5IRSA

Crystal structure of the proteasomal rpn13 pru-domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
110
structure length
110
Chain Sequence
KYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasomal ubiquitin receptor ADRM1
publication title Structures of Rpn1 T1:Rad23 and hRpn13:hPLIC2 Reveal Distinct Binding Mechanisms between Substrate Receptors and Shuttle Factors of the Proteasome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 29
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2016-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04683 Proteasom_Rpn13 Proteasome complex subunit Rpn13 ubiquitin receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.70 Mainly Beta Roll PH-domain like PH-domain like 5irsA00
2Z4DA 2Z59A 2NBVA 2KR0A 2R2YA 5IRSA
chains in the Genus database with same CATH superfamily
1H10A 2Y8GA 5C79A 4WSFA 4GOUA 5J3YA 1QC6A 3O96A 3A8PA 1DDMA 2KIEA 4IFSA 4QJ4B 4Y94A 1KZ7A 4KVGB 2MDXA 1FB8A 4A5KA 4HB3B 2MKRA 1B55A 2RGNB 2R09A 2ELAA 1U5GA 5HE0A 1MKEA 4HATB 2CY5A 4HAZB 2DHIA 4GPTB 3DCXA 1XR0B 3PEGA 1FHXA 2ZPYA 2K00A 3PVUA 2KUQA 4QXAB 2ELBA 1MK7B 1I2HA 2RUKB 3PP2A 4QJ3B 1M7RA 3M1IB 3TCAA 1U29A 2HE7A 4HB0B 3AU5A 4F7UP 2L2IA 1W1DA 4A6FB 2DX5A 3D8DA 5D3WA 4NSWA 2YS3A 3ULBA 4ZRIA 4IAPA 1ZM0A 1ZC3B 2VKIA 5DHAB 1RRPB 3ODXA 1XODA 2EMSA 2M38A 4HAVB 2FJLA 2DYNA 2P0FA 5EFXA 2OTXA 2D10A 1WGUA 2N0YA 2Y8FA 3MPXA 4DXAB 2YVCA 1Q67A 4GMXB 4PNKA 3U8ZA 3GYPA 2I5CA 4GN1A 1DROA 1Y5OA 2I1KA 3N7CA 2W2XC 1P6SA 1QQGA 3HW2B 1K5DB 2YT0A 2ADZA 5LOPB 2K2JA 2RNRB 5JHGA 2D9VA 3KY9A 4XWXA 1U5DA 4HB2B 2YT2A 5C6RA 1ZYIA 4KHBA 2EC1A 2Z0PA 3PVWA 2Z0QA 4HDOA 1RJ2A 3HSAA 2RVBB 5KQ1A 4CSQA 2KCJA 1MK9B 4ZRKA 1FAOA 3A58A 4DIXA 2YRYA 3KRXA 5L81A 3LJUX 3OHMB 2BCJA 4DX8A 3PG7A 3PZDA 5HE3A 2K8EA 4KHAA 2XQNM 1W1HA 5DI9B 2D4QA 3QIJA 3DXCA 1M7EA 1WVHA 2DYQA 2DN6A 2HTHB 5C5BB 3UZTA 1BAKA 4GMVA 2OQBA 2N23A 3A98B 4C0AA 4Z2MB 4HHVA 1KZGA 3QWMA 2DHJA 3F0WA 5D3XA 2NBVA 2IYBA 5KCVA 2AEHA 3SUZA 1ZVRA 4BBKA 2V76A 4CHMA 3U7DA 1UPQA 2DFKA 4HDQA 5C5BA 4MY6A 3VIAA 3AU4A 1TJ6A 1MIZB 1V5UA 2RRFA 3HIEA 3NW8A 2MWNB 2LULA 3ZDTA 1V89A 4HAUB 3SNHA 2KIGA 3FM8C 1Z87A 3U12A 1BWNA 2Z14A 5I2SA 4HAWB 1J0WA 2MFQA 1V61A 3IVFA 4Z2NA 3BINA 3FVCA 4GXBA 1PLSA 1MAIA 1V5PA 1DBHA 1KI1B 3NSUA 5LONB 2H7DA 4WVFB 2COCA 2Z13A 3KSYA 2EMTA 2QKMA 2K49A 1ISNA 4L1RA 5KQ4A 3TVVA 1OMWA 1PFJA 3SO6A 1UNRA 1TQZA 2KUPA 4K2PA 3V5WA 3CXBB 4P7IA 1WI1A 4TYZA 3ODOA 2CAYA 4ZRJA 1K5GB 4A6FA 1ZSQA 2ROVA 1WGQA 2LYDA 3A8QA 2Z0OA 4OT1A 5HE1A 3RCPA 1P3RA 1DYNA 2DA0A 1NI2A 2H7EA 4HSIA 2DHKA 2LOZA 1J19A 1U2BA 4B6HA 2KGXB 2D9YA 2KR0A 2NZ8B 3F5RA 1U5FA 5J3TA 2M14A 1EAZA 2DX1A 2YS1A 2J0MA 1T77A 5D3VA 5FI0A 1NU2A 2P8VA 4HB4B 2UVMA 4A6HA 4H8SA 4GZUA 5I2MA 4K81A 4TKNA 2COFA 1GC6A 1E5WA 3NWFA 1GC7A 1SHCA 2YSZA 1W1GA 1DDVA 2JP2A 2W2XD 4KAXB 2J0JA 3NWAA 4YL8A 2FJUB 1X11A 2P0HA 2QKLA 3TFMA 3D8FA 1N3HA 1AWEA 1MI1A 1X1FA 3PSCA 4F7HA 2GCLA 3ZVRA 1WJ1A 2R0DA 4A6KA 2RLOA 1OQNA 1Y19B 1BTKA 2YS5A 1X05A 3KZ1A 1X1GA 3MDBC 3HQCA 2DLWA 4D6WA 2I5FA 4GNKB 5GOWB 1FOEA 2D9XA 2YT1A 3ODWA 2UZSA 1U27A 4D0NB 4WJ7A 2D9WA 1FGYA 5FI1A 2D2QA 4IOYX 1XCGA 3KRWA 2DKQA 3FSSA 5DIFB 1V5MA 3P7ZA 1FHOA 3TO1A 1UPRA 2GJYA 5JLJB 5IRSA 2K2UA 3BJIA 1EVHA 3CIKA 2D9ZA 3PVLA 1NTVA 5DHFB 3TW1A 2ZKMX 2LG1A 2UZRA 4MT7A 4HAYB 4K2OA 4CYEA 3ML4A 4EMOA 1GG3A 2R2YA 2YF0A 3WYFB 1OY2A 3SV1A 1PMSA 1XKEA 3P6AA 2VSZA 2PZ1A 3DXEA 3X23A 4EJNA 1I7AA 3T06A 5M4YB 1TXDA 3B77A 1EF1A 4HAXB 1MPHA 2Z4DA 1SGHA 3G9WA 5CLLB 3OANA 2CODA 4QJ5B 1U5EA 3D8EA 1FGZA 5DH9B 5D3YA 2IFSA 4DBBA 2GS0A 4OSNA 3WA0A 1DDWA 4CHJA 2NMBA 2E2XA 2G35A 5C16A 2LKOA 4KHBB 1NTYA 5HE2A 1XX0A 2CY4A 1H4RA 5JHHA 2GCJA 4EKUA 3GYOA 1P5TA 1V88A 2W2WA 2COAA 1FHWA 1UNPA 1AQCA 2CRFA 2RSGA 2X18A 4KHOA 1IRSA 1LB1A 3NWDA 1UNQA 3HK0A 3ULCA 4MK0A 3DXDA 1XD4A 1X86A 1ZC4B 4YONA 5D27A 1EGXA 2L1CA 4K17A 1BTNA 2DTCA 2J0KA 1WJMA 2Z59A 2EJ8A 4F7GA 2Q13A 4NY0A 1LW3A 3VOQA 2GUMA 4L6EA 2AL6A 5LG4B 4DX90 5JP4A 2Y7BA 4PQ0A 2D11A 3QBVB 1MIXA 2I1JA 2J59M 3SYXA 2ROZB 1UEFA 2DKPA 3AJ4A 2LOXA 2VRWB 2P0DA 3FEHA 5J3QA 1WG7A 5CLQB
chains in the Genus database with same CATH topology
2ZKMX 4KHOA 4QJ5B 4CSQA 2GUMA 4GOUA 2GCLA 4Z2MB 2RRFA 5LG4B 3HIEA 3NWDA 3NW8A 2KIEA 2KUQA 3A58A 4IFSA 4OT1A 4IOYX 4QXAB 4OSNA 5I2MA 4DIXA 4QJ4B 4PQ0A 2NBVA 2R2YA 2Z13A 3FSSA 3NWFA 2KIGA 2YT2A 3OHMB 4KHBB 4HSIA 2K49A 4D6WA 1ZYIA 4L1RA 4KHBA 3TVVA 3TO1A 2K8EA 4KHAA 4QJ3B 4GNKB 2KR0A 2GCJA 2Z14A 3NWAA 5I2SA 5M4YB 5IRSA 2FJUB 2Z4DA 3U12A 3GYOA 3GYPA 2Z59A 4Z2NA 3TW1A 3FVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z4D A;  2Z59 A;  2NBV A;  2KR0 A;  2R2Y A;  5IRS A; 
#chains in the Genus database with same CATH topology
 1H10 A;  2Y8G A;  5C79 A;  4WSF A;  4GOU A;  5J3Y A;  1QC6 A;  3O96 A;  3A8P A;  1DDM A;  2KIE A;  4IFS A;  4QJ4 B;  4Y94 A;  1KZ7 A;  4KVG B;  2MDX A;  1FB8 A;  4A5K A;  4HB3 B;  2MKR A;  1B55 A;  2RGN B;  2R09 A;  2ELA A;  1U5G A;  5HE0 A;  1MKE A;  4HAT B;  2CY5 A;  4HAZ B;  2DHI A;  4GPT B;  3DCX A;  1XR0 B;  3PEG A;  1FHX A;  2ZPY A;  2K00 A;  3PVU A;  2KUQ A;  4QXA B;  2ELB A;  1MK7 B;  1I2H A;  2RUK B;  3PP2 A;  4QJ3 B;  1M7R A;  3M1I B;  3TCA A;  1U29 A;  2HE7 A;  4HB0 B;  3AU5 A;  4F7U P;  2L2I A;  1W1D A;  4A6F B;  2DX5 A;  3D8D A;  5D3W A;  4NSW A;  2YS3 A;  3ULB A;  4ZRI A;  4IAP A;  1ZM0 A;  1ZC3 B;  2VKI A;  5DHA B;  1RRP B;  3ODX A;  1XOD A;  2EMS A;  2M38 A;  4HAV B;  2FJL A;  2DYN A;  2P0F A;  5EFX A;  2OTX A;  2D10 A;  1WGU A;  2N0Y A;  2Y8F A;  3MPX A;  4DXA B;  2YVC A;  1Q67 A;  4GMX B;  4PNK A;  3U8Z A;  3GYP A;  2I5C A;  4GN1 A;  1DRO A;  1Y5O A;  2I1K A;  3N7C A;  2W2X C;  1P6S A;  1QQG A;  3HW2 B;  1K5D B;  2YT0 A;  2ADZ A;  5LOP B;  2K2J A;  2RNR B;  5JHG A;  2D9V A;  3KY9 A;  4XWX A;  1U5D A;  4HB2 B;  2YT2 A;  5C6R A;  1ZYI A;  4KHB A;  2EC1 A;  2Z0P A;  3PVW A;  2Z0Q A;  4HDO A;  1RJ2 A;  3HSA A;  2RVB B;  5KQ1 A;  4CSQ A;  2KCJ A;  1MK9 B;  4ZRK A;  1FAO A;  3A58 A;  4DIX A;  2YRY A;  3KRX A;  5L81 A;  3LJU X;  3OHM B;  2BCJ A;  4DX8 A;  3PG7 A;  3PZD A;  5HE3 A;  2K8E A;  4KHA A;  2XQN M;  1W1H A;  5DI9 B;  2D4Q A;  3QIJ A;  3DXC A;  1M7E A;  1WVH A;  2DYQ A;  2DN6 A;  2HTH B;  5C5B B;  3UZT A;  1BAK A;  4GMV A;  2OQB A;  2N23 A;  3A98 B;  4C0A A;  4Z2M B;  4HHV A;  1KZG A;  3QWM A;  2DHJ A;  3F0W A;  5D3X A;  2NBV A;  2IYB A;  5KCV A;  2AEH A;  3SUZ A;  1ZVR A;  4BBK A;  2V76 A;  4CHM A;  3U7D A;  1UPQ A;  2DFK A;  4HDQ A;  5C5B A;  4MY6 A;  3VIA A;  3AU4 A;  1TJ6 A;  1MIZ B;  1V5U A;  2RRF A;  3HIE A;  3NW8 A;  2MWN B;  2LUL A;  3ZDT A;  1V89 A;  4HAU B;  3SNH A;  2KIG A;  3FM8 C;  1Z87 A;  3U12 A;  1BWN A;  2Z14 A;  5I2S A;  4HAW B;  1J0W A;  2MFQ A;  1V61 A;  3IVF A;  4Z2N A;  3BIN A;  3FVC A;  4GXB A;  1PLS A;  1MAI A;  1V5P A;  1DBH A;  1KI1 B;  3NSU A;  5LON B;  2H7D A;  4WVF B;  2COC A;  2Z13 A;  3KSY A;  2EMT A;  2QKM A;  2K49 A;  1ISN A;  4L1R A;  5KQ4 A;  3TVV A;  1OMW A;  1PFJ A;  3SO6 A;  1UNR A;  1TQZ A;  2KUP A;  4K2P A;  3V5W A;  3CXB B;  4P7I A;  1WI1 A;  4TYZ A;  3ODO A;  2CAY A;  4ZRJ A;  1K5G B;  4A6F A;  1ZSQ A;  2ROV A;  1WGQ A;  2LYD A;  3A8Q A;  2Z0O A;  4OT1 A;  5HE1 A;  3RCP A;  1P3R A;  1DYN A;  2DA0 A;  1NI2 A;  2H7E A;  4HSI A;  2DHK A;  2LOZ A;  1J19 A;  1U2B A;  4B6H A;  2KGX B;  2D9Y A;  2KR0 A;  2NZ8 B;  3F5R A;  1U5F A;  5J3T A;  2M14 A;  1EAZ A;  2DX1 A;  2YS1 A;  2J0M A;  1T77 A;  5D3V A;  5FI0 A;  1NU2 A;  2P8V A;  4HB4 B;  2UVM A;  4A6H A;  4H8S A;  4GZU A;  5I2M A;  4K81 A;  4TKN A;  2COF A;  1GC6 A;  1E5W A;  3NWF A;  1GC7 A;  1SHC A;  2YSZ A;  1W1G A;  1DDV A;  2JP2 A;  2W2X D;  4KAX B;  2J0J A;  3NWA A;  4YL8 A;  2FJU B;  1X11 A;  2P0H A;  2QKL A;  3TFM A;  3D8F A;  1N3H A;  1AWE A;  1MI1 A;  1X1F A;  3PSC A;  4F7H A;  2GCL A;  3ZVR A;  1WJ1 A;  2R0D A;  4A6K A;  2RLO A;  1OQN A;  1Y19 B;  1BTK A;  2YS5 A;  1X05 A;  3KZ1 A;  1X1G A;  3MDB C;  3HQC A;  2DLW A;  4D6W A;  2I5F A;  4GNK B;  5GOW B;  1FOE A;  2D9X A;  2YT1 A;  3ODW A;  2UZS A;  1U27 A;  4D0N B;  4WJ7 A;  2D9W A;  1FGY A;  5FI1 A;  2D2Q A;  4IOY X;  1XCG A;  3KRW A;  2DKQ A;  3FSS A;  5DIF B;  1V5M A;  3P7Z A;  1FHO A;  3TO1 A;  1UPR A;  2GJY A;  5JLJ B;  5IRS A;  2K2U A;  3BJI A;  1EVH A;  3CIK A;  2D9Z A;  3PVL A;  1NTV A;  5DHF B;  3TW1 A;  2ZKM X;  2LG1 A;  2UZR A;  4MT7 A;  4HAY B;  4K2O A;  4CYE A;  3ML4 A;  4EMO A;  1GG3 A;  2R2Y A;  2YF0 A;  3WYF B;  1OY2 A;  3SV1 A;  1PMS A;  1XKE A;  3P6A A;  2VSZ A;  2PZ1 A;  3DXE A;  3X23 A;  4EJN A;  1I7A A;  3T06 A;  5M4Y B;  1TXD A;  3B77 A;  1EF1 A;  4HAX B;  1MPH A;  2Z4D A;  1SGH A;  3G9W A;  5CLL B;  3OAN A;  2COD A;  4QJ5 B;  1U5E A;  3D8E A;  1FGZ A;  5DH9 B;  5D3Y A;  2IFS A;  4DBB A;  2GS0 A;  4OSN A;  3WA0 A;  1DDW A;  4CHJ A;  2NMB A;  2E2X A;  2G35 A;  5C16 A;  2LKO A;  4KHB B;  1NTY A;  5HE2 A;  1XX0 A;  2CY4 A;  1H4R A;  5JHH A;  2GCJ A;  4EKU A;  3GYO A;  1P5T A;  1V88 A;  2W2W A;  2COA A;  1FHW A;  1UNP A;  1AQC A;  2CRF A;  2RSG A;  2X18 A;  4KHO A;  1IRS A;  1LB1 A;  3NWD A;  1UNQ A;  3HK0 A;  3ULC A;  4MK0 A;  3DXD A;  1XD4 A;  1X86 A;  1ZC4 B;  4YON A;  5D27 A;  1EGX A;  2L1C A;  4K17 A;  1BTN A;  2DTC A;  2J0K A;  1WJM A;  2Z59 A;  2EJ8 A;  4F7G A;  2Q13 A;  4NY0 A;  1LW3 A;  3VOQ A;  2GUM A;  4L6E A;  2AL6 A;  5LG4 B;  4DX9 0;  5JP4 A;  2Y7B A;  4PQ0 A;  2D11 A;  3QBV B;  1MIX A;  2I1J A;  2J59 M;  3SYX A;  2ROZ B;  1UEF A;  2DKP A;  3AJ4 A;  2LOX A;  2VRW B;  2P0D A;  3FEH A;  5J3Q A;  1WG7 A;  5CLQ B; 
#chains in the Genus database with same CATH homology
 2ZKM X;  4KHO A;  4QJ5 B;  4CSQ A;  2GUM A;  4GOU A;  2GCL A;  4Z2M B;  2RRF A;  5LG4 B;  3HIE A;  3NWD A;  3NW8 A;  2KIE A;  2KUQ A;  3A58 A;  4IFS A;  4OT1 A;  4IOY X;  4QXA B;  4OSN A;  5I2M A;  4DIX A;  4QJ4 B;  4PQ0 A;  2NBV A;  2R2Y A;  2Z13 A;  3FSS A;  3NWF A;  2KIG A;  2YT2 A;  3OHM B;  4KHB B;  4HSI A;  2K49 A;  4D6W A;  1ZYI A;  4L1R A;  4KHB A;  3TVV A;  3TO1 A;  2K8E A;  4KHA A;  4QJ3 B;  4GNK B;  2KR0 A;  2GCJ A;  2Z14 A;  3NWA A;  5I2S A;  5M4Y B;  5IRS A;  2FJU B;  2Z4D A;  3U12 A;  3GYO A;  3GYP A;  2Z59 A;  4Z2N A;  3TW1 A;  3FVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...