA 5FJIA 4D9MA 2DGDA 1EK6A 1F9EA 3QBEA 1FTNA 4HTFA 1XAGA 2P67A 1ZGAA 3DOCA 2Q1YA 3GP3A 4FQ7A 4GQBA 1X42A 3PITA 5P21A 4DQDA 3SY8A 4AWXA 4AJ1A 4TWZA 1KSJA 2WAXA 3DTTA 4GQAA 5EJ2A 1OH8A 1OIXA 1EXWA 1TMOA 1XJWA 1H8ED 3DJYA 2IHTA 4YHBA 1XMIA 3C3EA 5DI3A 4C7OA 1QFZA 4XEHA 4HEHA 3GGOA 4C0JA 1ZCZA 2XV1A 3M7IA 1PJ3A 4C0XA 2AG6A 5L7YA 4ENTA 3KE9A 4I9UA 1UPTA 2Q4TA 2FZGA 4QYXA 3S2IA 4AMYA 1SXJD 1X7ZA 4ZVKA 2WKPA 3OVMA 4V3CA 1I4LD 4XPIA 3WMGA 2XMRA 3FB4A 1NOJA 1ZWKA 2Z6AA 4GSLA 1W0KD 3DW1X 3ZWYA 4PO9A 4BNLA 1BD4A 1WTAA 4Q7JB 4ZOCA 4FCVA 2WIJA 1DCKA 2H2GA 1UMDB 1K92A 2XODA 3IQWA 4URYR 4Y6OA 4CBVA 3QELA 3KV1A 1H2AS 3NXKA 3VPXA 4MV7A 2R1ZA 1F4VA 1E5LA 3TTSA 2P7IA 4L08A 5KIAA 3PSHA 1WW3A 3OZIA 4J1QA 4LDZA 4R40A 1LLUA 4J03A 3RLFA 3R5SA 4C01A 3THYA 3I5YA 1LRKA 3IOBA 3ZOZA 1T9ZA 4RD6A 4JXXA 1L2TA 2AUMA 5ECGC 3HVUA 4MW0A 3JX9A 2IYXA 1N5OX 1A1VA 4OI2A 4ZTBA 3R9IA 1OWMA 1MH9A 1YI8A 3KJNA 4WXYB 3D54D 2WHPA 1P5HA 1TDJA 5JMOA 4ND7A 5J2UA 1YTUA 1VXRA 2XZPA 1FYEA 3ETCA 4KGXA 3ETJA 4G37A 2PTGA 2E49A 1UKYA 3LQ2A 1YHYA 2VXCA 5EINA 1XF1A 2GCPA 2XUKA 3R9KA 4FX2A 4KUEA 2EATA 8ATCA 1FDOA 3TQFA 2O6LA 4HN2A 3PC2A 4NAUA 2GSWA 4Q4CA 4XDGA 2YC4C 2BE7A 4X6YA 5BWOA 1CRQA 4QT0A 3TMYA 2BAGA 1NSYA 1R5NA 1C9NA 1XOIA 421PA 3IQDB 1G8AA 5C2JB 3C4VA 3EWAA 2FCAA 2Q5JA 4FOLA 4U7PB 3AF0A 2NTYC 3EZ2A 4JLKA 5TC4A 3IV6A 3Q88A 4GM0A 1SB9A 3PK0A 3IEVA 2O8FA 4L5AA 3SIPA 4BFWA 1DAGA 4O08A 2OG2A 1MXFA 2CFCA 1GPUA 3AVOA 3B53X 2YXEA 1S2LA 3ESZA 1YRHA 3HFRA 2I87A 1U2PA 3GC6A 3HWX1 3SLRA 1RAEA 3ZHTA 5L8VA 1TEXA 2I4NA 3X1DA 1K9SA 1BQEA 2IVZA 3GEMA 3DFKA 1CYDA 3JQAB 3NM6B 5C5CA 1NOKA 3GVPA 3DEAA 3DS8A 3VH4A 5ES3A 3GFSA 1EVYA 2REQA 1L7BA 3UMGA 4FXPA 4C03A 3H2JA 1P73A 2YYAA 3SYKA 1A9PA 2IXEA 1QHHB 1WZCA 2XGGA 3CURA 3QVVA 4Q7EA 4BFXA 2Q0SA 3O90A 2V3CC 3QU9A 3GPBA 5CW2A 4CKYA 1V5FA 3L7MA 3TUJC 4HEJA 3WL4A 4OQQA 3PR1A 1QZZA 1SU6A 3O6VA 1ZI9A 2D2VA 5JVDA 2G8LA 3KZXA 4ND6A 4XLTA 2HRRA 1TZMA 2ZJ0A 2K6GA 1XZMA 2VP4A 5FFFA 2HQ1A 4NJOA 2J8ZA 2Q2OA 5AKKA 3U1VA 2P9CA 4N54A 4YAWA 1VRCA 1N4DA 5JATA 1SKYE 3L4EA 1JA1A 5BVGB 3DVQX 2XVAA 2OESA 3ECCA 3I12A 5CNJA 3RRFA 3G5TA 3V7YA 4NF2A 5EP3A 1Y3HA 3KQQA 5LZ2A 1ZMRA 2XB8A 4AKIA 5AKIA 3HWWA 3V8RA 1OYYA 3L84A 3OA2A 3WG9A 3ZWXA 4UPVA 1MDFA 4ARAA 2WIFA 1SXJB 3RBXA 3TLGA 2YWGA 4H2DA 5ALMA 2PZEA 2QZ4A 4KQXA 4QTTB 2IEAA 4RPCA 4D9KA 5HGJA 1EFRD 1K1EA 1NF8A 1GZSA 3BXPA 3FYUB 2GJ9A 4ENSA 5F9FA 2J0UA 3OCJA 3G7UA 3TZ6A 4Z1OA 4KFUA 3F8SA 3I6MA 1E4EA 5I9IA 1GAJA 2GPYA 3OHMA 4O63O 1YIDA 4X1IA 5A6SB 1TQ6A 2B1QA 3OZAA 4G5SA 4KH0A 4E2WA 1L7PA 2DY1A 3A6HA 3DKPA 1MH1A 1Z3CA 3JWJA 4PXSA 2WT8A 3ZE9A 3CW9A 3GNLA 2Q7DA 3OZRA 3EVZA 5TEWA 1GQYA 2OHXA 2FW7A 3PBKA 2W2LD 1KOFA 1O94A 1IYZA 2AOUB 3QE2A 2VJAA 1Z6YA 4WV3A 3TTWA 1W34A 2FFQA 2VXOA 2WDPA 4IDPA 1CU1A 2PCJA 2FQ1A 3BREA 4II7A 5DHFA 4HLNA 2YWEA 3VO2A 4E30A 4GP7A 1FU8A 4BE7B 4CWAA 1TYZA 3AUXA 1TJ4A 3GXBA 4TXNA 4ZO8A 1FP2A 3W5BA 1T0IA 4QJ3A 3T4PA 1JX6A 3UQYS 1Q21A 4YP0A 4Y0AA 4ZANA 3TIGA 5HRUA 1EX7A 2X5XA 3U7HB 1WUHS 4Q7QA 1S4QA 2A0XA 4G01B 3IR7A 3VR4H 3G89A 1O9HA 2H4ZA 4IQ0A 1P60A 3U3DA 1T9KA 5JSHA 1OE0A 3OMLA 5ALIA 1AQNA 2D8MA 1OAOA 2L42A 2Q2VA 5E4YA 2Q49A 2E2WA 2AJTA 1L4EA 1XD2A 2FQXA 4PAWA 3G2MA 4QWWA 3DLBA 4AU1A 1WMEA 4LCJA 2ZRIA 2WU8A 1SVNA 4PW0A 1QC5B 1N2SA 2WQ6A 2RBGA 3EPPA 4OIMA 1O8CA 4RD4A 2CYAA 2RB4A 3TQIA 4OO3A 5ICFA 2YY5A 3R6TA 4U5XA 2YVLA 3HO6A 3I83A 4FFMA 3UMVA 1R0ZA 3L0OA 4YCMA 1CIJA 4MWBA 5I7UA 2FPGA 4QGBA 2EHJA 2NT4A 1GRQA 3U48A 2G06A 1C4XA 2IUTA 3HUTA 5AIBA 3PHLA 3F7NA 1R0LA 3DE4X 1HQYE 2C98A 4KZPA 5K0NA 5DWDA 1JAHA 1RACA 1IM2A 4WXHA 1PZEA 2B1RA 1P4SA 4M76B 5TXGA 2GZ1A 4P0TA 3LHKA 2A1IA 2N9UA 3UAZA 4MKZA 4OB8A 1GQFA 4AZTA 1SU7A 1KMIY 3KU4A 3PWKA 4H1HA 4IRUB 2XD4A 4GR4A 2X42A 5JAMA 3EX7C 4X8HA 5TQ0B 2BTQB 1M5TA 3BXHA 4D42A 2UDPA 4BO1A 2HA5A 2QTGA 3CZQA 3F49S 3OLXA 5DT2A 1U90A 5A9TA 2QTMA 4I0WB 4M99A 6PFKA 3TG2A 1I32A 1KK0A 3M49A 3FHCB 3V2HA 3R24A 2DPMA 4ID3A 4KGZA 1A96A 1HK7A 1TU0A 3AUFA 5JSQA 4QUKA 4KIWA 4PQEA 3U4QB 1YWGO 2O2XA 1E7WA 4MUHA 2VPYA 3NU1A 3QOYA 4PZ9A 4MMYB 4RLSA 3COPA 1ETUA 3Q9LA 2YYZA 1GTSA 3NBYC 2C2BA 2PKXA 3CX6A 3DZHA 3G59A 1PJTA 3LXRA 1XLUA 3OKFA 1NXPA 3K72B 4JP1A 4X44A 5KVSA 2VT6A 1C1DB 4M36A 2ZSUA 4KLCA 1A5TA 4UTZA 5E7QA 1CVIA 2CVFA 2Y0EA 1Z6GA 5I9MA 4B0PA 3DDHA 4OK5A 2J41A 4ECEA 4O2AA 5I45A 1R4MA 2IZ1A 5LA6A 1NW6A 1QG2A 2IZ7A 2HXSA 1XA3A 2LR0A 3DV0B 1CXZA 2B4RO 4G65A 1VZ2A 4BKPA 1B7GO 3BXEA 1Z0KA 3QEJA 1T8TA 4X1KA 1OBCA 4IILA 3ZDYB 3AHCA 1AUOA 1QMPA 5AW0A 3NIGB 7AT1A 1P5FA 3LVFO 4NCXA 2VYQA 3HTXA 4R98A 3ZHCA 4EJFA 3O2JA 1WBDA 1B8OA 3E4DA 5EMLA 4B79A 2PLAA 3FUCA 3U80A 4RV4A 2ZVJA 1OKKD 4IDHA 3P7MA 2V3WA 4Q05A 5BP7A 2HJHA 1KTIA 2WM3A 3NAQA 4LE0A 3W2HA 5ICCA 4KQFA 5DYYA 5B37A 1QVRA 1X8LA 5CLJA 4LC9A 2XEDA 2R47A 2IHVA 1QYXA 2XY4A 4TV9B 3FWPA 1E3IA 4FFBB 3EBLA 4XWAA 1T0HB 4QPDA 3AEYA 4G8BA 4LK3A 5LFAA 1I2MA 2YW9A 4URXR 4RNDB 4WACA 5LN1A 2OT3B 5IC6A 1K8QA 1ODIA 2I7VA 4FD3A 4FSHA 1XP5A 1RLOA 1SBHA 1UPAA 1KDOA 4L4RA 1ZVQA 4P81A 2W2OA 3ZOKA 3MGBA 2CFSA 3P2KA 2HWYA 5AUQA 3HFGA 2C2KA 4FZVA 4X65B 4HNTA 5JHHB 3H5NA 2C7PA 1UKVY 2VA8A 3QENA 4PZDA 4CL2A 2XGMA 2A5GA 1G5QA 1D3AA 3RW9A 4AKHA 3K70C 3R0ZA 2BY4A 2EFDB 1RZRD 3K3PA 3ENZA 4IGAA 2XJ4A 4MW7A 4OYRA 3UJDA 4DCMA 2ZLBA 5HZMA 4KNYA 5DSZA 1QRDA 5JBIA 3DVAA 1XA0A 3HFJA 2G9RA 2LZ0A 4Q82A 1FFAA 3F4LA 3RC1A 3UHJA 3IERA 3RH0A 4YV1A 3IEMA 1UMKA 2CWWA 2HI0A 3RVJA 2AF3C 5JC8A 3HWRA 5JDIA 1KHTA 4ITUA 4MUJA 4DXAA 5FI5A 4N82A 4AQYB 1RU3A 4RZIA 1YD7A 3CEHA 2DMRA 1XBTA 4P35A 4D3ZA 1G18A 1U0EA 5CYGA 1YBFA 1XNHA 1ESMA 1KI1A 2HNAA 1ZK2A 5COAA 1Z36A 2I4TA 4EGFA 4IO1A 2ZJBA 5JYEA 3O8RA 4TZKA 2RAUA 4BNNA 1BE8A 1V1MA 2WTAA 4BFSA 1ZSVA 1PWYE 5K2MA 2II6A 5DN6A 1SEVA 5DHPA 5I4IA 2P9BA 2P2YA 2CY0A 3L8ZA 1OBOA 2OWDA 4MEJA 4RFLA 4NR0A 5JDIC 1BX0A 1RC1A 4GYKA 5JWRA 5LZ4A 4TXHA 1N7HA 4W4TA 5I9SA 3INNA 3VYTB 1DBWA 4BRZA 5B57C 5MFPA 5J1SB 4C7VA 3L43A 4MR8B 4R2HA 2PXCA 3VHRA 2B1JA 1GFWA 3C3DA 2V9ZA 4CFYA 1BMTA 3HBAA 5G0UA 2W4MA 2JD1A 3AT1A 3UATA 4L4YA 2QD5A 3GCXA 3EAGA 3JZDA 4KWHA 4NCBA 1YJXA 3VJKA 3F90A 5FUWA 2ID4A 1IRIA 1M0TA 2TECE 5YASA 4DLUA 1HT3A 5CM8B 1P77A 1TF2A 3K9QO 5BNFA 1KYVA 3D0QA 2QP4A 3DE3X 1UBLS 3W5JA 2GEBA 4LFBB 2VSQA 1F06A 1QHYA 2OC9A 3OE1A 3MJ4A 4JUFA 4US0R 4Z9AA 2BTEA 5J3JA 3VR0A 5FUVA 3L82B 1FXWA 5ALZA 1RAIA 1UZAA 1Y81A 2FEWB 4EVQA 3VR3D 4KBFA 4BO9A 4BVKA 4JOBA 1J9GA 2C8KA 3MM4A 1U0FA 4JC5A 2ZSEA 4JP5A 4MS1B 3RF7A 1C0IA 1NWHA 4G0WA 3DBRB 1U8XX 2VP9A 4ECAA 2PJZA 3DP7A 5J2TA 1N3IA 2W37A 3ZNQA 2V7PA 1GFSA 4N5HX 3DD5A 4XX0A 5GAJA 2AFHB 2ZUBA 4DMGA 2VRCD 1BKDR 2PGOA 1G4UR 3K1ZA 3IAXA 3HGQA 5EZQA 1YMVA 5KJ1A 3K9HA 2WUFA 1YVEI 2X0IA 2M6SA 1H5QA 2HUNA 4TVBA 2I2WA 4JXJA 5TT0A 1YZFA 1O6CA 2C1ZA 3E5RA 3FZYA 4I3HA 5EJEA 1LX6A 3DH0A 5IX8A 4Q4LA 4YRMA 5LU8A 1WDKA 3NBAA 1Z5NA 2EX1A 1HE2A 4TSFA 1P2SA 1FOEB 3PEYA 3NXSA 3VO8A 5BV8A 3UQZA 2CVOA 1P9RA 2XMCA 4D26A 1URPA 5ECWA 2PL9A 1TIPA 2QN3A 3M6IA 3AUKA 1E2KA 4ZO9A 3AHJA 3K0EA 2JHFA 2Z9BA 2FZCA 5KWIA 3DM9B 2P11A 3OFND 4YJ3A 2WD7A 3HNRA 4Q4HA 3QEBZ 3F78A 5E9JA 3A1FA 4PM4A 2O8BA 5I7HA 3OO0A 1DAEA 2AXQA 4B3IA 1XRNA 3TI9A 4KZKA 1PJAA 1MVOA 5CLGA 1F3OA 2X8BA 3ES9A 4MWOA 4CUKA 2XLCA 3NHRA 4F8YA 3VH1A 4JI0B 1I4WA 4AY6A 4WA7A 1XTSA 3FCOA 4NDNE 1RFLA 3LH5A 3FI0A 4HLCA 4AW9A 4DQ0A 6REQA 4C22A 5B3JA 3P97A 1WZUA 4ZEOA 3SQLA 3DHVA 1R6XA 4PAQA 4TKMA 1O0CA 4GQIA 4N0EA 2DR0A 2AZTA 3AUAA 1Z2OX 1ZK1A 3WIDA 4BECA 2GTIA 5JXJA 1RJDA 4A92A 1DXOA 4ZRMA 3O3MB 3TQSA 4XCQA 4FGSA 4XXHA 2OC4A 2BFFB 2VDNB 2Z8YA 2JGEA 4LIPD 4GLLA 5JNWA 4DV5B 3KOOA 1DJQA 1WLYA 2Q5FA 3R6DA 5D87A 2L69A 1OLUB 3FNIA 4OCZA 3ZIAA 1ZKMA 4EVRA 5LOVF 3KZVA 4UHDA 3E35A 2BISA 3OZWA 3WLHA 4DS3A 2NYAA 1ZNZA 3PC7A 3L7JA 3MF4A 3EZ9A 5B3JC 3H9CA 3D7LA 3MB8A 3QITA 3N3AC 1II8A 2BBOA 3A4LA 3FMVA 2AG5A 3N2KA 4K9NA 4HH0A 1I1QB 1PJ2A 3NDJA 4JU9A 3TTYA 1CK4A 1LY1A 2ARKA 3X43A 5K3CA 3HSSA 1JZQA 1NW8A 1C81A 1P6QA 1V9SA 1BU8A 2R6HA 4OP3A 1FVHA 2BFBB 5DHSA 1QAMA 3CB2A 4UD6A 2HJGA 3KE8A 4R3WA 5DXAA 4U7FA 5TPZA 2PX8A 4A27A 4KO4S 3SHVA 2JIQA 2PVSA 3PXUA 2PUFA 1B0ZA 4R1UA 2GNPA 2HD4A 2QT0A 2VJMA 2QL6A 4LSMA 1YBMA 4O2BA 3Q9SA 4R8MA 2HNKA 5D2CA 1MV8A 1SD5A 1X1BA 3ABRB 3VSCA 4A6EA 3OTOB 1DC5A 3G68A 5KYTA 3RAGA 1QRRA 1TTPB 2B21A 4EJ0A 4F8JA 3CGWA 4YT5A 3VU1A 2QLNA 4JP2A 3FHJA 4QC2A 2QENA 3EVEA 5DZSA 1QG4A 4MYSA 3LZDA 3NBUA 1C9EA 3C97A 1VPVA 4PWYA 4LS3A 4MUMA 4WKNA 3QLEA 3BWBA 4F4JA 3B48A 1V4BA 1CERA 1D4FA 4Q01A 4XIIA 4PONA 4RVHA 4G9GA 3LNTA 4RHXA 4HNGA 2SNIE 1V96A 3U5ZB 4H4DA 1V26A 3L1KA 5CVEA 1JFFB 2BHRA 2IEGA 3LT4A 1KL7A 4B48A 2IOYA 4L4UA 4DA9A 1TAQA 3ZVKA 3AOGA 3H99A 3KKNA 1TKAA 4O25A 3Q40A 4Q1AA 3K0AB 1ZG3A 2AOTA 3PGJA 1BDMA 4P93A 3TNFA 3LP5A 2CK3D 5ALYA 2KLBA 4DY6A 2QVYX 4KXQA 2FB9A 1AB5A 2AV6A 3EGVA 3EEQA 2QJTA 4D9IA 4V2IA 3WRYA 3THXB 2CLIB 4WXEA 3FA2A 4XYMA 3DFMA 2IKQA 3WL7A 3H65A 2WSMA 3STHA 1V9CA 3GLRA 2PWPA 1BN7A 2R00A 1VB5A 4JLVA 4BKOA 1TEZA 1J0BA 4PPFA 2OM6A 3MMPA 4E5VA 4K46A 3WQQA 2DERA 3HCFA 4TS3A 1E1KA 2BWJA 1EFAA 2OXTA 4KV7A 1XIVA 5ALKA 3TOSA 4GKJB 4JOQA 3NP9A 4C21A 3FHLA 2RGBA 1RDFA 1YBVA 1VIYA 2BJHA 1C7JA 3CF0A 4OU4A 3DAYA 3V4VB 1MJ5A 4NXMB 1D1TA 2RSLA 1BDJA 4COKA 1OGJA 1IK4A 1N2CB 3GLHA 4WXMA 2XR1A 1E6WA 4G1EB 1VB3A 3WRYC 4EPTA 4OMUA 4ZQHA 2OSBA 4C04A 3JYNA 4D8VA 4ARCA 4M0MA 4A82A 4PQRA 5EHQA 2R00C 1O1YA 1SIWA 4UHJA 4F84A 4FP9A 3Q3CA 5DLEA 2RGCA 3QXCA 1PW5A 1U7PA 2CW5A 3BCUA 4YI3A 1RS0A 4L6CA 3O92A 4EUSA 1EXDA 1SVSA 3CSUA 3DKIA 3GXOA 4PO8A 3DE2X 4ME6A 4G5YA 4D25A 1ZMBA 1BJTA 3M89A 2IS1A 3HZHA 3RE1A 2L18A 3GFGA 1KPIA 3SKXA 4DADA 2QNIA 3ESQA 3AEKB 3UAGA 2O4UX 4MQLA 2PBFA 2V4ZA 1ACMA 1KDYA 4LN1A 5EJFA 4ETNA 2O1WA 1QHXA 4IGIA 2Q9UA 5F1PA 3BC1A 3HUFA 1BVUA 1Z9BA 3N0TA 2X4IA 4D9EA 4LJ6A 2YICA 3K0HA 3GELA 5ITZB 1LNQA 3FUWA 3AERB 1KAOA 2B92A 2F3QA 1I1NA 2BLLA 2OZKA 3HCPA 1P5ZB 4G5HA 4I5IA 4W8OA 3TD6A 1FUUA 2X5KO 3W5AA 4L9AA 4Q1CA 1V3TA 2ZIVB 1E8DA 3CLVA 5CK5A 4J16A 5EIBC 4CQLB 1XDZA 3BGIA 4RKYA 3CLTD 3CINA 1YR9A 3KFXA 5JTTA 3PLAE 1KFJB 2BF7A 3MN1A 4PGGA 1EVJA 2A1UB 4FGWA 4N7RA 1W2GA 2RCNA 3L0YA 1ZOPA 4HH3C 2PKRA 5AYVA 2GPNA 3R09A 2NXCA 2VP6A 4ARSA 5GINE 3A9CA 3ZQUA 3GLHE 2XF8A 5KPJA 3GRCA 3QKSA 4I50B 1CUXA 4HDMA 3WWPA 5KYVA 4FW8A 3KKPA 3L0SA 3A10A 2D1YA 2IY7A 1F8XA 1IBCA 3RSSA 8LDHA 2PBZA 4I08A 5BXQC 3BF7A 5CX1B 2G8NA 4BP8A 4CCSA 4XB1A 2P5UA 3PQ5A 3P0RA 4UTRA 1I9CA 1LBEA 2P3SA 3L79A 3NHBA 1E66A 4R8LA 3FDZA 5E3HA 3B1WA 3CX7A 2V58A 1THTA 3PZRA 5BVHA 1P6XA 1GFZA 2O8EB 6LDHA 2AK2A 2FLKA 2M1XA 4YASA 1DG9A 5KVVA 1WD7A 2G4LA 1YXMA 5IAGA 2FDRA 2JAPA 5B58C 2IHBA 3C1TA 2Q99A 4FBLA 3GJXC 3WJ1A 1LNSA 1O95A 4GM1A 3K53A 4EBBA 2FZLA 1EFVA 1KBQA 2WYWA 3KB6A 3ITDA 3ITNA 2I2CA 2PZMA 2HQBA 1NULA 3TZCA 1O97C 1MN6A 2AT1A 2R25B 5BSRA 3K0SA 3E9NA 2CNNA 3W8DA 2MMGA 1AS3A 2AC4A 2EOAA 2GN1A 4H3SA 4I9FA 4Q6BA 4Y7CA 5AK6A 1FVFA 2H2FA 1SKBA 3GN2A 1XCJA 2FG5A 3S7TA 3X1WA 5HRCA 2EDCA 1IUPA 1UPBA 4AICA 2VLIA 4WZBB 4HDCA 1AKYA 1Z17A 3ZLTA 4B3TB 1IK6A 1HLDA 1NN0A 3C1AA 4GBGA 5TS3A 2EEPA 1FP7A 1Q15A 4L16A 3GNTA 4RVOA 1EG7A 1NVVQ 3F9IA 3F6CA 2ACWA 3OEHD 4DIKA 2DY0A 4OHYA 1LRJA 3FOFC 2ZPAA 3CR3C 3ZJ5A 2PU7A 3PZBA 4ERXA 4J0KA 3V8MA 3PD1A 4UE6A 2ZBPA 1M0WA 5FUXA 4MRNA 2OQ2A 4TN5A 1AQJA 1SCBA 3S4YA 1H2ZA 3OTHA 2NNWB 4E14A 1K9VF 2LW7A 3O3NB 2CDNA 2FQYA 2QV0A 3IHLA 4FFWA 3NALA 1OD6A 4ND1A 4RVUA 4AJPA 4EJ6A 4TMZA 1DC7A 4KAJA 3RRMA 1ELOA 5KCMA 3LUBA 5LP6A 1YRLA 1SPBS 4O4IB 3D3JA 4RFSB 3R20A 4PS1A 2WRZA 3ZCVA 3RVPA 1D7AA 1HEUA 3DLAA 1A4RA 4PU0A 4KTVE 3T1HB 2WG1A 4EG4A 3G0BA 1PZXA 1YS9A 3R3VA 1C8LA 2X8WA 1T5SA 3SZUA 2OENG 4LYAA 4ARVA 3F6BX 5FWNA 3KEGA 5LMUB 3NOOA 1KEKA 1OLXB 4K9DA 3CKMA 3UWPA 1PL7A 4R8KA 3DEIA 1WPRA 3PEFA 4HYQA 3DL7A 2HU2A 3B51X 3OU6A 3FHTA 3IS3A 4YO8A 2IXGA 4DYVA 1W0JD 4FWBA 5KYUB 3IT1A 1UDAA 3U17A 3ZDXB 1VG1A 2OXEA 3HCWA 3C3XA 4LF9B 2XUZA 3WE7A 4PFJA 3JV7A 3T9CA 1ZXBA 4JYBA 1HKUA 4L02A 2ODQA 1RYNA 4J0QA 2ZYWX 5A2GA 3M4YA 1Q95A 1JLMA 1OXMA 1DAMA 1JU4A 1OYOA 1VE3A 2JFXA 3WLSA 4PYMA 4PAMA 4D0SA 4FN4A 1RXVA 3OJ0A 1DC3A 2XMBA 1CUFA 3AVQA 1V3QE 3N2YA 4F1WA 4O4LF 1DADA 1D2CA 3MXOA 5EC8A 2PX4A 5H9VA 4AP9A 5I8PA 4GVPA 2PUCA 4NZOA 5LJIA 4YRQA 1YL6A 4M54A 1JPUA 2AQ8A 1RHKA 2DUNA 5EJIA 3DGEC 3H1TA 3JQ8A 3TDMA 3C45A 3SEFA 4QDOA 1VL2A 3E48A 5M7EA 1DMRA 4TLCA 3U60B 2JNWA 4CDGA 4TUYB 2MSKA 3RR2A 1W85B 2OCKA 1K8ZB 4L0MA 4OJTA 4KQ2A 1OA1A 5DF1A 3BD7A 3ELWA 5JAZA 4FCTA 4G0MA 3SJAA 3K9CA 2VDPB 4QRDA 2CZGA 1PR4A 3DPIA 2CNBA 1R0SA 3QNUA 1PLJA 1LSUA 3K4QA 1VI2A 4U00A 1KEUA 3K0FA 1K86A 5B2EA 3ELYA 2EBWA 3WKEA 1GPH1 4FMDF 3GVXA 1ZJZA 1BGWA 1GZ6A 4Z54A 4Q18A 2ZBRA 3UMYA 5DLDA 3KSBC 1B8PA 3JQ7A 3I39X 2ACVA 2V97A 1RRVA 5KJ6A 2ZU0C 3LQQA 3GFVA 2WVGA 3KZ1E 4WVFA 3SVTA 3CR7A 4XRGA 4ZRDA 1IHUA 1IAVA 3F6PA 1DLIA 3MGCA 4OIFA 5BNZA 3GCGA 5I7SA 3GLIA 1N2HA 3P9SA 1A9QA 2D59A 2J33A 2PAAA 4KFTA 3TX2A 4GYWA 4CM4A 2JL1A 2W90A 4Z6KA 4ZYWA 4ASUA 1JFSA 4M46A 1LDYA 2J48A 1KZHA 3HB0A 1IATA 3TIVA 5FTWA 4UUAA 1G6KA 1W5FA 2RG1A 3L7AA 1IWOA 4LZOA 5FPYA 1LW6E 3PQ2A 1FMLA 1H2RS 1NFRA 3GLTA 4OGFA 1GU7A 4Z0HO 1XZDA 1UCFA 1EFUA 4UE3S 3DO8A 3TOXA 3T1OA 4ACBA 3AHHA 2IW3A 2O2EA 1HG1A 2FUNB 2QBYA 4B4DA 3O84A 2OFOA 3I42A 4BB0A 4HWKA 1KK2A 1PR1A 2IRWA 1DRJA 5C31A 3RG2A 3O8QB 4TXMA 3D4IA 4GW3A 2NU9B 3IOYA 4LMPA 3O3CA 2FR0A 2C29D 1ULBA 4J75A 5AW2A 3NPAA 4HB3A 2Y0CA 4IP0A 4REQA 1OIWA 1T5HX 4FZRA 4QBTA 5HE9A 2Q6VA 5DEOA 5E0KB 1N2OA 4Y2RA 4QBHA 5FBKA 1I7QB 3T5AA 4JV5B 3LCRA 3RJ5A 5LD2C 2PUBA 1OT5A 3OX2A 3PUHA 4RENA 4WDQA 1T9HA 3R9XA 1T24A 3AYZB 3FVRA 1N1EA 3L7LA 4ZMSA 3MCTA 4U1RA 4ZVLA 3LK7A 2F1JA 3EPLA 2DYKA 1CNFA 2ZJ2A 2M6KA 1V7CA 1W4BA 1XTTA 3N7TA 2PVPA 2QPTA 2EU8A 2VPQA 3GLIE 1D4ZA 4JENA 2QPAA 4M1MA 2I6FA 4EFMA 1MKYA 1SR8A 3LP6A 2MT9A 1DZ3A 2WWRA 5GJCA 4J4BA 3FCCA 1TQ2A 4B4OA 1F2UB 1ECFA 1XJ5A 4X1YB 4EARA 3HS3A 3KV3O 4YP1A 1FVXA 2GVZC 1KAHA 1JLRA 1XCBA 1NV9A 1GGMA 4HL6A 3L1HA 2WTMA 4PZYA 5IM4A 4HN9A 3ETLA 3RREA 4KYUA 4HUTA 4FWTA 3HKCB 3N0VA 1BXRA 4GXTA 1PSZA 1USKA 2QSYA 3VBCA 3I9NA 4O5OA 1MC1A 3I4CA 4KN8A 4WLNA 1WM1A 3SYTA 2GAJA 1KSHA 1N2IA 5IT5A 2IH5A 4ENVA 1EWVA 1PJBA 3OJOA 2A0KA 1XU4A 4E11A 3A1DA 5FHRA 1WXHA 1NI5A 3DFFA 3TAUA 3WAJA 4DB4A 3C3WA 2V5UA 1MVNA 4DV3B 1MHPA 4S2EA 1D2EA 3NNNA 2VSYA 2QL9A 3GUVA 4GXQA 1CB0A 2WJIA 2H9AA 5CB4B 3QOFA 4EQZA 2KYRA 3LLCA 4BKUA 4UTPA 1WR8A 5A5FA 2O20A 3H9UA 1NFFA 3CCBA 4X3CA 3R8CA 3E27A 3VMMA 3ZV6A 2JLYA 2ZBGA 3SR0A 3EIUA 4J29A 5B4UA 4CEHA 1Y6JA 3N8HA 1KYIA 4KFRA 2EFYA 4AP5A 4MQFA 2WFAA 2HCRA