5IRCD

P190a gap domain complex with rhoa
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
178
structure length
170
Chain Sequence
IRKKLVIVGDGACGKTLLIVNVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Rho GTPase-activating protein 35
publication title Deciphering the Molecular and Functional Basis of RHOGAP Family Proteins: A SYSTEMATIC APPROACH TOWARD SELECTIVE INACTIVATION OF RHO FAMILY PROTEINS.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 55
structure length 170
sequence length 178
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ircD00
2F1IA 3KJGA 5FTKA 1EXMA 3IBGA 3PEUA 2H7VA 4UXHA 1US8B 4Q5IA 3IEUA 1OIWA 1EFHA 3FTQA 4JL8A 1DEKA 1D9XA 1TU3A 4BFXA 1K5DA 3BWDD 4Q1FA 2HJVA 5EZ5A 1KAOA 4OJQA 4X8LA 4QBGB 1KY3A 1S8FA 4OYHA 3CONA 1ZM3A 3TAHA 4PQFA 3BH0A 1XJ0A 4LJ4A 3GJ3A 1DO2A 2OCBA 3CZPA 4PC6A 1NLFA 2BBSA 1JJ7A 1MABB 1Z6XA 2PH1A 3D8BA 5HE8A 5JRJA 1W4CA 4GRAA 4U00A 1G19A 3O8CA 1ZU4A 1D6JA 2R6FA 1KI8A 4JL5A 2VHCA 1D2EA 2VIIA 2RMKA 1W4BA 2FFQA 1JR3E 2YV5A 1Z2CA 5CDFA 3DOEA 5C46F 3HPQA 5HPYB 5DH9A 5FUVA 1E2IA 2GXUA 2NTYC 2IWRA 3FB4A 5CLQA 4MYCA 3CKLA 4MUBA 4IRUB 1R2QA 5GJCA 4KFRA 3QKSB 4OQLA 1S4QA 3TVTA 2BDTA 3T34A 3HR8A 3UPUA 2CK3D 3UXMA 5G40A 3ZD7A 4Q47A 4PO9A 4MGKR 2ODWA 1JNYA 1KKMA 1KDPA 2CK3A 1KNXA 1W48A 2YKGA 1GNRA 3ECCA 3WMGA 421PA 2YC2C 3NWJA 2ZUDA 1RIFA 4DKXA 3W8RA 3VAAA 3KXLA 2C8VA 5FBVB 4DZZA 3GQBA 1TX4B 5FR2A 4BGDA 2ZRMA 3PENA 4DHEA 2REXB 4EFMA 1NBME 4TZ6A 3L2OB 2ZJ8A 1DE0A 4UJ3A 1KGDA 4BFVA 1OXSC 1F6BA 3M4YA 1FFHA 2KBEA 3NEJA 1R4AA 2ZAOA 4IW3B 4B6EA 1XXHA 1XMJA 3ASYA 3MRSA 2CJWB 4ZCLA 4M2LA 1JB1A 2FX3A 2JJ2A 4D4JA 2WICA 4OK5A 2QP3A 2RGBA 4DSUA 5BXQC 3IPYA 3G5UA 2FF7A 4K81B 1ELOA 1NMXA 4DDWA 1XWIA 2FFHA 3LNCA 2CCGA 2FEOA 4V0MA 3KFXA 4EKDA 5F98A 4JSTA 3EAQA 1W2HA 4W5JA 2H16A 1P61B 1R0WA 4UXJA 2X2FA 4QBIA 2B7BA 1KK3A 3KKNA 2GJKA 2OO7A 3EPKA 2FZ4A 1ZD9A 4EQ6B 4DUGA 1R8QA 2PCJA 2WVJA 4PO1A 1CKEA 1OHHA 1T3HA 4A0HA 3R8CA 4KXFB 1E1RA 3U44B 4KCGA 2GJ9A 1MO4A 2QU8A 3UMRA 1VDZA 2RKOA 2REBA 3L0IB 1NL3A 3QXXA 4Q7JB 3EZ7A 3WRYC 2O8CA 1NVXQ 2WZQA 3I73A 1UPTA 5JI3E 2WWWA 2RGXA 2QBYB 2VP0A 4OJKA 3I62A 2J0UB 4TLEA 4JBWA 5H68A 3ZQJA 1QHHB 3K70D 2AWNA 2NPFA 5EQTA 4LHXA 1AGPA 2ZRAA 1I4LD 4DB4A 4XTCS 3HU2A 1QBKC 5L3SB 1KK1A 2JEOA 1CS4C 3QOFA 1ZJ6A 1Q20A 3DKPA 4TMKA 1E0KA 5JJIA 5E7IA 1HYQA 4KBGA 1GKYA 3RS7A 1ETUA 4IFBA 3H4MA 3J81k 4B3DA 1CLUA 4DBLC 4XSHA 1QVRA 3G0HA 3K0EA 1SKQA 1RYFA 4HLQB 3X1XA 4HDCA 4BWYA 4CEJB 1UM8A 2ZRHA 4B3CA 4F38A 2ZU6A 5CJ2A 1C1YA 2QT0A 1G7RA 3NHBA 4Q4AA 2CLCX 3U3MA 4V0NA 2YOHA 1SVWA 4Q1BA 1AM4D 4NYJQ 4CT5A 2F3RA 1Q22A 3KX2A 4C0BA 3GJ6A 5EUMA 1BO6A 1W0KD 3LBIA 2WIBA 2CLDX 3TK1A 4I81A 3VFDA 1LF5A 3B1WA 5LBIA 3SC3A 4A2PA 1NG1A 1UFQA 3BS4A 4RSGA 2V9PA 2QL6A 3AH8A 4DXAA 1CEEA 4DIDA 4PTLA 5L3QA 4JSYA 1TTTA 3I1FA 4DLWA 5JFGA 3K9NA 3W5JA 1XEXB 2QAGA 2ZI9A 3ZGXA 2HUPA 5FTNA 2F43B 3MWYW 2OSBA 4D0LB 3KTAB 3EC1A 3FWYA 3BE4A 4TLDA 1ZIOA 1OIVA 1J70A 3HP1A 5GVSA 3I61A 4G5GA 2JJ1D 4Q9HA 4ZCMA 2AD5A 5FOSA 2WWIA 3MMPA 4IOJA 2WJVA 2FEMA 4B2LA 4UKDA 5JECA 3R7WA 1EX6A 2QORA 1L4YA 1SVKA 3KQLA 2W6IA 1XTKA 2FOLA 2LKCA 3IIJA 3P26A 5TMPA 1NG9A 1II0A 4YONB 5AR1A 2QE7A 1XTSA 1Z5ZA 4G5SA 1M7GA 1DS6A 2AR7A 1G291 3X1WA 4CEIA 4RD1A 4F93B 4EPTA 3THWA 2ZJOA 2QTVB 4HDOB 1GOTA 4D80A 2RGEA 3RVBA 3BOSA 4ESHA 5BN4A 2A9KA 1XD2A 5CLLA 2OXCA 4TZ0A 3LQRA 1YKSA 4LSGA 1UDWA 621PA 2X77A 4UJ5A 3PG5A 3SN6A 3L0PA 4HATA 2OLKA 2DFKB 4S35A 2VTKA 2PZEA 2ZYTX 1Q12A 1J90A 1QRAA 2ZUBA 5J40A 3WNDA 3GLFA 4RD6A 3ZYCA 4PO8A 4BFYA 4M9SA 4PSVA 4LHWA 2UVQA 2ZE5A 2XX3A 3EASA 1K6MA 4JL6A 3EPHA 1E2QA 1DG1G 3AVVA 1P72A 4TTPA 3QKRA 1B23P 2ECKA 2ZYWX 5J4HA 4R7ZA 4HUTA 5JMTA 2WSSD 721PA 4IDNA 4YXWA 1QF9A 2V7QA 3QVUA 2GRJA 3SBDA 3LY5A 2YYZA 2WSSA 3EG5A 4YDHB 5FI0B 3GLHA 1G6OA 4NZYA 1VTKA 2QM8A 4Q9KA 1QHSA 4AIIA 2ERYA 2ZI4A 2YZ2A 2J1LA 2CHQA 3K53A 5KPJA 4A2WA 1NLYA 1N6RA 1P3JA 5KHOC 2GEVA 5KPDA 2ORWA 3CWQA 1W47A 1W2GA 3KKMA 1EWRA 3MWLA 2JLVA 1RRFA 2Q9CA 4YLGA 3W3AA 4DCNA 5FOXA 5J4YA 2DR3A 1DAFA 3WHLA 3AVQA 5K8TA 1OH5A 1PZNA 2J46A 3A1VA 1Z0AA 1DG3A 821PA 1R0XA 4JYCA 2QMOA 1GL6A 2R62A 4QC2A 1P2VA 2J0SA 3OF5A 2AD1A 1KTVA 2FSIA 3ADCA 3CIOA 2ZIAA 5ANRB 2RGCA 3EC2A 1OH7A 2OFOA 3LW7A 2GVDC 4MDFA 3RS3A 1D9ZA 3ICQB 1E79D 3IHWA 5E3HA 1ZW6A 4ZIRB 1N6LA 2D3WA 3BJIC 4C2TA 1E79A 1OXVA 4P0TA 1AS2A 2XSZD 4R2HA 3U4QA 2CEAA 4M1TA 2C99A 4A8JB 4WA7A 2OEPA 4O0MA 3KL4A 3MGCA 2ZRFA 1SXJC 2HLDD 2XSZA 4JVMA 4LRWA 4B6FA 3GFTA 3QUSA 4I1VA 4ZDIA 3D7MA 3BORA 2IHBA 1KZ7B 1F5NA 1KDTA 3F0TA 3MWKA 2ZRGA 2BEKA 2XTNA 2IEZA 3HYRA 4L15A 1KMQA 3IILA 2IYQA 4KFUA 3FMPB 3GCGA 1IOZA 2K5UA 2O5VA 1CIPA 4DJTA 2XAUA 1M1YE 4HAZA 3AF0A 4WZAE 3CRW1 5TV2A 1TL7C 2ZI6A 4Z8XA 3M0EA 3PITA 4U02A 4DT1A 1E9DA 1Z0IA 1Z28A 4BFTA 5BN5A 5J47A 2IYZA 2RGGA 2Z5FA 5D3MB 4WZ6A 2PZGA 2A78A 3WBKA 1JXOA 1TF7A 1E2GA 2HT6A 2HYDA 2OLJA 1XEFA 3TW4A 4BFZA 3TSZA 1V43A 1WMSA 4HLDA 3PEYA 2CJWA 5FI1B 5G3YA 1NN3A 1YU9A 3D3QA 1BOFA 2CL0X 3RC3A 3O8RA 2ZEJA 5SZKB 5C4MA 5C4GB 2Q3FA 1CTQA 4B34A 1E9SA 1U90A 4UNRA 4C7OA 2W2TA 5DGXA 1OXTA 4B3BA 5H8WA 4YMUA 1KJYA 3VHLB 2MMCA 5KTYA 2HV8A 1WP9A 4ASUD 1GKIA 4KFTA 2BBOA 1GVNB 5EXPA 4P4SA 4RZUA 3VX3A 5FOTA 2HJGA 3JVUA 2ZETA 4C2UA 1ZUNB 1FX0A 4C0AC 5KU1A 4OBEA 5GJVC 4V0LA 1M8PA 4BZQA 3AKYA 2QTHA 4BFUA 3VU9A 5CB6A 4F4CA 1DVRA 2VO1A 5GVRA 2OE2A 4KYUA 3EXAA 5D3QA 3QXCA 1U81A 4FXPA 3THYA 4HLUA 2DWPA 4NE2A 1K8RA 2ODEA 2DBYA 3SFVA 2V6IA 3AVOA 5KSOA 4BRWA 1JPJA 5E4FA 5L8VA 3I8XA 2J0UA 1FW6A 4Q1EA 4FIDA 1AK2A 121PA 2FPMA 4BZPA 2XZOA 3AB3A 4TLCA 2XB4A 3NDPA 4JLNA 2B92A 2PEYA 3RSOA 5B58C 4Q7KA 3CW2A 4LY6A 1NI3A 1G4AE 1G8GA 5L3SA 3O8DA 1GAJA 1MV5A 1Z3IX 4IXNA 3SEAA 4CEHB 2XNSA 2FWRA 4IJMA 3X1ZA 1UEIA 2QMHA 5DYIA 2IYLD 3TNFA 2YJTD 1YZQA 3PEVA 2VQSA 4RD3A 1A2BA 4PC3A 2ZXUA 2NO6A 4KSBA 4Q4HB 1TF5A 4A1FA 3MJRA 3CUEF 4NCKA 4US0R 2A7QA 1H65A 1SVIA 5TB5A 1FZQA 4ZI2A 4IDHA 3HPRA 5JSZA 5AK0A 2LKDA 3AV0B 2GCOA 1I2DA 1W1WA 1GP2A 2GCPA 1R5BA 5KDOA 5CYPA 1BH2A 1R0YA 1YE8A 1G8FA 4ILEA 1LV7A 2PT7A 4MGYR 1TQ6A 2D7CA 4CW7A 2W00A 2GJ8A 5FBRB 2ZSBA 4AYXA 2A5GA 3BH7A 2J0QA 1E2MA 4Q4LA 2BMDA 2IA5A 2D7DA 2BOVA 2IF2A 3ZIAD 1KMHB 4GNKA 3JVVA 3HWSA 4BLTA 2F43A 1ZIPA 2OV2A 5DO9A 1OYYA 3B82A 3ZIAA 3ZQ6A 4QJ5A 4JMPA 4QNRA 2B7CA 1KYIA 3KTAA 2PJRA 4M1KA 4PSAA 1NVWQ 4QHTA 1VG9B 2CNWA 1PV4A 3I5XA 3ZLJA 3NBFA 2O8FA 2XXAB 1CRQA 1JALA 4KAXA 4NCJA 4URZR 3QNUA 2E9SA 4DLUA 1X6VA 3RABA 4AKHA 3CPHA 1FUKA 5TVKA 2QENA 1Q0UA 2N42A 2AKAB 2BCGY 3VHXA 2CDNA 1DAMA 3BXZA 2DFNA 1P2SA 4QM7A 4NYIR 3D31A 1Q1EA 2ERXA 4PZZA 3T5DA 4RVCA 2G0NA 3SR0A 2IYRA 2G0TA 2FJUA 4ITRC 3VR4A 2ZQ5A 2IBMA 1A5TA 4TQ9A 3M1IA 1IJEA 4IVRA 2DPXA 4TL8A 1YZTA 4LV6A 5HCNA 3V4FA 4ACAA 1KI2A 1P9NA 1VYVA 4Q1DA 3ZVRA 1ZM2A 1ZCBA 4GP6A 4MRRA 2O52A 2VLIA 2F6RA 1TPZA 1FNNA 1XP8A 2VP4A 4TN1A 1T5IA 1G5RA 4GT1A 4JKIA 4MKGA 1LS1A 5GJWC 5FTLA 5JLJA 3K70C 3BIFA 3KKOA 1W36B 4TTRA 2JGNA 5L3RA 2O0KA 1NIJA 3OIWA 1W0JD 3U3JA 4NBSA 2VEDA 3SYNA 4OQFA 1S3GA 1XX6A 4IHQA 1A4RA 1GZSA 3WYGA 3SI7A 2A5JA 5E95A 1WA5A 4P4TA 2H57A 5AUOB 4RY2A 4B71A 2NIPA 2BBTA 5CM8B 1UKVY 5CK4A 3DMNA 3UWKA 4ABYA 1QG2A 1QHYA 3DMDA 4TYQA 4D4MA 2QP4A 5IK2D 5KO2A 3THXB 5JHGB 2JLXA 2PZFA 1R8SA 1AQYA 4JT2A 2KI5A 4PFSA 2BKUA 1I4DD 3O8BA 1EK0A 1CJMA 1G8PA 4HAWA 4ZI3A 5AUPB 1GNQA 5FPKA 3FOZA 2J59A 4X8HA 2NMVA 2NOAA 5C1BA 2TMKA 3SNHA 2DFLA 3CPJB 4A36A 1KAGA 3KQUA 3BK7A 2J3EA 4US2R 4EDHA 2QM7A 1FQJA 4G5QA 4OL0A 4TYYA 3K0AB 1SHKA 4UQOA 1CJTC 3K09A 2MSDB 4W9MC 1YR6A 3QQ5A 1FP7A 3W5IA 4D0GA 4AK9A 2P2LA 4Z8YA 4NHOA 1OH6A 1KOFA 2HCBA 4G3XA 5FPTA 1UKEA 2G1JA 2O8EB 1M7BA 2IUUA 1HQCA 5FL3A 4LBWA 4DCTA 2ZU0C 3QEJA 4URWR 3RRZA 4EIWA 5FUYA 3GP8A 2NQ2C 3GJ7A 4NDZA 3N5CA 4HUQB 1Q44A 3DKVA 1H8HD 4PHGA 3P4XA 2F55A 2V54A 1KO4A 3IPXA 1RJ9B 5TARA 5LDDC 3K9LA 3CRMA 1ZVQA 1H8HA 5JS7A 3SZRA 5CK5A 2PL3A 1C9KA 3WRXC 2HCJB 3EZ2A 3OIUA 4NYJR 4TYNA 1DO0A 1OIXA 2GK7A 2OBLA 4NYMQ 4Q1CA 3CH5A 1E69A 1J99A 4U5XA 3SBEA 4DRZA 3DZDA 3N70A 4NL4H 1P4SA 1UBGA 2AXNA 3AVYA 3GLGB 1FL9A 2Z6VA 1NMYA 1G3UA 1G5TA 3K0FB 1UKYA 4JIMA 3A58B 5FPYA 4PQYA 3AP2A 1XCMA 1D8TA 2WV9A 2IYSA 1B0UA 1N25A 1KI7A 4A0GA 5LD2B 4OHVA 4PHTA 2J9RA 3SS8A 3SHFA 1XB2A 1T0JB 3Q8XB 4NP6A 5B30A 1DAHA 4F92B 5JCZA 3B9PA 1JR6A 1XZPA 3IBYA 3QF7A 1U94A 2FZLA 2GAOA 2GAAA 1KI6B 2GZAA 2ZJ5A 3TLXA 4D82A 2ZR9A 3HU1A 3NBYC 4LYFA 5AJXA 2RB4A 4M22A 1NKSA 3EX7C 3BERA 2ZSDA 2W2XA 4EJSA 4DDTA 3BAFA 2IT1A 1X8LA 1T8UA 1VIAA 4MRPA 1YZKA 3NHAA 1F2UA 4OK3A 1U9IC 4MYTA 4NCIA 4OHZA 2YNMA 2FA9A 3SOPA 8OHMA 1II9A 4KO8A 2R2AA 3RLFA 3KUDA 2QAJA 5TDHA 3U3KA 3WMFA 4LCBA 3VNUA 1TQ2A 3W34A 1UF9A 3CBQA 3LO5A 2IUTA 5K8IA 1JI0A 2FPKA 1KI4A 3WXMA 2RGNC 4DDVA 1VMAA 4MRSA 4US1R 5HKKD 3U7GA 1IN8A 3LQQA 4KSCA 5SZJA 1AKYA 2JJ2D 4WXRA 5LD2C 1G5PA 4ZKDA 5JEDA 5HKKA 2VSOA 1ZD8A 3AVUA 1FUUA 2JCSA 1XMSA 3DM9B 3I92A 4GI7A 4B3GA 3WMEA 3LVQE 2WSMA 1T6NA 2IYTA 2FFBA 2E87A 1E6CA 1QVAA 2EFEB 3MJHA 4M0LA 3RWMB 1OYWA 2JA1A 1O3YA 2WWYA 3S1AA 4NMMA 1HV8A 1WBBA 4BPBA 2GXSA 2ZRPA 4B35A 5LPNA 4QG7A 2YOFA 3CF6R 3P4YA 4DUGD 4Q02A 2N46A 1OHHD 3K0CA 5CJPA 1YRAA 5GJBA 2I1QA 5KDLA 1E1RD 4RZ2A 3E70C 1QHNA 2QSYA 3LBNA 1E9RA 3CWZA 1VCOA 3IIKA 4LUCA 5DHFA 1TEXA 1I2MA 2P5TB 1N6HA 4QGAA 3NH6A 4LV8B 2ZS8A 4EPRA 1YR8A 3I5YA 1SVSA 3QI2A 2HT1A 2CE2X 3R20A 1TQDA 4WIAA 1R10A 2YINC 3MD0A 3A4MA 1VCNA 1AIPA 4XWKA 5J4LA 3A37A 4TQUS 1ZNXA 1IXRC 1M74A 3FMOB 1PUJA 4N0EA 2AFIE 1OKKD 4G01B 1XD8A 2F9LA 1ZUHA 3X1DA 1NMZA 1BMFD 4RCYA 2HXYA 1M7HA 1OKKA 5M04A 3EPJA 4CF7A 3T06B 2RCNA 1OF1A 2CXXA 2R6GA 1BMFA 1JAHA 1JJVA 4D81A 2OUKA 3OAAD 4MKIA 2FSGA 5CITA 1T0HB 1G17A 2P5SA 2QZ4A 5DI3B 5EP4A 2IYWA 3OAAA 4OK6A 1AQUA 1EFRD 2G77B 1TADA 4IDOA 2JDID 2R65A 4HYYA 1ZBDA 2RGAA 3PVSA 4GFDA 3KB1A 3GLGE 1EFRA 2WJYA 2GCNA 2JDIA 3K9GA 3I8SA 3X1YA 2OG2A 3R8FA 2IYVA 4FMCB 3ADKA 4HAYA 3PR1A 5JWRA 4D0NA 4BLSA 5F3WB 2BMFA 3T1QA 1T3LA 4F7WA 4B44A 1YJ5A 2IF0A 3AUXA 1FOEB 1WBDA 3RWOA 4LJ5A 1ONBA 1EFUA 4KI0A 1P75A 1X3SA 2G3YA 1GDDA 1MO6A 3CF0A 4FMDB 4NCNA 3QENA 4XTRA 3DDCA 3LBHA 3N2IA 2PMKA 4B73A 1KO5A 1JR3D 4A6PA 4Q9IA 5AJVB 4BECA 2IC5A 3QKUA 2W6JA 1JR3A 4FN5A 3PXGA 2DY1A 2VA8A 1RYHA 2XJ4A 4CYMA 4Q66C 1AA9A 2EWVA 1Y3AA 4YC7A 2WAXA 1C4OA 3DEFA 3TQCA 2QEQA 4BUJA 4CGZA 4HLUC 2KWIA 4YMWA 2B21A 2VHTA 4BQSA 2WKRA 2PJZA 4LOAA 4G0NA 2IS6A 1Z08A 4YDSA 3GLIB 2W6ID 2ZI5A 2O0HA 3CM0A 3LW8A 3ND8A 3B2EA 2BKEA 3TUZC 1PLLA 2LWIA 1LB1B 4TLBA 5A0FA 2X8AA 1NJGA 2QPTA 2GA8A 4H9GA 3C7KA 1PUIA 1KIMA 3EIQA 3DPUA 1CJKC 2QE7D 4JJZA 1NBMD 1NN1A 1IONA 1XEWY 4WXPA 4G1UC 2J5XA 2PT5A 4JLOA 3DL0A 4TTQA 4M1OA 1MT0A 4WVFA 4ESVA 3JZMA 4NPHA 4ZDWA 4GP7A 2J41A 2XZPA 5EE0A 1NBMA 3AKEA 4B3FX 4KBFA 3QSYA 1AS0A 4I99A 1ANKA 2OESA 1BYIA 1S1MA 2AHOA 1NY6A 2IL1A 2IUSA 3WYFA 1AGRA 1R0ZA 3ADDA 3CPEA 3TKLA 1H8ED 4U7DA 1IBRA 2GTPA 2YVUA 3U3OA 2ZITA 3KQNA 1NNEA 2DCUA 1D2NA 1H8EA 5EE9A 2C2HA 4GMDA 5KSPA 3SYLA 3NDBB 2R8RA 4TL6A 4ARZA 4OQNA 2PLRA 4KODA 3I3SR 4K8OA 3V9PA 3OZXA 4QJ3A 2CHGA 5G41A 2W0SA 4GDFA 1N5KA 3CRQA 4N3NA 4D4KA 4XSGA 5J4KA 2OAQ1 3TJZA 3U6KA 4W5WA 4BEJA 2EVWX 3W3ZB 3RYTC 4IOKA 2IEYA 4LPKA 2EFDB 1U8ZA 4UNPA 3IO3A 4M9ZA 1YRBA 4YXWD 4Q4JB 2V7QD 3BB3A 4I1UA 1AS3A 4LBZA 1YR9A 2JATA 4P33A 1GL7A 1SZPA 2XEXA 2QP9X 2O8DB 4HZUA 3OEED 1N5IA 4MDEA 4HSEA 1KNQA 5H1YA 2QPOA 3H0KA 2IK8A 4M9XA 3OEHD 1NVUQ 1G3MA 3OEEA 5HZHA 2QTFA 2HXSA 3HJNA 5HR5A 1CF4A 5KOYA 1SXJB 2ZAMA 4UNSA 1RJ9A 3OEHA 2XOKD 2C9CA 2BVNA 4Q7MB 1CULC 1G6HA 1LFDB 2ZJAA 2NO9A 3T5GA 4B43A 1MH1A 2IS4A 3PIRA 2XOKA 5EXTA 2DWOA 1XJCA 1US8A 2FGJA 4C30A 1MRSA 1M6NA 1N5JA 3PFIA 1W5SA 1Z0JA 4DLSA 4MITA 2O8BB 1GITA 1EWQA 3GLGA 1KDRA 2Q21A 3DO6A 1TU4A 1MKYA 1ZRHA 3K0FA 4M9QA 1P73A 2BC9A 3IO5A 2FN4A 2VHUA 5AJZA 4KV9A 2AXPA 3A1UA 3VKGA 2A5YB 2ZREA 3QG1A 1G1MA 3VQTA 1UAAA 1MABA 3EZFA 5AUNB 3ZVNA 3FKQA 2Q6TA 3Q72A 5AJWA 4OI1A 1VG1A 5C2JB 2OFXA 1NVVQ 3UKDA 1LS6A 2D2EA 3W6PA 3GJ0A 3M6AA 3UANA 1WF3A 1KI6A 1Z6TA 2GXAA 2H92A 2QT1A 2CE7A 4F4JA 5JWHA 4CRWB 3QKSA 1XTJA 3C8UA 2A30A 3R9WA 2EYQA 4MYHA 4PSKA 4JVNA 3GLIE 1Z47A 2AL7A 1Q57A 2F1RA 4JYBA 4Q18A 1J2JA 2R6CA 4V02A 5JCPA 1G4UR 4QJ4A 1LY1A 1ZYUA 3MCAA 3EIHA 2W83A 3BC1A 4HAVA 3WP0A 2H17A 2ZJYA 3IDQA 3EARA 2QY9A 3P27A 3RS4A 2VYFA 3AF3A 3L0SA 3BD9A 1E3MA 1G41A 2XNDD 1IM2A 1CBUA 1U98A 2NPIA 3KDSE 3T1VA 2XZLA 2J7KA 3FGNA 3AF1A 3K09C 4R9UC 4H1VA 4LX0A 4AYTA 5JZVA 3MG9A 2XNDA 4Y0VA 5EXSA 3FMFA 3Q5DA 4PHHA 1NSFA 2CVHA 1KO1A 1P7CA 5FBQB 1IQPA 3WBJA 5EP3A 3THOA 2ZE8A 3RANA 4KLZA 1Q3HA 1LF0A 3FE2A 4HAUA 2ZJBA 2JASA 4D4LA 4EPYA 3VKHA 3QPUA 1G21E 2GBLC 4TT3D 4E07A 2ZPTX 1Z0FA 4YQFA 3U61B 3KB2A 4BZXA 2DYKA 2IXGA 1GFIA 2ONKA 1CRPA 2NGRA 1U0LA 3ZH9B 2IHYA 3CR8A 4TT3A 1KJZA 3TR5A 3B13B 2CBZA 3C5CA 4AC9A 1KSFX 1SGWA 2A5DA 3K8YA 3UMSA 4EQ6A 3K0SA 1HT1E 2JLRA 2ZJ2A 4FI3C 3ZZTA 2WIAA 3QKTA 2GILA 5DYGA 3B60A 1COWD 4PANA 5IT5A 3U44A 4FMCF 4Q00A 4ON9A 3IKJA 4I1OA 5DE3A 4BRUA 1EESA 4BFSA 1COWA 2C03A 1OXXK 4KVAA 3RNLA 2WM9B 4J0QA 5L3VA 2Q9BA 3RAPR 2ZANA 4GOKA 2QBYA 2Z0MA 3EA0A 1NRJB 3LX8A 4FMDF 2AFHE 4TMTA 2R6DA 5TY0A 5CIQA 1QHHA 1BIFA 1VHTA 1HA3A 3CR7A 4MRVA 1SXJE 4B48A 5DLQC 2GKSA 3L0OA 4LI0A 5EP1A 4DSOA 1MO3A 5KSYA 3CLVA 3BH6A 2WOJA 4DVGA 1QZXA 3SFZA 4C0LA 4PC7A 1N5LA 3KQHA 3ADBA 1ZM4A 5DI3A 4C9BA 4LHVA 4JLPA 4JVSB 1ZD1A 3L82B 4WW0A 1KDOA 2WMNB 4RKFA 4HAXA 1NP6A 2Q9AA 4EJSC 1JXMA 1OW3B 4CIDA 4FWIB 1S96A 1CU1A 1V5WA 3A8TA 4MUAA 2ASEA 2FGKA 3TGPA 3MAAC 2MSEB 4XIGS 4QL3A 4GBMA 4CVNA 4JT4A 4A0RA 2ZJZA 4CEJA 3U60B 2WKPA 221PA 5JEEA 1P62B 2C98A 4BLRA 2G6BA 2KE5A 4R2IA 4S2EA 2WJIA 1KY2A 3RRYA 3TQFA 1W5TA 1IY2A 3MSXA 2J7PA 4B32A 1X8KA 2BHRA 4RCZA 1Z8FA 4AURA 1E9BA 3KJHA 4DLTA 1YR7A 3GJ8A 4DLYA 2KJQA 1A1VA 2ORIA 2W2VA 2ZUCA 5EP2A 4LDJA 2CL6X 2ZRKA 4KITB 2G9NA 1Z6GA 4C0HA 2J0VA 1ZAKA 1CR4A 3KKQA 5CB8A 1G9XA 4A6XA 4GSYA 2HEIA 2Y8EA 4QKQA 1XEXA 3KUCA 4MRNA 1E9FA 5SZHB 2CNWD 3C14C 3SU8A 2HDNB 3K70B 1QHIA 2GJSA 5EXXA 4D25A 2OCYC 4V0KA 1U0JA 1ZP6A 3LLMA 4LV5B 2C96A 4DCUA 1JQJC 1N0UA 1S9HA 2JLWA 4FD2A 1TNDA 3OHMA 2FSFA 4PXAA 4Z51A 2V3CC 1E2KA 2VSFA 3A1SA 1ZNWA 5KYKA 1AJEA 4ZPXA 4PX9A 3K0CC 1O87A 4KVGA 3VR1A 2BMJA 4AWXA 3NXSA 4FWTA 2CCJA 4XD7D 2ODBA 1GWNA 3LV8A 1W7AA 4JS0A 3AF2A 2WTUA 2YHSA 4XD7A 3K9HA 1XTRA 4KJZA 3B9QA 4LYJA 5F2EA 1Z07A 4TLAA 2VSXA 5FFMA 5CDFE 2JAQA 1IY0A 4DC9A 4JLBA 5P21A 3BBPA 1BKDR 4RD2A 4LK2A 2GETA 5BWMA 2A3RA 2A5FA 4IDPA 2GHIA 1E32A 1XU4A 3HU3A 1HH4A 2VHJA 3UMFA 3W6NA 1R6BX 4POAA 2NO0A 3EPLA 3TSOA 5F9HA 3OESA 1G3RA 3KJIA 3QPVA 5JWOA 3KKPA 4OKSA 1FPMA 1FTSA 1P6XA 4HI0E 2P6NA 3CX6A 3B7GA 3C4JA 5K8LA 2VL7A 2ZYVX 4DLRA 3T1OA 4F4IA 4DDUA 2IYYA 1KZGB 3AVPA 1WE2A 1YQTA 3U6BA 5EUQB 1E0AA 3WY9A 4QHYA 1E9EA 1XPOA 3NVAA 4M1YA 1N2CE 2GEDA 4NCHA 4Q4JA 2PBRA 1GRQA 3AUYA 5EZ6B 4E22A 2Z43A 1QHXA 4ZDJA 3B5JA 4XH9B 5AUQA 1ZNZA 3OFND 3B1YA 1L7VC 4CEIB 4TL9A 2XGJA 3CF2A 4TYPA 1YZLA 1Z22A 1S9DA 4II7A 3RDPA 1KK2A 3TH5A 3THWB 1WB9A 3OFNA 1KK0A 1M34E 1RRCA 3GEHA 2Z83A 1P2TA 3BFXA 3PCRB 1SXJA 4OQMA 3NTUA 1XD2B 4ZCIA 4LHZA 3NBXX 4V0ME 2B8WA 1G7SA 3F5FA 5CM9C 4A0FA 2FE4A 2JIZA 2FFAA 2X2EA 1RKBA 1IHUA 2QAGC 1E4VA 2WWFA 3MFYA 4P4UA 1CR2A 3ZD6A 2R44A 3FKSD 5A5GA 3AVTA 1E2LA 2CMKA 2FSHA 5HE9A 3GLFB 1G3QA 2QQEA 3REFA 3SE0A 1FQKA 3VR6A 5DSZA 3GEIA 2GF9A 2QMEA 3V4RA 1XCPA 3ASZA 2VP9A 3FKSA 1N6NA 4I1SA 4OHXA 3ZVLA 3RSLA 4AKIA 4PAMA 1XFAA 3SQWA 3QE0A 3LX5A 2DWQA 1E0SA 1XCGB 2R9VA 4B33A 2ZRBA 4LJ7A 3EA5A 4G5RA 3AQ4A 5HTKA 4C4PA 4PPGA 1VYUA 3FFBA 4ZIRA 1HUQA 2CL7X 4FW9A 4R98A 4URYR 3R9IA 1SULA 4UXIA 4B74A 2VF8A 4M1SA 3QY0A 3TSWA 1ESNA 4A8JA 3GLHB 2OXRA 3LH5A 1TQ4A 4GPTA 4HLCA 4N0DA 4QBFA 3KXKA 4QGGA 3PV0A 4M53A 3WHKA 3W8NA 2WWGA 2OCPA 4D2IA 4E09A 4URXR 3U7HB 4XWAA 4B2PA 4A4DA 2XTMA 2VPPA 2QNRA 3KQKA 3ZZ0A 1HQYE 5FBLB 2ZS9A 3P1JA 1Q21A 3FYHA 5DHAA 3KXIA 5GADl 3CH4B 2G83A 3IGFA 1HEIA 4DCSA 2FPLA 4C0QC 2ATXA 3AF4A 4WOPA 4KLNA 1Q3TA 2C9YA 2P0EA 3ETLA 5FPHA 1A7JA 5D3MA 1SVLA 1OE0A 2JLYA 2MSCB 3QVVA 1OXUA 1E99A 1OPXA 1W46A 1YZGA 3QF4B 3U7FB 1E0JA 4RJLA 5BW8A 4GOXA 3A1TA 3VR5A 5FUXA 2IXFA 5EE1A 3FMIA 4QRHA 2WJGA 2JLQA 3UATA 1DTSA 3GFPA 3U4QB 1SVOA 4AG5A 4L16A 1Q1ZA 3FDIA 3W90A 1Z29A 2OBMA 4PR0A 4B75A 1DPFA 2C9OA 4BEBA 3SJZA 3QBVA 3PQCA 4HB3A 2GXQA 2G88A 2GWHA 5FR1A 1NN5A 1F2TB 3HDTA 2GDJA 3NC1C 2W0MA 3L8YA 1ZUIA 1KO7A 2GJAA 3B85A 3EZ9A 1IAQA 2VP2A 1OFIA 4TMZA 2JLSA 3Q3JB 3DM5A 2JLUA 1G3IA 2OBNA 1Z63A 1ZC4A 5HZKA 4A9AA 3LFUA 2YC4C 2XB2A 4NYIQ 2ZYUX 1DADA 2ZRLA 2XTZA 3FPAA 3QXJA 4LJAA 4RFSB 1ZMXA 4DT1B 4LJYA 4O3MA 3DHWC 2PMDA 3RC8A 2AWOA 3WNCA 4MKFA 1S1CA 1E2JA 1XEWX 2N1BA 1ZM9A 3CB4A 5B57C 4ACBA 1FNMA 3D6TB 4FCVA 1DAKA 3GD7A 4QGFA 1IN4A 2ZRCA 1Z6AA 1RC8A 3B1VA 1VHLA 3I72A 2DFTA 2FG5A 2W58A 4PC1A 4OQXA 4C7OB 1VKJA 2G1KA 1CR0A 3E2IA 4GZMA 3SDZA 2DHRA 4CEHA 2GNOA 1S0UA 5KNBA 2O0JA 2QN6A 2C04A 3BB1A 4IVQA 2AKYA 3TVDA 4P4SB 1T8TA 2IWHA 4B3XA 4Q4HA 3GLFE 4L9SA 3GPLA 1FX0B 5KDDA 2NO1A 2X1VA 4IXMA 4BASA 5UKDA 4DLXA 1VIYA 5JJLA 2RGDA 4Z54A 2QMUA 3MUFA 3VU9B 2ZE7A 1AZTA 3RS0A 1KI9A 4GZLA 4MQBA 2F7SA 1XMVA 1G64A 1T91A 1VECA 2ZR0A 3THYB 1NN0A 3EWSA 3SJBA 2ZS7A 4LBVA 1ZM7A 4Q9LA 3GLHE 2VHQA 1WDTA 3SJAA 2ZROA 1E2HA 1FMLA 3WNBA 3KJEA 1NVVR 4KHZA 1G20E 4MGIR 1X8JA 3NBZC 3TMKA 4DLVA 3SHWA 1KMHA 3NH9A 1U2RA 2ANBA 4N1AA 2BWJA 1SHZA 2ATVA 2IX3A 3GJ5A 3VX4A 4DIEA 1NJFA 5JHHB 1CJVC 2H5EA 4Q03A 3ND9A 1L2TA 3VTKA 4W7SA 3VMFA 4EAQA 1MO5A 4C3ZA 4TL7A 2XXAA 2NG1A 1KSGA 3E5HA 2YWFA 3W6OA 2D06A 5IDVA 2NZ8A 2ZVPX 3TRFA 2WBLC 4DEXA 5FOVA 2W6JD 1U8YA 3PJRA 1T4GA 1AZSC 1NIPA 5IF9A 1P5ZB 1RVDA 4TMVA 3A1WA 3DZ8A 2Q0HA 4FINA 5HCIA 3VKWA 4URVR 1GM5A 4A15A 1SVMA 2REOA 2Z4RA 4BLPA 1VPLA 5JSZB 2GCOB 3IQWA 3AM1A 1TUEA 3RRMA 4PC2A 2BJWA 2QUZA 4MH0R 3LWNA 3RHFA 5JBQA 4XVRA 1JBKA 2IW3A 1GG2A 4EFNA 2P6RA 2KB0A 2VP5A 2MMGA 3UG6A 1W49A 1W4RA 2GEUA 4C0JA 2RAPA 2I4IA 1FMJA 2OHFA 2FNAA 3Q7QA 2Q3HA 3V00A 1WQ1R 3AEZA 4C0KA 2ZI7A 2V1XA 1W0KA 3F3YA 4AY2A 2EYUA 1SKYB 1Z6YA 1W36D 4P31A 2GVZC 3BRWD 3FVQA 1F3OA 3FFAA 1TF2A 3Q5EA 3CNNA 3PUXA 3TUJC 3LVRE 1TMKA 2P67A 4E5UA 5B2ZA 4QNMA 1Y63A 3NKVA 2ZSAA 2UZIR 3L8ZA 1N6OA 2WHXA 5JJKA 2WWXA 3ONWA 4NH0A 2O8FB 1E9AA 2ZI3A 3LRPA 4UNQA 2X19A 1OV4A 4OI4A 1AKEA 5H70A 2ZRJA 4MA4A 4DEYA 1OB5A 4CDGA 2JJ1A 3T61A 1CP2A 3CX8A 1Q1QA 2BIFA 2L0XA 4LJ9A 4LZZA 4QFMA 2KSQA 1R5NA 1IN6A 3C41J 1VG8A 4K46A 3ZDQA 2QPAA 2D2FA 3HR7A 4FCWA 2ZVQX 3UG7A 4I4LA 3THXA 3O47A 2XITA 1UBFA 3G82C 1KHTA 1XNJA 4MKHA 4QXAA 1GSIA 1OB2A 1W4AA 4M1WA 3A6PC 1GTVA 2CHVA 2WJJA 3C16C 5LB2A 1OFTA 4JLKA 4JVLA 5G53C 3FHCB 1JEDA 4AG6A 4QBHA 3VR2A 4D6PA 3QJYA 2GZDA 2H1LA 4JJKA 4TWZA 3K0AA 2BEJA 4FCTA 5CYOA 3TUIC 1M2OB 4YMSA 3EZ6A 3AKDA 4HDQB 2WAYA 4URUR 3SQXA 2O8EA 1A2KC 1D2MA 3OE7D 2B8TA 1JEEA 1N6KA 3CZQA 2LCFA 1LW7A 1XDBA 4IKEA 4HUQA 3OE7A 6Q21A 1G16A 3CX7A 4V0OA 1MRNA 4AKGA 2UKDA 3KFVA 1RW4A 1TEVA 1KI1A 3NIBA 3QXHA 4W5HA 2HF9A 1KJWA 2F1JA 3Q7PA 2ZSEA 1AN0A 3C15C 2A2ZA 1X1SA 2P6UA 2WPDD 2HF8A 1T9HA 2RHDA 4IFEA 3VNVA 1RRPA 5K8UA 1S3SA 1EG7A 1OLOA 1R5OA 1U9IA 2P3SA 1OT3A 4QOSA 2GZHA 3TE6A 2WPDA 4ZV4A 4B76A 1HE8B 1YHNA 3MWJA 1NLZA 4Q9JA 4A92A 2BM1A 3B8HA 1OJLA 2ZTSA 1UJ2A 4EUNA 1EFTA 1II8B 5ELXA 2RGNA 3GMTA 1FP6A 2C77A 3B1ZA 3PEWA 1PVOA 4HEJA 4LBYA 4RKEA 2FU5C 1Z2AA 4OHYA 2WOOA 1XMIA 1D5CA 3GJXC 5CIWA 5EJEA 2JLZA 3MLEA 4AD8A 2EFHB 1GILA 4AKEA 5DI9A 2F3TA 3TR0A 5JS8A 1JPNA 2QI9C 4HB2A 2H18A 1LTQA 1IJFA 4IVPA 3TW8B 4NONA 1PLJA 2WJHA 2WKQA 5E7MA 2QA5A 3LXXA 3QF4A 3B1XA 3EW9A 1NF3A 2FDCA 1JAIA 2NO7A 1MOZA 4TQAA 2RH5A 2C78A 2OT3B 2PX0A 4QM6A 2PEZA 1E2FA 2OFWA 2QROA 3A4NA 4XWOA 1SKYE 3ZVMA 1P2UA 3QEOA 4DSNA 3TIFA 1E94E 3NG1A 4EFLA 2C95A 3OIYA 4IDQA 4WAUA 5AJYA 2WWHA 4EPVA 4Q1AA 3LA6A 1W44A 2OM2A 1XJQA 4M21A 2I1VB 4X8MA 2QGNA 1HY3A 5KNCA 1JQLB 1LNZA 3I32A 1LVGA 4RD4A 3BB4A 2E1RA 5A4JA 1Q1BA 2HLDA 2VP6A 1G8HA 4M8NE 4P3YA 2H8KA 5FH9A 5IHPA 2AN9A 1F2TA 5JI2E 1RZ3A 1WXQA 4D26A 4O2RA 4XJXA 1XPRA 2IS2A 2GF0A 1N0WA 3H2YA 4IOMA 4Q7LA 1HURA 4GMXA 5C18A 4AI6A 5BYJA 5FBWB 1GIAA 4BLOA 2I3BA 3PUWA 1Z06A 4JLVA 3SYKA 1GRRA 1PLKA 4F91B 2IS1A 4RFSA 3IHLA 3PUVA 3X2SA 1EGAA 4Z1MD 1BS1A 1XZQA 1E2DA 4RFVA 4A2QA 3ZZUA 4EJSB 4TSFD 4Z1MA 1IXSB 2VH5R 3LLUA 5DIFA 1E9CA 4PPQA 2V1UA 1KI3A 3CRVA 2YOGA 3PUZA 1OH8A 3WP1B 4TSFA 4YMTA 3H84A 4WBSA 1X86B 1UBCA 2VF7A 1T3SA 4JLMA 1F2UB 5IRCD 1QHGA 4CT4B 2R6AA 1UKZA 1UADA 1E4YA 4A8JC 1CJUC 4HB4A 3NEYA 4B2IA 3RRNA 4B47A 4ERNA 3W9YA 1Z0DA 1DARA 4RZXA 4RD0A 2YWEA 3TAUA 1E1QD 4H1UA 1J8MF 1ZINA 2F1HA 4ASUA 4NU0A 1L4UA 1XD9A 1CR1A 3CNLA 3KZ1E 1E2PA 1E1QA 3EIEA 5J4VA 1GRNA 1XXHB 4GOJA 3DVLA 1N6IA 2PCLA 3QG5A 2AK3A 2UZ3A 3HYTA 4PQRA 1XBTA 3FHOA 2QSZA 3Q9LA 2CVFA 2QRZA 3QXSA 3RS5A 4R71A 2DB3A 4LPSA 1ZU5A 4RZ3A 5TXGA 4DB2A 2VRWA 2JJ8A 1G7TA 3S1AB 5DISB 1P9RA 4FMBB 4Q48A 2IXEA 3AVWA 3U5ZB 4OI0A 5FTJA 1OFUX 3JZAA 2BMEA 4PAQA 4NYMR 5BN3A 5KSZA 2RHMA 1A82A 4JKYA 3EWAA 2J7PD 1NKTA 3AVXA 1XF9A 5FL7D 5FOWA 1UBEA 3T12A 3ICEA 1P60A 2Z4SA 1JECA 4JLAA 1CXZA 1U99A 4HB0A 3Q85A 5FL7A 4QGHA 1I4TD 5FPSA 3T15A 4L4UA 3LAWA 3AGPA 2OAP1 4KYIB 3CO5A 3U3RA 3IEVA 2O8CB 2V8OA 1GNPA 1G7CA 2ANCA 2PLFA 2VBCA 1IXZA 3GEEA 3U2QA 5J5CA 3L43A 1ZCAA 3LD9A 4PZYA 2PX3A 1VG0B 3UK6A 1ZNYA 4IEEA 1KKLA 4IOLA 4KU4A 4DLZA 2Q3MA 3OIVA 4PHFA 4CZ2A 4EPWA 2J87A 3PUYA 1OFHA 3C5HA 3IQXA 4LJ6A 2V55B 1DELA 2EWWA 3BGWA 2EFGA 3QBTA 2IYUA 1IN7A 1DAEA 1R7RA 2ZRDA 3AP1A 4LGMA 1RPZA 1J8YF 2FV8A 2ONJA 1KSHA 1BYUA 3E1SA 3CNOA 4AYWA 4JZKA 4BLQA 4BE7B 4DCVA 5BYKA 2ORVA 3IIMA 3GLIA 1IY1A 4L5BA 4OI2A 4P32A 3K1JA 4MGZR 5B64A 4LHYA 2NZJA 2GK6A 4KFSA 1SQ5A 2BV3A 1EFCA 1HE1C 4JLJA 4M1MA 4HZIA 2D4HA 1YVDA 5KNDA 3LXRA 3VR3A 1P9WA 1NY5A 1F48A 1E98A 2XJ9A 4OHWA 1ESMA 4Q4AB 3SJCA 2D62A 4Q21A 4YMVA 2BCJQ 1RRGA 1XTQA 3I4LA 3ZS9A 2YWHA 1IN5A 2C5LA 3AGQA 3RS2A 1X1RA 3IUYA 3N2EA 1PJRA 4E03A 4L8GA 3T1TA 1FTNA 3F8TA 1E2NA 4LWZA 1DAIA 4PPFA 2D74A 1NSTA 1RE0A 1UDXA 1L8QA 5KUTA 2HYIC 2BBWA 4A82A 4QHSA 5L3QB 4C0SA 3GFOA 3R9XA 4XOIA 2QAGB 1U0HC 2J45A 1T5LA 2FMXA 1U8AA 1KO8A 1XRJA 2EQBA 5BQ5A 1K5GA 2AK2A 1N0VC 2AX4A 1F60A 4LC0A 2OILA 4MYUA 2ODNA 4XVUA 4TMWA 2ZSFA 4ZDKA 1Z83A 3H1TA 3AKCA 4DSTA 3R7WB 2B6HA 3B6EA 1MR3F 3BFVA 4WZBE 3UIEA 2GESA 2ZRNA 4LYAA 1TUIA 2ZRIA 2QGZA 4G5OA 4JBYA 5FOUA 4Q01A 4TYWA 1N3BA 2YWGA 2QQ0A 1VCMA 1YZUA 1XXHE 4O25A 1XTIA 4NKRA 2QG6A 1WCV1 2O8DA 1N6PA 4M4SA 3U7EB 5JRZA 1ODFA 1DAGA 4JLDA 3LDAA 1SXJD 4Q19A 2P65A 4TMXA 1UEJA 2EFCB 5EE5B 4X8OA 1W0JA 4LC1A 4IEIA 1ZC3A 2BJVA 5SZIA 1VYTA 4O2LA 1GL9B 2JIZD 2QRNA 5G3ZA 3QIAA 3CRRA 1DBSA 3TBKA 4LJ8A 1WRBA 3B78A 4DWJA 4JBXA 1QG4A 1TAGA 4PAOA 2V4ZA 1VCIA 1GUAA 1RFLA 1DOAA 5DNYB 3QPWA 3ZS8A 3UWOA 2BM0A 2F9MA 4ARZB 1E2EA 5IK2A 4XVQA 2WMOB 1S2MA 2V6JA 4NTZA 1J7KA 2ZR7A 2O8BA 3AP3A 4BFWA 521PA 4PPNA 4V03A 3DOFA 3GJ4A 4PZLA 2OZEA 4GL2A 5EE3A 1G8YA 1II8A 4Y0AA 2IYXA 3NC0C 3P20A 5F9FA 4ZO4A 2OCAA 4LYHA 5FTMA 3P32A 1W36C 3QKRB 1XPUA 2CLSA 4EPXA 1HTWA 5AWFC 3T35A 3ZJYA 2CCKA 5DN6D 2ZE6A 4UNNA 2FH5B 5LB4A 1G18A 4HZUB 3A4LA 2EU8A 1HT2E 5DN6A 2KBFA 1GKUB 1YZNA 1QDEA 2SHKA 3A36A 3H86A 3WYAA 1EX7A 1Z0KA 5FUWA 3REGA 1E96A 4L9WA 2ZM5A 1KSJA 5E7JA 2GBLA 3BFKA 3FHTA 2EW1A 4ZKEA 1OSNA
chains in the Genus database with same CATH superfamily
1YTLA 3KJGA 4JP8A 3E9DA 3LG2A 3SSAA 3SYRA 5FTKA 4KACA 1EXMA 4WCFB 4IINA 2NU6B 2H48A 5I7AA 3LPDA 4UXHA 3IEUA 1EFHA 5F7OA 1DEKA 3SE7A 1D9XA 2ZWVA 5KQGA 3LQ1A 4C87A 1JHPA 4F6LA 4CIVA 4ICIA 5B4TA 1KRXA 4Q1FA 3OIFA 1J49A 3LT4A 4OJQA 2FWAA 4X8LA 4X66B 5AKZA 1KY3A 5DGTA 3CONA 4ZT2A 3TAHA 1MZPA 1DC8A 4LJ4A 1CK4A 1O97D 2ZB8A 1Z6XA 2JIDA 4KP7A 2X3UA 2BFDB 3ITDA 3BTUA 1G19A 2EF0A 3EDCA 3O8CA 1J1UA 5IKOA 4BNXA 1TVEA 4KGVA 3MYYA 2UYHA 1GNSA 4BIMA 3VPGA 2J48A 3HI4A 4CF5A 1HGXA 5CA1F 5E38A 3IMEA 1JR3E 5AOCA 5CDFA 3C6BA 4HNGA 4CN8A 5HPYB 1VJGA 2QRKA 4KMRA 3FBGA 4QARA 3HTXA 3D4NA 4QEDA 3GAFA 3OUTA 4MYCA 5G1OA 5P8WA 3FAZA 4MUBA 3TMYA 5BN1A 5I7HA 4IRUB 4AUKA 1AH2A 2IHTA 4OQLA 5ICGA 3UH1A 3TIXB 2CVOA 4WLUA 5CCXA 2GMWA 2BDTA 1B6GA 3HR8A 4KEAA 4XOUA 1PW5A 2VXBA 2CK3D 3VC7A 4IJKA 3ZWDA 4LZJA 4DC0A 3UK2A 4Q47A 3GP3A 1GD1O 1N2ZA 2CK3A 1W48A 2FR8C 1JDJA 1GNRA 3ECCA 1KS2A 1LC0A 2B1GA 2VF4X 5EESA 5HA5A 5AXCA 2ZUDA 3EGXA 4G4JA 5E1DA 5BOVA 3VAAA 1R15A 1WX1A 2J09A 2YN4A 2P5UA 2GFHA 3KYJB 1PK8A 3LUBA 4EGAA 2DJIA 1T8WA 3KSMA 2CT8A 1DIRA 2WT9A 2ZRMA 4DHEA 5M2QA 5JZMA 2ZJ8A 4X41A 5B4UA 2PZMA 1KGDA 3MB5A 1LSOA 4GZ5A 4HGRA 1F6BA 2VC2B 2REQB 3JQFC 3NEJA 4IGFA 2OA0A 1R4AA 1X1BA 1Y42X 2ORED 3V48A 3ZV6A 4B6EA 1OLXB 3PRJA 4GWKA 1XXHA 2J6HA 2VS1A 4FKZA 4J16A 1UUFA 1XMJA 4MVJE 4C06A 2QW0X 4DJDC 1AN9A 1Z38A 3B5EA 4KWEA 2JJ2A 3L7BA 2X6QA 4WCVA 3NDRA 4HNHA 4D4JA 4ZVUA 3ZEIA 2RGBA 1SG0A 3FJOA 4DSUA 4E32A 1MB9A 1P0CA 1LZKA 3E7WA 3G5UA 4ZVRA 5A1TA 4OEHA 4L2IA 2V59A 4K81B 4XPIA 1ELOA 5ALMA 4EJMA 1NMXA 1IFXA 2CXTA 4UD6A 3UUWA 4HQ0A 2DZDA 2FFHA 3SIRA 2CCGA 3KFXA 3QWHA 4EKDA 3CLRC 4JSTA 3BHJA 4KIJA 1W5FA 5IH3A 1GAXA 3R6LA 1W2HA 4WN9A 3D9QX 3PT9A 1P61B 4IIYA 1IQ0A 5I9BA 1FFCA 1R0WA 2J4CA 3EH2A 1RI3A 4QBIA 1KK3A 2GJKA 4P36A 3R74A 2GM3A 2IITA 1NDHA 3S2EA 5IULC 3KAPA 3DBIA 4KXFB 4K6GA 3U44B 3MMZA 5JMWA 2GJ9A 1TEHA 1LPBB 1UK7A 4Y2YA 2DQ4A 3RUHA 1VP9A 3W2TA 2OCKA 4K9DA 3ZI0A 4AICA 1OLUB 2H1SA 3L0IB 3QXXA 1ISRA 4I50A 4CKYA 1SUAA 1H5QA 3WRYC 5JH7A 5HILA 4Y2JA 4WY8A 5JI3E 3AY7A 2WUFA 3OTHA 3KR0A 2VP0A 3R5FA 5C7LO 4EYQA 1CY7A 1PSDA 1SBQA 2O3JA 2AWNA 1RZRD 1P4RA 5EQTA 1DUSA 2E4WA 4OREX 3JALA 3DGFC 1I4LD 1JDVA 5BQXA 3OWHA 1ZKDA 1F8YA 4MJLA 1A7KA 1GZ5A 2DTEA 4XQEA 5L3SB 4XJTA 1SU7A 3QOFA 2VJOA 2XB8A 4S1PA 2OYSA 1Q20A 1EUDA 3OECA 4WJKB 5EIOA 3ZCUA 4BFVA 3ZWMA 1E0KA 5E7IA 2E6UX 4Q24A 1WBJB 4MW2A 3RTEA 3ZDRA 1V35A 4IFBA 3DNFA 5LJIA 3C8ZA 1YS9A 4ER5A 5F3DA 1QVRA 2VQEB 2H8GA 1KH3A 2P69A 2BGIA 4HLQB 3JAKA 4J2HA 4LOJA 4OH7A 2PSJA 4DWWA 2P4SA 4K9OA 4BWYA 3ND7A 1IL0A 4DNOA 3TQSA 2OHIA 3V7YA 4B3CA 2IVZA 1L0BA 1EHIA 2O7NA 5FUBA 2QT0A 4F2WA 3M6LA 4P7JA 3NHBA 1ZHOA 2CLCX 2M98A 3A6ZA 3T8YA 1Q3KA 4D92A 1SVWA 2PSHA 1AM4D 1GN9A 3FG9A 3MUNA 3KOUA 3GJ6A 1PO7A 3LBIA 3QU4A 4Y2HA 3WIBA 4EY6A 5I7WA 3VFDA 5IFLA 2XNKA 1J0XO 1WW2A 2ZWAA 2IYEA 2PBFA 3B1WA 1YIDA 3H5OA 1ECBA 2VPTA 4Q3BA 3R3YA 3F4KA 3BS4A 4ZAXA 3ZGVA 2W2LD 3AH8A 4DXAA 4DIDA 4HQRA 3ORQA 5L3QA 1SQFA 3KL2A 2D5BA 5J2UF 4J43A 4E5YA 3ST7A 4DLWA 2W2LA 3VZDA 3W5JA 2Y9MB 2Z98A 2QAGA 3RTBA 1UQTA 1AXEA 1P29A 5IAGA 5JISA 1IU9A 1D2AA 1LJUA 1B41A 2GGSA 2AIRA 2GCEA 3U4IA 4J6FA 4MW0A 2RD2A 1SXPA 2GASA 3BWEA 3KTAB 4FYKA 4D0LB 1SVUA 1TM2A 1XU9A 4E3ZA 4HD8A 1U7TA 5HVNA 1NF8A 2DHEA 3HBLA 2JJ1D 3VH2A 4JGGA 3JQAD 3ONFA 4IAOA 2CNKA 5HYVA 3JTMA 3NATA 4FBGA 4TKVB 3R7WA 3JRNA 1XLUA 2IQIA 3WWEA 3X3HA 1MQAA 3AIKA 3ICVA 1Z4NA 1Z7GA 3JQAA 4KQ2A 1M1YB 3H5VA 4J8PA 1M83A 4M9RA 3JTEA 3KQLA 4RY8A 1EDBA 1XTKA 4ZCPA 3IIJA 3L4BC 2W2OA 1KYYA 2A94A 1CDEA 1E2BA 1II0A 4H31A 2PMFA 3OQMA 3G5LA 3N3BC 2PG3A 5AR1A 1XTSA 2B1QA 4MJXA 1JTFA 3PNSA 2Y99A 5BYBA 3RFFA 5CB4A 3L8HA 4RD1A 3IAS6 1UZUA 7YASA 3NTOA 1HOXA 3IODA 2VZLA 2ZJOA 2BF4A 4GPD1 1CUZA 1Q0TA 2B82A 3BOSA 2QF7A 5KMGB 2AN1A 1SBCA 5CLLA 1ZI6A 2WE7A 2JHGA 2WJ3A 3CPSA 3D3KA 5JS2A 2VDQB 4IP0A 5BSKA 2QSUA 2YJ4A 3HUTA 3L4KA 4QM6A 1NT4A 4C78A 4J4BA 1XA0A 3PXEA 2SNIE 1IHDA 3L0PA 2D6FA 2IY8A 2OLKA 3PXDA 5ELXA 1SMKA 2VTKA 1Q7GA 2PZEA 4PZUA 2ZYTX 1Q12A 1J90A 4N3BA 4WGGA 5D5PA 5D7NA 5J40A 5F52A 4RD6A 5DP1A 1N7HA 1D4OA 1DDOA 2L2QA 1ULAA 5KYWA 4M9SA 3DC7A 5ENDA 3GOQA 1MDFA 2HSEA 3OHSX 2PRSA 4WERA 1E63A 3CG4A 4RDCA 3WR5A 5GONA 3SS9X 3ESCA 1BJTA 1QQ6A 5ULLA 4IWNA 1VSUA 3X2FA 1PZMA 1E2QA 1H1LB 2JIBA 1FS6A 4BUZA 5LNK6 1K66A 4KQ9A 1TFRA 3S40A 3ZLVA 4Z53A 5DXFA 4RESA 2ZYWX 2FFJA 2DPYA 4EFKA 2NVBA 1YTUA 2XIQA 4QRIA 4YFYA 4IDNA 4LFAB 1W35A 3TQIA 4GI2A 3MCVA 4OGLA 5J1TB 1VSTA 2W22A 2HV9A 4B3SB 3SBDA 3HKBA 2Z2IA 4G9EA 2IKQA 1GUBA 1Y3FE 3LY5A 5KINB 2P41A 5LP6F 4NZYA 5AKXA 3V1YA 3O9ZA 1ZJYA 1H2ZA 4TV9F 4JI8B 3DT6A 2XXBA 3FIUA 3Q6IA 1KEKA 1AF7A 1GQSA 3G6WA 4BFLA 2DFPA 3V3KA 1TA4A 4HJXA 1TVCA 3BXXA 4O4LB 5KNCH 3GEDA 3I04M 3H42B 3LCMA 3LYHA 1MPTA 4WCFA 2ROQA 3SQDA 5KPDA 4TV8A 4QECA 2ORWA 4QX6A 2C58A 2R00C 4UFNA 4HNRA 2F4VB 3KKMA 4BBJA 3JS5A 2R7AA 2ATEA 1RRFA 2Q9CA 3BE5A 4YLGA 5J4YA 2DR3A 3PDHA 1DAFA 3WWDA 3AVQA 3CLSC 2J46A 1Z0AA 4G25A 2E21A 4EI8A 4I36A 2MYPA 3THSA 2PT9A 2WJAA 4IDAA 2R62A 2IPNA 1P2VA 2QL7A 1JKJA 1Z8HA 3ASUA 4K1LA 3WSVA 2JAPA 2VEOA 1O6FA 1MEOA 4CU5A 5JXHA 1RC1A 1HDOA 2XDQA 3EC2A 3G2OA 1H0SA 5F7XA 1MW9X 3BXPA 4FSXA 4XQ0A 1RXVA 1OH7A 4ZZ3A 2IHZA 2GVDC 3LKBA 2VZEA 3ETNA 3LPNA 1UIMA 1D7OA 1FA9A 1ZW6A 3KCQA 3F5SA 4RLHA 4BVLA 3IPLA 1XDDA 2B2NA 1Y5NA 1PJAA 2D3WA 1NI4A 2F17A 2G7ZA 4P0TA 5J9FA 4HH4A 1LPMA 3IB3A 5DPMA 1YMVA 2CEAA 2VJKA 3FGZA 1EDOA 4ND8B 3ELDA 4PS1A 4WA7A 5MDHA 1PN3A 3AEKA 1XSEA 1I1NA 1L7MA 3KL4A 2FQYA 2OM6A 3Q3EA 4RPGA 1YE3A 4WTOA 1DTWB 2DQKA 2HLDD 3PGJA 4MV1A 4C2AA 3QUSA 5KQSA 3PSHA 1WB6A 3BORA 1Z5UA 2IHBA 3DJYA 3MWKA 2JGEA 2HHJA 3K96A 2BEKA 3HYRA 4W6QA 1R37A 2WDZA 2DCMA 1Y9DA 2A0XA 1V71A 3WK6A 4KFUA 1ZKMA 2QLMA 4J76A 3WLHA 2P1RA 1CUBA 2OO5A 1E7YA 1D6NA 4KI7A 3I01A 1HDXA 4QFCA 2R4UA 1IHYA 2ZB3A 3CTPA 3SY8A 5HIKA 4P7GA 3O0DA 3ABOB 2XVMA 2P7HA 3PITA 4UTPA 4MEAA 5K3AA 1E9DA 4BFTA 3E05A 1V8ZA 4E5DA 2IYZA 4U5QA 4HNUA 3K9QO 3WBKA 5IJ9B 1E2GA 2REQA 1PI3A 4A6EA 4W7IA 5EPOA 4BFZA 1UZMA 1V43A 1WMSA 5DK4A 1K3FA 4CETA 3PEYA 5MF6A 2VPIA 3JPYA 5AW6A 2HSJA 3K5IA 5A5DA 4PCLA 3RC3A 4YO7A 5SZKB 4MS1B 1UXHA 5C4GB 3T4PA 3P0EA 1U9YA 1IZ7A 2P4HX 4UNRA 9GPBA 1HPLA 1QOQB 2PRIA 1OREA 2PX2A 1XELA 1V3VA 2GHQA 1EINA 1LNSA 4KLCA 1VL5A 2HV8A 1L4MA 1WP9A 1GPLA 3KEQA 3QVGB 4FYJA 3TD6A 3WKEA 4UTRA 5BSVA 2WJ4A 1QRDA 1JW9B 1VLQA 5LKAA 1CZKA 4TTTS 5TQ2A 2ONZA 3Q87B 2E4VA 2RGUA 4KNYA 5GJVC 2EKDA 2Q5LA 2I8LA 1MH9A 3I2JA 5ESDA 2WEKA 4FDMA 3WNVA 3IP1A 2WPNA 4HZGA 3KRTA 5AXDA 1BGXT 1V8BA 2IV7A 1DVRA 1V37A 3T0FA 4XLLA 1QGZA 2PD3A 1JJIA 2V7GA 1RLTA 3PTLA 2JIQA 4IIJB 5D3QA 4LDNA 2Z5VA 2JVKA 1OLUA 2DWPA 3MXOA 2QSJA 1D7AA 3ELBA 3O74A 4G0MA 4BP9A 3P2MA 1TTQB 5DYWA 2DBYA 2XVXA 2VDOB 2ID7A 2ZDGA 1BD3A 4CM6A 3CZ9A 4OHBA 4Q1EA 5AP9A 5K8VA 1YOBA 5FO0A 4BWGA 1CVRA 1UC9A 4BZPA 4HDAA 4OGWA 5A71A 3AB3A 4TLCA 3ZDEA 1J21A 2ZJ6A 2B92A 3OCJA 5CDUA 3RSOA 2PUAA 1I5RA 1G4AE 4AAYA 3NIDB 4DMMA 2C5HA 4G0XA 4LF9B 1ISIA 3EK2A 5L3SA 4YP7A 4HADA 3T7RA 3D3WA 4DIFA 2BZ0A 1Z3IX 1WO8A 2CN1A 1I14A 3G2KA 2A88A 3N3AC 1O4VA 3O8LA 5C0OE 4IJMA 2D1RA 1BCRB 3X1ZA 2UYCA 4KTVE 2D54A 1YZQA 2AV6A 3PEVA 4RD3A 2C1EA 4O6VA 1C0LA 3ZV5A 2OYCA 4KSBA 4OSPA 3MJRA 1DKRA 4DCTA 1Y3CE 1YBFA 2BUBA 4MW6A 4WY5A 3ZDFA 3IBTA 1H65A 3ADPA 3HDYA 4F7DA 4ZI2A 5IYZA 5KTNA 1WHTB 5CU7A 4IDHA 3HKCB 3HPRA 3UBMA 4YRIA 4RYDA 5AKHA 2LKDA 4C4XA 1XJ5A 1K08A 3S2YA 3CTMA 1BOOA 3PS9A 1W1WA 3DYBA 1FVOA 1MAAA 2OZLA 4WLVA 4C88A 2PR7A 1R5JA 2VNJA 2JFNA 3GWZA 4FSDA 4INPA 2XRFA 1UJCA 4EMUA 1BFKA 1R12A 3HV0A 1LZLA 1DDIA 4MGYR 3N2ZB 4BMVA 4KJXA 2W00A 2GJ8A 4NZ9A 5FBRB 2XGGA 4NPCA 3DFFA 1QK5A 4PQEA 3TXAA 3BH7A 4AYXA 3KSUA 4Q4LA 4DV4B 1A9RA 3R23A 4OMUA 2D7DA 2BOVA 1I6KA 3QHPA 1HT0A 2IF2A 2DM6A 4IGAA 3ZIAD 4DHWA 1KMHB 5ALFA 2QUJA 4QVIA 5FIUA 2BMWA 1XVAA 3M6XA 3R1IA 3K1AA 5DO9A 1NXTA 4ZC8A 1A4UA 3T95A 3ZIAA 3PDWA 3FMVA 4ZCRA 3ZQ6A 4JMPA 4FMPA 5E1BA 3KTAA 1VG9B 4MUKA 1XTTA 1QVVA 3D59A 3I5XA 3NT2A 1PV4A 1H23A 4RK1A 3OJ0A 4EYGA 4WOKA 4IZIA 3IELA 4DLNA 1IEQA 4RV4A 1VE9A 2JIOA 4NCJA 1L5GB 1HFKA 2E9SA 4BLWA 1X6VA 4EHKA 4UQPA 1EE9A 2M32A 4HN4B 4M9UA 4EENA 4TVSA 4XYLA 2OGWA 3WFJA 3E9MA 2P78A 2N42A 1AU9A 1AC5A 1AUOA 1QLHA 1TIBA 3ZR4B 1F0YA 5KYXA 4U6SA 1SQSA 3JVDA 4FOTA 2DFNA 5D6OA 4QM7A 2DECA 2R1TB 4NOJA 4NYIR 4R1TA 4RX1A 5LZ5A 1Q1EA 2ERXA 2Y1EA 1T24A 3L7NA 3T0GA 2QTTA 4DJAA 4IM7A 4YPFA 3KXDA 5ALGA 4ZMRA 2ZBRA 2IYRA 4R6XA 5ILGA 5DYTA 1C30B 2C0QA 2GAFA 4Q4DA 5EFZA 4TQ9A 1Y6GA 4TL8A 5HZMA 3V4FA 1XOIA 4LV6A 1SUCA 1D0VA 4Z7NB 1F3LA 3UAVA 4G56A 4EO7A 1ZOLA 3RADC 1ZM2A 2YY5A 1C7ZA 3GZ4A 5ALKA 1ORVA 4QO7A 2H2FA 4YJ2F 4MRRA 3FPHA 2F6RA 5CA0B 4NFLA 1NXOA 1FNNA 2VP4A 3PGA1 4NOMA 2BEWB 3OCCA 4TN1A 5DHQA 3HBAA 1QJCA 3OX2A 5KVAA 4GT1A 4JKIA 1UBRS 3RUPA 2JGAA 3ODPA 5FWAA 1W36B 3KKOA 4YRTA 3NALA 2YWRA 4BUCA 2J8ZA 1EIWA 3LRTA 4QODA 1N92A 3OIWA 2PKCA 2V7WA 1W0JD 3SYNA 3NVKI 4LJLA 4OQFA 1S3GA 4YRFA 3WISA 1ZQ9A 1VQ1A 3I9LA 4ZP1A 3PE4A 2WVGA 3WLTA 2OC9A 1XA3A 2P4UA 2A5JA 4R31A 1KZ4A 1M2HA 1Z7EA 1RBMA 1RHJA 1X0VA 1U5CA 5TT1A 4B71A 3S55A 1UKVY 2JAOA 5D01A 4ZRMA 1QG2A 4FFMA 4HMPA 4L76A 4D4MA 4C03A 3KZXA 2OOKA 5KO2A 4GRIA 1PFVA 2ZIFA 4RE5A 3TAXA 4AF6A 3KWMA 4IXTA 1WDWB 2Q3BA 4F56A 2KI5A 5F12A 1K7FB 4FFOA 4EZIA 3AJAA 4HNTA 1EK0A 4HAWA 1NNSA 1WB4A 3BWCA 1U3DA 3BRSA 2PO5A 2NUPB 4UOQA 1Y1TA 2OQ2A 4Q93A 3A05A 3WK7A 2EEPA 2HB6A 2NOAA 2OHGA 4C4OA 1KETA 4XPZA 3RE1A 3TDNA 4GIBA 4WKNA 3P9NA 4PGHA 2B4RO 3CG0A 4IH1A 1KQ3A 2O7QA 3E8MA 2J3EA 3H9BA 1LSJA 5A7FA 5BWNA 4OL0A 3B3QA 3OZFA 3AX6A 2YV4A 3K09A 4UQOA 4ZU1X 4QTUB 3QQ5A 1FP7A 1MG0A 4KX3A 2H7CA 4D0GA 4PLZA 2XE8A 3ESAA 2CEKA 1ILEA 1KOFA 2HCBA 5FPTA 5B2FA 2FPXA 2XCOA 4TXLA 3MUOA 3ZDAA 1IEWA 4CEHB 1TVMA 3ENZA 1HYBA 1IWOA 3AI7A 3H97A 1HQCA 2PKQO 4LBWA 5FL3A 1K6XA 3QMWA 3OQIB 4LHEA 3RRZA 5FUYA 2NP6A 1YDEA 1GCUA 2NQ2C 3GJ7A 1PTJA 4P34A 4XYMA 5GV7A 4BNZA 4OGFA 2V0NA 3TW8A 3RK0A 2IOYA 2J0EA 3OHPA 5EVCA 3WGVA 3SYTA 1L7QA 2PIAA 2IPXA 3P4XA 3MRVA 5FOQA 1KO4A 4QBTA 2A0YA 4RY9A 4EHBA 1LPOA 1RDFA 2WDPA 4MV9A 3ZE1B 1EKXA 5DTMA 4YV1A 3SZRA 1NFFA 3ZE9A 3WRXC 1C9KA 3QPBA 1KAQA 1NQOA 3OIUA 1WXEA 2GK7A 1LPSA 3PNPA 4KDCA 4Y9SA 2EP8A 4OXIA 4NYMQ 3C45A 3RIYA 3CH5A 4G1EB 1J99A 3SBEA 2E5LB 4WVLA 1BEUB 2QJTA 3KSRA 4ND8A 1P4SA 5BYAA 2V0GA 2FRDA 3UT5B 5JBIA 4LDQA 4FUQA 3I23A 3H3JA 1G5TA 2BDUA 5B3LA 1IWBB 1H69A 1MAVA 1GZVA 1TFUA 5DTRA 2ZIEA 4BJ6A 2V74B 4EG4A 3F8SA 4F84A 3IHTA 3UMMA 4I9UA 2WR8A 2BKAA 1ZOIA 1K8XB 4CF3A 2WV9A 2PLWA 4G1CA 1JJAA 2FLWA 1ONOA 3TLEA 2XF2A 1T5TA 4ZJZA 4TTAA 1DJMA 1VHJA 4FJ0A 4KN6A 4RGYA 5DT2A 2HQBA 2J3JA 5T64A 4B3MB 3KQMA 5JCZA 1DI0A 5CH3A 1QIFA 4EECA 2NNWB 4JC8A 5A0VA 1FU7A 1U94A 2GAAA 2GAOA 3NPMA 1O89A 1ZOOA 4LYFA 3NBYC 4M22A 4BMCA 1NKSA 1G8KA 3EMDA 1JB9A 3EH1A 4AMYA 1CB7A 2W2XA 4U7FA 5ARCA 2YS7A 3BAFA 3PJFA 1XN1A 3G2LA 4EUEA 4DDTA 2B5WA 3ND5A 1RQ7A 1X8LA 3ULKA 4BP3A 5AFSA 2YNMD 4L5AA 4QYSA 1FNDA 3H6HA 2FJ0A 4OK3A 4M0KA 2YNMA 1HSZA 1VBNA 1WEKA 1II9A 3SOPA 4KO8A 2R2AA 4ZOCA 5T3YA 2QW1A 4QOJA 4DWOA 5IFKA 3D5QA 4CKXA 1B2RA 2B78A 3BA1A 3QVGA 4LCBA 4F4UA 1NBHA 2IUTA 5K8IA 5EMMA 1JI0A 1IYZA 2FPKA 4TLLB 3WXMA 4DDVA 3HN2A 1G8AA 1JQKA 2M1ZA 2PKYX 2XT6A 4KWCA 5K6AA 1I01A 3LQQA 1E6KA 5SZJA 2Z30A 3F5MA 4WXRA 5LD2C 3FTEA 1G5PA 4D9BA 5EJ8A 2DBRA 2EGGA 5JR3A 2A9QA 2PTHA 1NHGA 3D6JA 3OQPA 3ND6A 3P5BA 5HF9A 1FUUA 4JEUA 3ZV3A 1AUQA 5LXTF 4MQFA 4D79A 1M9NA 3IUMA 4WRRA 4MVYA 4IIJA 4LNAA 1L3BA 3CXUA 1IAVA 1Y4SA 1L5LA 2VJLA 4BQIA 4C4YA 4DREA 3GDFA 1E5QA 1E6CA 4AN0A 1WS6A 3GRKA 4EHAA 2HPZA 2Z8ZA 3JY6A 5BMVB 1GCOA 4WPGA 5BSTA 5L4SA 1C80A 3QU7A 2XBMA 1HV8A 3KUXA 3LIIA 3D5EA 1PZEA 4O5AA 4BPBA 1YUMA 5CG2A 3P4YA 4Q02A 3TQOA 4ALNA 1SVNA 2P1DA 1BFDA 1SUFA 3MNFA 5CJPA 3VXKA 1YRAA 2GHTA 3INNA 2WYWA 3CXRA 4YROA 4W1PA 4MPPA 5GJBA 1TJ5A 2EIHA 3JD3A 4K1XA 2ZPAA 1E9RA 3T7SA 1RTKA 4I5FA 4LUCA 4FFVA 3IAFA 3KWJA 2VSQA 1HLDA 1QQTA 4E7OA 2EBUA 1N6HA 1BXZA 4OMDA 5KTSA 4QGAA 3MVEA 4JYMA 4CMBA 4YY3B 2CW5A 2DUNA 3GGPA 4LV8B 2V58A 3L7YA 3SD7A 2QD1A 2R86A 4GD3Q 4EPRA 4PNEA 3I5YA 2HT1A 3CGWA 3N74A 4CXMA 5D6NA 4F3CA 2YINC 3A4MA 4GW3A 1VCNA 1AIPA 3KVRA 3R3SA 5CX4A 4BVJA 1RBYA 4JROA 3ELYA 2ZJ4A 4LYGA 1QYWA 1SHLA 1U2PA 1WHTA 2ASVA 1V7QA 2F9LA 2Z8YA 1ZUHA 1WKBA 1JFTA 2JK1A 4P3OA 3H99A 3PZBA 2G67A 3PC7A 2QJOA 4U7HA 3EPJA 1PNRA 4CF7A 4JJ4A 4NENA 3F96A 1FLDA 2CNOA 1JJVA 1MIHA 5PGMA 3ZWBA 5JNRA 3IS3A 2FSGA 5DCUA 1T0HB 3G2MA 4RHYA 5CITA 3A7EA 2VDMB 4P82A 2QZ4A 4FBMA 4BVAA 2XKAA 1EFRD 1ZY2A 1PFKA 2G77B 3RUDA 3SF8A 1WF6A 4IDOA 3VDRA 2JDID 2XUAA 2M6SA 2OD7A 1V9LA 2RGAA 3CVJA 3GLGE 4HX5A 2P40A 1EFRA 3ZH2A 3MQ2A 1JVBA 4JC5A 4N9QA 2UZAA 5LMNB 2JDIA 1QHEA 5IN5A 2OQIA 2X42A 3ADKA 3TWOA 3CYFA 2QOEA 3EXIA 3UK0A 3PR1A 2FX2A 3FYUB 4OM7A 3HLTA 4F04A 3AETB 1JU9A 3T1QA 1T3LA 5DBGA 1EZZA 4B44A 1VXRA 3DLTA 3UA4A 5AO9A 1E6WA 5EIFA 3X0DA 5C7IO 1MGPA 3TRKA 4C4AA 1EFUA 2I71A 4GLJA 5CT9A 4KI0A 1NMEA 1MO6A 2O23A 2RG7A 4NMXB 4DABA 5CT5A 3LBHA 2CLIB 4JCCA 4YFVA 1NGSA 2PMKA 1LRJA 1I1HA 2PMBA 3GLSA 3PQFA 2QGFA 1NAIA 1SELA 1ECCA 2IZOA 4PNZA 5CNKA 2JZOA 3JD2A 4RIIA 3V7NA 1BTOA 3GY0A 1C0EA 2XMPA 3JASA 1WUTA 3W78A 1X1EA 2WFAA 3QKUA 4PIMA 2W6JA 4B85A 4WLOA 2YDXA 4WUVA 4QA9A 2DY1A 1ORIA 2JAWA 2NN3C 2R1TA 3UKJA 4EGQA 2Y3IA 1AA9A 1ADBA 4RA9A 5K6TA 4BVGA 4ZYYA 3ONNA 1WZCA 2WAXA 1C4OA 1JSCA 2I0FA 1C2YA 1YDMA 2V7BA 4LXGA 5EJGA 4EGCB 4H4EA 4HLUC 1TPYA 5ISMA 1DG9A 1C30A 4R7GA 4PZ9A 3OTGA 1UCFA 1DCFA 1PSWA 3AR9A 3KUKA 3V32A 3DCNA 2PJZA 3U2QA 4G0NA 2I54A 4BNLA 3GLIB 2W6ID 3BL8A 3QZUA 2ZI5A 4OYRA 2O0HA 2G4VA 4ZI7B 3CM0A 1XQ9A 5IYZB 2BKEA 1P8AA 2I1LA 3ET4A 5CA0A 5A0FA 1V11B 1IUOA 1MVNA 2BEWA 2EL9A 2ID8A 1ZJZA 2GA8A 1QAOA 4FQ5A 4XGQA 4X65B 3DPUA 4JJZA 3L1IA 1NBMD 2R7KA 4G1UC 2PT5A 1SQ6A 3DXFA 3AR4A 4WVFA 1MT0A 2EKLA 1DKPA 2WAOA 2NYRA 3DDHA 3JZMA 2G5CA 4IIGA 4OUDA 4ZDWA 3RLIA 4E70A 4A03A 4RVNA 3KLNA 1NBMA 1CQJA 1NVEA 2NZWA 3PQ3A 4CWAA 1PCXA 4KBFA 3LZDA 4HDRB 1PFYA 2VDLB 3QEKA 4H0NA 3W7AA 1R6TA 1NC3A 1R0ZA 2QD2A 3WJ2A 4PGFA 1RPAA 4BGUA 5K0ZA 1C9DB 2P75A 3RI3A 1TZ2A 1O6GA 3VMMA 2YVUA 3G7NA 1Z6PA 2CLLB 2RJNA 2V7TA 4TKUB 1IG0A 2G9VA 1QH0A 3ZWNA 1P2DA 2Y0DA 4ND1A 4P4LA 4PZEA 5KSPA 2J33A 2R8RA 4NJOA 1N5RA 3UJ3X 1ZN2A 3OLXA 3OZXA 4N76A 4RJ2A 1PDWA 1U0TA 4YUYA 1IZYA 4XYGA 3AJRA 4AJOA 3QLTA 5H16A 2NUPA 1NW9B 5A9TA 3L49A 4EG8A 3LK7A 3OUUA 5SY6A 2B3DA 2DHQA 5J4KA 3K2EA 4D3ZA 3B38A 4IMJB 5EZYB 2M6KA 2A58A 3MT7A 5GTDA 4W5WA 1DWQA 4BEJA 3E81A 4ONEA 3W3ZB 5C35A 1Q91A 3RYTC 4HYTA 1RQRA 1CRWG 2EFDB 1YOVB 3GC6A 5T5QA 3IQZA 3L8DA 3PJDA 2O2CA 4OQ4A 4UNPA 3UWDA 4KXUA 1DKQA 4Q4JB 1GG8A 4WLFA 2V7QD 5EIHA 1L4LA 4IF6A 4LBZA 4KUGA 3NJ4A 3ESZA 2RARA 5EVJA 2JATA 1GGKA 3MQFA 1R9NA 1GL7A 1R6VA 1CZUA 1HF3A 3FGOA 4P33A 4C14A 1JSLA 2D5LA 1R16A 1QRSA 4OUKX 2RSLA 1DIHA 4QYMA 4HZUA 2O8DB 1APBA 4TWIA 1KNQA 3JZFA 4YLYA 2AEEA 4RVHA 4KXQA 1Y33E 1WVIA 3HJNA 5CW1A 4M38A 2VCHA 2ZAMA 3PHIA 3WIVA 4OP3A 2DSTA 2II6A 4YMHA 5K99A 2BVNA 4DDHA 1EUYA 1H22A 4Q7MB 1SCIA 1UBLS 2W11A 5HGJA 3T5GA 2NO9A 1QPBA 4F3TA 4MA5A 3NHJA 4O2AF 4LS3A 1FB5A 1G9TA 4CMJA 4YAFA 2FGJA 3I9V1 4IICA 3VH1A 4BWVA 2A1UA 4DMUB 3DCYA 1IHOA 2A9VA 1VIVA 4JEIA 2R6JA 4JFRA 3PFIA 1N5JA 1ECJA 1GA6A 4WBNB 5T8KA 1GITA 1YDGA 4P08A 2HRZA 2PWYA 2X9QA 3AJDA 4GR9A 3OJCA 4QQFA 5SV2A 4CBVA 2H11A 1Q77A 1W581 2NTNA 4HTAA 2E49A 2VHUA 3K5WA 1DUVG 4DRZA 2PU7A 4KV9A 4JUIA 4WV3A 2ISQA 5AVUA 2ZREA 2Q2OA 3QH4A 1G1MA 1Q92A 3QG1A 4I5IA 3SSNA 3VQTA 1MABA 3L77A 5FWNA 1ZISA 4K86A 2V9ZA 2B7LA 3AEQB 3B7WA 2JS7A 4P92A 3ZVNA 3AHFA 3TOZA 2IOFA 1N7JA 3EVDA 4E6PA 1BCSB 1WXXA 4HJRA 2PUFA 1NVVQ 2P9TA 2GYYA 3UKDA 1FMFA 1GVHA 3SEQA 3GJ0A 5IZ4A 2JRCA 3KIPA 4XM0A 4DQVA 4UCXA 3M6AA 4GWGA 4N4AA 3GVHA 5CGZA 4QTYA 3QTBA 1TIPA 4PQGA 2IODA 2H92A 5COBA 3GVXA 4F4JA 5JWHA 3G7UA 4CRWB 2PQ2A 4COOA 4UU8A 4N6GA 3ZKAA 5C32A 1UZLA 1ULTA 1GGNA 1V26A 4UUNA 1FLNA 1Z5NA 5LYJB 2YFHA 1QIKA 3L01A 1RR6A 3WZLA 5I48A 3F4BA 2PV0A 2ETVA 2I3DA 1Z47A 3AHGA 2XADA 3CEHA 2G17A 1P39A 3RAFC 4JYBA 1WUIS 4Q18A 3WRWA 4BZWA 4EA6A 4UTVA 1YS4A 2Y27A 3ZHQA 5IVPA 1WXHA 2PXXA 5AXAA 4KW7A 5FWDA 2ZJ0A 1Y8RB 2X6RA 1ICIA 5I5GA 4QU8A 4QLOA 3AOEA 3WP0A 5LIRA 3IDQA 3EARA 2QY9A 3E18A 3DQPA 3N8DA 2VYFA 3AF3A 2Z2JA 2OB2A 3EISA 1STOA 4E5SA 1G2PA 3OT5A 2EP7A 2X9NA 1U98A 3T1VA 5JBNA 2EZ8A 4DV2B 3MJCA 1UMCB 1J1ZA 4H1VA 5G0TA 1ULHA 1JEJA 3Q0IA 2WB4A 1N2JA 2YZGA 3FMFA 3ICWA 4CTMA 4YCCA 3NTXA 2HQ1A 1NSFA 1UJNA 3UJBA 4Z4EA 2BH2A 1PJCA 3N8KA 5FBQB 2PL9A 4ZANA 1JFSA 1S01A 4Q39A 5EP3A 3BE8A 3GRYA 2H1HA 5KQMA 3DTYA 2XE6A 3REQA 4KLZA 1Q3HA 2NO4A 5C8XA 3OIGA 3V80A 3Q3IA 2JVIA 3OY2A 3MWGA 4L4SA 5EQDA 4DG8A 1ZD3A 2X0RA 3SXUB 3VO2A 2AI3A 4CQMD 4O4HB 2IPAB 4BVFA 1AQJA 3SC2B 1GR0A 3WKDA 4BQNA 3AONB 4BZXA 2ZOSA 3S3TA 3UKOA 5E6RB 1U0LA 3V46A 3AR7A 3H5TA 4CQMA 1SIBE 1KJZA 2YWJA 3TR5A 3UYKA 4I6JA 4EBFA 1TM5E 2YJ3A 1SGWA 3OLVA 4YRRA 3K0SA 5EMLA 4EQ6A 1QQBA 3VOTA 5BNFA 4LYYA 2BY4A 4ZC1A 1Q6ZA 2WIAA 3QKTA 2GILA 4JENA 1ZSYA 5ADHA 5DYGA 5JRDS 1H3EA 2VJAA 4L02A 1ZK2A 2WYUA 4FMCF 1D2GA 4E14A 1CF9A 2VUTA 3HSYA 4I1OA 4D9NA 4FFWA 4QG3A 1CR6A 4BFSA 4N6NA 5AMXA 4UTOA 1EXVA 1QYDA 3GQBB 4G2NA 1W87A 1OXXK 2C03A 4KQXA 3RNLA 1NTOA 4ENWA 4C20A 3EEOA 1XN4A 3R7FA 5FT9A 1ZXLA 1N2CB 3VYSB 3JSXA 3CU5A 2QBYA 1L7EA 1EP1B 1NRJB 1QAQA 1Z33A 2VR1A 3LX8A 4J7CA 4GG1A 4EK9A 2R6DA 1OCEA 3FHJA 1QHHA 1BIFA 1VHTA 5CIQA 1HA3A 1O97C 4L8YA 1WQ4A 2W6MA 4FJ2A 2P9BA 1QVWA 3FI9A 4B48A 4BNKA 2GKSA 3E22B 4LI0A 1ZJ4A 4U3JA 3CLVA 4NC9A 4NWIA 4MRMB 4K9SA 1P17A 1GZ4A 2WKSA 4MWTA 1XNHA 1M34B 2ST1A 4L5YA 1NVBA 5BWOA 1BQEA 1IM5A 1CD5A 3KSDO 1PZFA 1SCQA 4P35A 3ADBA 5HRUA 4ZTZB 1XKXA 4WKGA 4LHVA 1P7ZA 3KWLA 4OHUA 2Q50A 4Y6SA 5HRAA 1ZD1A 2O20A 3NVMB 2PUHA 4RELA 1EBBA 2Z3WA 2XUFA 4HAXA 2VATA 4JGBA 1YNSA 4CIDA 1RWXA 3TLAA 4FWIB 1S96A 3USZA 3P2KA 2H63A 1A27A 1C2TA 4MUAA 4WDRA 4YAOA 4BKRA 3AV3A 2MSEB 4AJ1A 4QL3A 1QUEA 3LT0A 3MF4A 4J2TA 4AU1A 2RI6A 3FYUA 5JUWA 2WKPA 2CBGA 4DSZA 3AETA 221PA 2J9GA 1T5SA 4PAGA 5H4HA 1CUGA 3UW3A