5IRSA

Crystal structure of the proteasomal rpn13 pru-domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
110
structure length
110
Chain Sequence
KYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Rpn1 T1:Rad23 and hRpn13:hPLIC2 Reveal Distinct Binding Mechanisms between Substrate Receptors and Shuttle Factors of the Proteasome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Proteasomal ubiquitin receptor ADRM1
total genus 29
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2016-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04683 Proteasom_Rpn13 Proteasome complex subunit Rpn13 ubiquitin receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.70 Mainly Beta Roll PH-domain like PH-domain like 5irsA00
2Z59A 2Z4DA 2NBVA 2KR0A 2R2YA 5IRSA
chains in the Genus database with same CATH superfamily
1IRSA 2DLWA 5C16A 1X05A 1DYNA 3DXCA 3FVCA 2Z13A 2GS0A 5DI9B 4B6HA 2J0KA 5I2MA 2EMSA 2DTCA 4HB4B 2UZSA 2ZPYA 2P8VA 3M1IB 3MDBC 1SHCA 4PNKA 4MT7A 5CLQB 2D9XA 2LOZA 2N0YA 1ZYIA 5HE2A 5D3VA 1AQCA 4HB2B 4Y94A 2ROVA 3KZ1A 1XR0B 2RVBB 1OMWA 1ISNA 5D27A 1V5UA 2K00A 2OTXA 2YS1A 2RLOA 4DX8A 2X18A 1FOEA 5J3TA 2RSGA 3ODOA 2DA0A 3NSUA 2YRYA 3ML4A 4A6FB 5C5BB 5DHAB 3U7DA 1V89A 1I7AA 4K2PA 5KCVA 5CLLB 2GJYA 1V61A 2XQNM 2I5CA 1E5WA 2VKIA 2M38A 2EJ8A 2IFSA 5J3YA 3FSSA 1TJ6A 1EF1A 4PQ0A 1DROA 2GUMA 3A58A 1P5TA 1Q67A 3TFMA 2KGXB 1EVHA 2DYQA 2DX5A 2LOXA 3ULCA 4Z2NA 2GCLA 3CXBB 4HSIA 4CYEA 1FHXA 1BTKA 3TVVA 2P0FA 3SO6A 2CY5A 4EMOA 2FJLA 1WGUA 5DH9B 2D9ZA 3PEGA 4ZRJA 3QIJA 2Q13A 1P6SA 2N23A 1ZC4B 2D11A 2MWNB 1TXDA 2RUKB 4HAWB 2H7EA 3FM8C 1UPRA 2W2XD 3HK0A 3B77A 4TKNA 2M14A 1U5GA 4GN1A 2ZKMX 3GYOA 1U2BA 1WVHA 2W2WA 3IVFA 1J0WA 2QKLA 2LYDA 2D10A 5JLJB 4L6EA 2KUQA 3KRXA 1UPQA 4GMXB 2K49A 4Z2MB 3DXDA 1N3HA 2J0MA 5D3WA 1BTNA 3ODXA 1X1FA 1X1GA 2I5FA 4HAUB 4K81A 5FI0A 4GMVA 3F0WA 5LONB 1WGQA 2CY4A 5JHHA 4WSFA 1NTYA 4QJ3B 2KIGA 2HE7A 4HHVA 1NTVA 1XCGA 2DHIA 1UNRA 2DX1A 4L1RA 2ELAA 2H7DA 1PLSA 4A6FA 2AEHA 3P7ZA 3UZTA 2D4QA 4KHBA 5HE1A 3PVUA 3TW1A 1U5FA 4IAPA 3VOQA 2D9YA 2RRFA 1DDVA 4A6KA 2Z0OA 4NY0A 3NWDA 2K2UA 2EMTA 2LULA 4ZRIA 4A6HA 3A8QA 4WJ7A 1M7EA 1SGHA 4DXAB 5KQ1A 3CIKA 4HAVB 3KY9A 2Z0PA 2CODA 1NI2A 3T06A 2YT1A 4GPTB 3D8FA 3PP2A 4MY6A 2DFKA 2FJUB 3SUZA 1K5GB 4IFSA 2GCJA 1KZGA 4GXBA 2L2IA 2MFQA 3AU4A 2Z4DA 1FB8A 1P3RA 2MKRA 5GOWB 2YF0A 3DXEA 2DYNA 1U27A 3ZVRA 1GC7A 4P7IA 3HSAA 3N7CA 3P6AA 2KCJA 1ZC3B 2COFA 4DBBA 1MIXA 4F7HA 2ROZB 3AJ4A 1I2HA 2D2QA 3PVLA 2YT0A 2LKOA 2D9WA 1OQNA 4K17A 4DIXA 3RCPA 3KSYA 4QJ5B 1XKEA 1XX0A 4XWXA 4QJ4B 5M4YB 2Y8FA 1TQZA 3FEHA 2Z14A 4A5KA 2LG1A 1T77A 3LJUX 2YSZA 1BAKA 1V5PA 1FHWA 1AWEA 2R09A 3TO1A 5C5BA 2OQBA 4KHOA 1WJMA 4HB3B 4QXAB 3ULBA 2NMBA 1FHOA 1QQGA 1NU2A 2RNRB 4IOYX 4HDQA 2K8EA 5HE0A 4D0NB 2V76A 4D6WA 1DDWA 2ELBA 4K2OA 2UVMA 2YVCA 2COCA 1RJ2A 4TYZA 2E2XA 2G35A 3VIAA 1UNQA 1ZVRA 1PFJA 2PZ1A 1RRPB 4HDOA 5LOPB 4YL8A 2W2XC 2J0JA 4EKUA 3AU5A 3ZDTA 1WI1A 2ADZA 3A8PA 3SV1A 3BINA 1GG3A 3O96A 4KHBB 4MK0A 4YONA 2Z59A 4GZUA 1B55A 2VSZA 2NBVA 3QWMA 2KR0A 5IRSA 2YT2A 3SNHA 1UNPA 5D3YA 4EJNA 1MK7B 2IYBA 1Y19B 4H8SA 4KAXB 1DBHA 1WG7A 3A98B 3WYFB 2P0DA 3PSCA 2DHKA 2QKMA 4WVFB 1U5DA 2R0DA 2YS5A 4CHMA 1PMSA 1FGYA 5HE3A 3NWFA 2DKPA 3DCXA 1Y5OA 5JP4A 2Y7BA 3WA0A 1M7RA 1KZ7A 1W1GA 4KVGB 2JP2A 5D3XA 3SYXA 2R2YA 3PG7A 2DKQA 2P0HA 1U29A 1MK9B 2AL6A 4F7GA 1V88A 1MAIA 1DDMA 4HAXB 1W1HA 5C6RA 2CRFA 1WJ1A 2UZRA 1J19A 1H4RA 4CSQA 4ZRKA 3V5WA 2J59M 3OHMB 1ZSQA 2YS3A 2BCJA 5C79A 1H10A 4NSWA 3KRWA 2DN6A 5EFXA 3HIEA 1ZM0A 1MKEA 2I1KA 1EGXA 5L81A 4DX90 3D8DA 5J3QA 3GYPA 3NWAA 1BWNA 3PZDA 4C0AA 1QC6A 2CAYA 1FGZA 2COAA 4CHJA 2NZ8B 1X86A 3TCAA 3PVWA 2RGNB 1W1DA 4HB0B 3X23A 5DIFB 2HTHB 4HAYB 2Z0QA 3HQCA 1XD4A 5KQ4A 3U8ZA 1LW3A 3HW2B 1MIZB 1XODA 3U12A 1MI1A 5DHFB 1UEFA 3NW8A 1GC6A 1K5DB 1OY2A 4HAZB 2MDXA 4F7UP 1X11A 1MPHA 3G9WA 3MPXA 4GOUA 1KI1B 4OSNA 2DHJA 2Y8GA 2VRWB 2EC1A 5FI1A 1V5MA 3BJIA 5LG4B 2KUPA 4GNKB 5I2SA 3QBVB 2L1CA 4BBKA 5JHGA 4HATB 1EAZA 1LB1A 2I1JA 4OT1A 1Z87A 2KIEA 3ODWA 3OANA 3F5RA 2K2JA 3D8EA 4KHAA 2D9VA 1FAOA 1U5EA
chains in the Genus database with same CATH topology
2GCJA 2RRFA 2YT2A 3OHMB 1ZYIA 2ZKMX 4Z2NA 2GCLA 4HSIA 3TO1A 2Z4DA 3GYOA 3NWDA 4QJ3B 2R2YA 4KHOA 3FVCA 2Z13A 3TVVA 2KIGA 5LG4B 4QXAB 4GNKB 5I2SA 4L1RA 2KUQA 3U12A 3HIEA 5I2MA 4IOYX 4DIXA 4OT1A 2K8EA 3NW8A 4QJ5B 3GYPA 3NWAA 4D6WA 4QJ4B 2KIEA 4KHBB 5M4YB 4KHBA 3FSSA 4OSNA 2K49A 4PQ0A 2GUMA 2Z14A 3NWFA 4GOUA 3A58A 4Z2MB 3TW1A 2Z59A 4CSQA 2FJUB 2NBVA 4KHAA 4IFSA 2KR0A 5IRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z59 A;  2Z4D A;  2NBV A;  2KR0 A;  2R2Y A;  5IRS A; 
#chains in the Genus database with same CATH topology
 1IRS A;  2DLW A;  5C16 A;  1X05 A;  1DYN A;  3DXC A;  3FVC A;  2Z13 A;  2GS0 A;  5DI9 B;  4B6H A;  2J0K A;  5I2M A;  2EMS A;  2DTC A;  4HB4 B;  2UZS A;  2ZPY A;  2P8V A;  3M1I B;  3MDB C;  1SHC A;  4PNK A;  4MT7 A;  5CLQ B;  2D9X A;  2LOZ A;  2N0Y A;  1ZYI A;  5HE2 A;  5D3V A;  1AQC A;  4HB2 B;  4Y94 A;  2ROV A;  3KZ1 A;  1XR0 B;  2RVB B;  1OMW A;  1ISN A;  5D27 A;  1V5U A;  2K00 A;  2OTX A;  2YS1 A;  2RLO A;  4DX8 A;  2X18 A;  1FOE A;  5J3T A;  2RSG A;  3ODO A;  2DA0 A;  3NSU A;  2YRY A;  3ML4 A;  4A6F B;  5C5B B;  5DHA B;  3U7D A;  1V89 A;  1I7A A;  4K2P A;  5KCV A;  5CLL B;  2GJY A;  1V61 A;  2XQN M;  2I5C A;  1E5W A;  2VKI A;  2M38 A;  2EJ8 A;  2IFS A;  5J3Y A;  3FSS A;  1TJ6 A;  1EF1 A;  4PQ0 A;  1DRO A;  2GUM A;  3A58 A;  1P5T A;  1Q67 A;  3TFM A;  2KGX B;  1EVH A;  2DYQ A;  2DX5 A;  2LOX A;  3ULC A;  4Z2N A;  2GCL A;  3CXB B;  4HSI A;  4CYE A;  1FHX A;  1BTK A;  3TVV A;  2P0F A;  3SO6 A;  2CY5 A;  4EMO A;  2FJL A;  1WGU A;  5DH9 B;  2D9Z A;  3PEG A;  4ZRJ A;  3QIJ A;  2Q13 A;  1P6S A;  2N23 A;  1ZC4 B;  2D11 A;  2MWN B;  1TXD A;  2RUK B;  4HAW B;  2H7E A;  3FM8 C;  1UPR A;  2W2X D;  3HK0 A;  3B77 A;  4TKN A;  2M14 A;  1U5G A;  4GN1 A;  2ZKM X;  3GYO A;  1U2B A;  1WVH A;  2W2W A;  3IVF A;  1J0W A;  2QKL A;  2LYD A;  2D10 A;  5JLJ B;  4L6E A;  2KUQ A;  3KRX A;  1UPQ A;  4GMX B;  2K49 A;  4Z2M B;  3DXD A;  1N3H A;  2J0M A;  5D3W A;  1BTN A;  3ODX A;  1X1F A;  1X1G A;  2I5F A;  4HAU B;  4K81 A;  5FI0 A;  4GMV A;  3F0W A;  5LON B;  1WGQ A;  2CY4 A;  5JHH A;  4WSF A;  1NTY A;  4QJ3 B;  2KIG A;  2HE7 A;  4HHV A;  1NTV A;  1XCG A;  2DHI A;  1UNR A;  2DX1 A;  4L1R A;  2ELA A;  2H7D A;  1PLS A;  4A6F A;  2AEH A;  3P7Z A;  3UZT A;  2D4Q A;  4KHB A;  5HE1 A;  3PVU A;  3TW1 A;  1U5F A;  4IAP A;  3VOQ A;  2D9Y A;  2RRF A;  1DDV A;  4A6K A;  2Z0O A;  4NY0 A;  3NWD A;  2K2U A;  2EMT A;  2LUL A;  4ZRI A;  4A6H A;  3A8Q A;  4WJ7 A;  1M7E A;  1SGH A;  4DXA B;  5KQ1 A;  3CIK A;  4HAV B;  3KY9 A;  2Z0P A;  2COD A;  1NI2 A;  3T06 A;  2YT1 A;  4GPT B;  3D8F A;  3PP2 A;  4MY6 A;  2DFK A;  2FJU B;  3SUZ A;  1K5G B;  4IFS A;  2GCJ A;  1KZG A;  4GXB A;  2L2I A;  2MFQ A;  3AU4 A;  2Z4D A;  1FB8 A;  1P3R A;  2MKR A;  5GOW B;  2YF0 A;  3DXE A;  2DYN A;  1U27 A;  3ZVR A;  1GC7 A;  4P7I A;  3HSA A;  3N7C A;  3P6A A;  2KCJ A;  1ZC3 B;  2COF A;  4DBB A;  1MIX A;  4F7H A;  2ROZ B;  3AJ4 A;  1I2H A;  2D2Q A;  3PVL A;  2YT0 A;  2LKO A;  2D9W A;  1OQN A;  4K17 A;  4DIX A;  3RCP A;  3KSY A;  4QJ5 B;  1XKE A;  1XX0 A;  4XWX A;  4QJ4 B;  5M4Y B;  2Y8F A;  1TQZ A;  3FEH A;  2Z14 A;  4A5K A;  2LG1 A;  1T77 A;  3LJU X;  2YSZ A;  1BAK A;  1V5P A;  1FHW A;  1AWE A;  2R09 A;  3TO1 A;  5C5B A;  2OQB A;  4KHO A;  1WJM A;  4HB3 B;  4QXA B;  3ULB A;  2NMB A;  1FHO A;  1QQG A;  1NU2 A;  2RNR B;  4IOY X;  4HDQ A;  2K8E A;  5HE0 A;  4D0N B;  2V76 A;  4D6W A;  1DDW A;  2ELB A;  4K2O A;  2UVM A;  2YVC A;  2COC A;  1RJ2 A;  4TYZ A;  2E2X A;  2G35 A;  3VIA A;  1UNQ A;  1ZVR A;  1PFJ A;  2PZ1 A;  1RRP B;  4HDO A;  5LOP B;  4YL8 A;  2W2X C;  2J0J A;  4EKU A;  3AU5 A;  3ZDT A;  1WI1 A;  2ADZ A;  3A8P A;  3SV1 A;  3BIN A;  1GG3 A;  3O96 A;  4KHB B;  4MK0 A;  4YON A;  2Z59 A;  4GZU A;  1B55 A;  2VSZ A;  2NBV A;  3QWM A;  2KR0 A;  5IRS A;  2YT2 A;  3SNH A;  1UNP A;  5D3Y A;  4EJN A;  1MK7 B;  2IYB A;  1Y19 B;  4H8S A;  4KAX B;  1DBH A;  1WG7 A;  3A98 B;  3WYF B;  2P0D A;  3PSC A;  2DHK A;  2QKM A;  4WVF B;  1U5D A;  2R0D A;  2YS5 A;  4CHM A;  1PMS A;  1FGY A;  5HE3 A;  3NWF A;  2DKP A;  3DCX A;  1Y5O A;  5JP4 A;  2Y7B A;  3WA0 A;  1M7R A;  1KZ7 A;  1W1G A;  4KVG B;  2JP2 A;  5D3X A;  3SYX A;  2R2Y A;  3PG7 A;  2DKQ A;  2P0H A;  1U29 A;  1MK9 B;  2AL6 A;  4F7G A;  1V88 A;  1MAI A;  1DDM A;  4HAX B;  1W1H A;  5C6R A;  2CRF A;  1WJ1 A;  2UZR A;  1J19 A;  1H4R A;  4CSQ A;  4ZRK A;  3V5W A;  2J59 M;  3OHM B;  1ZSQ A;  2YS3 A;  2BCJ A;  5C79 A;  1H10 A;  4NSW A;  3KRW A;  2DN6 A;  5EFX A;  3HIE A;  1ZM0 A;  1MKE A;  2I1K A;  1EGX A;  5L81 A;  4DX9 0;  3D8D A;  5J3Q A;  3GYP A;  3NWA A;  1BWN A;  3PZD A;  4C0A A;  1QC6 A;  2CAY A;  1FGZ A;  2COA A;  4CHJ A;  2NZ8 B;  1X86 A;  3TCA A;  3PVW A;  2RGN B;  1W1D A;  4HB0 B;  3X23 A;  5DIF B;  2HTH B;  4HAY B;  2Z0Q A;  3HQC A;  1XD4 A;  5KQ4 A;  3U8Z A;  1LW3 A;  3HW2 B;  1MIZ B;  1XOD A;  3U12 A;  1MI1 A;  5DHF B;  1UEF A;  3NW8 A;  1GC6 A;  1K5D B;  1OY2 A;  4HAZ B;  2MDX A;  4F7U P;  1X11 A;  1MPH A;  3G9W A;  3MPX A;  4GOU A;  1KI1 B;  4OSN A;  2DHJ A;  2Y8G A;  2VRW B;  2EC1 A;  5FI1 A;  1V5M A;  3BJI A;  5LG4 B;  2KUP A;  4GNK B;  5I2S A;  3QBV B;  2L1C A;  4BBK A;  5JHG A;  4HAT B;  1EAZ A;  1LB1 A;  2I1J A;  4OT1 A;  1Z87 A;  2KIE A;  3ODW A;  3OAN A;  3F5R A;  2K2J A;  3D8E A;  4KHA A;  2D9V A;  1FAO A;  1U5E A; 
#chains in the Genus database with same CATH homology
 2GCJ A;  2RRF A;  2YT2 A;  3OHM B;  1ZYI A;  2ZKM X;  4Z2N A;  2GCL A;  4HSI A;  3TO1 A;  2Z4D A;  3GYO A;  3NWD A;  4QJ3 B;  2R2Y A;  4KHO A;  3FVC A;  2Z13 A;  3TVV A;  2KIG A;  5LG4 B;  4QXA B;  4GNK B;  5I2S A;  4L1R A;  2KUQ A;  3U12 A;  3HIE A;  5I2M A;  4IOY X;  4DIX A;  4OT1 A;  2K8E A;  3NW8 A;  4QJ5 B;  3GYP A;  3NWA A;  4D6W A;  4QJ4 B;  2KIE A;  4KHB B;  5M4Y B;  4KHB A;  3FSS A;  4OSN A;  2K49 A;  4PQ0 A;  2GUM A;  2Z14 A;  3NWF A;  4GOU A;  3A58 A;  4Z2M B;  3TW1 A;  2Z59 A;  4CSQ A;  2FJU B;  2NBV A;  4KHA A;  4IFS A;  2KR0 A;  5IRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...