5IS1A

Crystal structure of the extracellular domain of sensor histidine kinase yycg from staphylococcus aureus at 2.0 angstrom resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
142
Chain Sequence
NNLEKELLDNFKKNITQYAKQLEISIEKVYDEKGSNAQKDIQNLLSEYANRQEIGEIRFIDKDQIIIATTKQSNRSLINQKANDSSVQKALSLGQSNDHLILKDYGGGKDRVWVYNIPVKVDKKVIGNIYIESKINDVYNQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies on the Extracellular Domain of Sensor Histidine Kinase YycG from Staphylococcus aureus and Its Functional Implications
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
molecule keywords Histidine kinase
total genus 44
structure length 142
sequence length 143
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2016-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5is1A00
2J80A 2ZOIA 4HIAA 3H82A 3BWLA 2V0WA 1TS6A 2YKFA 4GHIB 4I3IA 2VV8A 3CWFA 4NXFA 3GECA 4WL9A 4BBTA 1S4SA 5TBMB 2W27A 4F3LB 1DP6A 1T19A 4R3AA 1LSXA 2D02A 3H9WA 4HJ6A 4I3AA 3A0RA 1VB6A 1LT0A 2OWJA 3LIEA 1LL8A 3MR0A 2YKHA 1LSWA 3RTYA 1F98A 2ZOHA 1N9LA 2GJ3A 3ZQ5A 4PKYG 5HWVA 5HSQA 4KUKA 4KQDA 3E4QA 3MQOA 4EQ1A 3LIBA 1V9YA 2L4RA 5F5YA 3E4PA 1N9NA 1TS0A 3BY8A 5J7EA 2PHYA 2V9AA 1P0ZA 3H82B 3LIFA 4GHIA 3LYXA 1EW0A 4I3JA 4I39A 3F1NA 1OTDA 4JGQA 4L9FA 1GSXA 3EWKA 3HJIA 5F68A 5HD3A 3UMDA 5TBMA 2PR5A 4F3LA 1S4RA 3ULFA 4BBUA 1S66L 2Z6DA 4LRYC 1GSVA 2V0UA 5F6AA 3T50A 1XFQA 2K7SA 3G6OA 3LIAA 5EFWA 5F69A 4EERA 3NJAA 3EEHA 3LICA 3NOTC 2VV6A 4L9GA 2ZBBA 4HP9A 2VLGA 3FG8A 1OT9A 3H7WA 2KX6A 3HJKA 5J4EA 5J3WA 3LI9A 5HD5A 2B02A 1WA9A 1OTAA 2EA9A 2OOLA 1T1AA 2QHKA 3C8CA 5HWTA 1UWPX 1D06A 3A0SA 1XFNA 2QJ5A 3LI8A 1S1ZA 4RQ9A 3K3CA 3LUQA 4HY8A 4I38A 4GS9A 2L1MA 2L0WA 2A24B 2PD7A 4HI4A 4L9EA 4HJ3A 4M4XA 2H28A 4HHDA 4H6JB 4JGRA 2I9VA 2QWSA 1X0OA 3NOUC 4GCZA 3F1OA 5HDSA 4WF0A 4NXEA 1GSWA 1LSVA 3UB8A 4JGOA 3A0VA 2WKQA 1NWZA 3NOPC 5AVEA 4EW7A 3P7NA 1P97A 4BBVA 3IS2B 4YWZA 3UB7A 5G4YA 1UGUA 3MQQA 4MN5A 1OTIA 5DJUA 4B9OA 5IS1A 3E4OA 5KIZA 1T1CA 3F1PA 2A24A 3ICYA 1XJ4A 3MXQA 4JGPA 3GDIA 3MJQA 3UMEA 3VE4A 4R38A 1DRMA 1V9ZA 2KDKA 3BY9A 5HWWA 1N9OA 4H6JA 4DJ3A 1D7EA 3CLOA 1MZUA 2R78A 2WKRA 2WKPA 2W0NA 5DKLA 4EESA 2M1CA 2PDRA 2V1AA 3SW1A 2OWHA 1OJ5A 4MN6A 2V1BA 4LRZE 5HDDA 4WLAA 1OTEA 3C2WA 3IBRA 1ODVA 4PKYA 2PR6A 3K3DA 3KX0X 1TS8A 1OJGA 1XJ3A 4LRXC 3IS2A 5DKKA 4DJ2A 1UWNX 4GW9A 4HH3A 2CMNA 2INWA 1XJ6A 1XJ2A 3FC7A 5I5LA 1F9IA 1T1BA 1OT6A 3D72A 4HH2A 4K08A 4LLOB 4GS9B 4EEPA 4R6LA 4E04A 3CAXA 4EXOA 1DP8A 4HOIA 2VV7A 5HDCA 2JN7A 2JHEA 3PYPA 4NXGA 5AVFA 4LPZA 2P7JA 3PHYA 1OTBA 3UE6A 5IU1A 4HNBA 5HZHA 2Z6CA 3F1OB 3F1NB 1S67L 4WN5A 2QJ7A 4KUOA 3LIDA 2BASA 4WUJA 5G4ZA 3UB9A 4EETB 3VE3A 4R70A 3RH8B 2PD8A 3NHQA 4I5SA 1KOUA 4XT2B 3MFXA 4HP4A 5DJTA 1G28A 2D01A 2HV1A 1T18A 2VEAA 1Y28A 3B33A 3F1PB 1S1YA 3OLOA 1DP9A 1TS7A 4HJ4A 4XT2A 4EEUA 5A8BA 3UB6A 3H7WB 4HQAA 4NXBA 3VOLA 2PYPA 1BYWA 2PYRA 2QKPA 1JNUA
chains in the Genus database with same CATH superfamily
4Y3IA 5CTMA 4AFIA 2G2WA 1T19A 3T4LA 3UDIA 1J3WA 4B4XA 2GJ3A 4KQDA 3LIBA 1BSGA 3SS4A 4B93A 2PHYA 3H82B 1ZTUA 3FPWA 3HJIA 4PPRA 2Z6DA 4FOFA 5EOEA 1JWVA 5TR7A 3EEHA 4PMAA 1YM1A 2GX5A 1G68A 3H7WA 1DJAA 1OTAA 4IHQA 2Y2LA 4YINA 2PU4A 4Q0HA 4M3KA 4HY8A 3UB5P 5KZHA 5EM0A 2H28A 4O01A 4JGRA 5G18A 2ACGA 2B5RA 1XKZA 3CHWP 4WZ5C 5G4YA 3D4FA 4MN5A 3NY4A 3F1PA 2ZQ8A 4YFMA 1ES2A 5HWWA 2WGVA 1E4DA 2V1AA 4OKPA 2BG1A 3NDGA 1XJ3A 4F94A 1UWNX 3FKVA 2EX2A 2VJWA 4E04A 4OOLA 2VGLM 4E3KA 5FQ9A 5KSCA 4ESPA 5HZHA 2VGKA 3W4OA 4KUOA 1EROA 4DN0A 3BYDA 5A8BA 4L0LA 2A2LA 4Y5FA 4CJNA 1CEFA 3VV4A 2ZOIA 3Q7VA 3H82A 4EBNA 3UE0A 3VMAA 1YLYA 3IH9A 2X01A 4ARZB 4BD0A 3MQOA 5FAPA 4KZAA 1L0EA 4S2OA 2M7VA 3SH9A 5EOOA 3MSHA 3N6IA 5F69A 4X55A 4K91A 2JE5A 2I72A 3O3VA 3B42A 5EVIB 4XUZA 3LI9A 3IH8A 5L8MA 1G5UA 2W1TA 1T1AA 3VP0A 4ZTKA 5FDHA 4GDBA 3T1XA 3LUQA 3BEBA 4I38A 5CHJA 3IXDA 1HVBA 2I9VA 1ES5A 4Q8IA 2EX9A 1GSWA 3DAVA 2GNXA 4QY5A 3UDFA 5EPHA 1FR6A 2Q0OA 4E3MA 1TDGA 4JGPA 1XJ4A 2WAEA 5F1FA 2ZMAA 3T12B 5DKLA 3SW1A 4E6WA 4S2JA 3KX0X 3BFCA 3CI6A 3LGOA 5FI2A 3V3RA 3DTIA 1YT4A 5DF7A 5E2EA 3TW8A 1GHPA 4QPRA 3P01A 3PHYA 1KE4A 4HNBA 4EWFA 4RX3A 3Q7VB 4UEYA 1A0KA 4KZ5A 1I5QA 3TSGA 1IFQA 5DF8A 4GOGA 4HJ4A 1JWPA 5M18A 2YKFA 3QNCA 4X25A 2XH9A 3NC8A 3LIEA 4KQOA 4NETA 3CJMA 3IWOA 4EQ1A 2WAFA 3JYIA 1GSXA 5K5BA 2Y4AA 3SS5A 2X02A 2V0UA 5DTTA 2VGJA 1KE3A 4HP9A 5GHYA 5L09A 3SZTA 3B3XA 5FASA 3EQVA 4MLLA 2E8IA 3HREA 5EV0A 1PZOA 1U60A 3F1OA 3VP2A 4O0PA 4OPZA 4IVKA 2XA7M 2BLSA 5DTSA 3MJQA 2KDKA 1KVLA 1HLUP 2R78A 2C6WB 4WLAA 4EBLA 4KZ9A 3WS5A 4JPMA 4PM6A 4ID4A 1XJ2A 1WYCA 4OH0A 1ES4A 5CX7A 3S7PA 4P6BA 5IU1A 2HPBA 2R9XA 2O9AA 3KO6A 1VM1A 4JBFA 5HAPA 5FI7A 4JF6A 3TOIA 3GRJA 1LHYA 4UAAA 4I3IA 4KZ4A 1Q2PA 3LEQA 1VHMA 1F98A 4LV2A 2JCHA 1V9YA 3BQAA 5GLAA 3UN7A 3JVVA 2V9AA 1SKFA 3BLMA 5CEDA 4GD8A 4B4ZA 1RP5A 1NRJA 4BBUA 4JXSA 4E3NA 4NKPA 3LICA 2J3TC 2EXAA 4BL3A 1ZG6A 4EU0A 4G3KA 2Y2KA 4CQHA 4R3BA 2PU2A 4YNRA 1TEMA 3C5AA 4WMCA 3SH7A 3LI8A 4X1MA 3K3CA 1NRFA 2WUQA 3MZEA 4GS9A 4HI4A 3Q82A 3HLFA 4ARZA 5DFXA 3KSGA 1KDSA 1PRQA 1LLBA 1Y4OA 2ZC4B 1ONGA 3P7NA 3T4TA 1UGUA 3PBTA 1YSPA 3S7OA 2XSSA 4JXGA 4H6JA 4FTXA 4EESA 4MN6A 1PI5A 1ODVA 1SCWA 5KMWA 1ESUA 4OLDA 4QHCA 1ESIA 2HJ9C 4K08A 3GR2A 4EEPA 5BOHA 3G34A 4NEED 1RGYA 1J9MA 1HZOA 4YOFA 2P7JA 4LENA 1C3BA 3LIDA 1AWIA 4WUJA 1MC0A 3O87A 2O9CA 3HBRA 3RXXA 1YLWA 1CQAA 4CLCA 1PIOA 4R4RA 1PI4A 1JNUA 2V0WA 3BW6A 4WL9A 4XT2A 1MKMA 4LFUA 3ZQ5A 2ZM2A 3UB6A 3LY4A 2ZD8A 3F1NA 3G32A 5F68A 2JKTM 3LIAA 3G6OA 3MMHA 3FPVA 3NOTC 1CF0A 5IT5A 3V50A 5IHVA 5FQKA 1ZKJA 1D06A 1FCNA 3A0SA 3W8KA 1XFNA 1S1ZA 4RQ9A 3PAGA 1S6RA 2Y2PA 3ZCZA 4H6JB 2H0TA 3KYEA 4GCZA 3IHAA 1LSVA 2ZC6B 1W8QA 2MJ6A 3G2ZA 3L7HA 4JGOA 4PHTA 4UQIS 2QMIA 4NK3A 3HVFA 1OTIA 2PRFA 3ICYA 4FH2A 5DVAA 1NZOA 5TGFA 5MC7A 2Y2QA 3CMZA 4Y17A 3VSLA 5FA7A 1VETA 1NZUA 3BFDA 4LRXC 4OPRA 4UQIM 1K55C 5FI6A 3SH8A 1T1BA 3QP6A 4ZRRA 4EXOA 3OPPA 2W1RA 4PAUA 2Z6CA 3F1OB 4H8RA 3W4PA 5EE8A 3EGXC 4S2NA 3ZFZA 3OBFA 3M2JA 4XT2B 3T4OA 2V20A 3L9KA 3VP1A 5FQIA 4EEUA 1PWCA 1BLPA 3MZFA 3W4QA 1CK3A 2FFFB 2IWBA 4MBHA 2Y2NA 2WGWA 1SZVA 5HSQA 5EVIA 5E43A 2Y2GA 1AXBA 2O9BA 1BT5A 4I39A 2VX8A 1ZC2A 3EWKA 5TBMA 2XLNA 4WEJA 5CERA 5J8XA 2ZLYA 2A49A 1MWUA 5HD5A 5DFYA 3FKWA 3OPRA 5EVEA 5CGXA 3C8CA 2OAQ1 1YLJA 4DXBA 1IEMA 4UA6A 1S0WA 4JXWA 3T1RA 2XFTA 4EUVA 1K54C 5L07A 3A0VA 4E3IA 2E8JA 1NWZA 4HBUA 4KZ8A 3BFFA 4KQQA 1I2WA 3T1QB 5DJUA 5KIZA 3WRTA 4R0QA 1XP4A 4DJ3A 4RVAA 2OWHA 5HDDA 3IBRA 2PR6A 1YMSA 3FC7A 3CITA 2HP9A 3CAXA 3NBLA 1WE4A 3PYPA 4LPZA 2V8CA 2UWXA 2BASA 4OQHA 3OPHA 4R70A 2GZAA 2PD8A 2WZXA 5DJTA 5DTKA 3N8LA 1IKGA 3F1PB 3E2LA 3CZDA 3VOLA 2G2UA 1E3UA 3WS2A 4MBFA 2J80A 2RCXA 1XA7A 3MR0A 3PBOA 3VP3A 5J7EA 3LIFA 4S2LA 4I3JA 4L9FA 1OTDA 2ZC7A 2PR5A 3V67A 3DWZA 3BFEA 3T1SA 4OPYA 4EV4A 3PR6A 3C7VA 4L9GA 2PAVP 5JYOA 3EOIA 4BL2A 5J3WA 5EVID 3N8SA 2ZC5B 4KG5A 4IUHA 5HAIA 4P87A 2H10A 3K2NA 3Q81A 1KDWA 4M4XA 1L0DA 2K31A 4WF0A 3A3EA 5AJGA 2WZZA 1P97A 4OQ0A 5FSRA 3IX4A 4ETXA 1MWRA 2OLUA 1JVJA 3T4JA 2V1BA 4E3OA 1D1JA 3BLSA 3FV7A 3LO7A 4BENA 4KZ7A 3RJUA 4OPQA 1DP8A 2XDMA 1YLTA 1S67L 2DCFA 1PZPA 2Q9NA 3LFVA 3MQ0A 3NHQA 2EX8A 3MFXA 2AVXA 3OLOA 2VEAA 3B33A 2ZM0A 4D60A 3IWIA 2G7UA 5HL1A 4P6ZS 2P08A 3NULA 4WYYA 3MBZA 3FYZA 1PNEA 1W5DA 4BBTA 1S4SA 4HJ6A 5GHZA 3BFGA 1K56D 1FILA 2W3FA 4S2NC 1PWGA 5F83A 1FQGA 2CC1A 1CEGA 1IYPA 2HJEA 3FWLA 3IF6A 4WZ4A 2WGIA 1SKOA 3ZG7B 5GLDA 1L0GA 3G2YA 1S4RA 4JF4A 3ULFA 1FSWA 1XX2A 3A3FA 3IT9A 1BLSA 2VLGA 4D2OA 2C5WB 5HWTA 2HDUA 3DTKA 4GNUA 3JPUA 1M6KA 1BZAA 3O88A 3VP4A 4GN2A 5AQ7A 4O7DA 2NUPC 3MQQA 4B9OA 2A24A 2Y2HA 1GA0A 4E3JA 1EWZA 3AGEA 2WKRA 4DMZA 2W0NA 1FCOA 2Y2OA 3A3IA 3HLEA 5EM1A 3TG9A 4PKYA 3K3DA 1DY6A 1FR1A 3P09A 1XJ6A 4FCFA 4LV0A 2VV7A 5AVFA 3ITBA 1I2SA 1FOFA 3DTMA 5FL3A 1H5XA 4B88A 1LI0A 5F1GA 2B95A 1OMEA 1SHVA 1T18A 1DJCA 3R7WB 3MS6A 4NXBA 5CRFA 2PYRA 1GHIA 3RFBA 3IF6B 1SKOB 3PBRA 2Z2MB 1K54A 2VV8A 3G35A 3MXSA 2D02A 2UV0E 3ZG8B 1LL8A 2WKEA 3ITAA 1L3LA 3I7JA 4PKYG 3WS4A 1KGGA 1ERQA 2BTFP 1TS0A 2ZC3B 4EUZA 4S2MA 1EW0A 3GQZA 2ZQ7A 1BUEA 5EFWA 1K6RA 3KSHA 4RYEA 1PYYA 1IELA 3FG8A 1ONHA 3HJKA 5CXWA 3Q7ZA 5M1AA 2WKHA 1YPRA 3HL9A 4KZBA 2HP6A 2PD7A 3U4LP 5I94A 3BRMA 3ZG5A 5FAQA 2J3TD 3UY6A 1MXOA 4II7A 4A5RA 2JKTI 5HDSA 3S22A 2WKQA 5AVEA 4JKTA 4WZ5A 3V5MA 1D7EA 2WKPA 2PDRA 4LRZE 3AGDA 2OSUA 3N4IA 3OCNA 4QY6A 1OJGA 2VZWA 3WRZA 5DKKA 3HLBA 1TDLA 1OPXA 4HH2A 5CTNA 1SDEA 3MXRA 4GS9B 2W3EA 1BTLA 1O7EA 2DMWA 5HAQA 4R23A 3MKEA 4OOYA 1ZHHB 3UB9A 4X6TA 3OC2A 5FDSA 2HDRA 5GLCA 2KLIA 2WGWB 3MKFA 5U47A 2WK0A 2XROA 4ZBEA 1G6OA 3CWFA 3Q07A 5TBMB 1RGZA 3VE4A 4JLFA 4QWOA 1LSWA 4LV1A 3ZYTA 2L4RA 1YMXA 5EVIC 5HWVA 4X53A 2PBDP 4F3LA 5F6AA 3KSFA 2XQZA 4CLCB 4CLCE 2XD5A 2P9VB 3PBQA 1L0FA 4UA7A 3T4QA 3HLWA 3M6BA 3PXPA 3BM6A 4U0XA 1K55A 4RA7A 3A3DA 4BD1A 5GLBA 1X0OA 3NOUC 2RL3A 3BJNA 1W8YA 4N92A 1W79A 3NOPC 4EW7A 1IKIA 1Y54A 4PM8A 1N9OA 2ZL1B 5M19A 3V39A 2M1CA 1YQSA 5L10A 3TE8A 4HH3A 1HD8A 3ZGAB 5HDCA 4Y0TA 4NXGA 3GTCA 3GMWA 1OTBA 3ZDJA 4OP5A 4WN5A 4ZJ3A 3PTEA 5HL6A 3VE3A 2D01A 2EFUA 3T4SA 3LR0A 3QNBA 2NUTC 2PYPA 2XRNA 4PM7A 4R1GA 4HIAA 1RCJA 4KQRA 4F3LB 2JC7A 3LCEA 4R3AA 4E3LA 2XD1A 4IBRA 3A0RA 4GLQA 3RTYA 3E4QA 4S2KA 5F5YA 3MFDA 3LR4A 5FQJA 4Y13A 3LYXA 4P0MA 4CLCC 2P04A 1PW1A 1BLHA 4GZBA 1S66L 2PBYA 1XFQA 1MBLA 2ZBBA 3NECA 4MDZA 4BMWA 3MZDA 5L2FA 3NCKA 3BQ8A 4MBKA 5HARA 1F2KA 2EXBA 2W3HA 2QJ5A 1MWTA 4WM9A 2DRWA 2ZQAA 3HLCA 2QWSA 4G3WA 1CJFA 3UB8A 1IOUA 4N1HA 4X56A 5KSHA 1NYYA 4IVIA 1YLZA 3GVBA 3C30A 4DKIA 4MN7A 5FAOA 2KOIA 1MZUA 4DF6A 3IHBA 2EWVA 3MF0A 1IYQA 3IXGA 5E2HA 1YSQA 3LEZA 4GW9A 3OPLA 4QJGA 2J9PA 1F9IA 3D72A 3HCYA 4WMCD 4ZJ2A 4OQIA 3TRCA 4P6ZM 5E2GA 3OZHA 4OONA 3UO9A 2Y2JA 3E98A 2LB9A 4HP4A 1NXYA 1TS7A 4HQAA 4N1XA 5AQ9A 3CUEC 2OAP1 2QKPA 2VV6A 4NXFA 4IEDA 2W27A 1DP6A 1LSXA 3H9WA 1FCMA 1VB6A 1LL9A 4KUKA 3UNWA 4OLGA 1ACFA 4ME4A 4DXCA 3O5YA 1XPBA 3WS1A 4JF5A 2JKFA 1GHMA 1OT9A 2V2FF 2Z2LB 1IYOA 2H0YA 2XR0A 2HF6A 4DE3A 1WA9A 2Q9MA 1L2SA 2ZMFA 3UE1A 5JYPA 1ERMA 4LCMA 2L1MA 2A24B 3OCLA 2R9WA 1FIKA 2LB5A 2P74A 4UHUA 3D3OA 3WWXA 3TJZC 4BBVA 4O8GA 4GDNA 4Z9QA 3E4OA 3S4XA 3PAEA 4N9LA 2EX6A 4R38A 1K0KA 4Y15A 2M7UA 1LI9A 2P9VA 3VFFA 5F82A 2INWA 3IX8A 3UPNA 3CG5A 2QYBA 4LGWA 3M6HA 4IJGA 1P9RA 3R7WA 2QPNA 2JN7A 3R4KA 2WADA 1N9BA 4XUXA 3PBSA 1ALQA 3JVUA 4Y2FA 3IF6C 2ZQDA 5G4ZA 1H0MA 4FUWA 2HV1A 3Q1FA 4DE0A 3ZG0A 1MKIA 4HEFA 5HX9A 1LL5A 5DF9A 4BWIA 2Y91A 3BWLA 3P98A 3N7WA 3NI9A 5CHMA 4ZJ1A 4C75A 3UE3A 3D9YA 1N9LA 5A90A 4KG2A 1JTDA 5EUAA 5FEFA 1N9NA 4U0TA 3BY8A 1YKDA 4GHIA 4JGQA 4S2PA 1GSVA 3T50A 5CEBA 2Y8HA 5FQMA 2KX6A 3UPOA 1K38A 2XK1A 5J4EA 2B18A 2B02A 4LV3A 1UWPX 2O0YA 4ZAMA 1M40A 3G4PA 4OP8A 4HJ3A 4FH4A 3KYQA 3U2AA 1P9WA 3GSGA 4ZDXA 4QB8A 3G31A 1KGFA 1EI5A 4YWZA 4X1LA 5IS1A 3IXBA 3EGDC 4X68A 5E2FA 1W7FA 2ZQ9A 4R3JA 1V9ZA 3BY9A 2K2NA 3DWKA 2XFSA 3C38A 3N8RA 1OTEA 3LY3A 3IS2A 1QMEA 3CPTB 4BJPA 3DBAA 2HGVA 3SS3A 4HESA 1H8ZA 1F5MA 2J8YA 4DDYA 2Y79A 5HPFA 1TF1A 2EWWA 2ZM8A 1H8YA 3DTEA 3EEAA 4OQGA 4E6XA 4EETB 1Z09A 1N4OA 2Y2IA 5EVLA 1YLPA 1DJBA 1KOUA 3QP4A 4S2IA 2ZQCA 4ETZA 1DP9A 3BECA 5CGWA 1VQQA 1BYWA 1K56A 2Y2MA 3V3SA 4FD8A 4GHIB 4JXVA 1GA9A 1PFLA 4IBXA 2JBFA 2OWJA 1NJ4A 1PW8A 3C4OA 3IXHA 4U3TA 3IF5A 4G3VA 3S7QA 4MCWA 1BLCA 3UMDA 2WYXA 1NLZA 1TVFA 4R4SA 5TFQA 2HZ5A 3ZG9B 3PBNA 2K7SA 1TD5A 3ZHHA 2FH5A 1VEUB 1XA1A 1GCEA 3DW0A 2V8FA 1CI8A 3C4PA 2JKRI 3KYZA 4WBGA 4Y0UA 1Q2QA 4HHDA 5CHUA 1MWSA 3O86A 2ZL1A 4GB7A 4DE1A 2W1TB 1K6SA 4QU3A 1G6AA 3LR3A 2IA2A 3IS2B 1PWDA 2FZ0A 4Q0JA 3S7NA 3MXQA 2ZJ9A 3GDIA 1DRMA 1H3QA 1STZA 3CLOA 2ZMVA 1OJ5A 2J7VA 4Y0OA 1IYSA 3W2ZA 3ZVTA 3GV9A 4DJ2A 1W63M 5I5LA 1KVMA 2W3DA 4LCLA 1O07A 3FZCA 5AQBA 4DE2A 5FEGA 4OVDA 1Z6FA 3UE6A 3RXWA 1SDNA 5AQAA 1K57C 1QMFA 4RX2A 5A91A 4K0XA 4WELA 4UA9A 1ZG4A 5GL9A 3H7WB 2WKIA 1TS6A 4Y7PA 2JKGA 4KZ6A 3GECA 1KGEA 4MMNA 2VKSA 5CGSA 1XGIA 3QP1A 4KENB 5A93A 3NIAA 4EBPA 2OV5A 3E4PA 1VEUA 5HW3A 1P0ZA 3S1YA 4DDSA 2VGLS 4C6YA 5HD3A 4LRYC 2HDSA 4EERA 3ZVWA 5LBRA 3NJAA 1XXMA 1CI9A 4HBTA 3IX3A 2OOLA 2O99A 2XF3A 5A92A 2JKRM 2L0WA 1NLYA 4L9EA 2W3GA 3QP8A 3UPPA 1MY8A 2OLVA 3ZNTA 1YAXA 4KZ3A 2EFXA 3UDXA 4QD4A 1ES3A 3VOYA 3OOVA 3HUMA 3IBJA 1TS8A 3KSIA 3QHYA 3E0YA 1H8MA 3G30A 2Y59A 1JWZA 1K25A 2JHEA 4EQIA 4GD6A 4K0WA 4XXRA 4Z1WA 4WEKA 4PM9A 3F1NB 4MEZA 5TJJA 3ISGA 3AGFA 1FSYA 2XEPA 3HLDA 3RH8B 4I5SA 3IWQA 5C5KA 1Y28A 1S1YA 3M2KA 3NDEA 4CPKA 4C3QA 1NY0A 3CUEA 3EQUA 3QP2A 4P85A 2H5SA 1K4EA 4I3AA 3CPTA 1LT0A 1JTGA 2YKHA 3T4KA 2ZOHA 3HLGA 2FFYA 3IQAA 4DRTA 4IUKA 3ZNYA 2VK3A 3LR5A 3B47A 4BLMA 4BQMA 2HP5A 2HDQA 1VETB 3E2KA 4FSFA 2GDNA 4CLCD 2EA9A 2DNSA 2QHKA 1XGJA 4GKUA 1K4FA 1KE0A 2IWCA 2A3UA 1BULA 1MPLA 3C7UA 4NXEA 3A3JA 2IWDA 1NYMA 3VOZA 5D3OA 3UB7A 4PM5A 4MNRA 2VA0A 1T1CA 2J3WA 4NG2A 1K57A 1W63Q 4Q0IA 3QP5A 4X69A 5GHXA 3C2WA 2QZ6A 2X71A 4OOMA 5HFOA 5CECA 2CMNA 4GJ4A 1OT6A 4KG6A 4LLOB 5FATA 4R6LA 3HUOA 4HOIA 3WS0A 2J9OA 5HPIA 2V1ZA 3VSKA 2Y55A 3VFHA 4N9KA 5FQQA 2QJ7A 1E3UD 2XGNA 3SOIA 5EECA 1E25A 1G28A 3UMEA 3HUNA 2PT7A 1HTZA 2XA7S 1WYBA
chains in the Genus database with same CATH topology
3PBRA 4Y3IA 3BWLA 2V0WA 3BW6A 2VV8A 4AFIA 4WL9A 1T19A 2D02A 4XT2A 3T4LA 1MKMA 3UE3A 1LL8A 1N9LA 2GJ3A 3ZQ5A 4PKYG 4KQDA 3LIBA 1N9NA 1TS0A 3BY8A 1YKDA 4B93A 2PHYA 3UB6A 3H82B 4GHIA 1EW0A 4JGQA 3F1NA 1ZTUA 3FPWA 3HJIA 5F68A 2Z6DA 1GSVA 2JKTM 4FOFA 3LIAA 5EFWA 3G6OA 3T50A 3MMHA 3FPVA 3KSHA 3NOTC 3EEHA 2Y8HA 2GX5A 5IT5A 3FG8A 3H7WA 2KX6A 3HJKA 5J4EA 2B18A 2B02A 1OTAA 4IHQA 1UWPX 2O0YA 1D06A 3A0SA 1XFNA 4Q0HA 1S1ZA 4RQ9A 4HY8A 2PD7A 4HJ3A 2J3TD 2H28A 3U2AA 3KYQA 1P9WA 4O01A 4H6JB 4JGRA 4II7A 2JKTI 4GCZA 5HDSA 1LSVA 2MJ6A 4JGOA 2WKQA 5AVEA 4PHTA 4UQIS 4YWZA 5G4YA 5IS1A 4MN5A 3EGDC 1OTIA 3F1PA 3ICYA 1V9ZA 3BY9A 5HWWA 1D7EA 2K2NA 2WKPA 5MC7A 2PDRA 2V1AA 3C38A 4LRZE 1OTEA 3OCNA 4LRXC 4UQIM 1XJ3A 1OJGA 2VZWA 3IS2A 5DKKA 1UWNX 4BJPA 3DBAA 2HGVA 1OPXA 1T1BA 4HH2A 4GS9B 1F5MA 2VJWA 4ZRRA 4E04A 4OOLA 4EXOA 2W3EA 2VGLM 2DMWA 2W1RA 4PAUA 5HZHA 2Z6CA 3F1OB 2Y79A 5HPFA 1TF1A 4KUOA 1ZHHB 2EWWA 3EEAA 3EGXC 3UB9A 4EETB 3OC2A 3OBFA 1KOUA 4XT2B 3T4OA 4DN0A 2KLIA 4ETZA 1DP9A 5A8BA 4L0LA 2A2LA 4Y5FA 4EEUA 1BYWA 3VV4A 2XROA 2ZOIA 3H82A 4GHIB 1G6OA 3CWFA 5TBMB 3VE4A 2OWJA 1LSWA 4ARZB 5HSQA 3ZYTA 3MQOA 2L4RA 2O9BA 4G3VA 3S7QA 5HWVA 4MCWA 4I39A 2VX8A 3UMDA 3EWKA 2M7VA 5TBMA 4F3LA 1NLZA 4WEJA 5F6AA 3PBNA 2K7SA 5F69A 1TD5A 3KSFA 2FH5A 3B42A 4CLCB 4CLCE 3PBQA 3LI9A 5HD5A 5DFYA 5L8MA 3T4QA 2W1TA 1T1AA 3C8CA 2OAQ1 3PXPA 3LUQA 4I38A 3KYZA 2JKRI 4HHDA 4EUVA 2I9VA 1X0OA 3NOUC 3BJNA 1GSWA 2W1TB 3A0VA 2GNXA 1NWZA 3NOPC 4EW7A 3LR3A 2IA2A 3IS2B 2FZ0A 4Q0JA 5DJUA 5KIZA 4JGPA 3S7NA 3MXQA 1XJ4A 3GDIA 1H3QA 1DRMA 1N9OA 4DJ3A 1STZA 3CLOA 2ZMVA 5DKLA 3SW1A 2M1CA 2OWHA 1OJ5A 5HDDA 3IBRA 3W2ZA 3TE8A 2PR6A 3KX0X 4DJ2A 4HH3A 1W63M 3CI6A 3FC7A 5I5LA 3CITA 3CAXA 2W3DA 5HDCA 3TW8A 3PYPA 4NXGA 4QPRA 4LPZA 3P01A 3PHYA 1OTBA 3UE6A 4HNBA 4WN5A 4UEYA 2BASA 5HL6A 3VE3A 4R70A 2GZAA 2PD8A 4WELA 5DJTA 1IFQA 2D01A 3T4SA 3F1PB 4HJ4A 3LR0A 3VOLA 3H7WB 2NUTC 2PYPA 2XRNA 2J80A 4HIAA 1TS6A 2YKFA 3GECA 4MMNA 2VKSA 4F3LB 4R3AA 3A0RA 3LIEA 4GLQA 4KQOA 3MR0A 3RTYA 3PBOA 3E4QA 4EQ1A 5F5YA 3E4PA 3LR4A 5J7EA 1P0ZA 3LIFA 4I3JA 3LYXA 4CLCC 2VGLS 1OTDA 2P04A 4L9FA 1GSXA 5HD3A 5K5BA 2PR5A 3V67A 1S66L 4LRYC 2V0UA 1XFQA 4EERA 3PR6A 5LBRA 3NJAA 4L9GA 2ZBBA 4HP9A 4MDZA 4BMWA 3EOIA 3EQVA 5J3WA 3BQ8A 2OOLA 2O99A 2W3HA 2QJ5A 4IUHA 2JKRM 3K2NA 2L0WA 1NLYA 4L9EA 4M4XA 2K31A 2W3GA 2QWSA 3F1OA 4G3WA 4WF0A 3UB8A 1IOUA 5KSHA 4O0PA 5AJGA 1P97A 3C30A 2XA7M 4MN7A 1YAXA 3MJQA 4ETXA 2KDKA 2KOIA 1MZUA 2R78A 3OOVA 3T4JA 2EWVA 3MF0A 2V1BA 4WLAA 3IBJA 1YSQA 1TS8A 4GW9A 3KSIA 3E0YA 1XJ2A 1H8MA 1F9IA 3D72A 3HCYA 1DP8A 5CX7A 3TRCA 3S7PA 4P6ZM 2JHEA 5IU1A 4Z1WA 4WEKA 3F1NB 1S67L 2O9AA 3E98A 2LB9A 5TJJA 3KO6A 3LFVA 3RH8B 3MQ0A 3NHQA 4I5SA 3MFXA 4HP4A 3OLOA 2VEAA 1Y28A 3B33A 5C5KA 1S1YA 1TS7A 2G7UA 4HQAA 4P6ZS 3CUEC 2P08A 2OAP1 2QKPA 2VV6A 3CUEA 3EQUA 4NXFA 4I3IA 4BBTA 1S4SA 2W27A 1DP6A 1LSXA 3H9WA 4HJ6A 4I3AA 1VB6A 1LT0A 2YKHA 3T4KA 1VHMA 1F98A 2ZOHA 2W3FA 4KUKA 1V9YA 3BQAA 2HJEA 3JVVA 2V9AA 4IUKA 4ME4A 1NRJA 1S4RA 3ULFA 4BBUA 3O5YA 3LR5A 3B47A 4NKPA 3LICA 2J3TC 2VLGA 1OT9A 2HF6A 4FSFA 1WA9A 4CLCD 2EA9A 4EU0A 2QHKA 4G3KA 5HWTA 4CQHA 4YNRA 3LI8A 2ZMFA 3K3CA 4GS9A 2L1MA 4HI4A 2A24B 4ARZA 3OCLA 5DFXA 2LB5A 3KSGA 4NXEA 3D3OA 2NUPC 3P7NA 3TJZC 4BBVA 4O8GA 3UB7A 3T4TA 1UGUA 3MQQA 3PBTA 4B9OA 3E4OA 1YSPA 1T1CA 2VA0A 2A24A 2J3WA 2XSSA 3S7OA 4R38A 4H6JA 2M7UA 2WKRA 4DMZA 2W0NA 4EESA 1W63Q 4Q0IA 4MN6A 3C2WA 4PKYA 1ODVA 4OOMA 3K3DA 2CMNA 4GJ4A 2INWA 1XJ6A 1OT6A 2QYBA 4IJGA 2HJ9C 4K08A 4LLOB 4EEPA 1P9RA 4R6LA 3R7WA 4NEED 4HOIA 2VV7A 2JN7A 3R4KA 5AVFA 4YOFA 2P7JA 3PBSA 3JVUA 4Y2FA 5HPIA 5FL3A 2QJ7A 3LIDA 5G4ZA 4WUJA 1MC0A 2O9CA 1G28A 3UMEA 2HV1A 1T18A 3R7WB 2PT7A 2XA7S 4NXBA 4CLCA 2PYRA 5DF9A 3RFBA 1JNUA 4BWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J80 A;  2ZOI A;  4HIA A;  3H82 A;  3BWL A;  2V0W A;  1TS6 A;  2YKF A;  4GHI B;  4I3I A;  2VV8 A;  3CWF A;  4NXF A;  3GEC A;  4WL9 A;  4BBT A;  1S4S A;  5TBM B;  2W27 A;  4F3L B;  1DP6 A;  1T19 A;  4R3A A;  1LSX A;  2D02 A;  3H9W A;  4HJ6 A;  4I3A A;  3A0R A;  1VB6 A;  1LT0 A;  2OWJ A;  3LIE A;  1LL8 A;  3MR0 A;  2YKH A;  1LSW A;  3RTY A;  1F98 A;  2ZOH A;  1N9L A;  2GJ3 A;  3ZQ5 A;  4PKY G;  5HWV A;  5HSQ A;  4KUK A;  4KQD A;  3E4Q A;  3MQO A;  4EQ1 A;  3LIB A;  1V9Y A;  2L4R A;  5F5Y A;  3E4P A;  1N9N A;  1TS0 A;  3BY8 A;  5J7E A;  2PHY A;  2V9A A;  1P0Z A;  3H82 B;  3LIF A;  4GHI A;  3LYX A;  1EW0 A;  4I3J A;  4I39 A;  3F1N A;  1OTD A;  4JGQ A;  4L9F A;  1GSX A;  3EWK A;  3HJI A;  5F68 A;  5HD3 A;  3UMD A;  5TBM A;  2PR5 A;  4F3L A;  1S4R A;  3ULF A;  4BBU A;  1S66 L;  2Z6D A;  4LRY C;  1GSV A;  2V0U A;  5F6A A;  3T50 A;  1XFQ A;  2K7S A;  3G6O A;  3LIA A;  5EFW A;  5F69 A;  4EER A;  3NJA A;  3EEH A;  3LIC A;  3NOT C;  2VV6 A;  4L9G A;  2ZBB A;  4HP9 A;  2VLG A;  3FG8 A;  1OT9 A;  3H7W A;  2KX6 A;  3HJK A;  5J4E A;  5J3W A;  3LI9 A;  5HD5 A;  2B02 A;  1WA9 A;  1OTA A;  2EA9 A;  2OOL A;  1T1A A;  2QHK A;  3C8C A;  5HWT A;  1UWP X;  1D06 A;  3A0S A;  1XFN A;  2QJ5 A;  3LI8 A;  1S1Z A;  4RQ9 A;  3K3C A;  3LUQ A;  4HY8 A;  4I38 A;  4GS9 A;  2L1M A;  2L0W A;  2A24 B;  2PD7 A;  4HI4 A;  4L9E A;  4HJ3 A;  4M4X A;  2H28 A;  4HHD A;  4H6J B;  4JGR A;  2I9V A;  2QWS A;  1X0O A;  3NOU C;  4GCZ A;  3F1O A;  5HDS A;  4WF0 A;  4NXE A;  1GSW A;  1LSV A;  3UB8 A;  4JGO A;  3A0V A;  2WKQ A;  1NWZ A;  3NOP C;  5AVE A;  4EW7 A;  3P7N A;  1P97 A;  4BBV A;  3IS2 B;  4YWZ A;  3UB7 A;  5G4Y A;  1UGU A;  3MQQ A;  4MN5 A;  1OTI A;  5DJU A;  4B9O A;  5IS1 A;  3E4O A;  5KIZ A;  1T1C A;  3F1P A;  2A24 A;  3ICY A;  1XJ4 A;  3MXQ A;  4JGP A;  3GDI A;  3MJQ A;  3UME A;  3VE4 A;  4R38 A;  1DRM A;  1V9Z A;  2KDK A;  3BY9 A;  5HWW A;  1N9O A;  4H6J A;  4DJ3 A;  1D7E A;  3CLO A;  1MZU A;  2R78 A;  2WKR A;  2WKP A;  2W0N A;  5DKL A;  4EES A;  2M1C A;  2PDR A;  2V1A A;  3SW1 A;  2OWH A;  1OJ5 A;  4MN6 A;  2V1B A;  4LRZ E;  5HDD A;  4WLA A;  1OTE A;  3C2W A;  3IBR A;  1ODV A;  4PKY A;  2PR6 A;  3K3D A;  3KX0 X;  1TS8 A;  1OJG A;  1XJ3 A;  4LRX C;  3IS2 A;  5DKK A;  4DJ2 A;  1UWN X;  4GW9 A;  4HH3 A;  2CMN A;  2INW A;  1XJ6 A;  1XJ2 A;  3FC7 A;  5I5L A;  1F9I A;  1T1B A;  1OT6 A;  3D72 A;  4HH2 A;  4K08 A;  4LLO B;  4GS9 B;  4EEP A;  4R6L A;  4E04 A;  3CAX A;  4EXO A;  1DP8 A;  4HOI A;  2VV7 A;  5HDC A;  2JN7 A;  2JHE A;  3PYP A;  4NXG A;  5AVF A;  4LPZ A;  2P7J A;  3PHY A;  1OTB A;  3UE6 A;  5IU1 A;  4HNB A;  5HZH A;  2Z6C A;  3F1O B;  3F1N B;  1S67 L;  4WN5 A;  2QJ7 A;  4KUO A;  3LID A;  2BAS A;  4WUJ A;  5G4Z A;  3UB9 A;  4EET B;  3VE3 A;  4R70 A;  3RH8 B;  2PD8 A;  3NHQ A;  4I5S A;  1KOU A;  4XT2 B;  3MFX A;  4HP4 A;  5DJT A;  1G28 A;  2D01 A;  2HV1 A;  1T18 A;  2VEA A;  1Y28 A;  3B33 A;  3F1P B;  1S1Y A;  3OLO A;  1DP9 A;  1TS7 A;  4HJ4 A;  4XT2 A;  4EEU A;  5A8B A;  3UB6 A;  3H7W B;  4HQA A;  4NXB A;  3VOL A;  2PYP A;  1BYW A;  2PYR A;  2QKP A;  1JNU A; 
#chains in the Genus database with same CATH topology
 4Y3I A;  5CTM A;  4AFI A;  2G2W A;  1T19 A;  3T4L A;  3UDI A;  1J3W A;  4B4X A;  2GJ3 A;  4KQD A;  3LIB A;  1BSG A;  3SS4 A;  4B93 A;  2PHY A;  3H82 B;  1ZTU A;  3FPW A;  3HJI A;  4PPR A;  2Z6D A;  4FOF A;  5EOE A;  1JWV A;  5TR7 A;  3EEH A;  4PMA A;  1YM1 A;  2GX5 A;  1G68 A;  3H7W A;  1DJA A;  1OTA A;  4IHQ A;  2Y2L A;  4YIN A;  2PU4 A;  4Q0H A;  4M3K A;  4HY8 A;  3UB5 P;  5KZH A;  5EM0 A;  2H28 A;  4O01 A;  4JGR A;  5G18 A;  2ACG A;  2B5R A;  1XKZ A;  3CHW P;  4WZ5 C;  5G4Y A;  3D4F A;  4MN5 A;  3NY4 A;  3F1P A;  2ZQ8 A;  4YFM A;  1ES2 A;  5HWW A;  2WGV A;  1E4D A;  2V1A A;  4OKP A;  2BG1 A;  3NDG A;  1XJ3 A;  4F94 A;  1UWN X;  3FKV A;  2EX2 A;  2VJW A;  4E04 A;  4OOL A;  2VGL M;  4E3K A;  5FQ9 A;  5KSC A;  4ESP A;  5HZH A;  2VGK A;  3W4O A;  4KUO A;  1ERO A;  4DN0 A;  3BYD A;  5A8B A;  4L0L A;  2A2L A;  4Y5F A;  4CJN A;  1CEF A;  3VV4 A;  2ZOI A;  3Q7V A;  3H82 A;  4EBN A;  3UE0 A;  3VMA A;  1YLY A;  3IH9 A;  2X01 A;  4ARZ B;  4BD0 A;  3MQO A;  5FAP A;  4KZA A;  1L0E A;  4S2O A;  2M7V A;  3SH9 A;  5EOO A;  3MSH A;  3N6I A;  5F69 A;  4X55 A;  4K91 A;  2JE5 A;  2I72 A;  3O3V A;  3B42 A;  5EVI B;  4XUZ A;  3LI9 A;  3IH8 A;  5L8M A;  1G5U A;  2W1T A;  1T1A A;  3VP0 A;  4ZTK A;  5FDH A;  4GDB A;  3T1X A;  3LUQ A;  3BEB A;  4I38 A;  5CHJ A;  3IXD A;  1HVB A;  2I9V A;  1ES5 A;  4Q8I A;  2EX9 A;  1GSW A;  3DAV A;  2GNX A;  4QY5 A;  3UDF A;  5EPH A;  1FR6 A;  2Q0O A;  4E3M A;  1TDG A;  4JGP A;  1XJ4 A;  2WAE A;  5F1F A;  2ZMA A;  3T12 B;  5DKL A;  3SW1 A;  4E6W A;  4S2J A;  3KX0 X;  3BFC A;  3CI6 A;  3LGO A;  5FI2 A;  3V3R A;  3DTI A;  1YT4 A;  5DF7 A;  5E2E A;  3TW8 A;  1GHP A;  4QPR A;  3P01 A;  3PHY A;  1KE4 A;  4HNB A;  4EWF A;  4RX3 A;  3Q7V B;  4UEY A;  1A0K A;  4KZ5 A;  1I5Q A;  3TSG A;  1IFQ A;  5DF8 A;  4GOG A;  4HJ4 A;  1JWP A;  5M18 A;  2YKF A;  3QNC A;  4X25 A;  2XH9 A;  3NC8 A;  3LIE A;  4KQO A;  4NET A;  3CJM A;  3IWO A;  4EQ1 A;  2WAF A;  3JYI A;  1GSX A;  5K5B A;  2Y4A A;  3SS5 A;  2X02 A;  2V0U A;  5DTT A;  2VGJ A;  1KE3 A;  4HP9 A;  5GHY A;  5L09 A;  3SZT A;  3B3X A;  5FAS A;  3EQV A;  4MLL A;  2E8I A;  3HRE A;  5EV0 A;  1PZO A;  1U60 A;  3F1O A;  3VP2 A;  4O0P A;  4OPZ A;  4IVK A;  2XA7 M;  2BLS A;  5DTS A;  3MJQ A;  2KDK A;  1KVL A;  1HLU P;  2R78 A;  2C6W B;  4WLA A;  4EBL A;  4KZ9 A;  3WS5 A;  4JPM A;  4PM6 A;  4ID4 A;  1XJ2 A;  1WYC A;  4OH0 A;  1ES4 A;  5CX7 A;  3S7P A;  4P6B A;  5IU1 A;  2HPB A;  2R9X A;  2O9A A;  3KO6 A;  1VM1 A;  4JBF A;  5HAP A;  5FI7 A;  4JF6 A;  3TOI A;  3GRJ A;  1LHY A;  4UAA A;  4I3I A;  4KZ4 A;  1Q2P A;  3LEQ A;  1VHM A;  1F98 A;  4LV2 A;  2JCH A;  1V9Y A;  3BQA A;  5GLA A;  3UN7 A;  3JVV A;  2V9A A;  1SKF A;  3BLM A;  5CED A;  4GD8 A;  4B4Z A;  1RP5 A;  1NRJ A;  4BBU A;  4JXS A;  4E3N A;  4NKP A;  3LIC A;  2J3T C;  2EXA A;  4BL3 A;  1ZG6 A;  4EU0 A;  4G3K A;  2Y2K A;  4CQH A;  4R3B A;  2PU2 A;  4YNR A;  1TEM A;  3C5A A;  4WMC A;  3SH7 A;  3LI8 A;  4X1M A;  3K3C A;  1NRF A;  2WUQ A;  3MZE A;  4GS9 A;  4HI4 A;  3Q82 A;  3HLF A;  4ARZ A;  5DFX A;  3KSG A;  1KDS A;  1PRQ A;  1LLB A;  1Y4O A;  2ZC4 B;  1ONG A;  3P7N A;  3T4T A;  1UGU A;  3PBT A;  1YSP A;  3S7O A;  2XSS A;  4JXG A;  4H6J A;  4FTX A;  4EES A;  4MN6 A;  1PI5 A;  1ODV A;  1SCW A;  5KMW A;  1ESU A;  4OLD A;  4QHC A;  1ESI A;  2HJ9 C;  4K08 A;  3GR2 A;  4EEP A;  5BOH A;  3G34 A;  4NEE D;  1RGY A;  1J9M A;  1HZO A;  4YOF A;  2P7J A;  4LEN A;  1C3B A;  3LID A;  1AWI A;  4WUJ A;  1MC0 A;  3O87 A;  2O9C A;  3HBR A;  3RXX A;  1YLW A;  1CQA A;  4CLC A;  1PIO A;  4R4R A;  1PI4 A;  1JNU A;  2V0W A;  3BW6 A;  4WL9 A;  4XT2 A;  1MKM A;  4LFU A;  3ZQ5 A;  2ZM2 A;  3UB6 A;  3LY4 A;  2ZD8 A;  3F1N A;  3G32 A;  5F68 A;  2JKT M;  3LIA A;  3G6O A;  3MMH A;  3FPV A;  3NOT C;  1CF0 A;  5IT5 A;  3V50 A;  5IHV A;  5FQK A;  1ZKJ A;  1D06 A;  1FCN A;  3A0S A;  3W8K A;  1XFN A;  1S1Z A;  4RQ9 A;  3PAG A;  1S6R A;  2Y2P A;  3ZCZ A;  4H6J B;  2H0T A;  3KYE A;  4GCZ A;  3IHA A;  1LSV A;  2ZC6 B;  1W8Q A;  2MJ6 A;  3G2Z A;  3L7H A;  4JGO A;  4PHT A;  4UQI S;  2QMI A;  4NK3 A;  3HVF A;  1OTI A;  2PRF A;  3ICY A;  4FH2 A;  5DVA A;  1NZO A;  5TGF A;  5MC7 A;  2Y2Q A;  3CMZ A;  4Y17 A;  3VSL A;  5FA7 A;  1VET A;  1NZU A;  3BFD A;  4LRX C;  4OPR A;  4UQI M;  1K55 C;  5FI6 A;  3SH8 A;  1T1B A;  3QP6 A;  4ZRR A;  4EXO A;  3OPP A;  2W1R A;  4PAU A;  2Z6C A;  3F1O B;  4H8R A;  3W4P A;  5EE8 A;  3EGX C;  4S2N A;  3ZFZ A;  3OBF A;  3M2J A;  4XT2 B;  3T4O A;  2V20 A;  3L9K A;  3VP1 A;  5FQI A;  4EEU A;  1PWC A;  1BLP A;  3MZF A;  3W4Q A;  1CK3 A;  2FFF B;  2IWB A;  4MBH A;  2Y2N A;  2WGW A;  1SZV A;  5HSQ A;  5EVI A;  5E43 A;  2Y2G A;  1AXB A;  2O9B A;  1BT5 A;  4I39 A;  2VX8 A;  1ZC2 A;  3EWK A;  5TBM A;  2XLN A;  4WEJ A;  5CER A;  5J8X A;  2ZLY A;  2A49 A;  1MWU A;  5HD5 A;  5DFY A;  3FKW A;  3OPR A;  5EVE A;  5CGX A;  3C8C A;  2OAQ 1;  1YLJ A;  4DXB A;  1IEM A;  4UA6 A;  1S0W A;  4JXW A;  3T1R A;  2XFT A;  4EUV A;  1K54 C;  5L07 A;  3A0V A;  4E3I A;  2E8J A;  1NWZ A;  4HBU A;  4KZ8 A;  3BFF A;  4KQQ A;  1I2W A;  3T1Q B;  5DJU A;  5KIZ A;  3WRT A;  4R0Q A;  1XP4 A;  4DJ3 A;  4RVA A;  2OWH A;  5HDD A;  3IBR A;  2PR6 A;  1YMS A;  3FC7 A;  3CIT A;  2HP9 A;  3CAX A;  3NBL A;  1WE4 A;  3PYP A;  4LPZ A;  2V8C A;  2UWX A;  2BAS A;  4OQH A;  3OPH A;  4R70 A;  2GZA A;  2PD8 A;  2WZX A;  5DJT A;  5DTK A;  3N8L A;  1IKG A;  3F1P B;  3E2L A;  3CZD A;  3VOL A;  2G2U A;  1E3U A;  3WS2 A;  4MBF A;  2J80 A;  2RCX A;  1XA7 A;  3MR0 A;  3PBO A;  3VP3 A;  5J7E A;  3LIF A;  4S2L A;  4I3J A;  4L9F A;  1OTD A;  2ZC7 A;  2PR5 A;  3V67 A;  3DWZ A;  3BFE A;  3T1S A;  4OPY A;  4EV4 A;  3PR6 A;  3C7V A;  4L9G A;  2PAV P;  5JYO A;  3EOI A;  4BL2 A;  5J3W A;  5EVI D;  3N8S A;  2ZC5 B;  4KG5 A;  4IUH A;  5HAI A;  4P87 A;  2H10 A;  3K2N A;  3Q81 A;  1KDW A;  4M4X A;  1L0D A;  2K31 A;  4WF0 A;  3A3E A;  5AJG A;  2WZZ A;  1P97 A;  4OQ0 A;  5FSR A;  3IX4 A;  4ETX A;  1MWR A;  2OLU A;  1JVJ A;  3T4J A;  2V1B A;  4E3O A;  1D1J A;  3BLS A;  3FV7 A;  3LO7 A;  4BEN A;  4KZ7 A;  3RJU A;  4OPQ A;  1DP8 A;  2XDM A;  1YLT A;  1S67 L;  2DCF A;  1PZP A;  2Q9N A;  3LFV A;  3MQ0 A;  3NHQ A;  2EX8 A;  3MFX A;  2AVX A;  3OLO A;  2VEA A;  3B33 A;  2ZM0 A;  4D60 A;  3IWI A;  2G7U A;  5HL1 A;  4P6Z S;  2P08 A;  3NUL A;  4WYY A;  3MBZ A;  3FYZ A;  1PNE A;  1W5D A;  4BBT A;  1S4S A;  4HJ6 A;  5GHZ A;  3BFG A;  1K56 D;  1FIL A;  2W3F A;  4S2N C;  1PWG A;  5F83 A;  1FQG A;  2CC1 A;  1CEG A;  1IYP A;  2HJE A;  3FWL A;  3IF6 A;  4WZ4 A;  2WGI A;  1SKO A;  3ZG7 B;  5GLD A;  1L0G A;  3G2Y A;  1S4R A;  4JF4 A;  3ULF A;  1FSW A;  1XX2 A;  3A3F A;  3IT9 A;  1BLS A;  2VLG A;  4D2O A;  2C5W B;  5HWT A;  2HDU A;  3DTK A;  4GNU A;  3JPU A;  1M6K A;  1BZA A;  3O88 A;  3VP4 A;  4GN2 A;  5AQ7 A;  4O7D A;  2NUP C;  3MQQ A;  4B9O A;  2A24 A;  2Y2H A;  1GA0 A;  4E3J A;  1EWZ A;  3AGE A;  2WKR A;  4DMZ A;  2W0N A;  1FCO A;  2Y2O A;  3A3I A;  3HLE A;  5EM1 A;  3TG9 A;  4PKY A;  3K3D A;  1DY6 A;  1FR1 A;  3P09 A;  1XJ6 A;  4FCF A;  4LV0 A;  2VV7 A;  5AVF A;  3ITB A;  1I2S A;  1FOF A;  3DTM A;  5FL3 A;  1H5X A;  4B88 A;  1LI0 A;  5F1G A;  2B95 A;  1OME A;  1SHV A;  1T18 A;  1DJC A;  3R7W B;  3MS6 A;  4NXB A;  5CRF A;  2PYR A;  1GHI A;  3RFB A;  3IF6 B;  1SKO B;  3PBR A;  2Z2M B;  1K54 A;  2VV8 A;  3G35 A;  3MXS A;  2D02 A;  2UV0 E;  3ZG8 B;  1LL8 A;  2WKE A;  3ITA A;  1L3L A;  3I7J A;  4PKY G;  3WS4 A;  1KGG A;  1ERQ A;  2BTF P;  1TS0 A;  2ZC3 B;  4EUZ A;  4S2M A;  1EW0 A;  3GQZ A;  2ZQ7 A;  1BUE A;  5EFW A;  1K6R A;  3KSH A;  4RYE A;  1PYY A;  1IEL A;  3FG8 A;  1ONH A;  3HJK A;  5CXW A;  3Q7Z A;  5M1A A;  2WKH A;  1YPR A;  3HL9 A;  4KZB A;  2HP6 A;  2PD7 A;  3U4L P;  5I94 A;  3BRM A;  3ZG5 A;  5FAQ A;  2J3T D;  3UY6 A;  1MXO A;  4II7 A;  4A5R A;  2JKT I;  5HDS A;  3S22 A;  2WKQ A;  5AVE A;  4JKT A;  4WZ5 A;  3V5M A;  1D7E A;  2WKP A;  2PDR A;  4LRZ E;  3AGD A;  2OSU A;  3N4I A;  3OCN A;  4QY6 A;  1OJG A;  2VZW A;  3WRZ A;  5DKK A;  3HLB A;  1TDL A;  1OPX A;  4HH2 A;  5CTN A;  1SDE A;  3MXR A;  4GS9 B;  2W3E A;  1BTL A;  1O7E A;  2DMW A;  5HAQ A;  4R23 A;  3MKE A;  4OOY A;  1ZHH B;  3UB9 A;  4X6T A;  3OC2 A;  5FDS A;  2HDR A;  5GLC A;  2KLI A;  2WGW B;  3MKF A;  5U47 A;  2WK0 A;  2XRO A;  4ZBE A;  1G6O A;  3CWF A;  3Q07 A;  5TBM B;  1RGZ A;  3VE4 A;  4JLF A;  4QWO A;  1LSW A;  4LV1 A;  3ZYT A;  2L4R A;  1YMX A;  5EVI C;  5HWV A;  4X53 A;  2PBD P;  4F3L A;  5F6A A;  3KSF A;  2XQZ A;  4CLC B;  4CLC E;  2XD5 A;  2P9V B;  3PBQ A;  1L0F A;  4UA7 A;  3T4Q A;  3HLW A;  3M6B A;  3PXP A;  3BM6 A;  4U0X A;  1K55 A;  4RA7 A;  3A3D A;  4BD1 A;  5GLB A;  1X0O A;  3NOU C;  2RL3 A;  3BJN A;  1W8Y A;  4N92 A;  1W79 A;  3NOP C;  4EW7 A;  1IKI A;  1Y54 A;  4PM8 A;  1N9O A;  2ZL1 B;  5M19 A;  3V39 A;  2M1C A;  1YQS A;  5L10 A;  3TE8 A;  4HH3 A;  1HD8 A;  3ZGA B;  5HDC A;  4Y0T A;  4NXG A;  3GTC A;  3GMW A;  1OTB A;  3ZDJ A;  4OP5 A;  4WN5 A;  4ZJ3 A;  3PTE A;  5HL6 A;  3VE3 A;  2D01 A;  2EFU A;  3T4S A;  3LR0 A;  3QNB A;  2NUT C;  2PYP A;  2XRN A;  4PM7 A;  4R1G A;  4HIA A;  1RCJ A;  4KQR A;  4F3L B;  2JC7 A;  3LCE A;  4R3A A;  4E3L A;  2XD1 A;  4IBR A;  3A0R A;  4GLQ A;  3RTY A;  3E4Q A;  4S2K A;  5F5Y A;  3MFD A;  3LR4 A;  5FQJ A;  4Y13 A;  3LYX A;  4P0M A;  4CLC C;  2P04 A;  1PW1 A;  1BLH A;  4GZB A;  1S66 L;  2PBY A;  1XFQ A;  1MBL A;  2ZBB A;  3NEC A;  4MDZ A;  4BMW A;  3MZD A;  5L2F A;  3NCK A;  3BQ8 A;  4MBK A;  5HAR A;  1F2K A;  2EXB A;  2W3H A;  2QJ5 A;  1MWT A;  4WM9 A;  2DRW A;  2ZQA A;  3HLC A;  2QWS A;  4G3W A;  1CJF A;  3UB8 A;  1IOU A;  4N1H A;  4X56 A;  5KSH A;  1NYY A;  4IVI A;  1YLZ A;  3GVB A;  3C30 A;  4DKI A;  4MN7 A;  5FAO A;  2KOI A;  1MZU A;  4DF6 A;  3IHB A;  2EWV A;  3MF0 A;  1IYQ A;  3IXG A;  5E2H A;  1YSQ A;  3LEZ A;  4GW9 A;  3OPL A;  4QJG A;  2J9P A;  1F9I A;  3D72 A;  3HCY A;  4WMC D;  4ZJ2 A;  4OQI A;  3TRC A;  4P6Z M;  5E2G A;  3OZH A;  4OON A;  3UO9 A;  2Y2J A;  3E98 A;  2LB9 A;  4HP4 A;  1NXY A;  1TS7 A;  4HQA A;  4N1X A;  5AQ9 A;  3CUE C;  2OAP 1;  2QKP A;  2VV6 A;  4NXF A;  4IED A;  2W27 A;  1DP6 A;  1LSX A;  3H9W A;  1FCM A;  1VB6 A;  1LL9 A;  4KUK A;  3UNW A;  4OLG A;  1ACF A;  4ME4 A;  4DXC A;  3O5Y A;  1XPB A;  3WS1 A;  4JF5 A;  2JKF A;  1GHM A;  1OT9 A;  2V2F F;  2Z2L B;  1IYO A;  2H0Y A;  2XR0 A;  2HF6 A;  4DE3 A;  1WA9 A;  2Q9M A;  1L2S A;  2ZMF A;  3UE1 A;  5JYP A;  1ERM A;  4LCM A;  2L1M A;  2A24 B;  3OCL A;  2R9W A;  1FIK A;  2LB5 A;  2P74 A;  4UHU A;  3D3O A;  3WWX A;  3TJZ C;  4BBV A;  4O8G A;  4GDN A;  4Z9Q A;  3E4O A;  3S4X A;  3PAE A;  4N9L A;  2EX6 A;  4R38 A;  1K0K A;  4Y15 A;  2M7U A;  1LI9 A;  2P9V A;  3VFF A;  5F82 A;  2INW A;  3IX8 A;  3UPN A;  3CG5 A;  2QYB A;  4LGW A;  3M6H A;  4IJG A;  1P9R A;  3R7W A;  2QPN A;  2JN7 A;  3R4K A;  2WAD A;  1N9B A;  4XUX A;  3PBS A;  1ALQ A;  3JVU A;  4Y2F A;  3IF6 C;  2ZQD A;  5G4Z A;  1H0M A;  4FUW A;  2HV1 A;  3Q1F A;  4DE0 A;  3ZG0 A;  1MKI A;  4HEF A;  5HX9 A;  1LL5 A;  5DF9 A;  4BWI A;  2Y91 A;  3BWL A;  3P98 A;  3N7W A;  3NI9 A;  5CHM A;  4ZJ1 A;  4C75 A;  3UE3 A;  3D9Y A;  1N9L A;  5A90 A;  4KG2 A;  1JTD A;  5EUA A;  5FEF A;  1N9N A;  4U0T A;  3BY8 A;  1YKD A;  4GHI A;  4JGQ A;  4S2P A;  1GSV A;  3T50 A;  5CEB A;  2Y8H A;  5FQM A;  2KX6 A;  3UPO A;  1K38 A;  2XK1 A;  5J4E A;  2B18 A;  2B02 A;  4LV3 A;  1UWP X;  2O0Y A;  4ZAM A;  1M40 A;  3G4P A;  4OP8 A;  4HJ3 A;  4FH4 A;  3KYQ A;  3U2A A;  1P9W A;  3GSG A;  4ZDX A;  4QB8 A;  3G31 A;  1KGF A;  1EI5 A;  4YWZ A;  4X1L A;  5IS1 A;  3IXB A;  3EGD C;  4X68 A;  5E2F A;  1W7F A;  2ZQ9 A;  4R3J A;  1V9Z A;  3BY9 A;  2K2N A;  3DWK A;  2XFS A;  3C38 A;  3N8R A;  1OTE A;  3LY3 A;  3IS2 A;  1QME A;  3CPT B;  4BJP A;  3DBA A;  2HGV A;  3SS3 A;  4HES A;  1H8Z A;  1F5M A;  2J8Y A;  4DDY A;  2Y79 A;  5HPF A;  1TF1 A;  2EWW A;  2ZM8 A;  1H8Y A;  3DTE A;  3EEA A;  4OQG A;  4E6X A;  4EET B;  1Z09 A;  1N4O A;  2Y2I A;  5EVL A;  1YLP A;  1DJB A;  1KOU A;  3QP4 A;  4S2I A;  2ZQC A;  4ETZ A;  1DP9 A;  3BEC A;  5CGW A;  1VQQ A;  1BYW A;  1K56 A;  2Y2M A;  3V3S A;  4FD8 A;  4GHI B;  4JXV A;  1GA9 A;  1PFL A;  4IBX A;  2JBF A;  2OWJ A;  1NJ4 A;  1PW8 A;  3C4O A;  3IXH A;  4U3T A;  3IF5 A;  4G3V A;  3S7Q A;  4MCW A;  1BLC A;  3UMD A;  2WYX A;  1NLZ A;  1TVF A;  4R4S A;  5TFQ A;  2HZ5 A;  3ZG9 B;  3PBN A;  2K7S A;  1TD5 A;  3ZHH A;  2FH5 A;  1VEU B;  1XA1 A;  1GCE A;  3DW0 A;  2V8F A;  1CI8 A;  3C4P A;  2JKR I;  3KYZ A;  4WBG A;  4Y0U A;  1Q2Q A;  4HHD A;  5CHU A;  1MWS A;  3O86 A;  2ZL1 A;  4GB7 A;  4DE1 A;  2W1T B;  1K6S A;  4QU3 A;  1G6A A;  3LR3 A;  2IA2 A;  3IS2 B;  1PWD A;  2FZ0 A;  4Q0J A;  3S7N A;  3MXQ A;  2ZJ9 A;  3GDI A;  1DRM A;  1H3Q A;  1STZ A;  3CLO A;  2ZMV A;  1OJ5 A;  2J7V A;  4Y0O A;  1IYS A;  3W2Z A;  3ZVT A;  3GV9 A;  4DJ2 A;  1W63 M;  5I5L A;  1KVM A;  2W3D A;  4LCL A;  1O07 A;  3FZC A;  5AQB A;  4DE2 A;  5FEG A;  4OVD A;  1Z6F A;  3UE6 A;  3RXW A;  1SDN A;  5AQA A;  1K57 C;  1QMF A;  4RX2 A;  5A91 A;  4K0X A;  4WEL A;  4UA9 A;  1ZG4 A;  5GL9 A;  3H7W B;  2WKI A;  1TS6 A;  4Y7P A;  2JKG A;  4KZ6 A;  3GEC A;  1KGE A;  4MMN A;  2VKS A;  5CGS A;  1XGI A;  3QP1 A;  4KEN B;  5A93 A;  3NIA A;  4EBP A;  2OV5 A;  3E4P A;  1VEU A;  5HW3 A;  1P0Z A;  3S1Y A;  4DDS A;  2VGL S;  4C6Y A;  5HD3 A;  4LRY C;  2HDS A;  4EER A;  3ZVW A;  5LBR A;  3NJA A;  1XXM A;  1CI9 A;  4HBT A;  3IX3 A;  2OOL A;  2O99 A;  2XF3 A;  5A92 A;  2JKR M;  2L0W A;  1NLY A;  4L9E A;  2W3G A;  3QP8 A;  3UPP A;  1MY8 A;  2OLV A;  3ZNT A;  1YAX A;  4KZ3 A;  2EFX A;  3UDX A;  4QD4 A;  1ES3 A;  3VOY A;  3OOV A;  3HUM A;  3IBJ A;  1TS8 A;  3KSI A;  3QHY A;  3E0Y A;  1H8M A;  3G30 A;  2Y59 A;  1JWZ A;  1K25 A;  2JHE A;  4EQI A;  4GD6 A;  4K0W A;  4XXR A;  4Z1W A;  4WEK A;  4PM9 A;  3F1N B;  4MEZ A;  5TJJ A;  3ISG A;  3AGF A;  1FSY A;  2XEP A;  3HLD A;  3RH8 B;  4I5S A;  3IWQ A;  5C5K A;  1Y28 A;  1S1Y A;  3M2K A;  3NDE A;  4CPK A;  4C3Q A;  1NY0 A;  3CUE A;  3EQU A;  3QP2 A;  4P85 A;  2H5S A;  1K4E A;  4I3A A;  3CPT A;  1LT0 A;  1JTG A;  2YKH A;  3T4K A;  2ZOH A;  3HLG A;  2FFY A;  3IQA A;  4DRT A;  4IUK A;  3ZNY A;  2VK3 A;  3LR5 A;  3B47 A;  4BLM A;  4BQM A;  2HP5 A;  2HDQ A;  1VET B;  3E2K A;  4FSF A;  2GDN A;  4CLC D;  2EA9 A;  2DNS A;  2QHK A;  1XGJ A;  4GKU A;  1K4F A;  1KE0 A;  2IWC A;  2A3U A;  1BUL A;  1MPL A;  3C7U A;  4NXE A;  3A3J A;  2IWD A;  1NYM A;  3VOZ A;  5D3O A;  3UB7 A;  4PM5 A;  4MNR A;  2VA0 A;  1T1C A;  2J3W A;  4NG2 A;  1K57 A;  1W63 Q;  4Q0I A;  3QP5 A;  4X69 A;  5GHX A;  3C2W A;  2QZ6 A;  2X71 A;  4OOM A;  5HFO A;  5CEC A;  2CMN A;  4GJ4 A;  1OT6 A;  4KG6 A;  4LLO B;  5FAT A;  4R6L A;  3HUO A;  4HOI A;  3WS0 A;  2J9O A;  5HPI A;  2V1Z A;  3VSK A;  2Y55 A;  3VFH A;  4N9K A;  5FQQ A;  2QJ7 A;  1E3U D;  2XGN A;  3SOI A;  5EEC A;  1E25 A;  1G28 A;  3UME A;  3HUN A;  2PT7 A;  1HTZ A;  2XA7 S;  1WYB A; 
#chains in the Genus database with same CATH homology
 3PBR A;  4Y3I A;  3BWL A;  2V0W A;  3BW6 A;  2VV8 A;  4AFI A;  4WL9 A;  1T19 A;  2D02 A;  4XT2 A;  3T4L A;  1MKM A;  3UE3 A;  1LL8 A;  1N9L A;  2GJ3 A;  3ZQ5 A;  4PKY G;  4KQD A;  3LIB A;  1N9N A;  1TS0 A;  3BY8 A;  1YKD A;  4B93 A;  2PHY A;  3UB6 A;  3H82 B;  4GHI A;  1EW0 A;  4JGQ A;  3F1N A;  1ZTU A;  3FPW A;  3HJI A;  5F68 A;  2Z6D A;  1GSV A;  2JKT M;  4FOF A;  3LIA A;  5EFW A;  3G6O A;  3T50 A;  3MMH A;  3FPV A;  3KSH A;  3NOT C;  3EEH A;  2Y8H A;  2GX5 A;  5IT5 A;  3FG8 A;  3H7W A;  2KX6 A;  3HJK A;  5J4E A;  2B18 A;  2B02 A;  1OTA A;  4IHQ A;  1UWP X;  2O0Y A;  1D06 A;  3A0S A;  1XFN A;  4Q0H A;  1S1Z A;  4RQ9 A;  4HY8 A;  2PD7 A;  4HJ3 A;  2J3T D;  2H28 A;  3U2A A;  3KYQ A;  1P9W A;  4O01 A;  4H6J B;  4JGR A;  4II7 A;  2JKT I;  4GCZ A;  5HDS A;  1LSV A;  2MJ6 A;  4JGO A;  2WKQ A;  5AVE A;  4PHT A;  4UQI S;  4YWZ A;  5G4Y A;  5IS1 A;  4MN5 A;  3EGD C;  1OTI A;  3F1P A;  3ICY A;  1V9Z A;  3BY9 A;  5HWW A;  1D7E A;  2K2N A;  2WKP A;  5MC7 A;  2PDR A;  2V1A A;  3C38 A;  4LRZ E;  1OTE A;  3OCN A;  4LRX C;  4UQI M;  1XJ3 A;  1OJG A;  2VZW A;  3IS2 A;  5DKK A;  1UWN X;  4BJP A;  3DBA A;  2HGV A;  1OPX A;  1T1B A;  4HH2 A;  4GS9 B;  1F5M A;  2VJW A;  4ZRR A;  4E04 A;  4OOL A;  4EXO A;  2W3E A;  2VGL M;  2DMW A;  2W1R A;  4PAU A;  5HZH A;  2Z6C A;  3F1O B;  2Y79 A;  5HPF A;  1TF1 A;  4KUO A;  1ZHH B;  2EWW A;  3EEA A;  3EGX C;  3UB9 A;  4EET B;  3OC2 A;  3OBF A;  1KOU A;  4XT2 B;  3T4O A;  4DN0 A;  2KLI A;  4ETZ A;  1DP9 A;  5A8B A;  4L0L A;  2A2L A;  4Y5F A;  4EEU A;  1BYW A;  3VV4 A;  2XRO A;  2ZOI A;  3H82 A;  4GHI B;  1G6O A;  3CWF A;  5TBM B;  3VE4 A;  2OWJ A;  1LSW A;  4ARZ B;  5HSQ A;  3ZYT A;  3MQO A;  2L4R A;  2O9B A;  4G3V A;  3S7Q A;  5HWV A;  4MCW A;  4I39 A;  2VX8 A;  3UMD A;  3EWK A;  2M7V A;  5TBM A;  4F3L A;  1NLZ A;  4WEJ A;  5F6A A;  3PBN A;  2K7S A;  5F69 A;  1TD5 A;  3KSF A;  2FH5 A;  3B42 A;  4CLC B;  4CLC E;  3PBQ A;  3LI9 A;  5HD5 A;  5DFY A;  5L8M A;  3T4Q A;  2W1T A;  1T1A A;  3C8C A;  2OAQ 1;  3PXP A;  3LUQ A;  4I38 A;  3KYZ A;  2JKR I;  4HHD A;  4EUV A;  2I9V A;  1X0O A;  3NOU C;  3BJN A;  1GSW A;  2W1T B;  3A0V A;  2GNX A;  1NWZ A;  3NOP C;  4EW7 A;  3LR3 A;  2IA2 A;  3IS2 B;  2FZ0 A;  4Q0J A;  5DJU A;  5KIZ A;  4JGP A;  3S7N A;  3MXQ A;  1XJ4 A;  3GDI A;  1H3Q A;  1DRM A;  1N9O A;  4DJ3 A;  1STZ A;  3CLO A;  2ZMV A;  5DKL A;  3SW1 A;  2M1C A;  2OWH A;  1OJ5 A;  5HDD A;  3IBR A;  3W2Z A;  3TE8 A;  2PR6 A;  3KX0 X;  4DJ2 A;  4HH3 A;  1W63 M;  3CI6 A;  3FC7 A;  5I5L A;  3CIT A;  3CAX A;  2W3D A;  5HDC A;  3TW8 A;  3PYP A;  4NXG A;  4QPR A;  4LPZ A;  3P01 A;  3PHY A;  1OTB A;  3UE6 A;  4HNB A;  4WN5 A;  4UEY A;  2BAS A;  5HL6 A;  3VE3 A;  4R70 A;  2GZA A;  2PD8 A;  4WEL A;  5DJT A;  1IFQ A;  2D01 A;  3T4S A;  3F1P B;  4HJ4 A;  3LR0 A;  3VOL A;  3H7W B;  2NUT C;  2PYP A;  2XRN A;  2J80 A;  4HIA A;  1TS6 A;  2YKF A;  3GEC A;  4MMN A;  2VKS A;  4F3L B;  4R3A A;  3A0R A;  3LIE A;  4GLQ A;  4KQO A;  3MR0 A;  3RTY A;  3PBO A;  3E4Q A;  4EQ1 A;  5F5Y A;  3E4P A;  3LR4 A;  5J7E A;  1P0Z A;  3LIF A;  4I3J A;  3LYX A;  4CLC C;  2VGL S;  1OTD A;  2P04 A;  4L9F A;  1GSX A;  5HD3 A;  5K5B A;  2PR5 A;  3V67 A;  1S66 L;  4LRY C;  2V0U A;  1XFQ A;  4EER A;  3PR6 A;  5LBR A;  3NJA A;  4L9G A;  2ZBB A;  4HP9 A;  4MDZ A;  4BMW A;  3EOI A;  3EQV A;  5J3W A;  3BQ8 A;  2OOL A;  2O99 A;  2W3H A;  2QJ5 A;  4IUH A;  2JKR M;  3K2N A;  2L0W A;  1NLY A;  4L9E A;  4M4X A;  2K31 A;  2W3G A;  2QWS A;  3F1O A;  4G3W A;  4WF0 A;  3UB8 A;  1IOU A;  5KSH A;  4O0P A;  5AJG A;  1P97 A;  3C30 A;  2XA7 M;  4MN7 A;  1YAX A;  3MJQ A;  4ETX A;  2KDK A;  2KOI A;  1MZU A;  2R78 A;  3OOV A;  3T4J A;  2EWV A;  3MF0 A;  2V1B A;  4WLA A;  3IBJ A;  1YSQ A;  1TS8 A;  4GW9 A;  3KSI A;  3E0Y A;  1XJ2 A;  1H8M A;  1F9I A;  3D72 A;  3HCY A;  1DP8 A;  5CX7 A;  3TRC A;  3S7P A;  4P6Z M;  2JHE A;  5IU1 A;  4Z1W A;  4WEK A;  3F1N B;  1S67 L;  2O9A A;  3E98 A;  2LB9 A;  5TJJ A;  3KO6 A;  3LFV A;  3RH8 B;  3MQ0 A;  3NHQ A;  4I5S A;  3MFX A;  4HP4 A;  3OLO A;  2VEA A;  1Y28 A;  3B33 A;  5C5K A;  1S1Y A;  1TS7 A;  2G7U A;  4HQA A;  4P6Z S;  3CUE C;  2P08 A;  2OAP 1;  2QKP A;  2VV6 A;  3CUE A;  3EQU A;  4NXF A;  4I3I A;  4BBT A;  1S4S A;  2W27 A;  1DP6 A;  1LSX A;  3H9W A;  4HJ6 A;  4I3A A;  1VB6 A;  1LT0 A;  2YKH A;  3T4K A;  1VHM A;  1F98 A;  2ZOH A;  2W3F A;  4KUK A;  1V9Y A;  3BQA A;  2HJE A;  3JVV A;  2V9A A;  4IUK A;  4ME4 A;  1NRJ A;  1S4R A;  3ULF A;  4BBU A;  3O5Y A;  3LR5 A;  3B47 A;  4NKP A;  3LIC A;  2J3T C;  2VLG A;  1OT9 A;  2HF6 A;  4FSF A;  1WA9 A;  4CLC D;  2EA9 A;  4EU0 A;  2QHK A;  4G3K A;  5HWT A;  4CQH A;  4YNR A;  3LI8 A;  2ZMF A;  3K3C A;  4GS9 A;  2L1M A;  4HI4 A;  2A24 B;  4ARZ A;  3OCL A;  5DFX A;  2LB5 A;  3KSG A;  4NXE A;  3D3O A;  2NUP C;  3P7N A;  3TJZ C;  4BBV A;  4O8G A;  3UB7 A;  3T4T A;  1UGU A;  3MQQ A;  3PBT A;  4B9O A;  3E4O A;  1YSP A;  1T1C A;  2VA0 A;  2A24 A;  2J3W A;  2XSS A;  3S7O A;  4R38 A;  4H6J A;  2M7U A;  2WKR A;  4DMZ A;  2W0N A;  4EES A;  1W63 Q;  4Q0I A;  4MN6 A;  3C2W A;  4PKY A;  1ODV A;  4OOM A;  3K3D A;  2CMN A;  4GJ4 A;  2INW A;  1XJ6 A;  1OT6 A;  2QYB A;  4IJG A;  2HJ9 C;  4K08 A;  4LLO B;  4EEP A;  1P9R A;  4R6L A;  3R7W A;  4NEE D;  4HOI A;  2VV7 A;  2JN7 A;  3R4K A;  5AVF A;  4YOF A;  2P7J A;  3PBS A;  3JVU A;  4Y2F A;  5HPI A;  5FL3 A;  2QJ7 A;  3LID A;  5G4Z A;  4WUJ A;  1MC0 A;  2O9C A;  1G28 A;  3UME A;  2HV1 A;  1T18 A;  3R7W B;  2PT7 A;  2XA7 S;  4NXB A;  4CLC A;  2PYR A;  5DF9 A;  3RFB A;  1JNU A;  4BWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...