5IRCD

P190a gap domain complex with rhoa
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
178
structure length
170
Chain Sequence
b'IRKKLVIVGDGACGKTLLIVNVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho GTPase-activating protein 35
publication title Deciphering the Molecular and Functional Basis of RHOGAP Family Proteins: A SYSTEMATIC APPROACH TOWARD SELECTIVE INACTIVATION OF RHO FAMILY PROTEINS.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 55
structure length 170
sequence length 178
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ircD00
3DO6A 2J46A 4N0EA 3SHWA 2ZI9A 3PEVA 2BKEA 4MA4A 3KXIA 4IVRA 1G20E 5C4MA 3O8DA 1JAIA 3RAPR 3E5HA 3NC0C 3S1AB 4YMUA 1HQYE 4GFDA 2GF9A 3DEFA 1XJ0A 1JALA 4KHZA 4BECA 4XIGS 4LYHA 2AN9A 1M2OB 1ZM3A 4GSYA 4TSFA 3VKHA 5EQTA 1NIPA 1XWIA 3Q5EA 4HAWA 3LW8A 3U60B 2GJ9A 4URUR 3A1TA 3NEJA 1FNNA 3RC3A 4RY2A 4DIEA 3R8FA 3IKJA 2PBRA 2VYFA 2BJWA 1CRPA 1NVXQ 5TVKA 4B76A 2OILA 1QHIA 3LD9A 1MABB 3CUEF 3REGA 5J5CA 1C4OA 3FGNA 3EPJA 4M1MA 2R6DA 4U00A 4MUAA 3W6PA 4CZ2A 1MH1A 2GXSA 1T4GA 1E9AA 3QNUA 1RJ9A 5BN4A 2EQBA 1KAOA 2PCLA 4BLOA 1OYWA 2VHQA 4LV6A 2KB0A 1TQ6A 4V03A 3SE0A 2ZRJA 2Q9BA 2ZI6A 3RRMA 3NXSA 2ZREA 3QXCA 1WF3A 4PZLA 1VCOA 1Q1ZA 2ANBA 1ODFA 3GCGA 2FWRA 1R5NA 4XD7A 3U2QA 4DXAA 4U7DA 3AVVA 2O8FA 3CO5A 3FHCB 2ZQ5A 3MRSA 4CF7A 4M53A 4NYMR 4XH9B 2REOA 3JZAA 3BB3A 4XTRA 4AYTA 5FPKA 1BKDR 2ATVA 1E94E 3VHLB 4WOPA 2XGJA 4A0RA 3GFOA 3GJ0A 3AKYA 2ZANA 4NCIA 4QFMA 4TLCA 2A3RA 2QQ0A 3A36A 2WSMA 1SVMA 1RW4A 1KY3A 4JLNA 5JECA 1COWD 4DDTA 4QGFA 1LY1A 4GRAA 5FL7A 3UKDA 4EPRA 2PLFA 2WWGA 1GAJA 1RJ9B 3IPYA 4Q03A 4EPWA 3SBDA 4LJ8A 4F38A 2ZI4A 1BH2A 3B78A 1CR2A 3AEZA 3RSLA 2ZE5A 1KDRA 1ZJ6A 2ASEA 4PC1A 3UK6A 4GNKA 3M4YA 2AFIE 2R9VA 1KDOA 3W8RA 1S9HA 2VIIA 1OPXA 1IBRA 4YQFA 3GP8A 3THYA 2O8FB 4LX0A 3K9HA 1TMKA 2H57A 3VX4A 2F1IA 2R6CA 4GI7A 4GT1A 2IWRA 4M8NE 4KODA 1VG1A 4UNPA 1T3SA 2IXFA 1Z0AA 3R7WA 1ZNZA 1ESMA 5D3QA 3RSOA 2G77B 3C8UA 3ZZ0A 1G8FA 4AWXA 3ZS8A 1H8ED 3LV8A 3I5YA 4UNQA 4P4SB 4Q48A 1GNPA 1OH5A 1W1WA 4BLQA 3LLMA 1CULC 2Z5FA 4URYR 1PUIA 4HUTA 2IYQA 3SFZA 5SZHB 1KAGA 2PMDA 3M0EA 4WXPA 5EE3A 4ACBA 3GLIE 4GZLA 4PSVA 1G64A 3ADKA 4LJYA 3VMFA 2BDTA 5B30A 2FJUA 1UADA 1NLYA 2QTVB 5C1BA 4Q9HA 1S1CA 4Y0AA 3IILA 4JJZA 1XX6A 1N5LA 5CJ2A 1DAEA 1HE1C 2AD5A 3MWKA 1KY2A 4TTQA 4Q9KA 4Q02A 1D2MA 4D4MA 3RRYA 3WHLA 1E9FA 3EW9A 1FUKA 1HQCA 2WMNB 2GCPA 3I72A 5FR1A 2VO1A 1AGRA 4NL4H 4LBWA 5EXPA 2QPAA 4B3CA 5H8WA 1NNEA 2BCGY 3I5XA 2ZI3A 4JIMA 1PUJA 5EJEA 3DZDA 4NYMQ 1ETUA 4PPQA 4B33A 5J4VA 1OIXA 3SS8A 2D7DA 1EK0A 4OJQA 4YC7A 1HYQA 2QP3A 4LHVA 3AKEA 3QXXA 4QBGB 5AUOB 1NI3A 2W0MA 4K8OA 1US8A 1G7CA 2GHIA 2KSQA 2C8VA 2Q6TA 2WIBA 3FHOA 3R20A 1GL6A 4NKRA 5FTJA 5CDFA 1TUIA 1QBKC 4OQLA 1Z6GA 2OBMA 5CB6A 1E2JA 2RH5A 2OFXA 3BFVA 3FMFA 3KQHA 1HUQA 4Z1MA 1TF7A 3ETLA 3ZLJA 2REXB 1WE2A 4M22A 1OV4A 5G41A 2NQ2C 3ZD7A 2XZLA 3KJIA 4CVNA 3QG5A 3HU3A 2V8OA 1W5SA 1QRAA 3PVSA 4QGAA 2IT1A 2X1VA 1GRNA 2KBFA 4MRPA 2ZRGA 4TMTA 4NCJA 1JQJC 4LHXA 2V54A 2NMVA 2FSIA 2YC2C 1U0LA 3AP2A 2D06A 1AM4D 2G1JA 2N1BA 2ODWA 1OFUX 2BBWA 2XEXA 2XSZD 1J99A 4C0LA 2AD1A 1SXJC 5FBRB 4MRNA 4XTCS 2A5DA 3OIUA 3QKSA 4NTZA 5CK5A 4Q21A 1R0YA 1WBBA 1IY0A 1TQ2A 4D6PA 1VYVA 3LBIA 1W0JD 1ZM7A 2R8RA 2EFCB 1LW7A 2H17A 2I1QA 5FTMA 1M34E 4CT4B 2WJIA 4G0NA 2W6JA 4HZIA 1G7SA 3P32A 4A0HA 4TQUS 1X8LA 1EFUA 3OEEA 4V02A 1ZNYA 1F3OA 5CLLA 1G7TA 5EXXA 1KSGA 2HYIC 3Q8XB 1AN0A 3BXZA 4LCBA 1XMSA 2DR3A 3IIMA 1G3MA 2ZSEA 4MGZR 4W9MC 3HPRA 4KLNA 5HR5A 5JCPA 2WMOB 1ZNXA 3MMPA 3QKSB 4TWZA 3CPHA 3NIBA 4LHWA 5DYIA 1CKEA 2IBMA 1QG2A 2YC4C 1ZD8A 1GL7A 1CJUC 5BYKA 4B3XA 2Q3HA 1E2LA 4TYPA 1OXSC 1XTRA 3Q85A 5FI1B 2GJAA 3WMEA 1FPMA 4YMVA 4URXR 4I1SA 4QNMA 5JJLA 2A9KA 3ZJYA 5F3WB 4OK3A 4HAYA 5LPNA 1KTVA 1ZUIA 2ZSBA 5J4HA 3EXAA 4Q1FA 2FE4A 5AJZA 1WXQA 2WJYA 2CEAA 1XRJA 2AFHE 3KKNA 4HDOB 5HE9A 5FOWA 4ZI3A 5DLQC 3DZ8A 1OW3B 1G5PA 5B57C 4BZQA 4BFYA 3RRNA 4EJSB 2OHFA 4BZXA 4WAUA 1U0HC 2JDIA 3A58B 4GP7A 4W5JA 3GPLA 4KU4A 1SGWA 2IYRA 3EA0A 3U44B 2CE2X 2X19A 3QKRB 3E1SA 4MKGA 3WP1B 1F2TA 3LFUA 2BEKA 3B8HA 2O8CA 1ZRHA 1VDZA 1U9IC 2DCUA 1G8HA 3FMOB 3G0HA 2F9LA 2W00A 2XNDD 3B9PA 3CWZA 2BM1A 1NN0A 2OLKA 1Z83A 1G8YA 3AF0A 3QQ5A 1Z6XA 4KLZA 4DEXA 3IDQA 4HZUA 2QEQA 3U7FB 4OL0A 2MMCA 2QT0A 1KIMA 4Q1CA 1LS1A 2GAOA 5M04A 2H18A 2NOAA 4BE7B 2PLRA 3THXA 3NBZC 4Q9LA 4PZZA 1E9RA 5IHPA 2V7QA 2VRWA 5G53C 1U81A 2BV3A 2PEZA 3LBNA 4D0GA 1CR4A 2XTMA 4IHQA 3FMIA 2RMKA 3QPWA 2C96A 2GBLA 2YOGA 4D81A 1RE0A 5EP1A 4JKYA 3B1YA 3NBXX 1N2CE 3SQWA 5JEEA 3RNLA 3BK7A 3L0PA 5JS7A 2PT5A 2O8EA 5F9FA 3OESA 3VNUA 4IRUB 2D7CA 1VPLA 1GRRA 1X6VA 4UXHA 2GZAA 4LPKA 4EPYA 1GOTA 1VHLA 2C99A 2CK3A 2VEDA 1GRQA 3Q3JB 1XTJA 2B8WA 1S1MA 2YINC 4OHVA 4RD1A 3FVQA 1I4LD 1QF9A 3KX2A 4BUJA 3GLGE 1Q0UA 4FCWA 2ZM5A 3RS7A 2JIZD 2YOHA 4NONA 3TSWA 1NSFA 5BW8A 2CCJA 3LX8A 1E2NA 1Q22A 4URVR 2AWOA 1UBFA 3UPUA 2OXCA 3QG1A 5FPSA 3THXB 4TQ9A 2VP9A 4DBLC 2R65A 4XWAA 1HE8B 4BRWA 3A4LA 2BMFA 2WM9B 2XAUA 4JZKA 3T5GA 4K46A 4L9WA 1CF4A 1G1MA 3MLEA 5GJVC 4NYJR 3T12A 4H1UA 5E7IA 5EE9A 1NG9A 3CX6A 4XWOA 2ZJ8A 4BASA 3EC2A 4B32A 2UKDA 1T9HA 3H4MA 2VP6A 4UNRA 2QMUA 3BBPA 3GQBA 5J4KA 3TAUA 1CJVC 2XJ9A 4HLCA 4DDUA 1NBMD 2GCOA 1RRGA 4HUQA 2VHCA 3CNNA 5FOTA 1AZTA 4L5BA 1FMJA 2B6HA 4C0AC 2B8TA 1FQKA 4BFZA 2ZS8A 3OF5A 4M1WA 4URWR 1RC8A 2GXQA 3QF4A 2QAJA 4EPVA 3VR2A 5EP3A 1P9NA 1XD2A 1P3JA 1WB9A 2ONKA 3A1SA 2DWPA 721PA 4NYIR 4KVGA 4W5WA 1XTIA 4A82A 1GFIA 3CRMA 4KXFB 2DWOA 2Z0MA 4NCKA 5GADl 4LHYA 1U94A 3AF3A 1ZCAA 4U02A 3C7KA 1CRQA 4QM7A 2OCAA 2ANCA 4Q9JA 2RGXA 2C04A 2OCPA 2VH5R 3C16C 5HKKD 1S4QA 2J0VA 1XTKA 1E1QD 4AKIA 2A5YB 1N5KA 1ZVQA 2GJSA 3K0FB 4YMSA 5TDHA 2GA8A 4M2LA 2CJWA 2WVJA 2ZR7A 4M9XA 2F7SA 3VHXA 1E2QA 2XX3A 2FF7A 3U3KA 3L8ZA 3HR8A 4IFEA 1EFRD 3TH5A 2EYUA 5FUVA 1SKQA 3GLFB 4ARZB 1ZD9A 1QHHA 4CEJA 4LYAA 2RGCA 1JPNA 3ZYCA 3K9GA 4XVQA 1E2DA 2NPFA 1TF5A 4Y0VA 3TUIC 5KDLA 2XNSA 4LBZA 5L3SA 3HR7A 1TTTA 1G3RA 1D5CA 2WWIA 5L3RA 1COWA 2WSSA 1E0KA 3KQUA 3X1DA 4A2PA 5L3QA 1KNXA 2GRJA 4BFVA 1KI8A 2HDNB 2QUZA 4FWTA 1PZNA 3H0KA 1WRBA 4K81B 5FBWB 2XITA 2VP2A 4D4LA 5AJXA 2XXAA 4D26A 4BFXA 2YNMA 4QGGA 2YVUA 2VA8A 3HU2A 1KK1A 3I1FA 2JJ2D 3MCAA 4HATA 2HXYA 2ERXA 1PVOA 2B92A 2ORIA 3JZMA 1EGAA 3ICEA 1A2KC 3CF6R 4CIDA 3ZZUA 1D9XA 3EPLA 2CNWD 4IW3B 1G8PA 2G3YA 2A7QA 4G5OA 1XP8A 4BFSA 3ASYA 2ZRKA 3P4XA 5L3SB 4NYIQ 1PLJA 3AVOA 1F5NA 2FSHA 5P21A 3SU8A 2O8BA 4MRVA 2EFEB 3AVPA 3CR8A 4KFSA 3WMGA 3SOPA 3ZVRA 4UXJA 5TY0A 3PEWA 2OAP1 2QBYA 2A30A 4XSHA 1RRFA 2ZI5A 2ZYUX 2O52A 2GCNA 2NO6A 4AIIA 2ZJAA 1N6PA 1UKZA 2BCJQ 3FTQA 2XXAB 2B7BA 3ADCA 1Z07A 5FTLA 2J9RA 4MDEA 4PHTA 2G6BA 2ZJ2A 1GZSA 1R6BX 2VP4A 4DCTA 3ZQ6A 1KHTA 4QGHA 2H16A 3ZVMA 4MDFA 1G6OA 2RAPA 1TADA 4RFVA 1E9SA 3T1TA 1MO3A 3KKQA 3MSXA 1DARA 1DAMA 2V1XA 5EZ6B 3TBKA 4MKHA 3VR3A 2JLSA 2H5EA 5TXGA 2MSCB 1YZNA 3QF7A 2VP5A 4M1KA 1KNQA 4YXWA 4II7A 5KNBA 4FMCB 2CHQA 4TL6A 3RDPA 5DIFA 2ZR9A 1NY6A 1Q21A 4A15A 4CYMA 4HSEA 2F6RA 3W8NA 4JVNA 2ZR0A 1UAAA 1A2BA 1MO6A 4E09A 4MUBA 1SVWA 2HLDD 4KFUA 1SKYB 2G1KA 5FOXA 4YDHB 1Y63A 1EX6A 1KMQA 4JLVA 5KSOA 4RD6A 2WKRA 2O5VA 1FX0B 2CVHA 3FOZA 1XTSA 1RIFA 3NHBA 4IXNA 5HZKA 1TU3A 5DGXA 1E2IA 1V5WA 2H7VA 4HB2A 3U4QA 3A1VA 4C7OA 4GMDA 2WOOA 1RPZA 1GVNB 4AKHA 2FOLA 3PEUA 3PUXA 2BVNA 2FNAA 3ZDQA 2QTFA 5BN3A 1ZIOA 2XSZA 2YWEA 1E32A 4FMDF 4P3YA 3U3RA 3GJ7A 3QBVA 4F92B 1FOEB 2CLDX 3P4YA 1AGPA 1JR3D 1MO5A 4JYBA 1JNYA 4IKEA 1E1RD 3NH6A 3OIYA 4Q1BA 3HPQA 3WYAA 4OQMA 3PUYA 4IVQA 4DIDA 2WWWA 3HYRA 1W0JA 4B48A 2CL7X 2PZGA 2J0QA 4MH0R 1J8YF 3C5HA 3UATA 4MYHA 4A8JA 2YZ2A 1W2GA 5TB5A 2BEJA 3PIRA 2YWHA 1T6NA 2FH5B 1KI4A 3CBQA 4C2TA 1XFAA 2QRNA 4Q9IA 2JJ1A 3N5CA 2OCBA 2YYZA 2FV8A 3C14C 3VTKA 1VIYA 1G3QA 3U4QB 4EFLA 4DSTA 1E2MA 2DHRA 4AURA 4RCYA 2JLUA 2IUUA 121PA 4JBYA 1UDXA 3ZVNA 1SVOA 2FEMA 4C0BA 2DFKB 2ZPTX 3A4MA 2F43B 3HJNA 1E9DA 1W0KD 3GLHA 3PITA 4I99A 4AC9A 4AG5A 1YZQA 1KJZA 3IUYA 3D7MA 3QPUA 3LXXA 3TR5A 5IK2D 4GL2A 2JATA 2WOJA 4LI0A 2GJ8A 4FW9A 2ZE7A 4EFNA 5CDFE 3TVTA 1P2SA 4TTRA 3CX8A 3KB2A 1YR6A 2FSFA 2QN6A 3KKMA 3VR6A 1G3UA 3Q7PA 3NG1A 4QHTA 1XPOA 5TV2A 1MABA 4DLRA 2E1RA 2FMXA 1A82A 2QL6A 1HEIA 3EIQA 3KL4A 2XZOA 3OAAD 2V3CC 4IDHA 2YWGA 2P5SA 1ZNWA 2QY9A 3JVUA 3GFTA 2VF7A 4NP6A 1DAFA 4ZV4A 1Z3IX 1Q44A 3GLHB 4OQFA 2CBZA 2GXUA 4RZ2A 2ZI7A 1P75A 3NVAA 5F98A 2OUKA 2C78A 2CVFA 1W44A 3K0SA 2I1VB 1ZM2A 1CJTC 2LWIA 4FI3C 4JLOA 4JKIA 1E2KA 5HPYB 1OHHD 1W36C 5DI9A 2QRZA 1IN4A 2GBLC 3I3SR 3ZGXA 4B74A 1XEWX 4ZKEA 3ICQB 2GKSA 3BOSA 1CBUA 2JJ8A 4AKEA 4D25A 1N6HA 3W5IA 1ZM4A 4FXPA 4TMXA 4Z8YA 4BZPA 1KI2A 2F1HA 2CHVA 2PX3A 3CRW1 4DLSA 3BD9A 3L82B 1YR9A 1G16A 2W2VA 1XMVA 1ELOA 2ATXA 3KKOA 2Q21A 1RVDA 1SVKA 1KK2A 2GK6A 3A8TA 4GPTA 2ZRHA 4Q1EA 4FIDA 2EWVA 2ZJYA 5G3YA 4Q5IA 1SVLA 1RRPA 1QHXA 4DC9A 2IYTA 1PLLA 3PCRB 1XNJA 2Q3MA 2ZITA 4G5SA 1IN7A 1E96A 2WJGA 2NGRA 3DDCA 2P6UA 3GJ4A 1R8QA 2CL0X 4R98A 4P4SA 1CIPA 1FTSA 3AQ4A 2CE7A 5HZHA 5FH9A 3N2IA 4OQNA 5LD2B 1T5IA 1JJ7A 3I73A 4KBFA 4F4JA 1ZYUA 3F0TA 4NHOA 4ZCIA 3FKSD 2PZFA 1FNMA 1KKMA 5AJYA 3OEHD 1UKEA 3PG5A 1GKIA 1Z08A 3FPAA 4DUGD 3DMNA 4WZAE 5FOVA 4B3DA 2P67A 1BYIA 2QPOA 4LPSA 2ODEA 1YZTA 3EZ2A 221PA 1W5TA 5CYPA 2PMKA 1W48A 2ZRMA 4NU0A 1L4UA 1A7JA 5HE8A 5EUQB 3RC8A 1Z0KA 2V9PA 4OKSA 1R5BA 4RD3A 3U6KA 1QZXA 2VHJA 4QHSA 3MAAC 5DHFA 1DO0A 1R10A 1YJ5A 2PT7A 4WIAA 1NBMA 4KBGA 2ZVPX 3WNBA 4QNRA 2FFQA 4M4SA 1TNDA 5KU1A 4JS0A 4TLDA 2WBLC 3U5ZB 4Q4AA 1ZCBA 1N6LA 1KK0A 4MYUA 3TGPA 3ADBA 2JLVA 2FEOA 2NG1A 2RGBA 3BIFA 4RD2A 1HV8A 1D2EA 1DAGA 1HURA 1Z28A 1XXHA 3FFBA 4BFUA 1W7AA 4FWIB 1OSNA 3P1JA 2FU5C 2ZE8A 3EZ9A 4FMBB 4M0LA 2CCGA 1QVAA 5KUTA 3SQXA 3U7HB 4QJ3A 2EVWX 1D6JA 2N42A 3AP1A 3K53A 4F93B 2ZTSA 5FUWA 1R5OA 4N1AA 1DPFA 4CGZA 5HCIA 2R6GA 1KJWA 2DWQA 3CZPA 3BRWD 3PXGA 5JWOA 2FA9A 2A5JA 3EIEA 5FPYA 2OCYC 1E1QA 4A0FA 4WXRA 4PHHA 1SXJD 2FGJA 1T8TA 1JJVA 2D2FA 4EKDA 1MV5A 3F8TA 4DSOA 3WBKA 4ESHA 3ZVLA 2QZ4A 4BFTA 4XOIA 4FCTA 2DY1A 3BFKA 4Q4AB 3QXHA 1U99A 1VCMA 4MYTA 2G0TA 3NKVA 2ZJOA 4QM6A 3SJCA 4AYWA 4BLPA 4QJ5A 3K09A 2CL6X 2WJHA 2XOKD 1G18A 3QVUA 1XXHB 3DOFA 1SZPA 2HUPA 1P62B 8OHMA 3MWYW 4AY2A 1L2TA 3K70C 2ZJBA 3RABA 3TR0A 1XJCA 3CB4A 5FOSA 2QE7D 5KO2A 5FBLB 4ACAA 3TMKA 4CDGA 4D4KA 4QL3A 1A5TA 4C0HA 5KTYA 4UJ5A 5B2ZA 3B7GA 4EAQA 2RCNA 1GSIA 2C03A 4DLTA 4E03A 1X3SA 5C4GB 2NO7A 3RS4A 1XEFA 2PJRA 4AKGA 4LYJA 4C0SA 2J7KA 4O2RA 1Z2CA 2RGDA 1KMHB 4A6PA 4Q1AA 2FSGA 3ZS9A 2JLXA 1EWQA 1IJFA 1W4RA 1OLOA 2ERYA 2OFWA 2DBYA 1QHGA 1L7VC 5CB8A 5A0FA 4LV5B 5JRZA 1IXSB 1GITA 1P4SA 1CJMA 2OXRA 4G3XA 5EP2A 2CNWA 2X2EA 4B2PA 2QSZA 2VSXA 2OBLA 1TUEA 2J5XA 4IEEA 2WAYA 3IPXA 1NVVR 3LNCA 3GJXC 4Z8XA 1UBEA 2QAGA 4PC3A 3SNHA 4DCVA 3AF1A 3L0SA 3THWB 1UBCA 5JSZB 1BMFD 1M7GA 4XVRA 3P26A 3VX3A 4QHYA 4R7ZA 1XTQA 3ONWA 3GD7A 4I4LA 4QXAA 4URZR 4EJSA 1Z06A 4N3NA 4JL6A 5JWHA 3B5JA 3QIAA 4D0NA 4RZXA 3U44A 2ZU0C 3C5CA 3T06B 1Q20A 3QKRA 2ZJ5A 2D62A 3P27A 5G40A 2VHUA 2QP9X 2R62A 2IHBA 1W4BA 1OH6A 3CNOA 4I1VA 2KE5A 6Q21A 4QKQA 3RHFA 5DNYB 1DOAA 5JMTA 1ZU4A 2C9OA 2JAQA 2WWXA 5HTKA 2QAGB 5AWFC 1DAKA 4MGKR 1GTVA 1HTWA 4GOKA 4JSYA 5FPTA 3FMPB 3V4FA 5FTKA 2BWJA 2I3BA 3IO5A 1AQYA 1E2HA 1CP2A 2WWFA 1XBTA 4TT3A 1K6MA 1T0HB 2W2XA 5IF9A 1KO1A 4AI6A 4DVGA 5E7JA 5EZ5A 4C2UA 1BO6A 1RZ3A 5BXQC 1UKYA 4KITB 1MKYA 1N5IA 2ORVA 3IEVA 4IEIA 1XU4A 4YMWA 3R9XA 5GJCA 2R6AA 4LDJA 4ZDKA 3AV0B 4IFBA 1H8HA 3CPEA 4ZIRB 3CM0A 1P9RA 2Z43A 4A8JC 4M1SA 3B60A 3RVBA 4PAMA 2ZRAA 2V55B 4LJ6A 3B1XA 4E5UA 5AK0A 3QOFA 1JR3A 2FFBA 4C0QC 1K5GA 1CXZA 1E1RA 1P73A 3X1XA 1DAHA 1S96A 3LQQA 3SJAA 3T35A 1AS2A 1NVVQ 1GDDA 1NSTA 1VYTA 1R0XA 3M1IA 3K0CC 3H2YA 3CH4B 3NTUA 3H84A 3OIVA 3RS5A 1NKSA 3DM9B 2BOVA 2IUTA 3TAHA 3NDBB 1CR1A 2FGKA 3T1OA 3FHTA 4Q4JA 1SKYE 1U90A 3D31A 1WP9A 4PO1A 1N25A 3SDZA 4DKXA 2ONJA 3UG6A 4TYNA 4HLQB 4B2IA 2YV5A 4HAXA 4JLAA 1EX7A 4B2LA 2HV8A 4JMPA 3I62A 5H1YA 3N70A 4B44A 3KQLA 3AVUA 2KI5A 4LZZA 4OI0A 5CJPA 1YRAA 4BWYA 2R6FA 5JLJA 4PQYA 5J47A 4JJKA 3CR7A 3OFND 4O3MA 2RGNC 2XB4A 1UDWA 1W0KA 2GILA 4M1OA 4OYHA 1XF9A 4DSUA 2AKAB 1E0AA 3BAFA 2FN4A 3IO3A 3CNLA 1VHTA 1YRBA 1OT3A 4IXMA 3RWMB 2WPDA 4HB3A 4I1UA 1N0WA 4WW0A 3ZQJA 1PJRA 4XD7D 1NJGA 3IHLA 4PZYA 3R9IA 3DL0A 4ASUD 2A5FA 5DE3A 5JI3E 3QE0A 2JLYA 2IA5A 1MRSA 4Q4JB 4OI4A 3B82A 4LJAA 3SBEA 5C46F 3QKTA 5KDDA 5H68A 4B6EA 1FP6A 3J81k 2EFGA 3GJ5A 3OAAA 1GILA 1KI6A 4QRHA 3B1VA 3X1ZA 3QUSA 4PX9A 3RS2A 2J0UB 2FPKA 2IYVA 4GBMA 1ZC4A 5BQ5A 4TYQA 3GLIB 1CS4C 2ZRFA 4GMXA 2JGNA 3LH5A 1NVWQ 3K0FA 5FL7D 2DB3A 5J4YA 1IONA 1KZ7B 4CRWB 5F9HA 4DRZA 2IS6A 1M74A 3O8BA 4OK6A 4PO9A 2J3EA 3OHMA 3CZQA 2R2AA 3KKPA 3V00A 4XSGA 1DG3A 1ZINA 5HCNA 3CX7A 3CH5A 1U0JA 4BRUA 3MJHA 3GLFA 4ARZA 4R71A 2K5UA 2AKYA 2RGAA 5FTNA 3UMRA 2VQSA 3K0AB 3K8YA 4V0ME 3PUWA 1O3YA 4FN5A 3RS0A 5GJWC 3WNCA 3C4JA 2W0SA 5DSZA 2HT1A 2W2TA 3AKDA 4P33A 4NBSA 1KI6B 1E2EA 4G5QA 1N0VC 4ERNA 4HB0A 3H86A 1NN3A 3OZXA 1FMLA 4OK5A 1MRNA 4QBFA 1GIAA 4TMZA 1E2FA 5G3ZA 4DZZA 3EASA 3PUVA 1RYHA 4ILEA 3QXJA 3KUCA 4X8LA 2GVDC 2KWIA 1AKYA 4C30A 3FKQA 1XMIA 3A37A 2FDCA 2Z6VA 2REBA 4WBSA 2ZUBA 3CKLA 3GLHE 3IGFA 5CIWA 4ZCMA 5JBQA 1GWNA 2J45A 3C15C 4CW7A 1XMJA 4B34A 2BJVA 4BLTA 1NLZA 1X86B 2MSEB 1EFTA 1TU4A 2HJVA 4B35A 4AD8A 2EFHB 3UIEA 2GK7A 5DO9A 4JVLA 5LB2A 3KB1A 3T1VA 1LVGA 1KO8A 4MGIR 1OB2A 1AZSC 1Q57A 4B71A 1YR8A 4JVMA 1KSFX 4DWJA 3KFVA 3EWAA 2OG2A 4IOKA 3FKSA 3ZD6A 3GFPA 1IXRC 3WRYC 3B6EA 3OEHA 1XD9A 3AKCA 3PENA 3X2SA 4LYFA 2DPXA 4DB4A 3UMFA 1J8MF 1RKBA 3GEEA 2TMKA 1JPJA 3KQNA 1KJYA 1JXOA 4B6FA 1U2RA 4QBIA 3SZRA 2IEZA 1NJFA 1YQTA 1G6HA 1AK2A 3T15A 3SJZA 2NTYC 3KQKA 2NO0A 1P6XA 4RZ3A 4WA7A 1UF9A 3FFAA 2AK3A 3MWJA 1JR6A 2ODBA 3TK1A 4PC2A 4PO8A 2HCJB 1X1RA 2NPIA 3B1ZA 3BH6A 2G9NA 1H8EA 4O25A 2IXGA 2GZDA 3SJBA 1NMXA 2O8DB 5E3HA 4Q4HB 1NIJA 5KOYA 4LGMA 4R2IA 1AIPA 1F60A 3L2OB 4MKFA 4KFRA 4M9QA 1DE0A 4BLRA 4D80A 3D6TB 3OE7D 2Q9AA 3K0EA 2PJZA 1P9WA 3B9QA 3M6AA 3CF0A 4DLUA 4P32A 3W34A 4IJMA 2C98A 1KO5A 3QVVA 4JLDA 3RANA 2DFNA 4DSNA 4FMCF 3KJEA 2ZYVX 3IIKA 3AH8A 1KGDA 4ZDIA 2D74A 5BWMA 2J7PD 5CLQA 1G17A 4UKDA 2JASA 3EG5A 1FX0A 1SXJA 2W6JD 1SHKA 2HF8A 3AF2A 3JVVA 1OFTA 4GP6A 4HLUA 3BERA 4MKIA 3AVWA 1N3BA 4LJ7A 5CK4A 1LFDB 4PSKA 4OHWA 1KI1A 3MJRA 1NL3A 1J90A 1EFCA 2QPTA 1WMSA 3LWNA 2XOKA 2QM8A 2GEVA 4YLGA 2P5TB 3GMTA 1FW6A 5JFGA 2YKGA 1G5RA 2D4HA 4TZ6A 4PHFA 1VCNA 2QE7A 2WKQA 3RLFA 1F2UB 1E79D 4PXAA 3RYTC 5DI3B 2QSYA 2VPPA 3A6PC 2A2ZA 1U8ZA 2EU8A 4ZKDA 3REFA 3LBHA 4PSAA 4CEIB 5EE5B 1GL9B 2ZYWX 4Q4LA 5AJVB 4GZMA 1TEXA 2AR7A 1E2PA 1SXJB 2ZJZA 1JXMA 3PQCA 1BYUA 4V0KA 3WBJA 5IRCD 4IDOA 4TL9A 2RGGA 4PQRA 3GJ6A 4B75A 3TRFA 1JECA 2VSFA 1NBME 1O87A 3LXRA 4MQBA 3CW2A 4LJ5A 4TMVA 1ZW6A 4V0LA 5FFMA 4HYYA 3W6OA 3CPJB 1LF5A 1T5LA 3B1WA 5JEDA 2QM7A 3AGPA 2F43A 2YWFA 2Z4RA 4LOAA 2JDID 1YR7A 1UEIA 3A1WA 4V0NA 5J40A 2NO1A 2C5LA 1XXHE 4A92A 3NDPA 4JL5A 3EZFA 1NG1A 1J2JA 3KFXA 1JBKA 1OIVA 4H9GA 1SULA 1QDEA 2QMHA 2ZXUA 4V0MA 4S35A 2FPMA 1OXUA 4QOSA 621PA 1ANKA 1D2NA 1KDTA 4IOLA 4HAVA 4A1FA 3EC1A 1BMFA 1XZQA 4OBEA 2EW1A 4H1VA 3V9PA 1W2HA 3LW7A 3A1UA 2CLSA 1OFIA 1NP6A 3MFYA 3AVTA 1II8B 3EZ7A 3T1QA 3ADDA 4KFTA 4Q66C 1KI3A 2AXNA 2J59A 3O8RA 2PX0A 4JL8A 2ZSFA 4JT4A 2B7CA 4NCHA 4LWZA 2G88A 1NMZA 4DEYA 1W36D 1NVUQ 2PZEA 1NRJB 4DLWA 1GUAA 3H1TA 4JT2A 2AHOA 1Z0JA 4LRWA 4Q7KA 5KHOC 3U3JA 4P4UA 3UANA 4TQAA 5KSZA 3DMDA 4ZPXA 3Q9LA 3X1YA 4DLZA 3DVLA 5ANRB 4D4JA 2HJGA 3EPKA 5BN5A 4GDFA 2WJVA 4TLEA 4OI1A 3BJIC 3FDIA 2GAAA 1B23P 2HEIA 1WA5A 2VSOA 2N46A 1EG7A 2ZUCA 3B13B 4TYYA 1YZKA 2O0HA 3AVXA 1IY2A 4WZBE 4B3BA 1VMAA 3G5UA 4Q01A 5GJBA 4PANA 4KV9A 1N6NA 1M7BA 1S8FA 1KKLA 3ZIAD 2C9CA 2XNDA 5JJIA 4EPXA 4NCNA 3UWOA 4X8MA 3WHKA 4D2IA 3IBGA 4OHXA 4RZUA 1I4TD 2GEDA 2WHXA 2RHDA 4ZDJA 3CRRA 5AUQA 2AXPA 2WIAA 1OJLA 1OYYA 3GEIA 3HP1A 3WYGA 4E22A 2IS2A 1R0ZA 2GNOA 3LA6A 1WBDA 1TF2A 4AYXA 2CDNA 3MWLA 1GKYA 1MOZA 4N0DA 3NEYA 4US2R 4M21A 2VHTA 3IQWA 4CEHA 1MT0A 3BORA 3A4NA 2IYYA 2ZS9A 1ZP6A 4ZI2A 5E7MA 3AB3A 2VL7A 1E2GA 1IY1A 1M7HA 4DCNA 5SZJA 4IDPA 3QKUA 2F55A 1K5DA 1R4AA 4B47A 5JS8A 4KSBA 1AA9A 1OFHA 1ZUNB 1Z6TA 4RKEA 2CCKA 4BPBA 2H92A 1E9BA 1TL7C 2UZIR 3OFNA 4ON9A 4Q00A 2OESA 1ZBDA 1W49A 2WV9A 3BWDD 3CONA 4I81A 4MRSA 4KJZA 2ZRLA 3FYHA 4RCZA 1DBSA 1E0JA 2JLRA 2JIZA 4F7WA 1JAHA 3SFVA 1UPTA 2QENA 5DH9A 2JLWA 1S9DA 2NZ8A 5KNCA 4KAXA 1N6OA 1NLFA 3LO5A 4JLPA 4CEHB 1T3HA 2IK8A 4DJTA 5K8TA 2QI9C 4GOJA 3BFXA 4PPNA 4ASUA 3B2EA 4L16A 2XJ4A 4A6XA 5DHAA 3L0IB 3NBYC 4G1UC 2IWHA 3LQRA 1NY5A 2BMDA 4C0KA 1UFQA 1Z47A 1HH4A 4U5XA 1Y3AA 2J87A 2OLJA 1Q3TA 4HLDA 3WRXC 2R44A 2IXEA 3O47A 3CIOA 2ZUDA 4NE2A 2KBEA 2IYLD 4F4CA 3TW8B 1KK3A 2WSSD 1BIFA 3GJ8A 5CYOA 4PAQA 3LDAA 4RD4A 5LB4A 5KPJA 5DN6D 1LB1B 3K70D 1OKKD 1W4AA 1OF1A 3PFIA 4FD2A 4LBYA 1JR3E 3BB4A 1ZU5A 4NMMA 4LHZA 3QBTA 1P2UA 1VECA 4FCVA 3T34A 4HDQB 4OJKA 3I92A 3ZZTA 2FFAA 4DT1A 4LY6A 1C1YA 3E70C 4B73A 1N6RA 1BOFA 3KDSE 1FFHA 1CU1A 3E2IA 1Q1QA 1IN6A 3CF2A 1YZLA 2Z83A 3W3ZB 1G41A 3HYTA 1R8SA 4A9AA 3L0OA 1DTSA 3QEJA 2ZS7A 4C4PA 1IOZA 1DAIA 1HT2E 1CTQA 3EZ6A 5HKKA 4GOXA 4A2WA 1OH7A 2LCFA 4DDVA 2JLQA 3BH0A 2IEYA 5AUNB 4BGDA 3PEYA 3CLVA 1DEKA 4JSTA 821PA 1E6CA 1H65A 1KMHA 5FUYA 5FBQB 3SEAA 2OBNA 1YVDA 2DFTA 4UNNA 4DLVA 1VG0B 2BHRA 1QG4A 5B58C 2SHKA 2ZVQX 2OSBA 4F91B 2YHSA 3FE2A 3LVRE 1IM2A 2CLCX 2O0KA 2E9SA 1EFRA 4RJLA 5UKDA 3THYB 3EIHA 1W47A 2OE2A 4JVSB 4OI2A 4DT1B 1FZQA 2ZAOA 4JBXA 4HAZA 5L3VA 2V1UA 1NN5A 2ZROA 3LRPA 3SYLA 3TJZA 3R7WB 2W6ID 3VKGA 3VR1A 4DCSA 3AVYA 1T3LA 2IYUA 3I8SA 2ZYTX 4TTPA 2FZ4A 2IC5A 2CHGA 1JQLB 2QQEA 4M9ZA 1OXXK 3THWA 5JSZA 2PL3A 2QU8A 4V0OA 3VAAA 1E98A 1G5TA 4I1OA 1RYFA 1S2MA 5K8IA 1YZGA 5JJKA 4R9UC 2XZPA 4YXWD 5JHGB 2FZLA 3I32A 3KJHA 4RKFA 2GEUA 3RS3A 2BMJA 2ZRPA 5JRJA 4Q47A 5GVRA 4M1YA 2FX3A 521PA 2D2EA 1CLUA 3PR1A 2ZRCA 3I61A 4A2QA 1VYUA 5TMPA 2JJ2A 2C2HA 3EARA 4QBHA 1T8UA 2QA5A 2J1LA 4JBWA 5FI0B 3Q7QA 421PA 1U8YA 1CJKC 3VFDA 1ZUHA 4OHZA 3GLFE 2L0XA 5IT5A 1YE8A 1KO7A 3EWSA 1SQ5A 3K1JA 2C9YA 5AJWA 2FPLA 4L4UA 5JI2E 2ZAMA 4TZ0A 3ZH9B 1NKTA 2XTNA 2V6IA 3B85A 4PC7A 5JHHB 3CRQA 3OE7A 5EE0A 5CM8B 2OAQ1 1GP2A 2WJJA 3NBFA 1G3IA 4HLUC 1IAQA 1F48A 3AM1A 3ASZA 3MGCA 1US8B 1G4AE 5J4LA 1GKUB 1XPRA 1X8JA 2J7PA 4L15A 4R2HA 4G5RA 2BIFA 1G9XA 2LKDA 1Q1BA 5JWRA 1ZIPA 2E87A 2F3RA 2YJTD 4EDHA 2IYZA 2NIPA 2ODNA 1HY3A 1KO4A 2Q9CA 5CIQA 2JJ1D 3T5DA 1KI9A 1U98A 5H70A 3SC3A 5EP4A 5AR1A 4NPHA 4ZIRA 4POAA 2PEYA 1KOFA 3TQCA 1HT1E 3IBYA 1KI7A 4C0JA 4Q7MB 2V4ZA 3FB4A 2JCSA 2BMEA 5KNDA 1N6IA 3LVQE 2OEPA 3U3MA 3UXMA 3UWKA 3QSYA 4M1TA 3BH7A 5FR2A 4EQ6A 4YONB 1E79A 5KSPA 1JEEA 2W83A 2HLDA 1V43A 2GXAA 1OIWA 2GESA 4HB4A 4QG7A 2DYKA 3KXKA 3R9WA 2Y8EA 2YOFA 4ESVA 5CM9C 4UQOA 4DCUA 2P6NA 3UG7A 1T91A 5K8LA 1Z2AA 3MD0A 4PC6A 3IIJA 1OB5A 4MGYR 4KSCA 1ZAKA 2BC9A 2NO9A 2GDJA 4M9SA 1G7RA 5LBIA 4ABYA 4DB2A 1IN5A 1Z5ZA 4OHYA 1E99A 1II0A 3I8XA 4PAOA 4HEJA 1P60A 3W90A 3U7GA 2IUSA 3NC1C 1DO2A 1QHNA 4EQ6B 2F1RA 1XEWY 1PLKA 2AL7A 2CMKA 1Z6YA 2ZE6A 4JLJA 4TN1A 2IS4A 1MO4A 2ZRDA 1A1VA 1D9ZA 3NH9A 2V6JA 4TSFD 2OM2A 3AP3A 3U6BA 4IOJA 1WDTA 4NH0A 3VQTA 2FG5A 5GVSA 3KZ1E 4P31A 3BC1A 1LS6A 1KZGB 2ZRBA 1G8GA 3D8BA 5BYJA 4QJ4A 4DHEA 4AK9A 1MR3F 3W3AA 3TW4A 4TYWA 1SXJE 1NMYA 1XD8A 2IW3A 3G82C 2J0UA 3EX7C 3QJYA 3GLIA 2HT6A 1FL9A 1UEJA 2WWHA 1BS1A 4KI0A 4YDSA 3TNFA 1P7CA 1Q12A 5EE1A 4JLMA 4TLBA 2XB2A 5IK2A 4G5GA 2I4IA 2ZRIA 1F2TB 4UXIA 5FPHA 3BE4A 4DDWA 2O8CB 1XEXA 2F3TA 1ZMXA 1UKVY 1E4VA 1SHZA 2OV2A 1DADA 1CEEA 1LF0A 2OT3B 3CWQA 2ZIAA 1GM5A 3I4LA 4IDQA 3AUYA 3FWYA 1TQ4A 4S2EA 4UJ3A 3SR0A 1JI0A 3K0AA 3HDTA 3BS4A 3D3QA 5TARA 4RFSA 5E4FA 3THOA 1A4RA 5KDOA 5C18A 4HZUB 5L8VA 2XTZA 2J41A 2QGZA 1TEVA 2G0NA 3SHFA 3X1WA 1R7RA 3VR5A 4BLSA 4A36A 3V4RA 1W36B 2RB4A 1E9CA 4UNSA 5LD2C 3ZIAA 1IHUA 3TVDA 4O2LA 2AX4A 4BEJA 2VLIA 1XEXB 1S3GA 1UBGA 1P2VA 1J70A 2O8EB 2AWNA 1YZUA 4ZDWA 1FTNA 1OHHA 3KTAA 3ND8A 3ECCA 4RSGA 3QEOA 4EIWA 1CR0A 1FUUA 1KSHA 2VBCA 4RFSB 3TQFA 1DVRA 4MITA 3TUJC 2ZSAA 1I4DD 2QROA 2HYDA 1IJEA 3BGWA 1I2DA 2A78A 3LAWA 2X8AA 4JLKA 4MYCA 5FUXA 3WNDA 1OH8A 4Q1DA 2ZSDA 1EWRA 2WICA 5LDDC 3TSZA 2Q3FA 2EFDB 2QTHA 3AUXA 4HAUA 3U61B 3PJRA 3RWOA 3HU1A 1ZC3A 2Z4SA 1X1SA 2BBSA 3VR4A 1QHSA 2Q0HA 3QI2A 5A4JA 1L8QA 2GETA 1Z6AA 4KO8A 3NWJA 2JA1A 2GZHA 3TSOA 1OXVA 1Q3HA 5KSYA 1WCV1 3RRZA 1G19A 3EPHA 1S0UA 1NN1A 4L8GA 3DPUA 5EXSA 2ORWA 3KTAB 4F4IA 1IN8A 3K9NA 3MG9A 1HA3A 2MMGA 2RKOA 4P4TA 3F3YA 1RRCA 4OQXA 4W7SA 2GCOB 4HUQB 2O8DA 4D0LB 4Q4HA 4TL7A 3GJ3A 4ZCLA 1KYIA 5K8UA 2ZEJA 2RGEA 2GVZC 4JLBA 2P65A 4XJXA 3SYKA 3QF4B 1GG2A 2WAXA 4BEBA 1XD2B 1N6KA 4DUGA 2PH1A 2BKUA 3IQXA 1VKJA 1F6BA 5CITA 1AJEA 4MRRA 2CXXA 4IDNA 1M8PA 3KUDA 1XPUA 2NZJA 3EA5A 2VTKA 4P0TA 4EUNA 4X8HA 1P5ZB 1ESNA 1VTKA 3ND9A 3VU9A 3KJGA 1E0SA 1GNRA 4PTLA 1GNQA 3WYFA 5FL3A 2OO7A 2HXSA 1T0JB 4PHGA 4Z1MD 5FBVB 4HDCA 2IX3A 2ECKA 5D3MA 1SVSA 2P3SA 5DN6A 2VF8A 2AK2A 3MUFA 2IF0A 3Q5DA 4NYJQ 4FINA 2C95A 5SZKB 3TLXA 1R0WA 1OKKA 2IS1A 1S3SA 4IOMA 4TMKA 1YHNA 2CJWB 2OFOA 3DKVA 4C9BA 3IHWA 1XCPA 1ZD1A 1L4YA 1EESA 3HWSA 1Q1EA 2DFLA 4W5HA 1LV7A 2IYWA 2WTUA 2QG6A 4PFSA 1M1YE 3LLUA 1K8RA 2QNRA 4LUCA 3WMFA 4TLAA 4DLYA 1E3MA 3TE6A 4D82A 1B0UA 1F2UA 4BFWA 1QHHB 5DI3A 4CEJB 4Q18A 4B3FX 4L9SA 4ITRC 2P2LA 3N2EA 4HI0E 3TIFA 5EXTA 3VU9B 2GWHA 1Z0IA 4AG6A 2C77A 4CEIA 4B3GA 1XB2A 3K09C 4G01B 1E4YA 3Q72A 2JEOA 4Q19A 1N0UA 5D3MB 3OEED 2IYSA 3SYNA 5L3QB 1XDBA 2FFHA 3K70B 2UZ3A 1VIAA 3VNVA 4CT5A 2PCJA 3P20A 1W46A 4EPTA 1YU9A 4Z54A 2A5GA 1NF3A 5ELXA 2P0EA 3L43A 2BBTA 2W58A 2LKCA 2HCBA 1VG9B 3UMSA 1KDPA 3K9LA 3U3OA 2MSDB 3C41J 2ZRNA 3AGQA 2W6IA 2WWYA 2BM0A 1M6NA 2QMEA 2ZU6A 5F2EA 4RD0A 2F9MA 1FQJA 5FOUA 4C3ZA 4LC1A 3QPVA 4NZYA 1XCMA 4J0QA 4DLXA 4TMWA 1FP7A 1WQ1R 2H8KA 4TL8A 5IDVA 4RVCA 4WZ6A 3SI7A 3GLGA 2O8BB 1IQPA 1OXTA 2G83A 3AVQA 1Z22A 5KYKA 3W6NA 5AUPB 2QBYB 1TAGA 1II8A 3WXMA 2EYQA 4A4DA 1G291 1EXMA 1XZPA 4PPGA 1Z29A 4TT3D 1VG8A 2X2FA 1JB1A 1Z8FA 2QAGC 2QMOA 4E07A 1R2QA 2IF2A 3KXLA 1RFLA 1Z63A 1G4UR 1J7KA 1D8TA 4EFMA 1TPZA 4PQFA 1Z0DA 2IYXA 1LNZA 3W9YA 2UVQA 2X77A 5JCZA 3BB1A 3EAQA 1ONBA 4LJ4A 4EJSC 2O0JA 3PV0A 4KYIB 4LJ9A 4WVFA 2QORA 4IVPA 3T61A 3WP0A 3WY9A 1G21E 1E69A 5DISB 1II9A 3TKLA 2OZEA 4BQSA 1H8HD 2JLZA 3QENA 4ZO4A 3GLGB 2B21A 1LTQA 2QP4A 2VP0A 1VCIA 1UM8A 3NHAA 1U9IA 5EUMA 4LK2A 5C2JB 4QC2A 1AQUA 3DM5A 4YMTA 3LY5A 1KSJA 5E95A 1U8AA 2EWWA 5A5GA 2V7QD 5KPDA 1TQDA 3PUZA 4US0R 1XCGB 3TUZC 2D3WA 4LV8B 4Q7LA 2HF9A 1P2TA 3DOEA 3L8YA 3F5FA 3LX5A 2BBOA 3GEHA 1DELA 1QHYA 2QT1A 1TX4B 3QY0A 4FMDB 4LBVA 1Z0FA 2IHYA 2WKPA 4C7OB 2GJKA 1UJ2A 4O0MA 1I2MA 3K0CA 5JZVA 1JEDA 4XWKA 2CK3D 3AF4A 1XJQA 3OIWA 3IEUA 3U7EB 1IXZA 3O8CA 1E9EA 3S1AA 2QGNA 1N5JA 4PPFA 4PR0A 4X8OA 2RHMA 1OE0A 1P72A 2ZETA 1DG1G 3DHWC 2GTPA 3R8CA 1P61B 4KCGA 1W4CA 5B64A 1C9KA 2P6RA 2WPDD 3CRVA 4KVAA 4US1R 1X8KA 1AS3A 4Z51A 2H1LA 4Q7JB 2KJQA 4LSGA 3VKWA 4A8JB 4XVUA 2RGNA 4JYCA 2GF0A 2IL1A 4A0GA 1DS6A 4KYUA 4B43A 2WZQA 3SN6A 1ZM9A 2J0SA 1AKEA 1EFHA 1QVRA 1SVIA 4LC0A 5DYGA 3W5JA 4NDZA 3QXSA 5SZIA 1YKSA 1AS0A 2F1JA 1PV4A 3DKPA
chains in the Genus database with same CATH superfamily
1KAMA 2J46A 3EQ2A 3TZHA 3AK4A 4JI5B 1U5BB 1UBTS 3PEVA 4MA4A 3RO7A 2OQVA 5BT8A 3RKRA 1M5UA 1W581 1HT0A 1RAAA 4DDKA 1UP6A 3O8DA 2LCQA 3VPBA 1TA0A 4WH0A 2NACA 2EFYA 2PO7A 2G5PA 1MW8X 4XIGS 1U0RA 4A10A 2O1WA 4S1VA 2BI4A 3LA8A 5ALPA 4UU8A 1EUCA 4H16A 4UEJA 1XF1A 2GJ9A 4X1YB 4URUR 1UBSB 2FB9A 1OT5A 4RJ2A 2HF2A 4JB2A 3HDGA 2EARA 3IKJA 4HQRA 3OCJA 2VYFA 4FJ2A 2YXNA 1UJMA 1NVXQ 3EUAA 4X6XA 1Z7YA 1YXMA 5TVKA 5K6RA 1TYBE 3T38A 1I36A 1L5RA 2RHLA 1U2DC 4KK3A 2OQIA 2O8VA 1C4OA 4QUIA 3OM0A 5FULA 4MQ5A 4G8BA 4MUAA 4AULA 3W6PA 4S1OA 4XPIB 2XMCA 4CZ2A 5B2FA 5AW7A 1IEXA 2VDWA 5ELLA 2GK4A 4O4JA 1YKGA 2GXSA 3N6XA 2EQBA 2FZKA 1GGFA 2PCLA 4LDNA 1OYWA 2VHQA 2HUNA 4ETNA 2VT6A 4JP3A 1ZK2A 2PNFA 3SE0A 2CLFB 4D1YA 4DY4A 2CXRA 2Z95A 2VJYA 5C5CA 4TTTS 5LLTA 2FSVC 1A3CA 4PZLA 2V98A 5CFZA 2QUJA 5EUCA 3BHNA 4TRJA 4ROSA 2O8FA 3GCGA 3B36A 3CG4A 3F3SA 4AP5A 5CT4A 2HNKA 3DAYA 2KMLA 4L4RA 1L5WA 3FHCB 4Y2VA 2QD2A 1KFCB 4FGSA 4F8JA 4OMCA 1GPAA 2RAVA 1E2UA 4YJ3A 3VHLB 3EWIA 3NDJA 4FBLA 4A0RA 5IPFA 1IK4A 1L5ZA 4N9QA 1YFZA 2XOEA 3GJ0A 1I6WA 2ZANA 4QFMA 4C3OB 4DG9A 4TLCA 5KKNB 4CLRB 2FEXA 2OCKA 2Y1KA 3IP1A 3E7FA 5AJHA 3NOVA 3A36A 3TLBA 4GGOA 4OF4A 2QR3A 3PXAA 4JLNA 5DLDA 3I9LA 1COWD 4DDTA 5GOTA 1CZOA 3R7NA 3ICPA 5BVHA 5IDWA 3BICA 3I9JA 3QLEA 5ER6A 1C1HA 2EQAA 3T95A 4X7MA 4DAEA 2ETXA 5ALYA 4KQ6A 3LBYA 4Q3LA 2ZE5A 3UK6A 3UJ3X 3ZNPA 1AH2A 4L0DA 5DBOA 3W8RA 2VIIA 4QBKA 1ZWLA 4EBBA 4MPJA 2E4YA 2I8CA 4MGHA 3V4LA 2DCMA 3BSYA 2IE8A 3THYA 1JFLA 4F46A 2R96A 1TMKA 4WFIA 1LX7A 3VX4A 2WF5A 3MWGA 4GI7A 4GT1A 2E4VA 4M88A 4NFHA 4UNPA 3TO5A 2YN2A 1Z0AA 4C4TA 1ZNZA 5D3QA 2G77B 3HKEB 1ENZA 2VBFA 4E2YA 1G8FA 1ZFNA 4UEKA 1SB9A 4P4SB 5AXDA 2FUG6 5AI4A 1T5SA 4BLQA 3LLMA 2Z5FA 1PUIA 3JTEA 3SFZA 4KRGA 2FPPB 3RHZA 2CKDA 5IJWA 2PMDA 2Z2JA 3L4BC 1CUAA 1PR4A 1KEWA 3CEMA 4WXPA 3O8NA 3UC5A 3UPDA 4PSVA 4A26A 4LJYA 2Q2OA 4IGEA 2X5KO 1H2BA 4IHAA 5E1DA 3EGVA 1NLYA 2QTVB 1BFKA 4LI3X 4Y0AA 4R0MA 1TUGA 1Y5MA 3DDZX 1N5LA 4M36A 2BGNA 4QTXA 1HE1C 4QVIA 1QUEA 1GXSB 3AEUA 1HNWB 3MWKA 3C3KA 2ODPA 2BSXA 4IZOA 3C5WP 1XRPA 3D5QA 3PXUA 1D2MA 1KAEA 2JARA 4D3FA 1C0IA 3RVSA 4DADA 2DHCA 3FDXA 1YV9A 3JSAA 2ZYSA 1RWBA 3LCUA 3C1OA 3O8QB 3G17A 5EXPA 5G1OA 3Q98A 3UJBA 1EUDA 2F59A 3UWMA 3LUKA 1XUOA 2IW1A 5CLFA 3I5XA 2ZI3A 1I80A 1GNSA 4JIMA 4WMLA 2GFHA 4E51A 3PPVA 3VR3D 2EKLA 3DZDA 1ETUA 1OIXA 4ER7A 5IT9A 2D7DA 2G80A 2P4QA 4RF4A 2CHUA 4OSPA 5KNBD 3HN6A 3AWDA 4CIXA 5AUOB 6AT1A 2W0MA 1JYSA 2Q6TA 1G7CA 2GHIA 3DR3A 2C8VA 3FHOA 3IHKA 4G3XA 3MXTA 4NKRA 4S3MA 1JMYA 1TUIA 5U9CA 1RP1A 4IWYA 4XUEA 5LOVF 4QUKA 3VNSA 2W4IA 3GEGA 1X9HA 3ZLJA 3KDPA 1VFNA 1WE2A 4EW6A 1OV4A 1E7RA 5G41A 2BELA 2XZLA 1USKA 1VP9A 3KJIA 3ONNA 3QG5A 1TEZA 3GYGA 5JU6A 3M4JA 2D7JA 4RCVA 4QGAA 3B38A 3W5SA 1GRNA 1K2VN 3G8BA 3TRKA 1YB5A 1I5RA 3OQVA 4MVJH 1JQJC 4NCJA 5E9WA 5T4EA 3HDJA 1A7UA 3G23A 3TZEA 2ZQYA 1U0OC 2VAMA 1U0LA 2YC2C 1F6WA 4BX2A 1G20A 1QB8A 3I01M 2G1JA 4MUXA 1S2OA 1OFUX 2UUOA 4RM3A 1W85B 1KJQA 3M8KA 4C0LA 2O48X 5BR4A 3E82A 2A5DA 3LCVB 3OIUA 1E89A 1UJ5A 3D54D 3QKSA 1U4OA 4Q21A 5CK5A 5T8KC 2JNWA 4AWAA 4FIZA 4ML3A 1P1RA 2I67A 1AMOA 2JI7A 5BRJA 1LK0A 4DM3A 2P9HA 5F33A 4RQAA 4TXMA 5BW6B 3L2OB 4KO3S 4EHJA 2R8RA 3GDWA 3M33A 1JR2A 2W22A 5D5QA 4AWBA 5FTMA 3QRWA 3N7UA 3PI6A 4CT4B 1FU8A 3B5IA 3QHAA 5CH8A 1XMOB 1G7SA 1Z2NX 2Q5FA 2QW8A 3P32A 1UT8A 4R9RA 1EFUA 4ZVQA 1KSGA 4A0HA 1F3OA 4E1AA 1G7TA 1N8TA 2LNDA 3NWOA 4B3TB 1IQUA 3SSNA 1P1BA 5LXTF 4C22A 3O38A 2BFBA 3Q7IA 1VIMA 4O8CA 1S2GA 1YGPA 2PUHA 5EMMA 1XMSA 2VNJA 4MGZR 1GQ2A 4JEIA 4B7ZA 1EGVB 2QVLA 4W9MC 4BQOA 1JKXA 2BFOA 4WZBB 2WMOB 3OTHA 2Z5GA 3K2IA 1Y8ZA 3RUFA 1XRLA 1RPTA 3NANA 4CV1A 1E3DA 1D7AA 4DJJA 2HNBA 4LHWA 3T7KA 1D04A 3DBVO 2MSLA 1CKEA 2RFLA 2WLTA 4TSKA 5D3KA 1QG2A 5HP4A 1J1UA 1GL7A 1WF6A 2CNKA 1WHTA 3JWEA 3MPOA 3NAQA 4CN8A 4DRYA 2ISQA 2Q3HA 2WINI 5FI1B 2OYCA 2WD9A 3WMEA 4O4IB 1FIUA 3AG5A 4I1SA 4URXR 1C4WA 5JJLA 5F3WB 4OK3A 3BA1A 2BT4A 3UCXA 2CNLA 5J4HA 4YQZA 3TB4A 2PSJA 3U3DA 3HYLA 4M8IA 3HVJA 2IXAA 3HCPA 4ZI3A 1XAHA 4GEGA 4TS3A 4DMLA 3DZ8A 1OW3B 1ISRA 1G5PA 2QDXA 3H5AA 1L4EA 1O08A 2PS0A 4BFYA 2HPZA 2JG3A 2VDRB 3SM9A 2ENUA 3DO5A 1R9NA 3OBIA 4WAUA 2QTMA 3A58B 4GP7A 1WSAA 2JLAA 2PPVA 5ELMA 3C3BA 3IKVA 1DNPA 1NJSA 2QYHA 4QPDA 3CSSA 1O6FA 5ALOA 3WP1B 1F2TA 1YQ9A 2CMDA 2HJHA 1N3IA 2NTEA 1VDZA 3KQYA 2DCUA 2ZIUB 1G8HA 5GV8A 1J24A 5BR1A 2F9LA 2W00A 2XNDD 3ZBUA 1MOSA 3BD8A 1TM2A 1C81A 4LSWA 1JLLB 1U0BB 2AFVA 4NVRA 4JV5B 1LNSA 2JZNA 2OHHA 1Y1SA 1TQ8A 1NN0A 1RJGA 2B1QA 2JFVA 2P4HX 4IDEA 3AF0A 4WWHA 2H5LA 4G0QA 5DV9A 4ENSA 1CQZA 2RE8A 4KLZA 4JZYA 3TSAA 1O9BA 5TSDA 2FZCA 4C6RA 4DEXA 2SKCA 2WNHA 1KIMA 4KKVA 1LS1A 2ZJ0A 2FDXA 4E31A 4OQDA 3T3OA 2P2GA 1OGYA 5HKAA 3C1TA 5M04A 2NOAA 4ROTA 3NAZA 3EGDB 2PLRA 1RWQA 4KVZA 4YJDA 4WZAB 5EIAA 3WB9A 2O7VA 4Q9LA 4BP1A 3N9IA 3OICA 5G53C 4C43A 4YRKA 2BV3A 2PEZA 4N7RA 2W8BB 1AF7A 4BAZA 4WV3A 3ZD8A 2IPOA 2RMKA 3I1IA 2G1UA 2NSLA 3WK4A 4EY5A 4F2GA 3LC1O 1T36B 1V9LA 1YE5A 3RNOA 4C7MA 1RE0A 2MTBA 2WY2D 3U7RA 3DH0A 5EZYB 1OAKA 5BSVA 3R9XB 1SOVA 3FUTA 4G1CA 4S1NA 3TQQA 3SQWA 1T0PA 2CLIB 5JS7A 2D5CA 3LGAA 2O8EA 3OC0A 4QO8A 3WFZA 5LQJA 4AB1A 4C7JA 5CNKA 4Z1OA 4QECA 1BVUA 4UXHA 4PZ0A 4YI3A 2F8MA 4LPKA 5T3UA 4M7OA 3V7UA 4DXHA 5LZ2A 3IR7A 4E2WA 4B8YA 3N1UA 1KEUA 2QSUA 4F8YA 1CFJA 4OHVA 4BUJA 1IVSA 1EXVA 1T1GA 1YZFA 4NONA 3TSWA 1NSFA 1LX6A 4Q93A 1E2NA 2H54A 3D0KA 4FEGA 2OXCA 4XCQA 3DF7A 4TQ9A 1NP7A 1C8VB 2R65A 3OEWA 4DBLC 3L7AA 1HE8B 1YZVA 2AVDA 2PKQO 3ZPXA 4U7GA 3S8MA 2BMFA 5CX1A 4X20A 3PPWA 1RHMA 2J5KA 4DNPA 4L9WA 3EDMA 3PFNA 1DIBA 2O3QA 1ADCA 4HDMA 2YZGA 1W6RA 5BVGA 1DWOA 1JHQA 1JILA 5CTAA 5K01A 3DXXA 4H1UA 1SC1A 3H1FA 2IODA 2R8BA 5CBPB 2ZJ8A 1CG6A 5CRIA 2YQ5A 2FN8A 3D64A 4P4LA 1T9HA 5DZSA 4BASA 3H4MA 5ECGC 1MIHA 2QMUA 3WLTA 5E4JA 3BBPA 5JSFA 1V1RB 3LGSA 1YGYA 2JHCA 3KQOA 2YWBA 4KMSA 1GPH1 4DDUA 1QR2A 2LIPA 1RRGA 1PT9A 4HUQA 2QMZA 5FOTA 4D9HA 1U8TA 4P5EA 5GP1A 1Y6ZA 2B8TA 3UUGA 3DOHA 1QMGA 3ITDA 2CUZA 4M1WA 2GXQA 2QAJA 3BCUA 3EFOA 2WM8A 4L75A 5EP3A 3ZQKA 2K7ZA 3IAS6 5MDHA 1D0IA 1P3JA 1XD2A 5FLXA 3A1SA 3ABRB 2DWPA 4HX9A 1WB9A 4CL8A 4W5WA 1SQSA 4KMOA 1XTIA 3OZGA 3P9NA 3M6VA 4TRRA 4A82A 4KXFB 2DT5A 5AKYA 1EFVB 1LCIA 3PZRA 5CT8A 3TIGA 4LHYA 4FDAA 3I9NA 3B70A 1W4LA 1G2QA 1BKYA 5HIMA 1T43A 2PGNA 3OMXA 3VDRA 4FB4A 4HWGA 4TV8F 2D00A 4PLZA 4Q9JA 2YJ6A 2VH5R 1KYYA 3BK2A 3C16C 3QUTA 1XTKA 3AIOA 3FXAA 3GQBB 4MDYA 5HIJA 3NT4A 2A5YB 1N5KA 2OAEA 3OQBA 1OGIA 3BHJA 3QTTA 3ZE2B 2O5EA 4YMSA 4DLBA 2GA8A 3L1KA 4M2LA 1J42A 3NPAA 1HFEL 4TKLA 3F9IA 2WVJA 5ALUA 4M87A 4RYDA 3JQAA 3K5HA 1RAIA 3R7BA 4IIJF 4BRSA 2RG1A 4LE2A 5EOVA 3VHXA 5KX5F 1E2QA 4JLWA 1XDDA 4PG4A 1N77A 4KQ9A 3V2IA 1C0PA 1JHOA 1QG0A 5LA6B 3FIUA 4IFEA 5HQJA 1K86A 1Z8NA 1SKQA 3NRCA 5DHRA 4LJSA 5KZMB 1X7DA 2EOAA 4CEJA 1R8JA 1NAIA 4RLHA 5JLAA 3DZKA 3EIWA 2NPFA 1BEUB 4Y0VA 1FB5A 3VJRA 3PGVA 1KYZA 3TUIC 3NM6B 4CTKA 4LBZA 1DWUA 5L3SA 5G4KA 3DQPA 1AXEA 3S4YA 3VPCA 2P41A 1T5TA 2WWIA 4J3NA 4AUNA 5EGSA 2AFHA 2QS9A 2I80A 2ZT5A 3U4CA 4W5QA 3ENWA 8MHTA 4QEZA 4A2PA 3EZXA 4NV1A 4MZXA 2IQIA 2QUZA 4FWTA 2QD5A 1WRBA 4B82A 3EVAA 3KSDO 2XITA 4IMIB 4JASB 1L4GA 1N5DA 2GZ3A 4ZQCB 4F4FA 4CL2A 4KUHA 4HH1A 1JIQA 2B4AA 1DFHA 4JR2A 2YNMA 4QGGA 3UAGA 1N2ZA 2YVUA 3I1FA 4AF7A 3NP7A 1KC1A 3RSZA 1RI3A 2ERXA 2WMYA 1YI1A 2QG4A 2B2XA 4XD2A 2ORIA 2O3SA 1SBTA 3BIJA 2D1SA 2D6FA 1LU9A 1NZFA 1A2KC 2JAUA 4R2KA 1GDTA 4BYMA 3EPLA 3OZ7A 3VVLA 2G3YA 2J4DA 2JCGA 4L8VA 3ZU4A 3O1JC 4FHGA 4G5OA 5C1DA 2H1OA 1JH8A 2G06A 1TZ2A 4KIWA 3OKCA 4BQNA 2H1WA 4NYIQ 2JJYA 1F5NA 1P0CA 2FSHA 5P21A 3IA7A 1LI4A 3AVPA 3DMRA 4KFSA 4NZ9A 3SOPA 3WMGA 5ITVA 1KAHA 1BDMA 1NWHA 5A03A 1VPTA 4IHKA 1XZHA 4XSHA 2DU8A 1RBMA 1IQ0A 2PV0A 3HRHA 3R3ZA 3KWFA 2PE5A 4FFBB 5DCWA 5JSKA 3ZWMA 3ZHZA 4OSOA 4Y6SA 1UKZA 1V35A 2FK8A 2ZTHA 3VUEA 3SZ3A 3ADCA 3EVEA 4QDKA 1EUQA 2EKPA 4QRDA 1JZTA 4RVOA 3A6ZA 1MF7A 4G0MA 3IT1A 2OCGA 4O08A 2X41A 1DLIA 2J85A 4OH1A 2IIQA 4X1KB 3G9ZA 3OZRA 3KXDA 1GGNA 5D01A 4JT9A 4DCTA 2C2WA 3GRZA 4QGHA 3GN1A 3ZVMA 1SU8A 4RFVA 5I4BA 3V42A 1I3OA 3IALA 3OKFA 4GC9A 1DAMA 1FYXA 3QVWA 4KDRA 1DAOA 1Q77A 4YRDA 5EWJA 3A26A 4XWGA 3TBKA 2PQ2A 3IUPA 5JR3A 1YZNA 4NBTA 2QL7A 1ZGBA 1VHQA 2JBWA 3PWZA 2JW5A 4WKPA 1PDVA 1W1IA 2OFPA 2L82A 2PRSA 1G5HA 4XUCA 2CHQA 1PIWA 3RDPA 5KOHA 1ZG3A 5J2TB 1EMDA 1TC1A 1NY6A 1Q21A 1CUDA 1KEEB 5CYGA 4CYMA 2F6RA 2WZDA 2GN1A 1A2BA 1H9CA 4IIGA 2WM3A 3PGA1 4FEAA 2DTXA 3RFVA 4DUPA 4O2BF 4YUVA 4EB8A 3F8WA 1TKAA 1VJ5A 1OCEA 2WDZA 1KMQA 4TVBA 2WTEA 3JALA 1QQ5A 3L1IA 1XA3A 1FX0B 2CVHA 2O5VA 3EGWA 1XTSA 3FOZA 3WKCA 1RIFA 2GFIA 3NHBA 3LPCA 4GOMD 4ISCA 5DGXA 4WXMA 4IYRA 4CJXA 4QYIB 3U4QA 3A1VA 2XVZA 5BMVB 1FFSA 3CEHA 1RPZA 2WOOA 4AKHA 3GYBA 5JC8A 3SM3A 2VCEA 1KGSA 2BVNA 2FNAA 4KV7A 2PGLA 2XWBF 2RG7A 5BN3A 2GZMA 1YNSA 3X1KA 4KRFA 2YWEA 1E32A 3U3RA 2XUQA 4NOKA 1U0SY 4DVJA 5SICE 3NVMB 3HVUA 1IHDA 4IKEA 5KNDH 3HBMA 1JKJA 3IQEA 2NV0A 4Q1BA 1AO0A 3Q7TA 3WYAA 4R9SA 4IVQA 4DIDA 2WWWA 3N0VA 1W0JA 4RK7A 2YS6A 1GPBA 1ISHA 3P7MA 1BH6A 1Y7PA 4HDSA 3C1UA 2IYPA 1RXWA 4A8JA 1VE1A 3FVTA 4R2LA 2B5OA 1V48A 1W2GA 2BR3A 2BEJA 4UMEA 1KORA 2FH5B 1ZGAA 3IESA 3QVLA 5FP0A 4C2TA 5KAMA 5B2EA 3W3AD 2RI1A 2PXXA 2YYZA 3DV9A 1CDZA 3LP5A 2P4SA 4RC9A 2B2CA 3RIEA 1T1JA 2J3HA 1E2MA 5FAKA 1RWNA 2DHRA 1UPXA 1JTEA 1TM1E 2IUEA 2P2CA 2YCLA 5AKHA 121PA 4GM1A 5F5XA 2CNOA 3TSYA 3IAAA 1ZJYA 4JBNA 5ERXA 3R09A 4P38A 2DGDA 5I9SA 2PRIA 3A06A 3HJNA 2P8SA 3L4JA 3GLHA 4MQ6A 3TLMA 1VA4A 1YZQA 2JFGA 4ZOAA 1XDGA 5JZ9A 1M2OA 3TR5A 1XNHA 1Q7EA 2PUWA 2JATA 4B5LA 3SPXA 3GJYA 2GO7A 4MQLA 1GDHA 4OMFG 5IKEA 2M6RA 3MWEA 2DRIA 3OZEA 1ZMBA 3A9TA 2C4WA 4RDIA 1P2SA 2JHGA 1H0RA 3TVTA 1KYTA 2FQYA 1QK5A 3T7TA 3TLYA 5ALJA 1ACLA 3VR6A 3ESRA 4QHTA 1KXZA 5I47A 3EXEB 1XPOA 4WESB 5AVKA 3H5RA 4BZZA 2E1RA 2FMXA 1O4VA 1KPGA 4YNBA 4AUEA 4ZVVA 2HIMA 3I2IA 3R7SA 3RG8A 2XZOA 1Y1RA 1HEUA 1Y3DE 2AJBA 4URHA 3BHMA 2GCIA 3WHPA 3M6UA 2QTTA 1FXSA 3ID6C 4IMRA 4F11A 4IDHA 2YWGA 1A76A 2A1TR 1ZNWA 1JWBB 2VWPA 4WLFA 1ZOPA 2JGDA 2QY9A 5M7EA 1X7WB 1K3TA 2JGMA 3GFTA 3H2KA 3JVUA 2H2FA 4H1HA 4WK4B 4BUCA 1Q44A 1C4KA 4F8EA 2UDPA 3UA4A 4UAGA 2AZTA 4RELA 4DMUB 2PAAA 3IOMA 4ED9A 4YT2A 2QQ5A 3CC8A 2XE8A 2O19A 3NVAA 1MX5A 3TI9A 4IUCS 3IPLA 4LY9A 4ONEA 4F4DA 1GZVA 2C78A 2XIJA 4H3HB 2Q3LA 1NVKA 4MHOA 4TKUB 1ZM2A 4GE3A 4NX2A 5HPYB 3WTBA 1Z2DA 4QA9A 2R6R1 5LBTA 1CDEA 1OHHD 1Y5IA 2XWJI 4FSHA 1W36C 2FPGA 4BPRA 1IN4A 2EEPA 2GBLC 5CFRA 4G09A 5CG1A 3C6XA 5ILOA 2HSJA 1TDJA 3ZE1B 1UWKA 2XYGA 4IWNA 4PF1A 5BN5B 3W6UA 2JJ8A 2HBYA 2IQ5A 4AKEA 4C7BA 3W5IA 4AECA 4UM8B 5K0JA 3BSSA 2CF5A 2F1HA 3HKBB 1Z5VA 1LD3A 5LQAA 2IIBA 3BD9A 4LVCA 4Y6QA 1AMNA 5IUKC 3AESA 1FLVA 3DL2A 2VDPB 3K31A 1OI2A 3O84A 3VH2A 4DRXA 3IIEA 1R5JA 1ZQ9A 1D2GA 5BNTA 2W48A 4RAQA 1SVKA 2GSDA 2VYVD 2Y9MB 5MHTA 4HXEB 1P1KA 3A8TA 1Z25A 4HC4A 4ZYLA 2AG8A 2FW6A 2ZWPA 3FMVA 2R5NA 1ULZA 1IUKA 1FYFA 5AQ1A 3ADPA 4Q5IA 1RRPA 1XP5A 3Q3VA 1PLLA 5K3BA 3L7MA 3BGDA 3MFQA 3ZE8A 3LT1A 4RMIA 1IN7A 2HN9A 4J7XA 4JX8A 1NVFA 1RWMA 3GJ4A 3U39A 1SUFA 5BSUA 2XQKA 4QLBA 3P94A 4K6GA 4MWOA 1QGZA 1WPRA 5JDIA 1U1DA 3JASA 3L4EA 4TMYA 3TIIA 4I2VA 3W4IA 3Q8LA 5DT2A 5FH9A 2ZZKA 3N2IA 3I73A 5BQPA 2DWCA 3GHHA 1D6SA 1VGRA 2GHQA 4NHOA 1GLNA 3L9XA 2IGTA 2W9XA 2YWRA 2PZFA 1FNMA 1KKMA 5LP6A 5AJYA 3PG5A 5F7JA 4ENTA 1Z08A 4J0IA 2O23A 4RK4A 2Y0BA 2ODEA 5LLSA 3L5KA 1R00A 1JLSA 2I2FA 3DXZA 3QWAA 1A50B 2PMKA 4ARAA 4HYEA 4U5QA 2HBQA 4NU0A 1L4UA 5HE8A 1TCCA 1YOVA 2ZJ4A 1JG7A 4PYOA 5EJGA 1XCLA 5IVIA 1JHUA 4RZSA 2VUSA 3RR2A 2PKYX 3AIKA 4EYSA 3U6KA 3R2JA 3T9CA 1Q5PA 4KXYA 5DHFA 4AM8A 3R40A 1DX4A 1R10A 3NETA 4C06A 3NBMA 2ZVPX 2P2YA 4YIKA 1GZ4A 3KR2A 2DJIA 3MERA 3LKDA 3NHJA 5KQRA 2X4IA 4TLDA 3FYCA 2WBLC 3U5ZB 5AI8A 4YV1A 5IT4A 4FYYA 1K89A 1QVZA 1QR6A 3OLYA 3P8ZA 1RQ7A 2FR1A 4MWEA 3QE9Y 4OHUA 5FOQA 5JSHA 5JO0A 1HURA 1Z28A 1XXHA 2OK7A 4FGUA 4IJUA 3FNIA 3OE4A 4FWIB 3P1JA 4MVJM 3NJ4A 4FMBB 3IJRA 5F3DA 1SZCA 2CCGA 1KZ4A 3DWEX 4NENA 1KQ3A 1YZ3A 3GH3A 5FCDA 3U7HB 4HPJB 1K7SN 2QRJA 3AUAA 2YN4A 2Y76A 1PVVA 1J5PA 2QM0A 1Y3BE 4O6VA 1WPGA 3AP1A 3S5JA 1G5IA 1QZ3A 5FUWA 4DJDC 4LMBA 1NNLA 3OP1A 3L3BA 5HCIA 1GN9A 1TO2E 4NCBA 3V2GA 4MR7B 3PNPA 5HTOA 3BEOA 4EJ0A 3FPCA 3JD2A 3F46A 1I0LA 2GDZA 4HRAA 3ER9A 2WJWA 3TNLA 3GA5A 2OCYC 3I6IA 4U3JA 4PHHA 5E6SA 5F64A 4ALLA 4ENQA 1T8TA 2D2FA 4F9GA 3UBMA 3F8TA 4DQVA 2W6ZA 1M10A 2V97A 1VLJA 1VC2A 4ETWA 4BFTA 4C5BA 4KW7A 5KU7A 4Y6PA 3UN1A 3WR5A 2JPDA 1JS1X 3GR6A 4WX2B 1N57A 4M1EA 5DGIA 3NKVA 2HU5A 4QM6A 3DR5A 5E1OA 4ZHQF 3IFSA 2CL6X 3IQHX 3DOFA 1U8XX 3PPXA 4JGIA 4RO0A 2ZCUA 4EKEA 2CVPA 1DCTA 3NX4A 2I2DA 3TXXA 1XJCA 4KPYA 5JZOA 5JW6A 4XX0A 3WLIA 3QELB 5FBLB 4ACAA 4CF4A 3ZCRA 4Z4HA 5K6AC 1FTGA 1Z6PA 2DQSA 3LC2O 3WMWA 2ZG6A 3HXPA 2E6KA 1VL5A 4IDCA 2PLNA 2RCNA 2X9QA 4R81A 1BQ3A 1VHJA 3LNTA 1VZ2A 4D92A 3GBVA 4U9HS 2UUCB 1X3SA 3GRUA 5C4GB 1DI0A 1UBNA 1XEFA 4E4TA 2J7KA 3AOGA 1H2HA 1Z2CA 3UF0A 1JN0A 1KMHB 1BE8A 4JC4A 4TUYB 4A6PA 1GAQA 2I4MA 4JSRA 3C3MA 2P9JA 3P96A 2I22A 3QM1A 3F9RA 3I23A 1Z7GA 4FOSA 5EHIA 3ZS9A 1W4RA 5BOSA 2NXNA 4CM3A 2G5GX 2EJWA 3L1HA 2OFWA 3Q0TA 1UCFA 1SUPA 1ZSVA 4KVFA 4N5HX 2NU7B 3OE5A 1L7VC 5CB8A 4QDZA 1MORA 1XAJA 5B7NA 4GPD1 1IXSB 3I4FA 3WGTA 1ECLA 1GITA 1P4SA 1JIVA 1K27A 1PWXA 1RAGA 1S2LA 2CNWA 2NYRA 3FMGA 3KPYA 4YJHB 4D6YA 4ZOLB 2YYYA 1TQHA 3VM6A 4AJ9A 3QH4A 2VUIB 1XE3A 1NONA 1YJAA 2OBLA 4NBVA 3OWHA 4I55A 4R2MA 1QQ7A 1QVWA 4YRAA 1GD1O 3TNDA 1TZJA 3OU6A 4XDHA 1VB5A 1DFGA 1VP3A 4J6FA 1L1EA 4BQPA 5KBYA 1XQWA 3ZH2A 5HIAA 2Q6OA 2GJ4A 4JXZA 2GHTA 3FX2A 4LXYA 4XSVA 4O4IF 5JSZB 4XQ0A 1EINA 1MQ9A 1R1DA 2X8BA 3VYTB 3OURA 3P26A 1HE2A 2ZP1A 1A2OA 1Q19A 5EYPA 4YRMA 4OATA 3VX3A 4JI4B 4HDKA 3ONWA 2HBRA 4I4LA 3WKBA 4EEZA 4EJSA 4N3NA 4O1HA 1KVSA 2V6FA 1FDRA 1XZBA 3OQHA 4EF5A 1LRLA 1U2PA 2RHGB 4MEBA 3U7QB 1OLXB 3ZLBA 2NXEA 4YRLA 2W7TA 3I04M 3QKRA 5FJIA 3PNMA 3ZNQA 2YFHA 4D9EA 4OP3A 4EW3A 5ALTA 1PG5A 3P27A 1GTMA 4Y2RA 5G40A 3K1ZA 3E0QA 3GRAA 2IHBA 2O7QA 3STHA 1S3IA 3DL4A 2FWIA 6Q21A 5F1KA 3OVMA 3TG2A 3WZ2A 2P3OA 1HYBA 5JRDS 1S5PA 1ZU4A 5EIOA 1VE3A 1HQKA 2P30A 1Q2UA 2D5LA 3KT3A 3MB8A 3P71T 1IZZA 5HTKA 1B43A 1DAKA 3ELWA 4MAAA 1HTWA 1MENA 3E6AA 4GOKA 5FPTA 4HJXA 3TE7A 4JJIA 5ARCA 4RL4A 1I5OA 1F0PA 3VOBA 3FLAA 3WAGA 4YRBA 1RKVA 3C70A 3MJDA 2IP4A 1CP2A 4MK4A 4AY6A 4TT3A 1T0HB 1VZ3A 2Q7XA 1GNLA 3MOSA 3NEPX 4ND5A 5EKUA 4AI6A 3FYUA 2XRMA 1GADO 4R83A 4YASA 2FOXA 4RIIA 5E7JA 1C3LA 1QB7A 2B35A 3OC6A 3T9BA 3A4TA 2Z1MA 3I2HA 3GELA 4KUGA 5H4GA 2BP7B 3T4UA 5ALEA 4DGQA 2YHUA 2Z5LA 1GA6A 4R1NA 3IEVA 2OV8A 3ND7A 5EJ7A 5BT9A 4BFCA 5JASA 3AY0A 2G0AA 2BFFA 2VYQA 4YMWA 5CFLA 2FPUA 2I6QA 5GJCA 4E5SA 5DLYA 1UQRA 2NPOA 3MS4A 2A3NA 2ECFA 3FRJA 3PLRA 3FOAA 4X3CA 3HM2A 5EZYF 4BNDA 1N3LA 5ITWA 3VVMA 1WB4A 5JVDB 2TYSB 3DCJA 4ZO9A 3KLPX 3RYFA 1JA0A 2ZRAA 4IDFA 1I0ZA 4D9BA 2FPWA 1BVRA 5EVJA 2QX4A 3L0ZA 4KO1S 2OBYA 1Z4JA 2DUNA 2NSJA 1DAHA 5K5EA 2QRVB 1Y37A 4REMA 5KTKA 3RYCB 1WXDA 3RUPA 3K71B 5CYFA 1X1CA 3CUYA 3KFLA 1GU0A 4NAVA 1X15A 4GGPA 2GEJA 1VYTA 1KA9H 3P9RA 4KAFA 3VSEA 3R5HA 1ORRA 3RRBA 3G2JA 1V7PC 3H84A 2QJFA 3NTUA 1PWZA 1E5XA 1NKSA 3TAHA 3NDBB 5B1YA 2FGKA 4K3VA 3T1OA 3OBBA 2QAIA 4N4AA 1DX9A 4Q4JA 2JFWA 5JCOC 3VR6H 1U90A 2VZEA 3SDZA 4Y9SA 2ONJA 1XN4A 4HLQB 4B2IA 3C87A 3L8DA 1N2HA 4RW0A 1EX7A 4B2LA 4JMPA 4WLOA 5HFJA 1W75A 3I62A 5H1YA 3EXIA 2Y4NA 3BKXA 3NYRA 1H1LB 1F4LA 3TLJA 4DWOA 1P7VA 3URKA 4BWYA 4JJKA 3OFND 3KU1A 3UHOA 5SYAA 5JTUA 5A5DA 3HVIA 1M73E 1W0KA 1MB4A 4OHFA 5AFSA 2GILA 2QJWA 4G89A 4M1OA 2OLEA 5ALKA 5IBQA 2EGUA 3UUEA 1EXWA 1XF9A 3FOBA 3MWFA 4OKIA 1CRZA 4DQUA 4PNHA 2IOYA 2A88A 5JTTA 3LU1A 3PEFA 1VHTA 1YRBA 4ENVA 3D5EA 4UAUA 3RWMB 1IIRA 4I50B 4WW0A 3ZXIA 1N0WA 4D9JA 4OHMA 4WI1A 1PJRA 3GEPA 1TC2A 3MRVA 3GV0A 1R0KA 3L7NA 2DAPA 4YV2A 3SC2B 3UK2A 5KTRA 1PF7E 1IWOA 2W71A 3W7BA 5ICGA 4RMJA 2BD0A 2FUNB 3QNMA 1JG6A 2P7IA 1MRSA 3G0DA 3B82A 4FZVA 1A72A 5C46F 3QKTA 3UMCA 2IH2A 4HEA1 1F5SA 4B6EA 1FP6A 1ULTA 4RHUA 2DKNA 5EWMA 3MBKA 5F4ZA 1QTRA 2J6IA 2QVGA 1U4SA 3L18A 2OMKA 3V7YA 1VJDA 3X1ZA 1D2RA 5BQ5A 3VZCA 2KQUA 3FPEA 2ZRFA 3PFHA 4ENPA 1O96A 2I65A 3LH5A 3DE5X 2D1FA 3AEYA 4J43A 3V8PA 3DDOA 5J4YA 4C4OA 3ESQA 1QAOA 1MAWA 2XB6A 1NSYA 3DUFB 2VJMB 3LRXA 5C8VA 5K3FB 5G0WA 4KLCA 3K4PA 3KKPA 5EEHA 1DG3A 4RGBA 2PD4A 4ZVOA 2W43A 2VHWA 3RLIA 2PLWA 3BEDA 3MJHA 1HORA 2YVAA 4WT7A 4ARZA 3ZKWB 1UANA 4R71A 3PR2B 1ZVKA 4IQFA 2VQSA 5LA6F 5LJLA 4FJ0A 3K0AB 4V0ME 2CSXA 1G8KA 1UXHA 3RTAA 1FPQA 2BKLA 3KYCA 4R6WA 3LWBA 2WSBA 4M83A 4P82A 2I8AA 3I05A 4NBSA 1KI6B 5G0VA 1Y1QA 1OX5A 2OG1A 2ZYRA 4JNCA 3H86A 1NN3A 2H1HA 1USGA 1GIAA 1M2VA 1SG6A 1SPBS 5G3ZA 3AJ9A 4OXIA 3WHIA 2PMBA 2P9FA 3KK0A 2R86A 5FUBA 1O6GA 2XLBA 5HF9A 2OBXA 2YX1A 2QVZX 4AG3A 4X8LA 2YY5A 5CXQA 3WGIA 2P62A 3GEDA 1KTIA 1AKYA 1RBQA 3FKQA 1SPXA 1XMIA 3IAHA 3BM5A 3NTOA 5ESWA 4F9TA 4HOYA 3NIFB 1WUKS 3WMRA 4K0RA 5JBQA 1BJKA 4Z53A 2OCLA 3D0QA 1PFGA 1Q1NA 3W8FA 3BMCA 3DB1A 5IYZB 3KLMX 4CMIB 4LJRA 4LN1A 2VT3A 4E2XA 2BHLA 1EFTA 1TU4A 2HJVA 3AX6A 4ZARA 1LBIA 3KELA 2VPQA 3UIEA 1OU4A 4EMUA 3G0CA 4JVLA 3QEKA 4LHXA 1LVGA 1NUAA 4MGIR 4NOMA 1DIGA 4AJKA 1IBKB 2FP4B 1OB2A 4WCFB 2O14A 5CURA 1DSSG 2Q6VA 4DWJA 3K94A 2W4MA 1AQ6A 2B5WA 3AUJB 4IOKA 3FKSA 1ZHHA 3ZD6A 1MT3A 3QVSA 2AI2A 3H5LA 5AW9A 4MGEA 3SYRA 1W4ZA 3B6EA 1FFGA 3UXHA 3T7IA 3WLQA 4BGEA 4WTOA 2AIRA 1L5YA 5BV1A 4L8LA 4OFWA 3B7PA 4EENA 4P7BA 2RHOA 5KJ1A 1JPJA 4UM5A 2IIVA 1KJYA 3R5SA 3T4PA 1U2RA 2Q45A 4KGZA 4RPCA 3SZRA 1ODCA 3BDAA 1MJGA 1YQTA 2PGJA 1U6JA 3BL5A 1INLA 4PLHA 1K7FB 2ZUUA 1PSDA 2CXUA 3CLTC 3KQMA 3NOOA 3KQKA 4WA7A 2RBKA 2GN0A 3FFAA 4J0CA 2OCXA 4FN4A 4JMLA 4JQCA 5TQVA 2CZGA 4BO2A 1UC8A 2PRKA 2E5WA 4DMKA 1W76A 4B6SA 1FP4B 1ZLXA 2ETVA 3A3PA 1YKFA 3O0TA 1T8RA 3S6JA 4PRLA 1XTPA 3UJ6A 3IOBA 2ZRQA 1I4OA 1U3WA 2ZBVA 4UPEA 4O25A 1WPXA 2IXGA 3F9CA 3L6EA 4L57A 3SJBA 3OOSA 1NMXA 5HILA 4OAOA 4MMYB 3URMA 5E3HA 1GZ7A 5DP2A 5HW0A 4ZAFA 3EMBA 1ADBA 5KOYA 1Y9JA 1UUFA 1XZJA 4LGMA