5IRCD

P190a gap domain complex with rhoa
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
178
structure length
170
Chain Sequence
b'IRKKLVIVGDGACGKTLLIVNVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho GTPase-activating protein 35
publication title Deciphering the Molecular and Functional Basis of RHOGAP Family Proteins: A SYSTEMATIC APPROACH TOWARD SELECTIVE INACTIVATION OF RHO FAMILY PROTEINS.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 55
structure length 170
sequence length 178
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ircD00
4BE7B 1XF9A 3VR4A 2QP4A 4R71A 2ANBA 3WYAA 2QROA 3FKSD 2BWJA 3SU8A 3B9QA 1BMFA 4QNRA 2E1RA 2PBRA 5L3SB 4BEJA 3CNLA 5JFGA 4RFSB 4TLEA 3THXB 1CF4A 2V6IA 1ZW6A 4RFSA 4CEHB 2XEXA 1E9BA 2YWFA 3T5DA 4LWZA 4OKSA 4QBIA 4MQBA 3GLIB 1ZM3A 4AD8A 3MRSA 1Q0UA 3LA6A 2VHQA 4JL8A 2CHVA 4DXAA 1U0LA 2ONJA 1JQLB 1D6JA 1SHKA 1LNZA 4DT1A 4IEEA 4TT3A 3W90A 5CITA 1RZ3A 3B1XA 2P5TB 1T8TA 3GLFE 1US8A 1EFHA 3T1QA 1JB1A 1KO5A 1X1SA 5DN6D 2ZSFA 1OIXA 4EDHA 3BGWA 2YHSA 3LNCA 1Z6GA 3CKLA 4R2IA 4HLDA 5DI3A 4PZLA 2NO9A 1KK3A 3E70C 1ZC4A 2P6UA 4B47A 1QHHB 1BS1A 3I73A 1NKTA 2JLZA 3KKPA 4KAXA 4O25A 3WBKA 3R8FA 3TIFA 1GNPA 4M1KA 4EFMA 3B13B 3OFNA 5C46F 4OHZA 4H1UA 3CIOA 1IHUA 3RS5A 1AKYA 3A4LA 1N6PA 4LHZA 4QRHA 4DC9A 4FMDF 3W5IA 3QF4A 2V54A 2W2XA 3ZVRA 3SE0A 2ZRAA 3P1JA 1DEKA 2B7CA 1P9NA 2WAYA 5E7IA 3U7GA 1CJTC 1G6HA 2REOA 1T3SA 6Q21A 3BOSA 3QKSB 2ZJOA 5FOWA 4XWKA 3CW2A 5FUVA 2RCNA 1GZSA 1R4AA 3FGNA 1ZM9A 1OH6A 3NDBB 1LS6A 3TUZC 3H84A 4JYBA 5LD2B 3Q9LA 4FCWA 3DOEA 5GVSA 1TEVA 1CP2A 2YZ2A 3LAWA 1OIVA 4KV9A 1OXTA 2QAJA 5EXXA 2O8DB 3KKNA 3PUYA 4Q9KA 2FH5B 3A37A 4TMXA 2OCAA 4QBGB 1E9EA 3DMDA 3I1FA 5EXSA 2B6HA 3PEVA 1NLZA 1XD2A 1QBKC 1W0JD 3LH5A 3PUZA 4BFSA 3A6PC 5EUMA 1E2GA 5FPHA 3K0CC 4LHXA 1N25A 4E03A 1CJVC 3IEVA 4JKYA 3JZAA 4QM7A 1YKSA 2HDNB 3TQCA 4OQMA 1BKDR 1G18A 1T4GA 1W0KD 4QJ5A 2GJ8A 4WBSA 4KJZA 1UBEA 2C99A 4EJSA 1W36C 2BDTA 5FUWA 1ZAKA 4QL3A 1ZIOA 2NO1A 3T35A 2D4HA 3D8BA 5FPTA 1VHTA 2ZIAA 4BLPA 1Q44A 1SVOA 3A1WA 2B8WA 4AG6A 4BLTA 5KSYA 2DCUA 2F9LA 1FX0B 1XJCA 2R6AA 4QBHA 1FX0A 3W6NA 3AEZA 1R7RA 1ESNA 2ZJ2A 3GLHE 2EYQA 2ANCA 3FWYA 2JJ8A 4V0OA 1VPLA 4LBVA 1P60A 4TTPA 2DY1A 1P2UA 1Z6YA 3VKWA 4M53A 2ZI3A 4IOLA 4LYFA 4MRVA 4EPWA 3I32A 3SFVA 1KDTA 2BMDA 2FMXA 2O0KA 4C0HA 3U6KA 1ZRHA 4CW7A 1J8MF 3AF0A 3L8YA 1AM4D 4UNNA 1JNYA 2OE2A 1G16A 2WOOA 2ODEA 4Z54A 2ZYTX 3PCRB 5EE3A 3H86A 3SJZA 1S9HA 1LW7A 2P3SA 5GVRA 5HCIA 4DZZA 4Q5IA 3C14C 3MG9A 4NCKA 4LC1A 4US0R 3U5ZB 1LY1A 1Z83A 1WP9A 1EFUA 2GJSA 2W6IA 3EASA 2BV3A 2XNDD 4BZQA 1QHXA 1QHIA 1KJWA 1GKYA 2AK3A 4MGKR 1R2QA 2ZUCA 2GEVA 2YC2C 5JI3E 1SKYE 1Z5ZA 3O8BA 3RRMA 1N6KA 1RYHA 1X1RA 2GK7A 1TPZA 2V9PA 2PL3A 1XCPA 1SXJA 5HZHA 2WZQA 4JIMA 4ZDJA 1JECA 4POAA 2O8EB 1P72A 1XPRA 3RS0A 2QTHA 2BM0A 2J59A 2Z43A 1YZKA 1DE0A 3UXMA 4WZBE 3UMSA 3V00A 1E98A 3UK6A 3NDPA 2QG6A 1GRNA 3U44A 3K70B 4RZ3A 1YU9A 5FBLB 2FPKA 1SULA 2GVDC 4ZCMA 1SVSA 2FPLA 3TUIC 1FMLA 1A82A 2WHXA 3E5HA 5EP4A 2W83A 3IIMA 4W9MC 3CRW1 1LV7A 2HCJB 4DB2A 1R8SA 2LWIA 2RMKA 1V43A 3QXHA 2YC4C 3SBEA 2O5VA 1NL3A 2QE7A 1FZQA 3KB1A 2OFWA 2AHOA 4HZUB 2BHRA 3L0SA 4BZXA 2JIZD 1WF3A 3IGFA 4PHTA 3I8SA 2FFAA 1II8A 3AF2A 3FKSA 4PQYA 4U00A 1N6IA 1Z29A 3F5FA 1KJYA 3QXXA 2X19A 5FOSA 4UNRA 2KE5A 3Q8XB 2IUSA 3CX7A 3LVRE 4HUTA 2WAXA 1HTWA 1Z0FA 1E2HA 3CB4A 2XZPA 4GFDA 4BQSA 2FJUA 1N5JA 4IVQA 1JXMA 2YVUA 1KI9A 3LW7A 2Y8EA 3NC1C 4PPGA 2HLDD 3W8RA 4DJTA 1K5GA 3PR1A 2H5EA 1CEEA 2ZU6A 3AVOA 2IK8A 3Q85A 4QHSA 4JLAA 2J7PA 2PMDA 1W46A 2WKPA 1W4BA 2H17A 3LY5A 4Q47A 1E2QA 2ZANA 3ZVNA 3DPUA 4HEJA 3M1IA 4YMSA 3IO3A 3PEUA 1S4QA 1AA9A 3OEED 5FBQB 4EQ6B 2FNAA 3GEHA 3Q5EA 4B3BA 4GP7A 1WCV1 3SYNA 1UAAA 1CJUC 2RGAA 4HUQB 3AH8A 2UZIR 2RKOA 4JSTA 2WV9A 2ECKA 4TL9A 3B1ZA 1G7TA 2IYQA 4IDPA 521PA 4L8GA 3AKCA 4KVGA 4URXR 5BYKA 3SJBA 3GQBA 3DL0A 4M1OA 5SZJA 5K8IA 3I61A 4LJ7A 3TQFA 5JCPA 4Q4LA 4TYQA 2EFCB 5KHOC 4RY2A 1DO2A 3GLFA 3B1WA 4LPKA 4LX0A 4GPTA 1RRPA 1MT0A 3NG1A 4XH9B 3B85A 4OL0A 1YR8A 3LFUA 3SHWA 1Q3HA 3A1SA 5JS7A 4WZAE 4KYUA 3AUYA 2Q3MA 1T91A 3LX5A 3RWOA 3V9PA 2FEOA 4NU0A 4NP6A 2JATA 2GVZC 4A2QA 3MFYA 3NBFA 2IT1A 5FTJA 3WY9A 1W0JA 3UWKA 2H92A 1FPMA 3OHMA 1U9IA 3QBVA 4DSOA 1I4LD 3SN6A 2IA5A 2BMJA 1E0KA 2BOVA 2YOFA 2XZLA 3EA5A 3NVAA 2VP6A 4AKGA 1PJRA 1KY3A 4YMWA 1PUIA 3LBIA 4JL6A 3JVVA 3C8UA 2PZEA 3KXLA 3VTKA 2NTYC 4JBWA 3SOPA 3VQTA 3W5JA 2WWIA 1TAGA 2ODNA 3BFVA 4PANA 2JLWA 1E2DA 5CDFE 2G77B 2IUTA 3FMOB 3KUDA 4LCBA 2FZLA 4EJSC 2WICA 3KQLA 4ZIRB 3VKGA 3AVTA 1J2JA 2J7KA 4NE2A 4QGHA 1X86B 3QKRB 2O8CA 4DLYA 1CS4C 2EQBA 5L3QB 1R0ZA 4DSNA 4ILEA 2GF9A 5L3QA 2P6RA 1T8UA 3H2YA 2QUZA 4TSFD 1FTSA 4Q1AA 3KZ1E 3EARA 4WXPA 2FE4A 3PVSA 4URWR 2MMGA 1G8PA 4DRZA 5IF9A 3BWDD 2J5XA 3FMIA 3HPQA 4WOPA 4PPQA 1TX4B 5EQTA 5L8VA 1ZUIA 4U7DA 1XWIA 2GEDA 5DNYB 3M4YA 5M04A 4EPRA 2GXQA 3ICQB 1WDTA 2F43B 2MSEB 4HAVA 5FL7D 2REXB 5J4HA 4G1UC 2ZJYA 3ASYA 4N3NA 1L8QA 5B58C 2GA8A 4A15A 2XNDA 2HUPA 3PEWA 1VCNA 2ZAOA 2CCKA 1S9DA 2ZR7A 5B64A 1JJVA 2D06A 5JSZA 5E3HA 3I4LA 4G5RA 4I81A 3K9LA 1P73A 1AS0A 3CBQA 1IN7A 3PFIA 4LY6A 1Q1QA 1OFTA 1HEIA 3KUCA 4HLCA 3AVQA 4KHZA 5J5CA 4YMUA 3LLUA 5KTYA 1J99A 4NCIA 3I3SR 2FF7A 5FTMA 4MKHA 1NSFA 1SXJC 2Q9CA 2VSOA 5AJZA 5G40A 3SJCA 3DM9B 4HB4A 1FQJA 1R5BA 1U98A 3MWKA 1XXHB 1R8QA 2GAOA 2N46A 4DDUA 3ZIAD 3GLIE 3SNHA 1OYYA 2CVHA 1FNMA 4AYTA 1AK2A 1S96A 3CWQA 4PR0A 3CLVA 2ZROA 2A3RA 4OBEA 1KZGB 2CBZA 1C4OA 4OJQA 2WWFA 1JPJA 2KSQA 1X6VA 2VHTA 1MO5A 3OAAD 2NZ8A 5J40A 3A8TA 5B30A 1GWNA 4QM6A 2A5DA 5DHAA 2GJKA 1RKBA 4CEIB 4XTRA 4DLSA 4AY2A 2G6BA 4WW0A 2VL7A 4B2IA 4BEBA 5KDLA 4QNMA 1JAIA 5JMTA 1EG7A 2GJAA 1RYFA 1KI4A 3K0AB 4P33A 1IN8A 1FP6A 3LVQE 2GESA 4BLRA 4FW9A 4HZIA 2W00A 4JLJA 1XTSA 2GJ9A 3K9NA 4M9QA 1EESA 2B92A 3P20A 3EX7C 3SQXA 1T5IA 3OE7D 1XTRA 2DWQA 2G9NA 4B73A 1UKYA 2QI9C 3TVTA 1OHHD 2PCJA 2WJGA 3ZJYA 2QBYA 2JGNA 1DVRA 2NQ2C 2IBMA 2OG2A 4Q9IA 4JLBA 4EFNA 3MD0A 2GXSA 3QG5A 4X8HA 3UATA 4B6FA 2J87A 5AJWA 2DYKA 1GOTA 2NO7A 1U90A 4B34A 3OEEA 2XGJA 2FGKA 1AS2A 1MOZA 3L2OB 1OSNA 5DYGA 2DWPA 4PPNA 2C98A 4UKDA 1P3JA 3Q72A 2XTNA 2JAQA 1DAHA 5AR1A 3WYGA 1CTQA 1E2PA 2ZRDA 2JLRA 3EIEA 5B2ZA 4LBZA 4EFLA 1OH7A 3K0CA 4HSEA 5CJPA 4FI3C 1J7KA 1R6BX 2ZRKA 4ESHA 2VP5A 3C16C 3GFTA 4KFUA 3U3JA 4CYMA 1OH5A 5CIQA 5SZHB 3F0TA 4TYPA 2XZOA 5F3WB 2O52A 4LV6A 4GL2A 4A6PA 4QBFA 2V7QA 3CUEF 3G82C 4DSTA 1S2MA 1F2UB 1W36B 1KI2A 1IJFA 2PZFA 4M9SA 3ETLA 1F2UA 3CH5A 2IHYA 3L82B 4QGAA 2EYUA 4II7A 4XTCS 3WP1B 3WMGA 4R98A 1KI1A 2OSBA 2RHMA 1LF0A 3X1ZA 4KSBA 5CLLA 4HDQB 4OK3A 2ZJAA 4KFTA 1FQKA 4PHGA 3ZGXA 2QP3A 3OIYA 2AR7A 2ZR9A 4LHYA 3HYTA 1U2RA 2PEZA 1GNRA 2ZRLA 4BFVA 3MWJA 4MYUA 3TMKA 5JWRA 2EVWX 2J41A 1EWRA 4MRPA 1E2EA 3T1OA 4UQOA 4LC0A 4C0BA 1UADA 4LJAA 3T34A 3RC8A 1DS6A 5TDHA 1GRRA 1ZM2A 4HAWA 1G4UR 3DM5A 4NYMR 1KDPA 1IY1A 1DG1G 2VLIA 5LDDC 1ZIPA 3TR5A 2AD1A 2FG5A 1G1MA 1OXUA 4ERNA 4WA7A 3VNUA 1N3BA 5KDDA 3PITA 2KB0A 2W2TA 4JLDA 3TAHA 2Z4RA 3TGPA 2ZSBA 3CPHA 3F3YA 1E9SA 1HQYE 2FWRA 3BH0A 2ZI5A 1QG4A 5C4GB 2ZUBA 3LQRA 4O0MA 5FTKA 3VX4A 4FWIB 2REBA 4HLQB 4MGZR 4NYMQ 4A2PA 4NZYA 4BLOA 1F3OA 3GJ0A 1U8YA 1L4UA 2H7VA 2FFHA 3GJ5A 1CJKC 4DCUA 4CVNA 1XJQA 1IONA 5FL3A 2GWHA 4QJ3A 2GCNA 1Y3AA 5HPYB 1HT2E 4KITB 1OB5A 1E0AA 1JR3E 3N2IA 4PHHA 4ARZB 1XRJA 2JJ1D 4MITA 4QOSA 4ACBA 1TF5A 4ARZA 4BLSA 3JZMA 3ZD6A 4A0GA 5LPNA 3SJAA 4NH0A 3S1AB 1FP7A 1OFUX 5CDFA 2IS6A 3L0IB 3EW9A 2WSSA 2NPIA 4JSYA 4ZDIA 5KSPA 4TWZA 3W3ZB 2FSFA 3B1YA 4TL6A 5G41A 3C5HA 1NI3A 3LWNA 1IM2A 1NN0A 2FGJA 3TKLA 4DCVA 2JDID 1A2KC 1NVUQ 2DPXA 3KTAB 3T1VA 1E2LA 2EFDB 1KKLA 1Q20A 4JLPA 1UDWA 1HQCA 3QENA 4RCZA 5BQ5A 4Q00A 2CXXA 2CEAA 3RSOA 1Z07A 4RVCA 5K8TA 3R9WA 4PC2A 1H65A 4LJ6A 2WBLC 3KKQA 2AD5A 4RD4A 1JR3D 1U0HC 1GKUB 1GKIA 2DFLA 4HB3A 4Q1FA 3TAUA 1G8YA 4IKEA 3OEHD 4A0RA 4B3CA 3FHOA 4IHQA 2WWHA 1G5RA 1XFAA 4PFSA 3ONWA 4FD2A 1HE8B 1OXXK 2GETA 1BO6A 1MR3F 2GKSA 2UKDA 2ZSDA 3IPYA 4YMTA 3N70A 4B44A 4KFSA 1XB2A 4F93B 2ZITA 1TMKA 4IOMA 3CF2A 2BKUA 3IDQA 4C7OA 1Z0AA 4OQXA 1BYIA 3THYA 3ADKA 3H1TA 4DT1B 1CKEA 4TZ6A 2HXYA 1AZTA 2ZE6A 2OT3B 5EXPA 2BCJQ 4UXJA 1US8B 2EU8A 1G7SA 2ODWA 2VPPA 4G3XA 4M1MA 1GITA 1NBMA 2GEUA 2XTZA 4PO1A 1UF9A 2O8BB 1TQ4A 2ORVA 4LUCA 4P3YA 5DI3B 2VHUA 2O8BA 4GZMA 1KAOA 1U8ZA 3F8TA 3MUFA 3QVVA 4LRWA 4PO8A 4G5SA 3ZH9B 4MRNA 1L2TA 1ZU5A 2YOHA 2VF8A 2OHFA 1U94A 4DUGD 1N5LA 4CRWB 3CO5A 4IW3B 3OE7A 4HAUA 1LF5A 2YJTD 1XCMA 2OM2A 2VP0A 1Z06A 2W0MA 5FPKA 1OHHA 3P32A 3RC3A 3WYFA 2GXUA 2XOKD 4CT5A 4YDHB 3QF4B 1D8TA 3MCAA 5BYJA 1OFIA 2ZETA 1E3MA 3FVQA 3U61B 1P9WA 3AVUA 1NVWQ 1E0SA 1EGAA 621PA 3ZVMA 3I5XA 2D74A 2F3RA 3B82A 4Y0VA 3WRYC 2QEQA 1TF2A 2C04A 1T0JB 1R0YA 4M21A 1XD8A 2VSXA 1OPXA 2F3TA 3IQWA 5AJXA 1O3YA 3TW8B 2NGRA 4TTQA 2IHBA 1CU1A 2O0HA 2A5JA 1E79D 1XP8A 2I4IA 1ZD1A 1NN1A 2ZSAA 2PX3A 5HTKA 1PLJA 1S0UA 2OBNA 4Q03A 1ZYUA 1RJ9A 2E87A 4UXHA 2KJQA 2OV2A 4B33A 1XD2B 3KJEA 1CULC 1KK0A 5TMPA 1MO3A 1G19A 3U7HB 3ZS9A 3QBTA 4I1VA 1ZVQA 3ECCA 4D81A 4TMTA 3CF0A 2CLSA 1P2TA 1XMIA 1XMJA 2IXGA 1Z0DA 5FBRB 4M1TA 1XTJA 4DSUA 2V6JA 4B2PA 2R6CA 4EJSB 2PT7A 5J4LA 3TRFA 4V0ME 5E7JA 3BE4A 4PC1A 4C30A 3B78A 2W6JD 4O2RA 4FCTA 2FEMA 5KNCA 5FBWB 4UNQA 4E22A 4OK6A 4LJYA 1XEXB 1GL6A 1XEXA 2EW1A 2ZYWX 2A5YB 4L9SA 5F9HA 1XD9A 1VCIA 4B71A 821PA 2QT1A 3CONA 4JLMA 3BH7A 3EWAA 2F9MA 1NG1A 1Z8FA 1XNJA 1LB1B 4JS0A 5DE3A 2ZRBA 3REGA 3KXIA 4H9GA 2IYRA 4ZV4A 2XITA 4N0DA 2EFGA 4XSHA 3EZ2A 1YZNA 1UBCA 5JEEA 4DCSA 3OZXA 4F4IA 2HV8A 1QHGA 2NIPA 4JMPA 2ZPTX 5DISB 1SKQA 4FCVA 1Z63A 1M7GA 4RZXA 1CRPA 2XB2A 4WIAA 4BFUA 5AJVB 2AN9A 3O47A 1A2BA 5KNDA 1PLKA 5LBIA 3VHLB 3A1VA 3WBJA 1OT3A 4QGGA 1Q57A 5FFMA 2IEYA 4ASUD 1PLLA 2YWHA 3IHLA 1D2MA 3NXSA 3CRQA 5J4KA 5DYIA 4C0KA 2ZR0A 2WVJA 3CNOA 5C1BA 3R8CA 3EXAA 1WQ1R 2CE2X 2IYSA 4LHVA 1E32A 1VYUA 2GZHA 1ZNXA 4HYYA 3MWLA 1NNEA 1WRBA 2QA5A 4JVLA 1SXJB 4B6EA 5G53C 3FDIA 1FMJA 3TVDA 3SFZA 4DBLC 1FTNA 3DO6A 3VHXA 3H4MA 2IEZA 2AL7A 2FFQA 4DEYA 4ZDKA 5KYKA 3QEOA 3U6BA 4OHYA 2WIAA 4KO8A 1Z0JA 2X8AA 3I62A 2OCBA 4RFVA 4UXIA 1UEJA 5KDOA 3EZ7A 3U44B 1CBUA 4W5JA 2IXEA 1F48A 3RLFA 5DGXA 2Q6TA 4AYWA 2RGDA 2FX3A 2ZYUX 3EG5A 1P6XA 3EPHA 2OUKA 4M4SA 2WTUA 4Q7JB 2O8FB 1II0A 3RDPA 1JR3A 3SS8A 5TVKA 2O8FA 1E1RD 2QNRA 3C5CA 3SI7A 5HKKD 2IS1A 1EX7A 1YZLA 3OEHA 2ZM5A 2G0NA 2SHKA 1II8B 3ND8A 1IQPA 5P21A 1N6OA 1ZNWA 3KKOA 4M9XA 3GLGE 1CIPA 1K5DA 4G5OA 1NKSA 2Q9BA 2OAP1 1S1MA 1EWQA 1GILA 2KI5A 3EZ6A 1G9XA 3QPWA 2IYWA 2Z5FA 2N1BA 1ZJ6A 3CM0A 4OHVA 2HT6A 4UNPA 4FN5A 2JLXA 1N5IA 1W48A 2WMNB 1FNNA 3LDAA 4PX9A 1E2MA 4TLCA 2C95A 3B1VA 4Q1BA 1RW4A 2QMEA 4EPVA 4NCJA 1TUIA 1IOZA 3QSYA 2C77A 3PUWA 2DR3A 2YINC 2VRWA 1QVAA 4NHOA 1Q1BA 2WJIA 5DN6A 5HR5A 4BFWA 2CMKA 4OQNA 2GBLA 2V55B 3QXCA 3KDSE 3V4FA 1E9FA 5EJEA 4D25A 4Q4JB 1S3SA 3THWB 2FDCA 4IDOA 4Q4JA 5KPDA 2JLSA 1G17A 2OLJA 4Q66C 1NVXQ 4DUGA 3THWA 3E2IA 4A1FA 3TW4A 4BPBA 3QKTA 1Q12A 2H1LA 4A0FA 4NONA 4MRSA 4EPXA 1W7AA 1GFIA 3OIWA 4I4LA 1XMSA 2E9SA 4OYHA 4XJXA 3K0SA 3HP1A 4OHXA 3WHKA 1VECA 3EZ9A 1P7CA 1F60A 4L15A 1ZD8A 1AGPA 3WNDA 2IYLD 3PJRA 4L9WA 4F38A 1Y63A 2VEDA 1UFQA 4LYAA 2A30A 3U2QA 5K8UA 3GLFB 3KFXA 2QRZA 4ACAA 2V1UA 4Y0AA 5FPYA 3U3MA 1TEXA 5AUNB 4F91B 1KSHA 2HYDA 2PZGA 1WXQA 5FUYA 1ZM7A 1HURA 2FSHA 1E79A 1JJ7A 3QXJA 1VHLA 1P75A 2FSGA 1AIPA 3AP1A 3A36A 2JJ2D 3QKUA 5C2JB 1KNXA 1B23P 1KK2A 1OH8A 3GJ7A 1T6NA 4MGIR 3FB4A 1S1CA 5BN3A 3BFXA 3DZ8A 3NC0C 2G1JA 3EPLA 3AGQA 5C4MA 1GM5A 2GXAA 4MH0R 5AK0A 2ZI9A 4AIIA 3K0FB 1GNQA 3R7WA 1KO7A 1WMSA 1T3HA 3K0FA 1W0KA 4DWJA 2ZU0C 4A9AA 2ERXA 2JLYA 4R9UC 1ZC3A 1Q3TA 3ZDQA 4US1R 3H0KA 4Q9HA 4NMMA 5CK5A 4GSYA 3NEYA 1NG9A 2B7BA 1N0WA 2W6JA 1T9HA 1E9DA 3X1DA 2BBSA 3PIRA 4Q1CA 4PXAA 2IX3A 1W44A 2F55A 5JBQA 3B2EA 2O8CB 3ADBA 1SHZA 4NPHA 5L3VA 1UKVY 1XTKA 2NO0A 4AWXA 3CNNA 4JKIA 4Q1EA 1OYWA 4D6PA 4YMVA 2ZE8A 1SQ5A 3A4MA 4BFZA 4O2LA 1ZINA 1LS1A 2J0QA 3SYLA 1L7VC 4D82A 1G3MA 3QOFA 4TLDA 2QM8A 1RRCA 4TYYA 2CCJA 5FI0B 3RS4A 2ZE7A 4P4TA 3O8RA 2J46A 5EE5B 5GJVC 2WPDD 1N2CE 2BBOA 1G8GA 2GF0A 2GRJA 2QAGC 3EWSA 2D7DA 1H8ED 1DAKA 1KTVA 2P0EA 2R8RA 2VHCA 3M6AA 3WXMA 1COWD 2C5LA 3UPUA 5JCZA 1U8AA 4TLBA 5GJCA 4C0QC 1W49A 2PLRA 1KMHA 2ZQ5A 1E1QD 1N6HA 2HXSA 2J0SA 4TYWA 4B48A 2WMOB 3BB4A 2ZE5A 4IDNA 1AN0A 5EP2A 2QMUA 4ZCLA 1QZXA 5A4JA 3KFVA 2A7QA 5DH9A 4TZ0A 5JSZB 3GLHB 4GMDA 2D3WA 3AVPA 2AFHE 3GLHA 3AV0B 4PAQA 3T61A 4CZ2A 4KFRA 3BFKA 2QQEA 2QL6A 3RHFA 3VKHA 2WWWA 1P2SA 4A36A 3Q3JB 3FHTA 1C9KA 2XAUA 2R6DA 3AP3A 2OBMA 3NEJA 3HJNA 2NMVA 4R7ZA 2BBTA 3AF3A 3MJRA 3NTUA 2IYZA 5DSZA 3U60B 4ZO4A 4DLZA 3CZQA 3DMNA 1IAQA 1K8RA 2FV8A 4IVPA 4XWOA 4GZLA 1NF3A 4GDFA 1DBSA 1H8HD 2JLUA 4FIDA 3CRRA 4ABYA 3NH6A 3RRNA 1Z08A 1KGDA 1Z6XA 1D9XA 2BMFA 2A9KA 3IBYA 5AUOB 1W4RA 3P4YA 4D26A 4KI0A 1D5CA 4U02A 4HI0E 3GEIA 4U5XA 2Z4SA 5CIWA 1GG2A 1BH2A 1E2KA 3N2EA 1M6NA 2WWYA 2JEOA 1E1RA 1GL9B 3VR6A 2BCGY 1SKYB 2RGBA 1VG9B 2WJHA 2YWEA 4Q7MB 5FTNA 4BLQA 3HU1A 3ASZA 3BORA 4CGZA 2JIZA 4TMZA 4LSGA 4HAXA 1UJ2A 1IBRA 1KOFA 1XPUA 1LVGA 2BC9A 1X8JA 4RZUA 5JI2E 3OF5A 2ZI6A 2NG1A 4A2WA 3QI2A 4C4PA 2ZS7A 2QSZA 4URUR 1AS3A 1S3GA 2PCLA 1R0WA 1WA5A 3R9IA 3SZRA 4BFXA 2FU5C 3HR7A 2X2FA 2OXCA 1U99A 4OHWA 1NJFA 1N0UA 1ETUA 1KHTA 2QTVB 3BBPA 1GVNB 3W3AA 5IT5A 2V3CC 4B76A 1E96A 3DOFA 2D7CA 4JYCA 1KAGA 2HLDA 3WP0A 2QBYB 1IY0A 4F92B 1HE1C 1QHSA 5L3RA 2HJGA 4I1OA 4FMDB 4P4SA 3TR0A 3CH4B 4D4MA 2CL6X 4EKDA 1PV4A 1WE2A 4LJ8A 4KXFB 4B2LA 1Z6AA 3TJZA 5JWHA 2F1JA 4Q7LA 4QGFA 1TNDA 3DKVA 3PV0A 2F1IA 1HYQA 2GBLC 4QXAA 4A0HA 1ESMA 2Q21A 3OFND 1NMYA 3RANA 2EWWA 4C3ZA 1XPOA 5KPJA 1ZUHA 4B43A 2IS4A 4CT4B 3L8ZA 3HPRA 4RKEA 1TF7A 2YNMA 4AKHA 1TQDA 2ZRMA 4P4UA 1ZNZA 3DVLA 1J90A 1IN4A 3QE0A 4LGMA 2QQ0A 5KO2A 3ZS8A 1KY2A 1AQUA 3UIEA 3FOZA 3L0OA 3T15A 3T12A 4G01B 1NP6A 2P67A 5JJLA 4DIDA 2OAQ1 1RPZA 5BXQC 1D9ZA 5FTLA 4AK9A 2A2ZA 4ON9A 2OCYC 3K53A 3AP2A 1XCGB 2XXAA 3EC2A 3ZZTA 1M34E 1NSTA 1YE8A 3NKVA 3V4RA 1M1YE 2OO7A 3WMEA 3IHWA 4DIEA 1NRJB 5CB8A 3L43A 3B6EA 1GL7A 1GDDA 4TQUS 4E09A 4AKIA 3B7GA 2JA1A 2DFNA 2R44A 4YLGA 4IRUB 1VIYA 4RCYA 4V0KA 4D2IA 2VP2A 4PC6A 5KNBA 2GCOA 3ZZUA 2WSMA 4MKFA 3AB3A 1Z0IA 3HU2A 1U81A 1EX6A 1L4YA 4URZR 3SYKA 3K9GA 4GP6A 2VYFA 1NVVR 3OESA 4HATA 3P26A 1Q1ZA 1B0UA 2C9CA 3QY0A 4A8JC 121PA 4HB0A 4LZZA 5HE9A 4BRWA 3O8DA 1R10A 3BERA 3KX2A 2DFTA 4PSVA 4HAYA 1VKJA 4R2HA 5EUQB 1KYIA 5H1YA 4GNKA 5JZVA 4UJ3A 2NZJA 1R0XA 4L4UA 4V03A 4IEIA 4BRUA 5SZKB 2XTMA 1ZCBA 1HV8A 2QT0A 3U3KA 2Q0HA 1GAJA 4TSFA 5JS8A 4PO9A 4M8NE 2RGCA 4DLRA 2CHQA 4PTLA 2HT1A 1NVVQ 3KL4A 1J8YF 4NTZA 1EXMA 4Q9LA 1SXJE 2RGNC 2OESA 1FW6A 3REFA 2CK3D 2P6NA 4PPFA 1EFRD 1F5NA 2WPDA 5A0FA 2RH5A 5BN5A 3TSZA 2CCGA 2ZEJA 4I1UA 2XNSA 2XJ4A 4LI0A 3AUXA 4KSCA 5FPSA 1COWA 2ZJ8A 2A5GA 2JCSA 3FFAA 4PAOA 1YR7A 2GILA 3FFBA 2DFKB 1A7JA 2VA8A 3LLMA 5FL7A 4B3GA 2ZAMA 5EE0A 5IDVA 1E1QA 4QHYA 5F2EA 2QTFA 3GJ3A 1OKKD 1RC8A 3VX3A 4C0SA 3NBYC 3C4JA 4YQFA 4B75A 2V4ZA 3UG6A 3NBZC 2IYUA 3UWOA 4WXRA 2CDNA 3RRYA 1ZD9A 1BYUA 1TADA 3IKJA 2GTPA 1FUKA 1KJZA 2JASA 3TK1A 1KSGA 5E95A 5TV2A 3FMPB 5FR2A 4EPTA 4H1VA 2FN4A 1N0VC 1W1WA 1UBGA 2P5SA 4W7SA 3KJHA 4M0LA 5FOUA 1G21E 1H8HA 4OQFA 3AQ4A 2CVFA 1TQ2A 1ODFA 1GSIA 3AKYA 1DARA 1I4TD 3RS2A 2GZAA 5H70A 3U3OA 3ZIAA 4CIDA 1JXOA 3K70D 1XTIA 1DO0A 2I1VB 3MMPA 1E9AA 1M7HA 4C7OB 1QHYA 1G3UA 3THYB 2ZJ5A 3BC1A 2BM1A 3I8XA 3OAAA 1KO1A 1J70A 4HLUC 2QE7D 2DWOA 4I99A 4MUAA 4PHFA 3EZFA 2QGZA 1E94E 2OZEA 3KB2A 3TE6A 3VFDA 3VU9B 1QHNA 3VR3A 3VU9A 4QG7A 1VCOA 2B8TA 4MGYR 2B21A 3DZDA 3QUSA 2BEKA 3NH9A 4RD1A 3BRWD 1X8KA 3UKDA 2J3EA 2X2EA 1P5ZB 3NBXX 2HF9A 3QPUA 1P9RA 2WM9B 1M74A 2BIFA 4LV5B 4NKRA 3W9YA 5L3SA 2YKGA 1E2NA 3B60A 1G20E 4M2LA 3NWJA 3THXA 4CEHA 4A4DA 3ZYCA 4KYIB 4GI7A 2J0VA 1E99A 3GLIA 2ERYA 1P61B 1QVRA 4BZPA 1G3IA 4BUJA 2IUUA 4IOJA 1R5NA 4FMCF 5SZIA 1UEIA 5EE9A 4C9BA 4D80A 2OXRA 1CXZA 2J7PD 5K8LA 1Z22A 4DLVA 1G5TA 2QU8A 2RAPA 2VIIA 2C9YA 3C41J 4Q21A 2CHGA 4IOKA 3IQXA 4YXWD 2DHRA 4C0LA 2G3YA 2QSYA 1KO4A 1QHHA 4XWAA 5EE1A 1CR0A 3X1XA 5KU1A 4XD7D 1G3RA 1GTVA 2LCFA 4S2EA 4LOAA 1Q1EA 2QPOA 5GJBA 2R2AA 2RGGA 3CPJB 3M0EA 3PXGA 4PZYA 4AYXA 5A5GA 3FHCB 3G5UA 4DLUA 3FTQA 5ELXA 2JLVA 1RJ9B 2ZSEA 1TUEA 3HR8A 5D3MB 2Z6VA 2RB4A 3A1TA 1VG0B 1TU3A 4LBYA 1NLYA 5D3MA 1PUJA 2VP9A 4JVMA 4RD2A 1IXZA 2GHIA 4BWYA 4D4LA 4F4CA 3AVYA 1TL7C 1A4RA 5CJ2A 3PUXA 1Z6TA 5KSZA 3KQHA 2YV5A 2VBCA 1KI6B 2W2VA 2C2HA 4RZ2A 4C0AC 1JI0A 3QKSA 3KXKA 1YZQA 1KI6A 2H57A 1NN5A 2ZTSA 2LKCA 1G6OA 4EIWA 2ZRNA 5CB6A 2ZRIA 4URYR 2Z0MA 1ZNYA 1E2IA 2FFBA 3D3QA 5G3ZA 2VH5R 5IK2D 2OEPA 1LFDB 1M2OB 1F6BA 1HA3A 4QHTA 1XZPA 4DLWA 4ZCIA 1E2JA 2IF2A 2QORA 4ZI3A 4OI4A 2O8DA 1DAEA 2VF7A 3W6OA 5DO9A 2HEIA 3GJ8A 4ZDWA 1S8FA 2VP4A 3SR0A 4PSAA 3AM1A 2ASEA 3LV8A 3GJ6A 3PUVA 2ZREA 4YC7A 1Z2CA 2NO6A 1EK0A 4EPYA 4XSGA 1E9CA 3SHFA 2JLQA 3G0HA 3PEYA 1N6RA 3ICEA 2MSDB 4JT4A 5JRJA 2QENA 1K6MA 2VHJA 5GADl 5EXTA 2QAGB 1E9RA 1KNQA 4MDFA 2QAGA 2ZRPA 1DELA 4GOXA 1OIWA 1GUAA 2VQSA 2IW3A 4Q02A 3LXRA 2WWGA 2ZS9A 2C96A 2J0UB 4RD0A 5FUXA 4LJ9A 3X2SA 3EIQA 3GFPA 2J0UA 4B3FX 3QIAA 1TQ6A 3TUJC 2CLDX 4G5GA 4XVUA 2IC5A 1BIFA 2AX4A 2OCPA 4GOKA 4JLNA 5DLQC 3RYTC 4MYTA 3TSWA 2GAAA 1X3SA 2AXNA 2R9VA 2ZRGA 2IYYA 4IJMA 4XVRA 3IEUA 1AKEA 4DDTA 4OQLA 1JR6A 4D0NA 3EAQA 3EIHA 2CK3A 4LJ4A 1RE0A 5AUPB 1EFRA 2BJVA 3N5CA 2XJ9A 2JJ1A 3BB3A 3RABA 1T0HB 5J4YA 4P31A 2W0SA 4KBFA 3BXZA 3KQUA 5FR1A 3RNLA 2IL1A 5FOXA 3MGCA 1YZUA 4AKEA 4TQAA 2XB4A 1II9A 1YZGA 3BJIC 3D6TB 4PC7A 2RHDA 4DEXA 4AI6A 1HUQA 3CRVA 2I3BA 5EP3A 1OKKA 3ADDA 1XXHE 4YONB 1WBDA 3CPEA 2CLCX 5JJIA 2H18A 2PH1A 3GJ4A 3NHBA 4Q1DA 4CDGA 1WBBA 5CLQA 2JDIA 2QZ4A 5GJWC 1IY2A 2N42A 2XSZD 1QRAA 4N0EA 4F4JA 1DAGA 1DG3A 3U3RA 1ZM4A 2BKEA 2J1LA 4HDOB 4B32A 3ZZ0A 4Z1MD 1UKEA 3RWMB 1XX6A 1AQYA 3I72A 1KMQA 3P27A 1WB9A 2ATXA 4Z8XA 4L5BA 3MJHA 3ZQ6A 4Q01A 2IWRA 2KWIA 4PAMA 3C7KA 5CM9C 721PA 4LBWA 4Q7KA 3U7FB 3QEJA 4CF7A 2Q9AA 2O8EA 4TL7A 1CR1A 3GD7A 3FKQA 5G3YA 3LRPA 2PEYA 2BEJA 5LB2A 3QG1A 3RRZA 4GT1A 1XEWY 3L0PA 4HAZA 1KKMA 4MRRA 2GZDA 3K8YA 4OI1A 3K0EA 3VR2A 3B8HA 2EWVA 4P0TA 4JJKA 2G83A 3QF7A 1RFLA 4W5WA 1VCMA 4Q4AB 3QPVA 3AVXA 1KI3A 1NLFA 5JJKA 2C9OA 2RGEA 1MABB 4Q4AA 3MSXA 2MMCA 1OW3B 4IDQA 4A92A 3HWSA 1MABA 4M1SA 2NPFA 1G41A 1NIPA 1OF1A 2CL7X 1W4CA 2AFIE 2YWGA 2J45A 2ZVQX 3K9HA 4HZUA 2IYXA 1NY5A 5JWOA 3IIJA 2X77A 4M9ZA 4K8OA 1MKYA 1P2VA 4OI0A 4BFYA 4G5QA 1E0JA 4KVAA 4Q9JA 4HDCA 1RVDA 4TYNA 1E2FA 1RRFA 1QF9A 2G0TA 2QY9A 2IF0A 4JBYA 1XJ0A 5HE8A 2G1KA 3LD9A 3DHWC 1KDOA 3MWYW 1N6NA 5AUQA 4C2UA 4S35A 2AWOA 3VAAA 3GCGA 5B57C 2D2FA 1IXSB 2H8KA 2XOKA 2C78A 4JLVA 2IWHA 1GRQA 4Q4HB 2DBYA 4BFTA 3VR1A 4Q4HA 2UZ3A 1DPFA 1NMXA 5J47A 2ATVA 4YXWA 2OLKA 1YVDA 4LHWA 1ZU4A 3GMTA 421PA 1MRSA 5F98A 4KU4A 4LPSA 2VSFA 4XD7A 2YYZA 3AF1A 3JVUA 4EQ6A 3EPKA 1DAMA 1IXRC 4QFMA 2KBFA 2BBWA 3IUYA 1KK1A 4HUQA 1VYVA 1SVIA 3D7MA 2MSCB 3IO5A 3UG7A 2V8OA 3BK7A 3D31A 2BVNA 1OLOA 2TMKA 4WZ6A 4JVSB 2F6RA 3U7EB 3DDCA 1UBFA 4JL5A 2R65A 1ZP6A 2ORWA 4GMXA 2ZRHA 2V7QD 3W34A 5HCNA 5EZ5A 4Q19A 1G291 1NY6A 1UDXA 2GDJA 2GCPA 2ZI7A 1E4YA 1G64A 4GRAA 3DEFA 3OIVA 3WNBA 1W36D 3BIFA 1Z3IX 4A8JB 4NDZA 1SVKA 1HY3A 2AXPA 2IYTA 4A8JA 5IK2A 3CWZA 3BAFA 5EP1A 1A5TA 1XZQA 3AF4A 8OHMA 1CJMA 4NCNA 1Q22A 2WJJA 1ZBDA 1DTSA 3RVBA 2ZJBA 5HZKA 3CR8A 3LQQA 1JBKA 5LD2C 4V0LA 1PVOA 1R5OA 2ODBA 1KZ7B 1DAIA 2C03A 3RS7A 2J9RA 3BB1A 4Z8YA 3B5JA 1N6LA 2ZUDA 2K5UA 4JLOA 2PT5A 3ZLJA 5CM8B 1JPNA 4MDEA 3RSLA 1O87A 4MUBA 4FXPA 5JLJA 2WWXA 1MH1A 2RGNA 1YJ5A 4LV8B 3VNVA 3X1WA 2ZJZA 2BMEA 5BW8A 3E1SA 1IJEA 3UMRA 4XOIA 5JRZA 1TU4A 1JEEA 1NJGA 2AKYA 4QJ4A 2H16A 4NYIR 2VO1A 4RSGA 4ZKEA 4D0LB 4P32A 4ZIRA 1JALA 4V0MA 4ESVA 5C18A 3QQ5A 2ZXUA 3LBHA 5KOYA 1VDZA 4TTRA 4E07A 2L0XA 3UANA 1VG1A 2F7SA 3QKRA 4MA4A 3MAAC 4EUNA 4Q48A 1KMHB 2WKRA 4DDWA 1D2EA 3T5GA 4J0QA 2EFHB 4ASUA 4TMKA 2WJYA 5CK4A 3GPLA 4FWTA 5AJYA 4FINA 4V0NA 4AURA 4O3MA 2ZRFA 3A4NA 1N5KA 1C1YA 4NL4H 5TB5A 3ZD7A 1ELOA 3SC3A 4B3DA 4FMBB 4MKGA 4L16A 1M8PA 2F1HA 3I5YA 1VYTA 2QRNA 3QNUA 4NYIQ 4AG5A 4RKFA 5EZ6B 3WNCA 4M1YA 2KBEA 1Q21A 4TL8A 4G0NA 1VG8A 4JJZA 2F43A 3NIBA 2WSSD 2R62A 1XBTA 1MO6A 4C0JA 1OE0A 2QM7A 2UVQA 3SDZA 1NMZA 5LB4A 4TLAA 3TH5A 1IN6A 4B3XA 4K46A 4QKQA 5KSOA 1T5LA 4B74A 3GP8A 3TNFA 3AGPA 1KDRA 3K09A 3R9XA 1E4VA 3DKPA 2XSZA 1FL9A 4ZPXA 2A78A 1CR4A 4X8LA 3W6PA 1HH4A 4TMWA 3BS4A 2CJWB 2R6FA 3QXSA 1ZMXA 4HLUA 1A1VA 5AWFC 1F2TB 1UKZA 2OFOA 4Z1MA 2CJWA 4KCGA 3U4QB 1W2GA 3FPAA 1F2TA 1G7CA 2HF8A 4OJKA 3WHLA 4BGDA 3U4QA 2CNWD 2QGNA 1NBME 2RGXA 4PC3A 1DADA 1KIMA 4LK2A 4JLKA 2IXFA 3A1UA 1X8LA 1Z47A 4WAUA 5TY0A 5HKKA 3AVVA 3EC1A 4URVR 2WKQA 4JVNA 1SGWA 3P4XA 2P2LA 1DAFA 4IXNA 1YRAA 1U0JA 4IXMA 4V02A 2CL0X 4W5HA 3GEEA 3IILA 4BASA 1BMFD 1BOFA 3CZPA 5TARA 1AJEA 1XXHA 1JAHA 1G3QA 3NHAA 1SZPA 2ZVPX 221PA 2AK2A 4ZI2A 3Q7PA 4JT2A 3ADCA 4IVRA 3LO5A 3K70C 5BN4A 4TQ9A 4D4KA 1OV4A 4C2TA 1I2MA 2X1VA 5DHFA 3SBDA 2D2EA 4CEIA 4TT3D 3HU3A 5TXGA 4FMCB 4P4SB 2QMHA 1SVMA 4GOJA 4PZZA 4RJLA 1NBMD 2GK6A 2ZS8A 4DCNA 1ONBA 1QG2A 1M7BA 3Q7QA 3K0AA 4DLTA 3O8CA 3ZQJA 4DKXA 4KODA 2WIBA 5D3QA 1CRQA 1YR6A 3T06B 1W5SA 5FBVB 2HYIC 4ZKDA 4DB4A 1XDBA 3GLGB 1RIFA 5IRCD 3IBGA 1Z0KA 3GLGA 4RD6A 4IFEA 4TN1A 1AZSC 3UMFA 5H8WA 2F1RA 3FE2A 1T3LA 4LDJA 1PZNA 3PQCA 1MRNA 1UM8A 3FMFA 5KUTA 2P65A 4DHEA 1OXSC 4UNSA 3BD9A 1OFHA 1D2NA 3BH6A 4DCTA 5DI9A 4PQFA 3FYHA 4A6XA 5JHHB 3EA0A 4HB2A 1MO4A 1OXVA 2G88A 2ONKA 4ITRC 5FOTA 1XU4A 3A58B 3LW8A 1G8HA 1P62B 4XVQA 4E5UA 5E7MA 5UKDA 1EFTA 1VTKA 2ZYVX 2XXAB 4NBSA 2V1XA 2JJ2A 4JBXA 2PJZA 4JZKA 2C8VA 1EFCA 3KQNA 4D0GA 1UPTA 1W4AA 5FOVA 5BWMA 3CX8A 3SEAA 2NOAA 3Q5DA 1V5WA 5CYPA 1XTQA 1W5TA 2Q3HA 2XX3A 3AKEA 1FOEB 1VMAA 2LKDA 2QPAA 4AC9A 2GCOB 1FFHA 1IN5A 3PG5A 3WMFA 5CYOA 1SVLA 2YOGA 2ZI4A 1DOAA 2AWNA 2FPMA 2OBLA 1E6CA 2FA9A 3CRMA 5JECA 4QC2A 1FUUA 2Q3FA 2O0JA 2I1QA 4M22A 4EAQA 1I2DA 4MKIA 3IPXA 3KKMA 2QPTA 3OIUA 3LXXA 4F7WA 4NYJR 3T1TA 3EPJA 4TMVA 1OB2A 1KSFX 4GBMA 2ZRJA 4MYCA 1RRGA 3X1YA 2FOLA 4IFBA 1GIAA 3LBNA 3VMFA 4K81B 4Z51A 1U9IC 2FZ4A 1XEWX 4NCHA 1OJLA 1LTQA 4A82A 5IHPA 1MV5A 3HDTA 3QJYA 2IS2A 1XEFA 4I1SA 1G4AE 1G7RA 3AVWA 3HYRA 1AGRA 1JQJC 1G5PA 1KO8A 3AKDA 2CE7A 4KBGA 5H68A 3RAPR 4XIGS 4US2R 1KI7A 4X8OA 4B35A 4NYJQ 4DDVA 4BECA 2D62A 1SVWA 1YRBA 2PMKA 2W58A 3QVUA 1H8EA 3TSOA 1GP2A 4DLXA 1XMVA 3CR7A 3WRXC 5E4FA 3C15C 4LJ5A 2ORIA 3KJIA 3CX6A 2ZRCA 1ZUNB 3CF6R 2R6GA 2PX0A 2FSIA 4LYHA 1G8FA 2BJWA 5ANRB 1W2HA 2W6ID 2PLFA 4M1WA 5FI1B 4N1AA 3TBKA 4CEJB 2GNOA 1YHNA 1HT1E 2Z83A 3ZVLA 3THOA 4D4JA 3KQKA 4CEJA 2AKAB 1Z28A 1CLUA 1W47A 1YZTA 3TLXA 3GJXC 4WVFA 1ZCAA 4IDHA 1SXJD 5J4VA 5JHGB 3S1AA 2WJVA 5DIFA 5F9FA 2EFEB 2QP9X 2WOJA 1TTTA 3PENA 4DVGA 4OK5A 1YQTA 3RS3A 1Z2AA 1I4DD 2HJVA 1YR9A 4KLNA 3KJGA 3B9PA 3I92A 1P4SA 4LYJA 4KLZA 3SQWA 5JEDA 2VTKA 3KTAA 3MLEA 1VIAA 3K09C 2HCBA 1E69A 2QN6A 1ANKA 3K1JA 3LX8A 4X8MA 3J81k 4YDSA 3R20A 2CNWA 3ND9A 4PSKA 4Q18A 2QMOA 1KSJA 4OI2A 4RD3A 1QDEA 3IIKA 5FH9A 1NN3A 3GFOA 1KI8A 4MYHA 3W8NA 3R7WB 2OILA 1JEDA 3VR5A 2PJRA 1CR2A 1NIJA 2A5FA 2DB3A 4UJ5A 4PQRA 2IYVA 2OFXA
chains in the Genus database with same CATH superfamily
1XF9A 1WPQA 3VR4A 4R71A 4ESEA 1MXHA 3IULA 5AHOA 2ANBA 4JZYA 3FKSD 3LECA 2BWJA 3WKDA 1DV1A 1BMFA 3NC4A 4QNRA 5LUAA 4PX5A 3HZOA 2OGWA 2PBRA 4BEJA 4RFSB 2XKAA 2MSWA 2B35A 1Z2DA 4H7PA 3THXB 4BLWA 1CF4A 4RFSA 1LC0A 3IP9A 1OA1A 1W59A 4PYNA 1R6UA 1QB8A 3DTYA 4MQBA 2RONA 2BGWA 3QOYA 3LA6A 2VHQA 4ZVVA 1IY9A 4PXSA 4DXAA 2OUIA 3B3GA 3CSDA 1IOLA 1SHKA 2JZNA 3E5NA 4BV8A 4DT1A 4IEEA 3VVMA 3FLAA 3ZGZA 1GO2A 3B1XA 1N1GA 2WMDA 1JB1A 1JYEA 4DV2B 3H04A 5DN6D 3PDIA 3FBWA 3NXKA 2ZSFA 3DE3X 2CMDA 4JNCA 5KKNB 1VJ0A 4GI5A 3E03A 3CKLA 2A0FA 4N65A 3ZD9A 1UDAA 3HFGA 1KK3A 5BP7A 1QHHB 3I73A 2JLZA 1F17A 5E1DA 1A9PA 4JR1A 4O25A 3V3TA 2DAPA 4OHMA 1U7OA 3H9QA 4BUZA 5L6LB 4M1KA 2ACKA 4OHZA 4WUVA 4WXYB 3DOOA 4BTEA 5K3EA 1R0CA 2IYAA 3KDAA 4N0PA 2F4NA 1MHPA 1PW5A 2WQZA 4FGKA 4LHZA 1QQTA 4FMDF 3QF4A 3R5HA 3O8OB 3I53A 2QUJA 3HGTA 1P8JA 3GVHA 3P1JA 5CX1A 3C3WA 1DEKA 3IOEA 4LIPD 2QOEA 3HU5A 4QODA 3ZWBA 3IB3A 2EJTA 1GSOA 3P9ZA 3G2NA 6Q21A 2V97A 3BOSA 4J3JA 4IIEA 4B6JA 5F76A 5IJ0A 1QC5A 4C4SA 4XWKA 1RJWA 1X38A 3O3NB 4WLUA 4J4BA 4YCAA 1I7DA 1GZSA 4CE6A 3FGNA 1ZM9A 4QEDA 1KY5A 4QE3A 1LS6A 3M1YA 5HP4A 3CRNA 4HZGA 3OQBA 1LPOA 2OHGA 1SOWA 2H4JA 3Q9LA 4KDEA 3O21A 4WN9B 1YZYA 3VDXA 1ONSA 1SUDA 1TEVA 2HLPA 1ZH6A 2Z1DA 2FRDA 2ZXFA 4RHUA 4WN9A 5FA6A 5EXXA 2G80A 2EDCA 2Q5QA 4ZYZA 4Q9KA 2OVFA 4HMOA 4RV4A 2H1RA 3A37A 1E9EA 2PGDA 2FDRA 3F3KA 5KSZA 5EXSA 3UCFA 2B6HA 2O20A 1L4HA 3N0XA 1NLZA 3LH5A 1W0JD 3PEVA 3PUZA 4ZHQA 1GGJA 1X2BA 1VHWA 2MR5A 4LHXA 2W70A 1Q7RA 2H1OA 5DHQA 5E4YA 3FRJA 4QO8A 4QM7A 1DKPA 4IV8A 4TGLA 2HDNB 3TTSA 3L6BA 3L7KA 3VRHA 2PQ6A 3W77A 3BCHA 3KYIB 4MXDA 1O4WA 1JZQA 4E2ZA 1PKEA 3U4IA 1W0KD 4OCZA 4QJ5A 1RNLA 4F7DA 2AUMA 2W2OA 4CXMA 4JEHA 2BT4A 3RIEA 2ZSHA 4NJMB 1FSSA 1W36C 1L5ZA 3M3PA 5HMLA 1XNQB 2WNHA 3F5SA 3T35A 3EZGA 5D6NA 1L9KA 3JYPA 5U1PA 2GHTA 4QARA 3CUTA 3ESQA 4EG8A 3A28A 3B89A 1M34B 1VHTA 3PWZA 4BLPA 2JGAA 1W52X 4QEKA 3GN2A 1SVOA 4F85A 1M34A 3TAXA 3D0QA 9ATCA 4L9RA 1I5OA 1GDHA 2NVBA 1U0NA 3NV7A 2JGEA 3EGCA 1NJ2A 2J3LA 3LK7A 3PXXA 1C9EA 3Q3CA 5FLXA 1DFHA 4IXDA 3AEZA 2XUKA 1ISGA 1ESNA 1QNFA 2GD1O 2ZJ2A 5F21A 3V3KA 3UUEA 1V71A 1QTRA 2YBDA 4HNHA 1JYFA 4LBVA 1P60A 1GADO 3RD5A 2WUGA 3BA6A 1NC1A 3BMNB 1EHIA 1AH2A 3AYZB 4RANA 3HY3A 2D6FA 3HM9A 1ZRMA 3PQEA 4MRVA 1H2YA 1HL3A 1Y8QB 3P19A 4X1YA 3CVUA 3I32A 1O6ZA 3SFVA 1Y8QA 2BMDA 4G56A 2GKOA 2IOQA 3WJ7A 2BTOA 1ZRHA 4BNTA 3U6KA 2FKAA 3AF0A 2EEZA 3L8YA 1LRJA 2E82A 4XZ3A 4ZT4A 1JNYA 4IDEA 4J0DA 2ODEA 1JMKC 3H86A 3LX4A 1DXHA 1LW7A 3IP5A 3Q9NA 4J0GA 2HHLA 2OOKA 2G06A 4EHLA 4L0QA 4L02A 2FPOA 2O2SA 2Y68A 4Q5IA 5K45A 1EU1A 3K4PA 2MCFA 4W8OA 2RGRA 3DE1X 2DPYA 3ADOA 3FR7A 1G66A 2VZ8A 3PHIA 1FJHA 1QHIA 1VMEA 1KJWA 1GZ6A 1WW3A 3LXMA 4C08A 4L57A 1YB1A 3GT3A 3NATA 4YCNA 1R2QA 4RBNA 4QU9A 2E6UX 2CLHB 3ICVA 5JI3E 1SKYE 2GD2A 1K6IA 1HE3A 4RPHA 2UXBB 4DW8A 1N6KA 1RYHA 3R6WA 3I34X 5B3AA 1E89A 2N3ZA 4KXVA 1Z4MA 3D3KA 2WZQA 4JIMA 3NHFA 3ABOB 1ADCA 2X4LA 4WKGA 2O8EB 2XYHA 4GKBA 2XUPA 1U3TA 4AIRA 2XWSA 1YOVB 2Z43A 2VHWA 3H1FA 4DJJA 1CK4A 4FHGA 1SXPA 3IAAA 4G5HA 4WZBE 1BXGB 1ABBA 3VBEA 1E98A 3EXIB 3L4EA 1RZRA 1N3LA 1BXGA 2IY8A 4OQPA 3BDVA 2YN0A 2VSYA 3PPIA 1SH7A 2IH5A 1Q3KA 4QLAA 4UM7A 4A2CA 3TUIC 1OASA 1SCUB 4AMZA 3OCJA 3BWYA 4ZA2A 4CJXA 2W83A 3IIMA 4W9MC 3DLHA 4KH0A 3QA9A 1LV7A 2NYAA 4EX7A 4O4HB 1V43A 3B5IA 4O4HA 3EFOB 4WLNA 1MGOA 1BN7A 3EFOA 2OFWA 3KB1A 5FTWA 4BKMA 1UDRA 2C31A 2Z30A 3H4IA 4GQBA 4HYQA 4ND1A 4MIKA 4R2JA 4PHTA 4YXFA 3FPKA 2G8NA 3ZY3A 2FFAA 1GA1A 3D1JA 1N6IA 4V3BA 5KX5B 2ZBGA 4H3VA 4LMRA 4NEHB 3I5AA 4RHFA 1Z29A 4NMWA 4UEOA 3RYHB 1QR2A 5KX5A 1HRDA 2I2CA 4FGUA 4KVFA 3CX7A 2PR7A 4YIKA 3DT9A 1Z0FA 2FPRA 1P77A 1R37A 2HBYA 4DQDA 3EBOA 3A2MA 5FF9A 5K8JB 6ADHA 4JU8A 2J6BA 2NSJA 2R8BA 1E92A 3E8SA 4GFDA 4DF3A 5LQCA 1Z2NX 2LUOA 5D3KA 3LW7A 2RBGA 3NC1C 2Y8EA 5LP6C 2HLDD 2JAPA 4DJTA 1K5GA 2DPLA 1CEEA 2HSWA 2ZCUA 3LUJA 2A84A 2ZU6A 4BATA 4JLAA 3AMVA 2XKBA 3QWAA 1YE3A 1DBRA 3C87A 1P7ZA 5KAPA 3NNSA 4PRZA 1LGYA 4Q47A 4WK2B 4URHA 1R0KA 1KMCA 2Q1WA 3UPDA 3M1IA 3OLYA 3PEUA 3G5LA 3OEED 3E9DA 2BF4A 4FP9A 4EGJA 4HP8A 5FBQB 4JVOA 5MN4A 1UAAA 1Y7PA 2CV0A 5CDSA 1YGPA 4XSVA 4EMUA 2YY7A 3AH8A 2VNIA 3T7RA 1PNTA 3NANA 3HCNA 1F8GA 1V1JA 3WJAA 2BSAA 4WWHA 2AQIA 1WUHS 3GMSA 2CD9A 4L8GA 2QJRA 1ZRNA 3GQBB 4KVGA 4TXJA 1AKWA 2UZ4A 3GQBA 4BP9A 2YNMD 3AHJA 3HI4A 5TGZA 4QECA 3K8OE 2OO5C 4FYWA 3I61A 4E31A 4MLPA 4UTNA 5LM3A 4E4TA 3EQ2A 2EFCB 1EJ2A 2HADA 2RCYA 3MJ4A 4HH1A 4IZOA 5E4JA 5KHOC 1SIWA 3EC7A 3TBFA 5LMCA 4RZIA 4GPTA 3L5OA 4NBKA 1EVJA 1ZOLA 2VNAA 4WQMA 5ENDA 3DQZA 3V6MA 2FRXA 4N5HX 5IULC 5IU6A 2D5IA 1T6XA 2PAAA 1O96B 2DFVA 5AVRA 4GLOA 3DDSA 4H6WA 3G1UA 4RL6A 1YC2A 4MKRA 4IIXA 1R0LA 2BW0A 3LX5A 3RWOA 4C7JA 3W6UA 4C6RA 1NPYA 4QFCA 2GR9A 2NXJA 4KE9A 2GK3A 2GVZC 3V80A 1OI4A 3PHLA 4Z4HA 3WY9A 1EM8B 3CVXA 3UWKA 3IAUA 2G40A 3A26A 1XZHA 3LCCA 5LZ9A 2XDYA 1EM8A 5JD4A 1RT9A 3MRXA 4PRKA 2BMJA 3E05A 4D8WA 1E0KA 4MV9A 4MVJP 4GBGA 2EX0A 1FFCA 3EA5A 3D6HA 3GVCA 3EIUA 3MIIA 3NVAA 4KQ9A 4F2DA 3U13A 3KSBC 3T7TA 1PJRA 2II6A 3B70A 5BYBA 4U6SA 4N0QA 1Y6QA 4BYMA 1PR4A 4MUNA 4YK7A 1PUIA 2WM3A 1YDEA 5B2EA 4GDMA 1OROA 2RJOA 4XM0A 4JBWA 1XJ5A 5LA6A 3VQTA 4ZTUB 2WWIA 4LRQA 2PUWA 1Z75A 3HYSA 4WN3A 3DZCA 4XYMA 5AVVA 2JLWA 2WB2A 2B1GA 1Q83A 5AIAA 1A71A 3HN2A 3FMOB 2IUTA 1PDVA 3SQNA 3KUDA 3PE6A 2WICA 5LQRA 2GBCA 1J2EA 1ADFA 2J7KA 3IKVA 3BL5A 5FLKA 1QPGA 3EIXA 4PIVA 1E3WB 3C4VA 3QU4A 1MPTA 3FJOA 2E37A 3GDOA 3WIDA 1E3WA 1J20A 1V8FA 2OV1A 3ANNA 3DJFA 3M6UA 4ARAA 1OAKA 3E4DA 3M6MD 4FYYA 5L3QB 1TJ3A 5L3QA 2GF9A 4GYYA 5ALLA 3IH5A 4YRPA 2P6RA 2F3SA 4A16A 3HDVA 1PT9A 2QUZA 4P3XA 5JQWA 1PV2A 1FTSA 3KLOA 3NKFA 4Q1AA 1E6WA 3ASVA 3AJRA 3EARA 4WXPA 1CF2O 3PC8A 3Q98A 2MMGA 4L8WB 4URWR 4MPRA 4YAFA 4DRZA 1C4XA 2J5XA 2QSUA 3DBHB 1YI0A 3HPQA 3KJZA 3DEIA 1P6QA 1PTJC 4GEKA 5L8VA 1NW3A 3DBHA 4ZVRA 4MHTA 1EVEA 1G9TA 1XWIA 5EPUA 3U7QA 2PZLA 3JD2A 4OJMX 4E6PA 4JI7B 3NB0A 1AHHA 2HJHA 3NO4A 1WVIA 1ZW1A 4V1CI 2WM2A 4W6ZA 4P2BA 4MYRA 1IWOA 4V0QA 2BE9A 3ZPXA 5FL7D 4G8DA 5HKBA 3ZE2B 2VN8A 2ZJYA 4INJA 3TO5A 4ZOLB 1KFCB 2IUFA 4TROA 5B58C 2DUMA 5JT1A 4ZOLA 5CLHA 1IHDA 1RXIA 1X2EA 2ZAOA 2CCKA 4G26A 3GGSA 4GP9A 1RC1A 4Y6LA 4DWWA 2ZR7A 4LE2A 4D7AA 4BKOA 1T1EA 4TTJA 4H6PA 3ZU2A 4QELA 3QYJA 4Q1VA 3WAJA 1MD9A 4QZVA 1AS0A 1WCIA 1SHUX 3CPSA 1ZXXA 2Y1CA 1DQNA 4LY6A 4MVJE 2EWMA 1DKLA 1N2EA 1OFTA 2ADOA 2XUDA 1DWUA 1QIMA 4KHZA 1FIUA 3WL7A 5CRIA 4KRYA 3LLUA 2H08A 1KBQA 4NCIA 3TJRA 1CQZA 3I3SR 2Z6QA 1KC1A 4GOLD 3T7SA 4MW6A 1QP4A 3TEJA 4MUHA 4KN6A 1BWPA 2VSOA 5AJZA 4JUCA 2I6UA 1B8OA 1FQJA 4RXMA 5EIBC 4ZU6X 5FWXB 3K0KA 5FWXA 1KE2A 3VPAA 2GAOA 2N46A 4URFA 4BTLA 2GEKA 4DL9A 3CW9A 1K8QA 1NW7A 2XPCA 4RTMA 1XMOB 1B93A 3R76A 3OPYI 4Q3OA 4AYTA 1OYYA 1Y7IA 2ZBVA 3S68A 4PR0A 3CWQA 4YCBA 2VEOA 3ORRA 4HNRA 4IQFA 4WNIA 3HUFA 1KU0A 5EOVA 3RBVA 2PRKA 2XDQB 3P9XA 4LQCA 4AAYA 2VHTA 1MO5A 3OAAD 3C5EA 5IT0A 2XDQA 1MXFA 1RSZA 4X63A 1YB6A 2GDZA 5DHAA 1N32B 4OGFA 3FNEA 2B1IA 3NUGA 5NULA 2G6BA 4WW0A 3VR3D 2YJ4A 4N0MA 4B2IA 4AY2A 1NQUA 3BG5A 3U09A 4PG5A 1R0RE 2ZIVB 2XQGA 1BKYA 5GINE 3U4CA 2GJAA 1RYFA 1KI4A 2RBKA 3K0AB 3D3NA 3Q0IA 1IN8A 1FP6A 2M1ZA 5EHXA 1M6WA 4DUYB 3AWIA 5FRDA 4G63A 4R8LA 1VLVA 1XKTA 3Q6IA 1DBPA 2FY8A 2GJ9A 1KAEA 3LXUX 5LZ8A 4MZXA 4IH4A 1N9GB 2WLTA 4Q15A 5I9LA 5LOVA 1T5IA 2P9FA 4UE2A 3TNLA 1L8AA 3UJ6A 1XTRA 2DWQA 4B73A 1UKYA 4UUQA 3TVTA 2KLHA 2RHHA 2ZB8A 1RKVA 3F6RA 4G5XA 4ZAYA 4B6GA 3WRYA 4B2YA 3ZJYA 1PJTA 2H06A 2PDAA 4BAZA 2BCEA 3QA3E 3KYBA 4J1NA 5ADUS 2AFIB 1E1CB 2GSWA 2IE0A 2IBMA 3C74A 4Q9IA 3FOFC 2B9EA 3ID6C 3DMHA 3ORQA 3P96A 1VSTA 4REQB 4E46A 4OXNA 1ONNA 3QG5A 4MV4A 2GCGA 1IM5A 1E58A 2DYKA 3ZI7A 5CH3A 5CEEA 3BE5A 4HBGA 3TI7A 5E6SB 4NFLA 5DYGA 1KYYA 5JE8A 3RSSA 1YQGA 1OVMA 4UKDA 2BF7A 3UJAA 3ZDEA 4OAOA 2D3TA 2IOHA 2QM0A 4F06A 3E2PA 4RY0A 3UJBA 4YMGA 1WCWA 5I7EA 1Y3FE 5T7BA 2JAQA 5AR1A 4B45A 3HUEA 2NP7A 4IPTA 3WYGA 4YO8A 5IDQA 1E2UA 2P2GA 1NF8A 4EFLA 2X7HA 4OMCA 4A91A 4M38A 3WNZA 4FI3C 4UAVA 4ER7A 1ZLXA 4ESHA 3C16C 3FPFA 3PUHA 4TZTA 1RQPA 3PUKA 1V39A 2NNWB 3GXOA 4G1BA 4KRXA 4OBXA 4GL2A 4U6QA 3DXFA 4NBVA 5EGSA 4QBFA 2OYRA 1EGMB 4I50B 4MAMA 2BKVA 3WLSA 5HKOA 2GM3A 1S2MA 4I50A 2Y76A 4BVLA 1Y4UA 4GVLA 4H7FA 2CFCA 2BR5A 4M9SA 2R8EA 1W36B 4QVGA 3L82B 2IHYA 5GZ3A 1EZZA 3AEKA 1QQ7A 2BDUA 3LT4A 2P4UA 2C83A 3IVAA 3O1IC 1A8QA 1RXUA 3FRIA 3WP1B 4JP1A 5AHKA 1XE3A 1LF0A 2JIDA 1Z4QA 2X8JA 4WT7A 5CLLA 3I0MA 3RUHA 5ADWA 4HDQB 2PL1A 4HRXA 3KQMA 4RF2A 4M37A 4KFTA 4C29A 4F2WA 3LBYA 5FBHA 2VYQA 1D2GA 3QHQA 3VJMA 3EMKA 3O82A 3PE3A 3EB9A 4FGSA 1P9LA 3B48A 1U2RA 2FMFA 1U7UA 1PG5A 2V9ZA 2WRZA 3KK0A 1XVTA 1V7CA 3WLJA 2F3PA 4MYUA 4HEA6 3QFHA 3T4XA 4ZYUA 2J41A 3FUTA 5B36A 3FPSA 2G76A 1DJLA 3O1HB 4LC0A 1UADA 3SMQA 2OAGA 3KKZA 2OA0A 4NS1A 3T34A 1G4UR 3DM5A 3H0CA 4NYMR 1BQ4A 1QMPA 1IY1A 3IOYA 5LQNA 2VLIA 3V4OA 4DPLA 5LDDC 2FF5A 4ICIA 2FN7A 3PDHA 4W5TA 1Y3CE 3Q6NA 4TWJA 1AVTA 2VZ0A 5JO0A 2FW1A 1FMCA 1AOXA 2PMFA 3A31A 4FT4A 3EZYA 4ZYWA 1YONA 3LUHA 3AQIA 1E1NA 2PGNA 5KDDA 1SIBE 4IIGA 4D1YA 1Z0ZA 1UC8A 2Q1UA 1EEHA 3TGPA 1MFZA 3C4QA 1P81A 2GMWA 1PR3A 2Q5IA 2R1ZA 4BXOB 1XKQA 2GEJA 4UUBA 4BXOA 2ZI5A 4XEHA 4Q7QA 5JS2A 1I2AA 1QG4A 1WPXA 3MBKA 5C4GB 5KNDD 3UJNA 3UAYA 3ZQ4A 3VX4A 4MS3B 4FWIB 3WLEA 1MG0A 4HLQB 3LCJA 2IPXA 1F3OA 2HA6A 4F8YA 1U8YA 3D8HA 4QTZA 5KVCA 1FFSA 1EIWA 5KYVA 1FRQA 2HWXA 4DCUA 1AKUA 1ZJZA 1XJQA 1BS9A 2R85A 2X4GA 5FL3A 3DEYX 1J4AA 1L7XA 1HT2E 1KJQA 2FZKA 1OB5A 1G63A 3N2IA 4ZYVA 1ECBA 5JVDB 1SBZA 2JJ1D 4E15A 2I22A 1ZDMA 2AZMA 3JZMA 5E1BA 4H17A 5AI5A 5JVDA 3ZD6A 2BUCA 5DM4A 1VC2A 3DLCA 3HRKA 3Q8KA 3W9BA 5LPNA 3SJAA 1KBOA 3A7DA 1FP7A 5EKUA 3S1AB 2B1JA 1T4CB 2G82A 2VDOB 2WSSA 1ZR2A 1T4CA 1H2WA 4AJPA 4ZDIA 3VSDA 4EATA 1I3KA 3H2HA 4LWQA 2Y1XA 5DRTA 2P8JA 1CZUA 4TL6A 3C5HA 2WWTA 4DR6B 3LWNA 4M36A 2EKQA 4C6TA 4P3OA 2F8TA 3X3HA 2JDID 1V9SA 2CZCA 1NVUQ 1EWVA 2DPXA 3KTAB 2HXGA 1C2TA 3T1VA 1E2LA 2F00A 5IBQA 2VK8A 4S12A 3LOQA 3BTOA 3KB6A 4HF7A 4OBBA 4DIKA 4Y2YA 3ZNNA 2EG9A 2I1LA 1O54A 4FDVA 3S1LA 4RYDA 1A5SB 2CXXA 2DECA 2B1QA 1Z07A 3RSOA 3MOSA 3FOWA 4FE4A 1XZFA 2WBLC 1JR3D 2RH9B 1GKUB 4E1VA 4PEVA 1GKIA 4WADA 2BUAA 2DFLA 4HB3A 2RK3A 4HWRA 1FFAA 1R6AA 4QXPA 2VJKA 3ROPA 5K7SA 1POXA 4UDYX 2YJ3A 3FHOA 3MQ4A 2WWHA 4IHQA 5B4TA 4PFSA 1EQ2A 2AE1A 3ONWA 3NPMA 3WTCA 2HU8A 1KZYC 1VLMA 1K0FA 1Z5UA 2PXHA 1MR3F 3AEUB 3HWX1 4IJQA 2Z8XA 1UMCB 2W2MA 3LK6A 1XI2A 1LDNA 3AEUA 3AINA 2YJNA 3N0TA 3QVJA 4HJRA 4IGKA 3KZOA 4KFSA 4X97A 1KHHA 2DLDA 1QORA 1TMKA 2PZKA 4F93B 3F7TA 3CF2A 5LP6A 1EDBA 2A57A 3H5IA 3CZ5A 4TV8F 1IHXA 1YR2A 2ZIZA 2PYZA 2DCMA 2SBTA 3M5WA 1BQ3A 3PQ2A 5K05A 3PQ8A 3JPWA 5IDYA 3R7SA 4HWGA 2R1VB 2ID7A 3AESB 3CA8A 1XZ8A 3PT9A 2ZUSA 1CKEA 4M76B 5C5CA 3ERCA 1MX3A 1AZTA 5EXPA 2Q9UA 2BCJQ 4UXJA 4H6VA 2HPAA 2ODWA 2VZLA 1L5KA 1LJLA 4JP3A 2W5UA 1GITA 2DRIA 5D5HA 2XTZA 4PO1A 1UF9A 2EKDA 5JTUA 1RBYA 2WYVA 5CX1B 1UBHS 5DI3B 2XWBF 2VHUA 3CJQA 1X77A 1NBEA 3ZH2A 2C5FA 4HGZA 1SEVA 4AJ1A 2NSYA 2YIVX 4E14A 5K0FA 3H2SA 1U94A 1UK7A 1LA2A 1YIDA 1N5LA 3DBVO 3BGIA 2LDXA 1MORA 2ZRQA 5TQVA 3NBQA 5JY6A 3KTOA 4AQDA 4IW3B 3OE7A 4HAUA 4QOIA 1C0EA 1XCMA 3P52A 1JAYA 4G0PA 3VKFA 5L51A 3FWZA 4I9UA 4KWIA 3ZX5A 3TECE 1TRKA 2XOKD 2OO5A 3RTBA 4B4UA 4CKEA 1YTUA 3FHLA 5BR8B 4KOAA 3JXEA 1OYVA 1D8TA 4JI5B 3T3OA 2ZETA 4NSNA 3AVUA 4K7JA 3TE7A 2HHCA 1E0SA 1EGAA 4KN5A 5KMGB 4PLGA 2WAOA 3HQ4O 1J21A 2F3RA 2EAUA 4PGGA 3ZVMA 1NJ6A 2FN9A 3ROMA 4AWAA 2W6QA 5CD9A 2H1CA 4M21A 1EK5A 1NYQA 2O8NA 3OC6A 4OQYA 3ZX4A 5KNLA 1EUDB 1U8TA 3OCUA 1O3YA 2Z8ZA 1EUDA 2YW2A 3TW8B 3U62A 1CVIA 4TTQA 2DU8A 2W6CX 2JFVA 3W4KA 2IIBA 5D7NA 1YO6A 1E79D 3EYAA 1XP8A 5D5PA 1QV6A 1Z39A 4ZGWA 3O03A 3BTSA 4D82A 4DMLA 1D4FA 3GA0A 5G0WA 1JR4A 3SY8A 3T9FA 2B2NA 3P0JA 1ZYUA 3KD3A 4UXHA 2KJQA 4OAQA 1MHTA 5JADA 2OV2A 3SVLA 4N7RA 1IMOA 2ZT8A 1LLCA 1ZICA 1OQAA 1PO7A 3DG9A 3U7HB 1GY8A 3ECCA 3PXBA 4RHYA 1PI3A 1N9KA 3HSKA 4M60A 3FCCA 3AUUA 1LC3A 2HL6A 2JK0A 3LLSA 3O7WA 4JC5A 4QQKA 4BQEA 1O6CA 1PZFA 2H7CA 3TL2A 5FBRB 4M1TA 1KH3A 1Y9ZA 1Y48E 4DSUA 4JLSA 4Z7OB 1P4AA 2R6CA 2D2XA 3P9PA 1XHLA 4ZVUA 3SKXA 4KUEA 4LVCA 1VL2A 1WW8A 5ED0A 3EG9B 1GAEO 2GFQA 3L41A 5E7JA 1L5YA 3BE4A 4YRDA 4C30A 1F0NA 4DMMA 4IL5A 4KL8S 1P1IA 1CFZA 3AUSA 4RELA 3FTDA 5FBWB 3BWCA 3SXJA 4E22A 2GN0A 2YHIA 4OK6A 1RAAA 3T5CA 1GL6A 4L9SA 4QATA 2ZT5A 2QVBA 3L93A 4UD2A 3N7TA 4UVEA 1PBNA 1DAPA 2N9UA 2ZVDA 4LN1A 3CONA 1L3BA 4MWBA 3EWAA 5H3HA 5LYJB 3VYVA 1WBJB 1JPVA 3REGA 4XGNA 1K86A 3E7FA 4AMUA 3KXIA 4H9GA 2QY6A 3L0ZA 1SUCA 2AR0A 2XITA 5KYUB 9MHTA 3D64A 2JCYA 1YZNA 2ES4A 1CVRA 4K26A 4DCSA 2VXYA 1NXPA 3CLRC 4PSUA 1N8TA 3WGJA 3ZOKA 4BHTA 4Z86A 3Q0EA 3EGIA 4F4IA 2NIPA 2Y93A 3OPQA 1DOHA 2ZPTX 4RK0A 1SKQA 2XQKA 3RUEA 3EOZA 4RZXA 1F2VA 2XB2A 1CRPA 3ESBA 1TVKB 4BP3A 4N6OA 2VT7A 1OYOA 3CCFA 4ZAFA 3O47A 3O4GA 1TVKA 2BFFB 3BFJA 5FNZA 5LBIA 1JQAA 1EUCB 1G8SA 2PYIA 3HVUA 3QE3A 3USES 2VQEB 5FBZA 1B6GA 1FJ2A 1EUCA 2BHSA 1GZ3A 2IEYA 2PXXA 2RK6A 5K2MA 3S2EA 3N2YA 3T3DA 13PKA 2OHHA 4CMKA 2AX3A 3WRVA 4RJKA 3UAGA 5TPZA 4EYOA 1ZONA 5AM2A 2NAPA 2WVJA 3CNOA 5DF1A 4HNVA 4HEQA 5A6SA 3EXAA 1WQ1R 1KF0A 2CE2X 2IYSA 4LHVA 3ZUPA 2P2CA 2HRQA 4OYLA 5AK5A 2GPBA 4EUFA 3E9NA 3MWLA 1NNEA 1PX0A 1WRBA 1Y3DE 1O5OA 2HN9A 3II6X 5ENZA 3KSRA 2Q3BA 5JSHA 1RLMA 3FDIA 2H07A 3TVDA 1PR6A 4B0PA 3H4MA 3K7EA 4DMCA 1RCUA 2AL7A 2B34A 1PR2A 3IMKA 5JNVA 1DRKA 4RAQA 3U6BA 4OHCA 3AKZA 4OHYA 2JI4A 3REOA 1IOVA 1RJEA 1Z0JA 2OCBA 3P97A 4QXQA 5F4BA 5KDOA 1Q95A 3EZ7A 1B14A 4RK7A 4I1YA 5LMNB 5LKRA 4WNAB 4BY9E 3BVPA 3CW8X 1IL0A 3CINA 3DVRX 4WNAA 2D00A 2QVZX 3K1AA 1IYZA 4UREA 1BD3A 1D6MA 4HL6A 2Y9PB 4U7TB 1AUOA 3OTGA 4EVSA 1OLUA 1SPXA 2FX3A 3T0GA 4CUZA 3AL3A 2H5LA 3BXOA 4F5WA 1OX5A 1M0WA 3V32A 3SEQA 5HJ2A 1BQEA 1HI9A 5HKLA 3QITA 1J06A 2FI1A 4BTVA 3CZ9A 3SS8A 4CIYA 2C7OA 4H7DA 2H4HA 3OCVA 5K6RA 1YFZA 4FEGA 2EKZA 1EX7A 1YZLA 3OEHA 3A25A 3S1SA 1VLJA 2SHKA 2O5CA 1HT0A 3ND8A 1IQPA 1YGYA 3HKEA 2C61A 3CE9A 3X0DA 1C0LA 2HHJA 4WTOA 1MQ8B 3B2QA 3QVGB 3K1YA 1S2IA 4IDCA 5IN5A 3TSAA 1OC2A 2OAP1 1S1MA 3IJRA 4K2AA 1Z9BA 3GEPA 3UJHA 1WSAA 3RARA 3DNFA 2H2DA 3CRZA 4JUDX 4G1CA 1ULZA 3C3AA 4MUEA 3I9V6 4LDPA 4KKXB 3ABZA 4A1OA 1FNNA 4B75A 1T10A 2Y66A 4PRLA 5ESWA 3W7AA 2QMEA 4ZO8A 4ISCA 3ROZA 3K9WA 1U1FA 3PUWA 1DC7A 5KPDA 1RD4A 1T4DA 3ZV6A 2I3DA 1FVHA 1PEAA 1X9IA 1QVAA 2HU7A 3BIJA 3JD0A 1UQUA 1A5ZA 4V24A 5J9FA 3M70A 1T8PA 2A59A 2QX4A 3ZLUA 4J4TA 2QDXA 3KDSE 4YRLA 3V4FA 2UXCB 4COOA 4WECA 1ML3A 1ZSYA 3JR7A 1YJ8A 2NSHA 3C8MA 3D6NB 5E0OA 5F7ZA 3RW9A 2JLSA 4JFAA 2OLJA 2XGOA 1NVXQ 1TKAA 1U9ZA 3DBRB 3D4LA 3E2IA 3GRPA 3TW4A 1GTZA 1T9CA 3UTCA 4NONA 3JCZA 4EPXA 2OMEA 2BDEA 3DE0X 1JSLA 7REQB 4PIMA 3QX8A 7REQA 4YRKA 1JI3A 2E9SA 3K0SA 5ELMA 4OHXA 4RMNA 5BQFA 1MAHA 1M6VA 4N7BA 1F60A 3DULA 3I6ZA 3JQ8A 3D7LA 4M8SA 1M2EA 3E27A 3WNDA 1PZEA 1KVQA 2Z98A 1HR0B 1QGZA 2G36A 1AC5A 4JITA 4F21A 2PUFA 4LYAA 2YJ5A 5MFZA 3GLFB 3UJCA 1SWVA 3ZHVA 1M6EX 1F3LA 4LF6B 5FPYA 2Z8YM 1JIJA 1TZ2A 3U3MA 4HD8A 3N3BC 1ZO8A 4U2KA 1YOBA 4E30A 1WXQA 1Y8RA 4UBIA 3VDNB 3VPHA 3WDSA 3WO1A 4R31A 3GBSA 3H9JA 3QXJA 4OFBA 4JUAA 3AP1A 5CEFA 5B1YA 5C2JB 2I9KA 5B58T 1KNXA 1B23P 1FU7A 1BVRA 1OH8A 4GQAA 4KHPB 3LC7O 2I9PA 1GTMA 1W85B 3EUAA 5I7FA 1TEZA 2CLMB 1YS1X 1W85A 2R8XA 3GP3A 3J7AC 2I62A 4WGGA 2L2QA 3BICA 1JDSA 4UFOA 1XO1A 2D1YA 2G1JA 4TVKA 1SQFA 4AJ9A 4YJ2A 1JIXA 5AKXA 4MH0R 4QVIA 1GNQA 1X0XA 4TTAA 4BAGA 3R7WA 2A1TS 1WMSA 1T3HA 2D8AA 4IJ5A 4CLHA 3ZCSA 3J80A 1JNXX 2QQGA 3V46A 4E1AA 1LI5A 3PXEA 2Z09A 4US1R 1XCBA 3H0KA 3BIXA 4P58A 4Q9HA 1P39A 2PUEA 2A3NA 1USVA 3NEYA 2W6JA 1N2BA 1YS4A 1E9DA 3HBFA 3FSJX 5COBA 2P5YA 2VA9A 1H3FA 4P36A 4I6EA 3R2JA 3KE9A 2IX3A 3OHPA 3O1JC 4GMKA 1D03A 2ZDHA 2F55A 2FPSA 2E6KA 1B1CA 2FG7C 1UKVY 3AILA 1XTKA 4NPHA 1CW2B 4AWXA 3AF5A 1LRKA 3DCNA 1E77A 2M2IA 4D6PA 3CUUA 4MVJI 1LI4A 3A4MA 4FUTA 4BFZA 4L08A 4HXFB 4QU5A 1TM2A 1U0FA 1XZIA 1IBMB 3SYLA 3SC4A 3KV1A 2QTAA 4TKMA 1BCRB 4FKBA 1AQNA 2Z58A 2CCJA 3RS4A 1BCRA 2E4WA 4DS3A 5LFAA 4LOIA 1Y9JA 4N40A 1GDTA 3HYNA 4K9QA 2ZE7A 4QFBA 2W8BB 4UHFA 3SEZA 3T95A 5ADHA 5GJVC 1KWGA 1N2CE 2Q0XA 4WKPA 1G8GA 1L5RA 1DT5A 2GF0A 2W8BA 5CVDA 1H8ED 4C89A 2D7DA 3MCVA 1QM5A 2VHCA 1KTVA 1YSCA 1TT5B 1Z15A 3OLZA 3OUUA 4WL0A 5EJFA 4DC0A 4DFDA 4DJ5X 2IYNA 4CI9A 3UPUA 3N2KB 3IUJA 1YZHA 2H2AA 3S5JA 2K7ZA 2OV3A 3N2KA 4C0QC 1KMHA 1Y34E 2I76A 4GMFA 1H0KA 4TYWA 5TPWB 3FSEA 2WIFA 5EP2A 3DT8A 4ZCLA 3NDBB 1HTBA 3KFVA 2QW0X 4TYMA 2RHOA 4NZPA 5C81A 2I7VA 4B40A 4LYGA 4YBZA 3A04A 3OVMA 3FN4A 4WOCA 3TQTA 3UJ8A 4DANA 1V5GA 2QL6A 3PJFA 3OZTA 4O5AA 3S2ZA 1P2SA 5DNAA 5EINA 2I7DA 4YA6A 4G25A 1GPDG 4JEUA 1GZHB 3AP3A 3CMCO 4U9UA 4IIJF 3PFHA 4NE7A 2M6KA 1TAHA 1Z6PA 3MJRA 4RNDB 4W1QA 5ADVA 4DG9A 5AM3A 2YVKA 2QLFA 4H16A 4K9KA 4NU6A 1DIAA 1IAQA 2FV8A 4IVPA 1J0EA 1TMOA 2O7SA 4XWOA 1ISJA 1JEOA 1OREA 1LLQA 1Z0SA 4FIDA 1DAOA 1FXWA 4CLOA 5KTPA 3BSWA 3JQPA 3VM6A 1LI7A 3DOCA 2A8YA 3PQ5A 2W2KB 4QYWA 2C7VA 5SICE 4CR6A 3A32A 3IBYA 4S1WA 3P4YA 4F2HA 3E9QA 3AERA 1SA0A 4QYXA 3NFRA 2QRLA 1W2WB 2F59A 1DQPA 3BXGA 5KZMB 1R4NB 1YB2A 4CQMD 4HUJA 5J2UB 1R4NA 3E5MA 3ETGA 2WWYA 4K6OA 5I51A 5DTMA 2V5VA 2H1HA 4UVIA 3TLZA 3ZXUB 2IYEA 1RAEA 1Z4PX 3LA8A 1FF9A 5F2NA 4CGZA 4YUWA 1AK9A 3GGCA 5CDTA 5GONB 4LSGA 2ZZNA 2E1PA 1UJ2A 1IBRA 1KOFA 1V48A 4PAGA 5GONA 5JY1A 2BC9A 3C24A 3W5AA 4ITUA 5EYPB 1P1CA 1W1UA 1NOIA 3GARA 1LPSA 3OT4A 2IXAA 4C4PA 2ZS7A 2QSZA 4IJ6A 4JT8A 1UZUA 2PCLA 4RA6B 2QYSA 2FU5C 4H7HA 3HR7A 4RA6A 4FK8A 2V6BA 1U99A 2BELA 1GJRA 1NJFA 2BM8A 1N0UA 4ZVLA 4RULA 1C3JA 4XWTA 2HAEA 2FHPA 4TKUA 5IT5A 3W3AH 2GAJA 3DOFA 2D7CA 1Q19A 3CVJA 3JD1A 2YFQA 4WK4B 1W88A 3U16A 2X1LA 3WWZA 4IS3A 3LQYA 3KSZO 5AH0A 4INZA 4U7PB 1UANA 4XDGA 4JYZA 3LUBA 1UIRA 1NNI1 1Y80A 1BWQA 4FOTA 1I0LA 4P7GA 4XUGB 1ZOPA 1AO3A 3VUEA 4RORA 1XLUA 2OV8A 1SZCA 1Z6AA 3TJZA 2AF3C 2QN2A 3ETNA 3UH1A 3UV6A 1X1BA 1XCOA 3AFMA 2VDUE 1TNDA 5HRAA 3DKVA 1NULA 3S2UA 1A3CA 2QV0A 2F1IA 1NT4A 1HYQA 5F7OA 4FFBB 3VGJA