5IS1A

Crystal structure of the extracellular domain of sensor histidine kinase yycg from staphylococcus aureus at 2.0 angstrom resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
142
Chain Sequence
NNLEKELLDNFKKNITQYAKQLEISIEKVYDEKGSNAQKDIQNLLSEYANRQEIGEIRFIDKDQIIIATTKQSNRSLINQKANDSSVQKALSLGQSNDHLILKDYGGGKDRVWVYNIPVKVDKKVIGNIYIESKINDVYNQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies on the Extracellular Domain of Sensor Histidine Kinase YycG from Staphylococcus aureus and Its Functional Implications
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
molecule keywords Histidine kinase
total genus 44
structure length 142
sequence length 143
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2016-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5is1A00
1UWNX 1OTEA 5HWVA 3LIBA 5G4YA 4EEUA 1N9LA 4NXEA 2INWA 3UB8A 3EWKA 2OOLA 4PKYA 3MQOA 1OT9A 2V1AA 3E4PA 1S66L 2WKPA 5KIZA 5HDCA 1S67L 4JGRA 1OTBA 3IS2B 4HP9A 4H6JA 4BBTA 4HJ3A 5HD3A 1S4RA 3NOPC 1V9ZA 4DJ2A 5I5LA 3LI8A 4KUOA 1LSWA 1TS0A 1Y28A 3F1OA 1F98A 3UMDA 3IS2A 3VE3A 4E04A 3CWFA 2Z6CA 3BY9A 4GCZA 4HH3A 2A24B 2P7JA 2L1MA 1S1ZA 4M4XA 3BY8A 3RH8B 5J4EA 3OLOA 1OTDA 4HIAA 1P97A 2PR6A 3NJAA 4RQ9A 3GDIA 3E4QA 3HJKA 4JGQA 5DKLA 5F69A 3MQQA 1D7EA 2K7SA 2L4RA 1BYWA 5TBMA 1LSXA 3SW1A 4I3JA 4HJ6A 3UMEA 1LL8A 2W27A 3H7WB 4YWZA 3C2WA 1F9IA 2EA9A 3LI9A 4NXGA 2D01A 3ULFA 4WF0A 1EW0A 2V0WA 5TBMB 4XT2B 2I9VA 5HDSA 3LIEA 3K3DA 4KQDA 4DJ3A 3A0RA 4R38A 4EQ1A 4NXFA 4R3AA 5EFWA 1XJ2A 2QHKA 4EESA 3EEHA 4XT2A 5J3WA 4PKYG 2KX6A 2V9AA 4WLAA 4BBUA 1T18A 2YKFA 2B02A 5DKKA 1G28A 2ZBBA 3ICYA 1OTAA 2QWSA 3MXQA 1N9NA 5IS1A 4WN5A 3T50A 1TS8A 1X0OA 3H9WA 3LIAA 4EW7A 1UWPX 4JGOA 1V9YA 2D02A 1MZUA 3LUQA 4GS9B 1OJ5A 3ZQ5A 3MR0A 2V0UA 2JN7A 4LRXC 1NWZA 2Z6DA 3UB9A 5HZHA 1T1CA 1D06A 1DP8A 1XFQA 1DP9A 2YKHA 4H6JB 5J7EA 2PYRA 2PD7A 1OTIA 1XJ4A 2A24A 4LLOB 4R6LA 4LRYC 3UB7A 3NOUC 3F1NB 1OJGA 2ZOIA 3LICA 4EXOA 3VOLA 3E4OA 3MJQA 2JHEA 1T19A 2VV6A 2CMNA 1GSWA 1DP6A 2W0NA 3F1OB 4HY8A 5AVEA 2HV1A 1TS7A 2QJ5A 2VLGA 2J80A 2KDKA 2VV8A 1JNUA 3BWLA 1S4SA 4L9EA 4GS9A 5G4ZA 4I38A 1VB6A 3LIDA 3F1NA 1GSVA 1LT0A 2M1CA 2PHYA 3HJIA 3PYPA 4EERA 1P0ZA 1XJ3A 2WKQA 1T1AA 3IBRA 3LYXA 4I5SA 4MN6A 2VV7A 4GHIA 2QKPA 4BBVA 3CAXA 5DJUA 4HH2A 4HQAA 2H28A 4MN5A 5AVFA 2QJ7A 2BASA 1N9OA 3B33A 1WA9A 1XJ6A 4K08A 5A8BA 5HDDA 2VEAA 3A0SA 4JGPA 3PHYA 4HJ4A 3FG8A 3UE6A 4HP4A 4HHDA 1UGUA 2V1BA 3G6OA 3H82B 3NHQA 5HD5A 2PD8A 3H82A 4L9FA 4LRZE 3D72A 4I39A 2OWJA 4NXBA 1XFNA 5IU1A 3VE4A 2ZOHA 1ODVA 3FC7A 4KUKA 3MFXA 3A0VA 4B9OA 4F3LA 3RTYA 3F1PB 3F1PA 4LPZA 4EEPA 5DJTA 3NOTC 2PR5A 4EETB 1TS6A 1S1YA 1GSXA 1T1BA 2PYPA 4L9GA 5F68A 5HWTA 4F3LB 3UB6A 5HSQA 4WUJA 3KX0X 4GHIB 4HNBA 4I3AA 2OWHA 2R78A 1DRMA 2WKRA 3H7WA 3GECA 2PDRA 3LIFA 1LSVA 3C8CA 4HI4A 4I3IA 4R70A 4WL9A 1OT6A 1KOUA 2L0WA 3CLOA 2GJ3A 4HOIA 3P7NA 4GW9A 5F5YA 3K3CA 5F6AA 5HWWA
chains in the Genus database with same CATH superfamily
3VMAA 1YLPA 1MKMA 2WZXA 2E8IA 5FI7A 3U2AA 2WKPA 1CI8A 3NI9A 1IYSA 4E6WA 1WYCA 4HJ3A 2WGWB 4KUOA 4OQIA 1BTLA 3LR0A 2A24B 2L1MA 1K6SA 3RJUA 1P9RA 2A3UA 5CHMA 1AWIA 2EWVA 1MWTA 1H8MA 1BYWA 1W5DA 3KSHA 4PHTA 3WS0A 4JXVA 4S2KA 4OLGA 4XT2B 2I9VA 5KMWA 3IXGA 4NXFA 1E25A 3A3DA 3SH7A 2B02A 1G28A 3UPOA 4GD8A 1K6RA 4GLQA 4JLFA 3ZQ5A 5HPIA 1FCOA 1MY8A 1K56D 2PD7A 4R6LA 3CITA 5FQJA 3VOLA 2VKSA 2BTFP 1YLZA 2VV8A 1S4SA 4IVIA 4OKPA 4YFMA 2PHYA 2IA2A 4S2NA 3P98A 4WEKA 5DTTA 3G6OA 4BJPA 1FQGA 3FPWA 3LGOA 1ALQA 5TGFA 3LR5A 5FL3A 5IS1A 5E2GA 3FKWA 1DY6A 4Q0JA 4WL9A 3LY4A 3WRZA 3MR0A 4WYYA 1OTEA 5CEDA 3UPNA 4NXEA 4G3VA 4WEJA 3S7QA 4WMCA 2V1ZA 5CRFA 4C3QA 2HF6A 5HDCA 2NUPC 3QP8A 2ZLYA 4ME4A 4PM7A 3BW6A 2EFUA 1MWSA 5AQAA 4EUZA 3MF0A 3S7OA 3CHWP 5J8XA 3T1QB 5L10A 3EGXC 3OC2A 5A92A 2XROA 2BLSA 3Q82A 1W79A 4I3JA 2UWXA 1NYYA 1FR6A 2D01A 5CGWA 2V0WA 1IYQA 2ZMFA 4QY6A 4XT2A 3M6HA 5DFXA 1OTAA 4DRTA 1TS8A 4OOLA 3SS4A 1OJ5A 2G2WA 3BFFA 3QP5A 1IOUA 4MBKA 3M6BA 3N4IA 3IHAA 1GSWA 4FH2A 4GDNA 2QJ5A 2KDKA 4L9EA 4DE1A 1YAXA 2ZC7A 2EXBA 3LYXA 3VP0A 1CQAA 4E3LA 5DJUA 4HH2A 4CLCE 3Q7ZA 2H10A 1DJCA 3TW8A 3EOIA 5F1FA 4F94A 3B47A 2C6WB 4B4ZA 4ETXA 3W2ZA 5G18A 3O3VA 1YPRA 3Q1FA 2O9AA 3CG5A 1KOUA 3V5MA 5HWWA 2XD5A 1GCEA 3VP4A 1N4OA 5HAQA 5EVID 2INWA 3W4OA 4KQRA 1S6RA 5FASA 1J9MA 2B95A 1OTBA 4CQHA 4P87A 1Y28A 1I2WA 3VE3A 1TD5A 4O7DA 5E2FA 3VP1A 4P0MA 1HLUP 1D1JA 2WKHA 3DAVA 1E4DA 5HL1A 3HLDA 4WF0A 4NG2A 3QP1A 3BRMA 3EGDC 1FILA 5EFWA 1XXMA 3OCLA 5CX7A 2ZC5B 4EW7A 1UWPX 5EVLA 1BLCA 2VZWA 4JPMA 4JF5A 3UB9A 1KE4A 2XSSA 1PW8A 3IF5A 1G6OA 4HY8A 4EXOA 2CMNA 5AVEA 3B42A 4DXBA 4LV3A 3NIAA 2VGLS 5M18A 4I5SA 4MBHA 5FAOA 1L0FA 2WKIA 2Y2HA 3ITBA 2FFYA 1GA0A 2Y2KA 3IQAA 2OWJA 3A0VA 4C6YA 3EQUA 4R23A 3DW0A 3HLCA 4EEPA 2Q9NA 3C5AA 5AJGA 3V67A 2XK1A 1HZOA 4F3LB 3UB6A 1VM1A 4LCLA 4I3IA 4B88A 3MQOA 1H5XA 5G4YA 5EUAA 2FH5A 1BZAA 4R3BA 2XGNA 3JPUA 4RYEA 2W3FA 3E4PA 4QD4A 2H0TA 2WUQA 2ZL1B 3FPVA 3IF6B 3LI8A 3BYDA 3F1OA 2GZAA 4Y15A 3BY9A 1PWDA 5CGXA 4CLCA 5CHUA 3W8KA 4CJNA 3NJAA 3SZTA 3C30A 1ERMA 3B3XA 1CF0A 5EOEA 3C2WA 3OCNA 5A93A 2EA9A 4NXGA 1K54C 4OPRA 3AGFA 3ZFZA 4OOYA 4S2NC 1HD8A 3PBSA 3ICYA 3T50A 2Y2PA 2KOIA 3HLBA 4FD8A 2OV5A 3UY6A 4LLOB 2A24A 3NOUC 4S2LA 2ZOIA 3LICA 4X68A 5FAPA 5KIZA 1DP6A 1XPBA 2WGWA 3GSGA 2O99A 2B18A 2O0YA 2JC7A 3T1SA 2ZQ7A 3PYPA 4D2OA 1IKGA 2WKQA 5FQIA 2HPBA 2PBYA 5FQKA 4KENB 2QJ7A 1NRFA 5EVIA 3UE1A 4ZJ1A 3IH8A 5IHVA 4R4RA 5IT5A 5JYPA 5EE8A 4F3LA 4CLCD 1ODVA 3MMHA 2H0YA 1K55C 4Y5FA 5GLCA 2ZM2A 1MWRA 4EQIA 2HJ9C 3GECA 3TOIA 5GHYA 4X1LA 5BOHA 1OT9A 4HEFA 3O88A 5K5BA 2DRWA 3HREA 3MZFA 5FQQA 3NDEA 4BWIA 4IJGA 4WZ4A 2HDSA 4ZRRA 5J4EA 3GTCA 1OTDA 2P04A 4P6ZS 5DKLA 1XA1A 3ZGAB 1MBLA 1LSXA 2ZMVA 4NK3A 4QPRA 4KZ8A 5F1GA 1XX2A 1KGFA 2AVXA 5HAIA 4O0PA 3HVFA 4GB7A 4MCWA 5CTNA 1Z09A 5DKKA 2GNXA 2Y2GA 1X0OA 1M6KA 4FSFA 4B93A 3IBJA 3L9KA 4DXCA 4IHQA 4LRXC 4OQ0A 1DP9A 1K54A 5J7EA 2VGLM 4UEYA 3PBRA 5HFOA 2VLGA 5CGSA 4OPQA 2ZC3B 1BLHA 3ITAA 4FOFA 3D9YA 4BBVA 2VX8A 3A3EA 2H28A 2EFXA 2ZQAA 1WA9A 2M7UA 3LEZA 5FAQA 1BULA 3C7UA 4WMCD 3GV9A 5E2EA 3VP2A 4DKIA 3NCKA 3UNWA 4ARZA 3NOTC 1TS6A 1CI9A 4P6ZM 4Z1WA 2XDMA 4OVDA 3LIFA 4OPYA 3VFHA 4E3NA 4X1MA 3T12B 3G31A 2RCXA 3MXSA 3BQ8A 1PNEA 1KE3A 3PBTA 1K38A 5TFQA 4HBUA 3NOPC 5GHXA 4DJ2A 2PRFA 1MXOA 5HPFA 3ZYTA 2V8FA 3BLMA 1YQSA 2Z2MB 3NDGA 1PZPA 4WBGA 2W27A 4YWZA 5HL6A 1IELA 4DDYA 4MBFA 1KGEA 2QHKA 5J3WA 5FATA 4MMNA 1DJBA 1YT4A 3W4QA 2WADA 1IEMA 2D02A 3LUQA 2ZQ9A 3R4KA 3HUOA 4M3KA 3ZG5A 1CEGA 5DF7A 3WS2A 3IWOA 4XUXA 4O8GA 4KQQA 5C5KA 4MN7A 1K57A 1JNUA 3Q7VA 4GS9A 4GN2A 4MN6A 2ZJ9A 2P9VA 2QKPA 5EM1A 1N9OA 3A0SA 4HP4A 2J3WA 4HHDA 3H82B 4Y3IA 3VSLA 4PPRA 4OPZA 1U60A 1YLTA 4B9OA 2W3HA 3T4OA 3F1PA 5HSQA 2Y2QA 3HLFA 3H7WA 1VEUB 4UA9A 2QPNA 4P6BA 2VV6A 1UWNX 4JXGA 1OMEA 4CPKA 1DJAA 4FH4A 4PAUA 3ZG8B 1GA9A 5EVIC 1S66L 4L0LA 1Q2QA 5HD3A 3A3FA 4R0QA 2FZ0A 1TS0A 2QZ6A 4KZ9A 4HH3A 2ZMAA 3DTMA 4BL3A 4UHUA 1VEUA 3UE3A 5FQMA 3BY8A 2PBDP 1O07A 3WRTA 5F69A 5KZHA 3N8SA 4KZAA 1ZKJA 4QY5A 3LI9A 2EXAA 1ZC2A 3TRCA 2GDNA 1ZG6A 1EW0A 4EBPA 5HDSA 4KQDA 3PAEA 4R3AA 1SDEA 1XJ2A 2B5RA 3NECA 1MPLA 3IXBA 2XH9A 4BLMA 4WN5A 2HDQA 2JN7A 2WAFA 2DMWA 1A0KA 4UA7A 1Z6FA 3CMZA 5FA7A 2OLUA 2PYRA 3O5YA 5GLBA 3V50A 4CLCB 3UB7A 4UAAA 1K56A 2W0NA 1JWZA 2ZL1A 2HV1A 4JBFA 1H3QA 2JCHA 2Q0OA 4KG2A 4HQAA 1Y4OA 3N6IA 3IH9A 3QNCA 1LHYA 3C7VA 4ZBEA 3FG8A 2OSUA 3D72A 3FC7A 2WZZA 2Y2IA 4EV4A 2Y4AA 3WS1A 1JWPA 2PDRA 3HCYA 1H0MA 3RXWA 3RFBA 4HOIA 4GW9A 4EWFA 1ES2A 3KSIA 3LIBA 2XLNA 3UO9A 4IUKA 2JKRI 3TG9A 2XR0A 1F5MA 5FI6A 5HARA 3K2NA 2XFSA 4EBNA 5LBRA 2GX5A 4H6JA 3LEQA 4X6TA 2VJWA 4WM9A 3NC8A 4GCZA 3RH8B 2XA7S 4Q0IA 1FSWA 3FKVA 3GVBA 1IYOA 3DTEA 3UDIA 1W8QA 3ZNYA 3IX4A 3BECA 3UMEA 1W7FA 3T4QA 3IT9A 2J3TD 1NXYA 3Q81A 3HUNA 3LIEA 3K3DA 4HESA 3VOZA 1YM1A 3PBOA 2KX6A 1T18A 2Y79A 4DE0A 1NZUA 3UE0A 3UDXA 1N9NA 4IBRA 1V9YA 1TDGA 1XGIA 4MDZA 1XFQA 1SHVA 1XKZA 1OTIA 5HW3A 3G2YA 4OH0A 3R7WA 4IEDA 2J80A 4UQIM 1I2SA 3S7NA 3O87A 3VV4A 5FQ9A 3HJIA 4K91A 4NKPA 2J9PA 3BFGA 1NRJA 1ZG4A 2V20A 4E3IA 3HLEA 2R9WA 2OAP1 4U0XA 3M2JA 2ZOHA 5TJJA 1KVLA 1SCWA 3UPPA 2ZQDA 3S1YA 2HGVA 3LCEA 3QHYA 3BLSA 1S1YA 4IUHA 4HNBA 1BUEA 1H8ZA 4Y2FA 3DTIA 3PBNA 4PM9A 3IX8A 5F6AA 3IWIA 2R9XA 4AFIA 3CPTB 4JF4A 1K0KA 2V1AA 5HAPA 4X69A 4BL2A 4RX2A 4HP9A 3LY3A 4QWOA 4FUWA 2OAQ1 3SOIA 3IS2A 4E04A 1BLSA 2PR6A 3G2ZA 4RQ9A 3CUEA 2JE5A 4JGQA 4Y13A 1L0EA 2IWBA 3ZG7B 3IXDA 1LL8A 3N8RA 1ACFA 4DMZA 4WELA 4HBTA 2HJEA 5TBMB 1KE0A 3VSKA 4S2JA 1YLYA 4OOMA 1FSYA 3OPLA 2G7UA 4N1HA 1NLYA 4BQMA 3EQVA 3LIAA 2VGKA 1PFLA 2Z6DA 3W4PA 1PZOA 5EVEA 3P01A 1LI0A 5TR7A 2X01A 4IBXA 5FEFA 3PTEA 5G4ZA 5AQ7A 1CK3A 3OOVA 4JXSA 3ZCZA 2A2LA 3E2LA 3IBRA 1T1AA 3MS6A 4IVKA 3HLGA 4KZ4A 3KSFA 3CAXA 2QMIA 3I7JA 4P85A 3MSHA 4K08A 1LL5A 1XP4A 3IHBA 4N92A 3UE6A 1UGUA 4GD6A 5DTSA 5GHZA 5A90A 1C3BA 1ZHHB 5DJTA 2X02A 2ZC4B 4QHCA 3S22A 5EPHA 2NUTC 5KSHA 2PT7A 4R70A 3ZG9B 1QMFA 1NJ4A 2K2NA 2Q9MA 5HWVA 5GLAA 4ZAMA 3CJMA 1PIOA 1YLJA 4PKYA 4QB8A 4R4SA 2J8YA 1BT5A 5L2FA 1S67L 4ZJ3A 1LSWA 4YINA 1YKDA 2O9CA 1RCJA 2JBFA 2Z2LB 4JXWA 1K4EA 4LFUA 3GDIA 1D7EA 2HP9A 2XF3A 5TBMA 3UB5P 3ULFA 4LCMA 5CERA 2EX9A 4EESA 2HDUA 1S0WA 2BG1A 4BBUA 4KZ7A 5CXWA 3L7HA 2QWSA 2XFTA 4PMAA 3OBFA 3D3OA 1E3UD 1SZVA 3MXRA 3PBQA 2PAVP 1NWZA 3MKEA 1T1CA 5EV0A 4UQIS 4Q0HA 1CEFA 3T4KA 3NULA 1EROA 3Q7VB 3BWLA 1XGJA 2A49A 4DE3A 1FR1A 2HP6A 5AVFA 2VEAA 3GRJA 4NETA 1RGYA 2Y2MA 3C38A 4R1GA 2W3EA 5GL9A 1SKFA 4GOGA 3C4OA 3G35A 5F68A 4WUJA 4X56A 3SH8A 3BFCA 3TE8A 1SKOB 1PI4A 3P7NA 3QP6A 1TDLA 4XXRA 5F82A 2W3DA 3DBAA 3AGEA 1S4RA 3N8LA 5I5LA 3MZEA 3MQ0A 4ETZA 4KZ6A 3UMDA 3GMWA 2Y2LA 3OLOA 2K31A 4K0XA 2W1TA 1W63Q 2HP5A 1ES4A 2ZQ8A 1JTDA 2LB5A 4X55A 1KDSA 4PM6A 1RGZA 1FCNA 3UDFA 4G3WA 3IXHA 3MXQA 3P09A 1VQQA 4XUZA 1GHMA 1MZUA 3A3IA 2YKHA 2Y2OA 4OQHA 1WYBA 3F1NB 1FOFA 3KYEA 1PYYA 5M1AA 4WZ5A 3E4OA 3PAGA 2W1RA 3MKFA 2W3GA 2FFFB 4I38A 3QNBA 1EI5A 1LT0A 2WAEA 1K55A 3IF6C 1IYPA 3T1XA 2PU4A 3FWLA 4OONA 4BENA 4OP8A 4JGPA 3PHYA 5EECA 5HD5A 1XFNA 4PM8A 4CLCC 4O01A 4EBLA 4I3AA 1DRMA 2MJ6A 4K0WA 3C8CA 4HI4A 1YSPA 3T1RA 3S7PA 4B4XA 4Y0TA 2ZQCA 3R7WB 1PW1A 4LV2A 1AXBA 5AQ9A 2XD1A 2P08A 2Y55A 1NYMA 4Q8IA 1G68A 2Z6CA 2WYXA 1IFQA 2P7JA 5EM0A 3WS5A 2ACGA 5EOOA 3Q07A 2ZC6B 3ISGA 3VP3A 2JKGA 1YMXA 2L4RA 1O7EA 3H7WB 1ERQA 1MKIA 1KVMA 1K25A 3CI6A 2X71A 4R3JA 4PKYG 2V9AA 1J3WA 2WGIA 3CZDA 3ZNTA 2P9VB 4Z9QA 4GS9B 2XRNA 3S4XA 2V0UA 1ZTUA 4GNUA 4ESPA 3RXXA 2J7VA 1XJ4A 4N9KA 3C4PA 1Y54A 5DVAA 1MC0A 1TS7A 4YNRA 3ZDJA 1W63M 4EERA 2C5WB 1WE4A 1XJ3A 4N1XA 3KO6A 1KDWA 1VHMA 2XEPA 1XJ6A 5HDDA 3HUMA 5CECA 2V1BA 2H5SA 2PD8A 4LRZE 2Y91A 3ZVTA 1Q2PA 5FSRA 2VA0A 4LPZA 3MFDA 3JVUA 4EU0A 2OWHA 2R78A 1K4FA 3MZDA 3DWKA 3CLOA 4GZBA 3V39A 4KZ5A 4E3JA 1LL9A 3PR6A 4BBTA 5CHJA 1I5QA 1HTZA 1RP5A 3IF6A 1F98A 5DFYA 2EX2A 4Y0UA 1H8YA 1P97A 5DF9A 3MQQA 4ZDXA 2K7SA 1SDNA 3A3JA 3GQZA 3AGDA 5M19A 3OPHA 1JWVA 3TJZC 4RVAA 4R38A 3LFVA 3EEHA 3HLWA 4G3KA 1BLPA 1L0GA 4LV0A 1LI9A 2OLVA 5KSCA 2WK0A 2J3TC 3H9WA 3OPRA 4JGOA 2W1TB 4KG6A 2V2FF 2EX6A 2WGVA 3U4LP 1JVJA 4QJGA 2RL3A 5FDSA 3MJQA 3F1OB 1CJFA 2M1CA 3LR4A 2I72A 2ZD8A 4GHIA 1IKIA 1ES5A 4HJ4A 3NHQA 1M40A 3H82A 4S2MA 4NXBA 4KUKA 2CC1A 3G32A 4YOFA 3WWXA 5L07A 2E8JA 1OT6A 3SS5A 3K3CA 3HL9A 4EEUA 1N9LA 2EWWA 4GDBA 2ZM8A 1JTGA 1L0DA 3BQAA 5D3OA 4U0TA 4BD1A 1TF1A 3HBRA 3VOYA 3FZCA 3G30A 2JKTM 3E4QA 4EUVA 4NEED 3ZHHA 3V3SA 3SW1A 1TVFA 4HJ6A 5L09A 4BD0A 3A0RA 5CEBA 1TEMA 4KQOA 2YKFA 2ZBBA 4QU3A 2WKEA 4RX3A 2P74A 1YSQA 4S2PA 5HZHA 4H6JB 1OJGA 3E0YA 3NBLA 1NLZA 1PRQA 1VB6A 2Y8HA 3LIDA 5GLDA 2IWDA 4MN5A 3V3RA 1N9BA 5F83A 4ARZB 4U3TA 3T4SA 2EX8A 3NY4A 4L9FA 4FTXA 4E3KA 3RTYA 3G34A 1ESIA 4EETB 2LB9A 2PYPA 3BEBA 3DTKA 2O9BA 3TSGA 2UV0E 3KX0X 2M7VA 2WKRA 3QP4A 4RA7A 4DN0A 5E2HA 1PWGA 3GR2A 1ONGA 4LV1A 1ONHA 1OPXA 1G6AA 5DF8A 3N7WA 5FEGA 3IS2B 4OLDA 1BSGA 1NZOA 3O86A 2IWCA 4Y7PA 4HIAA 1MWUA 3HJKA 3QP2A 1LLBA 1W8YA 2DNSA 4X53A 3ZVWA 4ZJ2A 2J9OA 4Y17A 1P9WA 5JYOA 4DJ3A 4JKTA 5EVIB 1PI5A 3T4LA 4WLAA 3SH9A 2HDRA 2QYBA 4PM5A 4H8RA 2XA7M 1D06A 4MEZA 4D60A 1PWCA 4LRYC 3CPTA 4N9LA 4UA6A 1FCMA 2JHEA 1T19A 3E98A 2KLIA 4DDSA 3EEAA 1SKOA 4MNRA 3F1NA 2HZ5A 4WZ5C 3JYIA 1EWZA 2Y2NA 5L8MA 1ES3A 3T4TA 1FIKA 1GHPA 3PXPA 1E3UA 4FCFA 4DE2A 3IX3A 3SS3A 1G5UA 4I39A 5IU1A 4S2OA 2XQZA 4JF6A 3UN7A 3MFXA 1YMSA 4X25A 3F1PB 2V8CA 4A5RA 2PR5A 1F2KA 1T1BA 4L9GA 3BFEA 4GHIB 5U47A 5HX9A 1LSVA 2L0WA 1L2SA 3G4PA 2ZM0A 3OPPA 3KYQA 4GKUA 3UB8A 3EWKA 4LENA 2OOLA 3CUEC 4C75A 1YLWA 4JGRA 4MLLA 4KG5A 1V9ZA 1STZA 3E2KA 4BMWA 3CWFA 3DWZA 1KGGA 3BM6A 1S1ZA 4M4XA 3JVVA 2JKTI 3FV7A 2Y2JA 3LO7A 5FDHA 2G2UA 4OQGA 1F9IA 4KZ3A 4II7A 1NY0A 4EQ1A 3LR3A 2DCFA 4LGWA 2Y59A 5AQBA 1VETA 5CTMA 2JKFA 1DP8A 5DTKA 5A91A 4OP5A 5FI2A 4E6XA 2JKRM 1XA7A 3D4FA 4ID4A 4KZBA 2VGJA 4Y0OA 1ESUA 1GSVA 1L3LA 4E3OA 1P0ZA 4GJ4A 1HVBA 3KYZA 3OZHA 2VV7A 1K57C 5E43A 4DF6A 2VK3A 4ZTKA 2PU2A 1VETB 2BASA 3B33A 3VFFA 3KSGA 5A8BA 1QMEA 3IWQA 3FYZA 3T4JA 4E3MA 3BJNA 3VE4A 5MC7A 3BFDA 1GHIA 1GSXA 5HWTA 5I94A 3ZG0A 3WS4A 4S2IA 3M2KA 3MBZA 5F5YA 2GJ3A
chains in the Genus database with same CATH topology
4AFIA 1MKMA 1OT9A 2V1AA 3U2AA 2WKPA 5K5BA 3PR6A 4HP9A 4BBTA 4HJ3A 2OAQ1 4KUOA 1F98A 5DFYA 3IS2A 4E04A 4BWIA 3LR0A 4IJGA 2A24B 2L1MA 4ZRRA 5J4EA 1P9RA 1OTDA 1P97A 2PR6A 2EWVA 4RQ9A 2P04A 1H8MA 3CUEA 4JGQA 4P6ZS 5DKLA 5DF9A 3MQQA 2K7SA 1BYWA 1LSXA 1LL8A 2ZMVA 3KSHA 4QPRA 4DMZA 4WELA 4PHTA 3TJZC 2HJEA 5TBMB 4XT2B 2I9VA 4R38A 4NXFA 3LFVA 3EEHA 4OOMA 4O0PA 4MCWA 4G3KA 2B02A 5DKKA 1G28A 2G7UA 1NLYA 2GNXA 1X0OA 2J3TC 3EQVA 3H9WA 3LIAA 4FSFA 4GLQA 4JGOA 4B93A 3IBJA 2W1TB 3ZQ5A 4IHQA 4LRXC 2Z6DA 5HPIA 1DP9A 3P01A 5J7EA 2VGLM 2PD7A 4R6LA 4UEYA 3CITA 3PBRA 3VOLA 3MJQA 3F1OB 2VKSA 2VLGA 2VV8A 1S4SA 5G4ZA 3OOVA 2M1CA 2PHYA 2A2LA 3LR4A 3IBRA 1T1AA 4FOFA 2IA2A 3KSFA 4BBVA 4GHIA 3CAXA 2VX8A 2H28A 1WA9A 2M7UA 4K08A 4WEKA 4HJ4A 3UE6A 1UGUA 3G6OA 3NHQA 3H82A 4NXBA 4BJPA 4KUKA 1ZHHB 3FPWA 3LR5A 4ARZA 5FL3A 5DJTA 3NOTC 5IS1A 1TS6A 4YOFA 4P6ZM 2NUTC 4Z1WA 5KSHA 3LIFA 4Q0JA 2PT7A 4R70A 4WL9A 1OT6A 3MR0A 3K3CA 2K2NA 1OTEA 5HWVA 4EEUA 1N9LA 4NXEA 2EWWA 4G3VA 3BQ8A 4WEJA 4PKYA 3S7QA 2HF6A 5HDCA 3PBTA 2NUPC 1S67L 3BQAA 4ME4A 3NOPC 4DJ2A 1LSWA 1TF1A 3BW6A 1YKDA 2O9CA 5HPFA 3ZYTA 3MF0A 2JKTM 3S7OA 3GDIA 3E4QA 3EGXC 3OC2A 4EUVA 2XROA 4NEED 1D7EA 5TBMA 3SW1A 4I3JA 4HJ6A 2W27A 4YWZA 5HL6A 2D01A 3ULFA 2V0WA 2ZMFA 3A0RA 4EESA 2QHKA 4XT2A 5J3WA 4KQOA 4BBUA 2YKFA 4MMNA 5DFXA 2ZBBA 1OTAA 2QWSA 3OBFA 1TS8A 4OOLA 3D3OA 2D02A 3LUQA 1OJ5A 3R4KA 1YSQA 3PBQA 1NWZA 5HZHA 1T1CA 4H6JB 4UQIS 4Q0HA 1IOUA 3T4KA 4O8GA 1OJGA 5C5KA 3E0YA 1GSWA 4MN7A 2QJ5A 2KDKA 3BWLA 1JNUA 1NLZA 4L9EA 4GS9A 1YAXA 1VB6A 2Y8HA 3LIDA 3LYXA 4MN6A 2QKPA 5DJUA 4HH2A 4MN5A 5AVFA 4CLCE 1N9OA 4ARZB 3T4SA 2VEAA 3A0SA 4HP4A 2J3WA 4HHDA 3TW8A 3H82B 4L9FA 4Y3IA 3C38A 4B9OA 3EOIA 3RTYA 2W3EA 2W3HA 3T4OA 3F1PA 4EETB 2LB9A 2PYPA 3B47A 5F68A 2O9BA 5HSQA 4WUJA 3KX0X 4ETXA 3W2ZA 2M7VA 3H7WA 2WKRA 3TE8A 2O9AA 1KOUA 5HWWA 2VV6A 3P7NA 4DN0A 1UWNX 1OPXA 2INWA 4PAUA 2W3DA 1S66L 3DBAA 4L0LA 1OTBA 3IS2B 4CQHA 5HD3A 1S4RA 5I5LA 2FZ0A 3MQ0A 1TS0A 1Y28A 4ETZA 3UMDA 3VE3A 4HH3A 3UE3A 1TD5A 3BY8A 3OLOA 2K31A 4HIAA 3HJKA 5F69A 2W1TA 1W63Q 3LI9A 3TRCA 4WF0A 1EW0A 1P9WA 2LB5A 5HDSA 3EGDC 4KQDA 4DJ3A 5EFWA 4R3AA 1XJ2A 3T4LA 4WLAA 4G3WA 3OCLA 3MXQA 5CX7A 4WN5A 4EW7A 1UWPX 2QYBA 1MZUA 2VZWA 2JN7A 3UB9A 2DMWA 2XA7M 2YKHA 1D06A 2XSSA 2PYRA 3O5YA 4CLCB 4LRYC 3UB7A 3F1NB 1G6OA 3E4OA 2JHEA 1T19A 3E98A 2CMNA 2W0NA 2W3GA 2W1RA 4HY8A 5AVEA 4EXOA 2HV1A 2KLIA 3B42A 3EEAA 1H3QA 4I38A 2VGLS 3F1NA 1LT0A 4I5SA 5L8MA 3T4TA 4HQAA 3PXPA 4JGPA 3PHYA 3FG8A 5HD5A 3D72A 4I39A 2OWJA 5IU1A 1XFNA 3FC7A 3MFXA 3A0VA 3EQUA 3F1PB 4EEPA 5AJGA 4CLCC 2PR5A 3V67A 1T1BA 4O01A 4L9GA 4F3LB 3UB6A 4GHIB 4I3AA 1DRMA 2MJ6A 2PDRA 3HCYA 1LSVA 3C8CA 4HI4A 4I3IA 1YSPA 3RFBA 2L0WA 3S7PA 4HOIA 4GW9A 3MQOA 3KSIA 3R7WB 3LIBA 5G4YA 4IUKA 2FH5A 2JKRI 3KYQA 3UB8A 3EWKA 2OOLA 1F5MA 3CUEC 3K2NA 2W3FA 3E4PA 5LBRA 2GX5A 2P08A 4JGRA 4H6JA 1V9ZA 2VJWA 3FPVA 1STZA 3LI8A 4BMWA 3F1OA 2GZAA 3CWFA 2Z6CA 3BY9A 4GCZA 1IFQA 4CLCA 2P7JA 1S1ZA 4M4XA 3RH8B 2XA7S 4Q0IA 3JVVA 3NJAA 3C30A 2JKTI 2L4RA 3UMEA 3H7WB 3T4QA 2J3TD 3C2WA 3OCNA 1F9IA 2EA9A 4NXGA 4II7A 3LIEA 3CI6A 3K3DA 4EQ1A 3LR3A 3PBOA 4PKYG 2KX6A 2V9AA 1T18A 3PBSA 2Y79A 3ICYA 1N9NA 3T50A 2KOIA 1V9YA 4GS9B 2XRNA 4MDZA 2V0UA 1ZTUA 1XFQA 1DP8A 4LLOB 1OTIA 1XJ4A 2A24A 3NOUC 2ZOIA 3LICA 5KIZA 1DP6A 1MC0A 2JKRM 1TS7A 2O99A 3R7WA 2J80A 4YNRA 2B18A 4UQIM 2O0YA 3S7NA 3VV4A 1W63M 1GSVA 4EERA 3PYPA 3HJIA 1P0ZA 1XJ3A 4GJ4A 3KO6A 2WKQA 4NKPA 1VHMA 3KYZA 1NRJA 2VV7A 2QJ7A 2BASA 3B33A 1XJ6A 3KSGA 5A8BA 5HDDA 3T4JA 2V1BA 2OAP1 3BJNA 2PD8A 4LRZE 3VE4A 5IT5A 4F3LA 2ZOHA 1ODVA 5TJJA 3MMHA 2VA0A 4CLCD 5MC7A 4LPZA 2HGVA 4Y5FA 1S1YA 1GSXA 4IUHA 5HWTA 3JVUA 4EU0A 4HNBA 2OWHA 2HJ9C 2R78A 3GECA 4Y2FA 5F5YA 3CLOA 2GJ3A 3PBNA 5F6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWN X;  1OTE A;  5HWV A;  3LIB A;  5G4Y A;  4EEU A;  1N9L A;  4NXE A;  2INW A;  3UB8 A;  3EWK A;  2OOL A;  4PKY A;  3MQO A;  1OT9 A;  2V1A A;  3E4P A;  1S66 L;  2WKP A;  5KIZ A;  5HDC A;  1S67 L;  4JGR A;  1OTB A;  3IS2 B;  4HP9 A;  4H6J A;  4BBT A;  4HJ3 A;  5HD3 A;  1S4R A;  3NOP C;  1V9Z A;  4DJ2 A;  5I5L A;  3LI8 A;  4KUO A;  1LSW A;  1TS0 A;  1Y28 A;  3F1O A;  1F98 A;  3UMD A;  3IS2 A;  3VE3 A;  4E04 A;  3CWF A;  2Z6C A;  3BY9 A;  4GCZ A;  4HH3 A;  2A24 B;  2P7J A;  2L1M A;  1S1Z A;  4M4X A;  3BY8 A;  3RH8 B;  5J4E A;  3OLO A;  1OTD A;  4HIA A;  1P97 A;  2PR6 A;  3NJA A;  4RQ9 A;  3GDI A;  3E4Q A;  3HJK A;  4JGQ A;  5DKL A;  5F69 A;  3MQQ A;  1D7E A;  2K7S A;  2L4R A;  1BYW A;  5TBM A;  1LSX A;  3SW1 A;  4I3J A;  4HJ6 A;  3UME A;  1LL8 A;  2W27 A;  3H7W B;  4YWZ A;  3C2W A;  1F9I A;  2EA9 A;  3LI9 A;  4NXG A;  2D01 A;  3ULF A;  4WF0 A;  1EW0 A;  2V0W A;  5TBM B;  4XT2 B;  2I9V A;  5HDS A;  3LIE A;  3K3D A;  4KQD A;  4DJ3 A;  3A0R A;  4R38 A;  4EQ1 A;  4NXF A;  4R3A A;  5EFW A;  1XJ2 A;  2QHK A;  4EES A;  3EEH A;  4XT2 A;  5J3W A;  4PKY G;  2KX6 A;  2V9A A;  4WLA A;  4BBU A;  1T18 A;  2YKF A;  2B02 A;  5DKK A;  1G28 A;  2ZBB A;  3ICY A;  1OTA A;  2QWS A;  3MXQ A;  1N9N A;  5IS1 A;  4WN5 A;  3T50 A;  1TS8 A;  1X0O A;  3H9W A;  3LIA A;  4EW7 A;  1UWP X;  4JGO A;  1V9Y A;  2D02 A;  1MZU A;  3LUQ A;  4GS9 B;  1OJ5 A;  3ZQ5 A;  3MR0 A;  2V0U A;  2JN7 A;  4LRX C;  1NWZ A;  2Z6D A;  3UB9 A;  5HZH A;  1T1C A;  1D06 A;  1DP8 A;  1XFQ A;  1DP9 A;  2YKH A;  4H6J B;  5J7E A;  2PYR A;  2PD7 A;  1OTI A;  1XJ4 A;  2A24 A;  4LLO B;  4R6L A;  4LRY C;  3UB7 A;  3NOU C;  3F1N B;  1OJG A;  2ZOI A;  3LIC A;  4EXO A;  3VOL A;  3E4O A;  3MJQ A;  2JHE A;  1T19 A;  2VV6 A;  2CMN A;  1GSW A;  1DP6 A;  2W0N A;  3F1O B;  4HY8 A;  5AVE A;  2HV1 A;  1TS7 A;  2QJ5 A;  2VLG A;  2J80 A;  2KDK A;  2VV8 A;  1JNU A;  3BWL A;  1S4S A;  4L9E A;  4GS9 A;  5G4Z A;  4I38 A;  1VB6 A;  3LID A;  3F1N A;  1GSV A;  1LT0 A;  2M1C A;  2PHY A;  3HJI A;  3PYP A;  4EER A;  1P0Z A;  1XJ3 A;  2WKQ A;  1T1A A;  3IBR A;  3LYX A;  4I5S A;  4MN6 A;  2VV7 A;  4GHI A;  2QKP A;  4BBV A;  3CAX A;  5DJU A;  4HH2 A;  4HQA A;  2H28 A;  4MN5 A;  5AVF A;  2QJ7 A;  2BAS A;  1N9O A;  3B33 A;  1WA9 A;  1XJ6 A;  4K08 A;  5A8B A;  5HDD A;  2VEA A;  3A0S A;  4JGP A;  3PHY A;  4HJ4 A;  3FG8 A;  3UE6 A;  4HP4 A;  4HHD A;  1UGU A;  2V1B A;  3G6O A;  3H82 B;  3NHQ A;  5HD5 A;  2PD8 A;  3H82 A;  4L9F A;  4LRZ E;  3D72 A;  4I39 A;  2OWJ A;  4NXB A;  1XFN A;  5IU1 A;  3VE4 A;  2ZOH A;  1ODV A;  3FC7 A;  4KUK A;  3MFX A;  3A0V A;  4B9O A;  4F3L A;  3RTY A;  3F1P B;  3F1P A;  4LPZ A;  4EEP A;  5DJT A;  3NOT C;  2PR5 A;  4EET B;  1TS6 A;  1S1Y A;  1GSX A;  1T1B A;  2PYP A;  4L9G A;  5F68 A;  5HWT A;  4F3L B;  3UB6 A;  5HSQ A;  4WUJ A;  3KX0 X;  4GHI B;  4HNB A;  4I3A A;  2OWH A;  2R78 A;  1DRM A;  2WKR A;  3H7W A;  3GEC A;  2PDR A;  3LIF A;  1LSV A;  3C8C A;  4HI4 A;  4I3I A;  4R70 A;  4WL9 A;  1OT6 A;  1KOU A;  2L0W A;  3CLO A;  2GJ3 A;  4HOI A;  3P7N A;  4GW9 A;  5F5Y A;  3K3C A;  5F6A A;  5HWW A; 
#chains in the Genus database with same CATH topology
 3VMA A;  1YLP A;  1MKM A;  2WZX A;  2E8I A;  5FI7 A;  3U2A A;  2WKP A;  1CI8 A;  3NI9 A;  1IYS A;  4E6W A;  1WYC A;  4HJ3 A;  2WGW B;  4KUO A;  4OQI A;  1BTL A;  3LR0 A;  2A24 B;  2L1M A;  1K6S A;  3RJU A;  1P9R A;  2A3U A;  5CHM A;  1AWI A;  2EWV A;  1MWT A;  1H8M A;  1BYW A;  1W5D A;  3KSH A;  4PHT A;  3WS0 A;  4JXV A;  4S2K A;  4OLG A;  4XT2 B;  2I9V A;  5KMW A;  3IXG A;  4NXF A;  1E25 A;  3A3D A;  3SH7 A;  2B02 A;  1G28 A;  3UPO A;  4GD8 A;  1K6R A;  4GLQ A;  4JLF A;  3ZQ5 A;  5HPI A;  1FCO A;  1MY8 A;  1K56 D;  2PD7 A;  4R6L A;  3CIT A;  5FQJ A;  3VOL A;  2VKS A;  2BTF P;  1YLZ A;  2VV8 A;  1S4S A;  4IVI A;  4OKP A;  4YFM A;  2PHY A;  2IA2 A;  4S2N A;  3P98 A;  4WEK A;  5DTT A;  3G6O A;  4BJP A;  1FQG A;  3FPW A;  3LGO A;  1ALQ A;  5TGF A;  3LR5 A;  5FL3 A;  5IS1 A;  5E2G A;  3FKW A;  1DY6 A;  4Q0J A;  4WL9 A;  3LY4 A;  3WRZ A;  3MR0 A;  4WYY A;  1OTE A;  5CED A;  3UPN A;  4NXE A;  4G3V A;  4WEJ A;  3S7Q A;  4WMC A;  2V1Z A;  5CRF A;  4C3Q A;  2HF6 A;  5HDC A;  2NUP C;  3QP8 A;  2ZLY A;  4ME4 A;  4PM7 A;  3BW6 A;  2EFU A;  1MWS A;  5AQA A;  4EUZ A;  3MF0 A;  3S7O A;  3CHW P;  5J8X A;  3T1Q B;  5L10 A;  3EGX C;  3OC2 A;  5A92 A;  2XRO A;  2BLS A;  3Q82 A;  1W79 A;  4I3J A;  2UWX A;  1NYY A;  1FR6 A;  2D01 A;  5CGW A;  2V0W A;  1IYQ A;  2ZMF A;  4QY6 A;  4XT2 A;  3M6H A;  5DFX A;  1OTA A;  4DRT A;  1TS8 A;  4OOL A;  3SS4 A;  1OJ5 A;  2G2W A;  3BFF A;  3QP5 A;  1IOU A;  4MBK A;  3M6B A;  3N4I A;  3IHA A;  1GSW A;  4FH2 A;  4GDN A;  2QJ5 A;  2KDK A;  4L9E A;  4DE1 A;  1YAX A;  2ZC7 A;  2EXB A;  3LYX A;  3VP0 A;  1CQA A;  4E3L A;  5DJU A;  4HH2 A;  4CLC E;  3Q7Z A;  2H10 A;  1DJC A;  3TW8 A;  3EOI A;  5F1F A;  4F94 A;  3B47 A;  2C6W B;  4B4Z A;  4ETX A;  3W2Z A;  5G18 A;  3O3V A;  1YPR A;  3Q1F A;  2O9A A;  3CG5 A;  1KOU A;  3V5M A;  5HWW A;  2XD5 A;  1GCE A;  3VP4 A;  1N4O A;  5HAQ A;  5EVI D;  2INW A;  3W4O A;  4KQR A;  1S6R A;  5FAS A;  1J9M A;  2B95 A;  1OTB A;  4CQH A;  4P87 A;  1Y28 A;  1I2W A;  3VE3 A;  1TD5 A;  4O7D A;  5E2F A;  3VP1 A;  4P0M A;  1HLU P;  1D1J A;  2WKH A;  3DAV A;  1E4D A;  5HL1 A;  3HLD A;  4WF0 A;  4NG2 A;  3QP1 A;  3BRM A;  3EGD C;  1FIL A;  5EFW A;  1XXM A;  3OCL A;  5CX7 A;  2ZC5 B;  4EW7 A;  1UWP X;  5EVL A;  1BLC A;  2VZW A;  4JPM A;  4JF5 A;  3UB9 A;  1KE4 A;  2XSS A;  1PW8 A;  3IF5 A;  1G6O A;  4HY8 A;  4EXO A;  2CMN A;  5AVE A;  3B42 A;  4DXB A;  4LV3 A;  3NIA A;  2VGL S;  5M18 A;  4I5S A;  4MBH A;  5FAO A;  1L0F A;  2WKI A;  2Y2H A;  3ITB A;  2FFY A;  1GA0 A;  2Y2K A;  3IQA A;  2OWJ A;  3A0V A;  4C6Y A;  3EQU A;  4R23 A;  3DW0 A;  3HLC A;  4EEP A;  2Q9N A;  3C5A A;  5AJG A;  3V67 A;  2XK1 A;  1HZO A;  4F3L B;  3UB6 A;  1VM1 A;  4LCL A;  4I3I A;  4B88 A;  3MQO A;  1H5X A;  5G4Y A;  5EUA A;  2FH5 A;  1BZA A;  4R3B A;  2XGN A;  3JPU A;  4RYE A;  2W3F A;  3E4P A;  4QD4 A;  2H0T A;  2WUQ A;  2ZL1 B;  3FPV A;  3IF6 B;  3LI8 A;  3BYD A;  3F1O A;  2GZA A;  4Y15 A;  3BY9 A;  1PWD A;  5CGX A;  4CLC A;  5CHU A;  3W8K A;  4CJN A;  3NJA A;  3SZT A;  3C30 A;  1ERM A;  3B3X A;  1CF0 A;  5EOE A;  3C2W A;  3OCN A;  5A93 A;  2EA9 A;  4NXG A;  1K54 C;  4OPR A;  3AGF A;  3ZFZ A;  4OOY A;  4S2N C;  1HD8 A;  3PBS A;  3ICY A;  3T50 A;  2Y2P A;  2KOI A;  3HLB A;  4FD8 A;  2OV5 A;  3UY6 A;  4LLO B;  2A24 A;  3NOU C;  4S2L A;  2ZOI A;  3LIC A;  4X68 A;  5FAP A;  5KIZ A;  1DP6 A;  1XPB A;  2WGW A;  3GSG A;  2O99 A;  2B18 A;  2O0Y A;  2JC7 A;  3T1S A;  2ZQ7 A;  3PYP A;  4D2O A;  1IKG A;  2WKQ A;  5FQI A;  2HPB A;  2PBY A;  5FQK A;  4KEN B;  2QJ7 A;  1NRF A;  5EVI A;  3UE1 A;  4ZJ1 A;  3IH8 A;  5IHV A;  4R4R A;  5IT5 A;  5JYP A;  5EE8 A;  4F3L A;  4CLC D;  1ODV A;  3MMH A;  2H0Y A;  1K55 C;  4Y5F A;  5GLC A;  2ZM2 A;  1MWR A;  4EQI A;  2HJ9 C;  3GEC A;  3TOI A;  5GHY A;  4X1L A;  5BOH A;  1OT9 A;  4HEF A;  3O88 A;  5K5B A;  2DRW A;  3HRE A;  3MZF A;  5FQQ A;  3NDE A;  4BWI A;  4IJG A;  4WZ4 A;  2HDS A;  4ZRR A;  5J4E A;  3GTC A;  1OTD A;  2P04 A;  4P6Z S;  5DKL A;  1XA1 A;  3ZGA B;  1MBL A;  1LSX A;  2ZMV A;  4NK3 A;  4QPR A;  4KZ8 A;  5F1G A;  1XX2 A;  1KGF A;  2AVX A;  5HAI A;  4O0P A;  3HVF A;  4GB7 A;  4MCW A;  5CTN A;  1Z09 A;  5DKK A;  2GNX A;  2Y2G A;  1X0O A;  1M6K A;  4FSF A;  4B93 A;  3IBJ A;  3L9K A;  4DXC A;  4IHQ A;  4LRX C;  4OQ0 A;  1DP9 A;  1K54 A;  5J7E A;  2VGL M;  4UEY A;  3PBR A;  5HFO A;  2VLG A;  5CGS A;  4OPQ A;  2ZC3 B;  1BLH A;  3ITA A;  4FOF A;  3D9Y A;  4BBV A;  2VX8 A;  3A3E A;  2H28 A;  2EFX A;  2ZQA A;  1WA9 A;  2M7U A;  3LEZ A;  5FAQ A;  1BUL A;  3C7U A;  4WMC D;  3GV9 A;  5E2E A;  3VP2 A;  4DKI A;  3NCK A;  3UNW A;  4ARZ A;  3NOT C;  1TS6 A;  1CI9 A;  4P6Z M;  4Z1W A;  2XDM A;  4OVD A;  3LIF A;  4OPY A;  3VFH A;  4E3N A;  4X1M A;  3T12 B;  3G31 A;  2RCX A;  3MXS A;  3BQ8 A;  1PNE A;  1KE3 A;  3PBT A;  1K38 A;  5TFQ A;  4HBU A;  3NOP C;  5GHX A;  4DJ2 A;  2PRF A;  1MXO A;  5HPF A;  3ZYT A;  2V8F A;  3BLM A;  1YQS A;  2Z2M B;  3NDG A;  1PZP A;  4WBG A;  2W27 A;  4YWZ A;  5HL6 A;  1IEL A;  4DDY A;  4MBF A;  1KGE A;  2QHK A;  5J3W A;  5FAT A;  4MMN A;  1DJB A;  1YT4 A;  3W4Q A;  2WAD A;  1IEM A;  2D02 A;  3LUQ A;  2ZQ9 A;  3R4K A;  3HUO A;  4M3K A;  3ZG5 A;  1CEG A;  5DF7 A;  3WS2 A;  3IWO A;  4XUX A;  4O8G A;  4KQQ A;  5C5K A;  4MN7 A;  1K57 A;  1JNU A;  3Q7V A;  4GS9 A;  4GN2 A;  4MN6 A;  2ZJ9 A;  2P9V A;  2QKP A;  5EM1 A;  1N9O A;  3A0S A;  4HP4 A;  2J3W A;  4HHD A;  3H82 B;  4Y3I A;  3VSL A;  4PPR A;  4OPZ A;  1U60 A;  1YLT A;  4B9O A;  2W3H A;  3T4O A;  3F1P A;  5HSQ A;  2Y2Q A;  3HLF A;  3H7W A;  1VEU B;  4UA9 A;  2QPN A;  4P6B A;  2VV6 A;  1UWN X;  4JXG A;  1OME A;  4CPK A;  1DJA A;  4FH4 A;  4PAU A;  3ZG8 B;  1GA9 A;  5EVI C;  1S66 L;  4L0L A;  1Q2Q A;  5HD3 A;  3A3F A;  4R0Q A;  2FZ0 A;  1TS0 A;  2QZ6 A;  4KZ9 A;  4HH3 A;  2ZMA A;  3DTM A;  4BL3 A;  4UHU A;  1VEU A;  3UE3 A;  5FQM A;  3BY8 A;  2PBD P;  1O07 A;  3WRT A;  5F69 A;  5KZH A;  3N8S A;  4KZA A;  1ZKJ A;  4QY5 A;  3LI9 A;  2EXA A;  1ZC2 A;  3TRC A;  2GDN A;  1ZG6 A;  1EW0 A;  4EBP A;  5HDS A;  4KQD A;  3PAE A;  4R3A A;  1SDE A;  1XJ2 A;  2B5R A;  3NEC A;  1MPL A;  3IXB A;  2XH9 A;  4BLM A;  4WN5 A;  2HDQ A;  2JN7 A;  2WAF A;  2DMW A;  1A0K A;  4UA7 A;  1Z6F A;  3CMZ A;  5FA7 A;  2OLU A;  2PYR A;  3O5Y A;  5GLB A;  3V50 A;  4CLC B;  3UB7 A;  4UAA A;  1K56 A;  2W0N A;  1JWZ A;  2ZL1 A;  2HV1 A;  4JBF A;  1H3Q A;  2JCH A;  2Q0O A;  4KG2 A;  4HQA A;  1Y4O A;  3N6I A;  3IH9 A;  3QNC A;  1LHY A;  3C7V A;  4ZBE A;  3FG8 A;  2OSU A;  3D72 A;  3FC7 A;  2WZZ A;  2Y2I A;  4EV4 A;  2Y4A A;  3WS1 A;  1JWP A;  2PDR A;  3HCY A;  1H0M A;  3RXW A;  3RFB A;  4HOI A;  4GW9 A;  4EWF A;  1ES2 A;  3KSI A;  3LIB A;  2XLN A;  3UO9 A;  4IUK A;  2JKR I;  3TG9 A;  2XR0 A;  1F5M A;  5FI6 A;  5HAR A;  3K2N A;  2XFS A;  4EBN A;  5LBR A;  2GX5 A;  4H6J A;  3LEQ A;  4X6T A;  2VJW A;  4WM9 A;  3NC8 A;  4GCZ A;  3RH8 B;  2XA7 S;  4Q0I A;  1FSW A;  3FKV A;  3GVB A;  1IYO A;  3DTE A;  3UDI A;  1W8Q A;  3ZNY A;  3IX4 A;  3BEC A;  3UME A;  1W7F A;  3T4Q A;  3IT9 A;  2J3T D;  1NXY A;  3Q81 A;  3HUN A;  3LIE A;  3K3D A;  4HES A;  3VOZ A;  1YM1 A;  3PBO A;  2KX6 A;  1T18 A;  2Y79 A;  4DE0 A;  1NZU A;  3UE0 A;  3UDX A;  1N9N A;  4IBR A;  1V9Y A;  1TDG A;  1XGI A;  4MDZ A;  1XFQ A;  1SHV A;  1XKZ A;  1OTI A;  5HW3 A;  3G2Y A;  4OH0 A;  3R7W A;  4IED A;  2J80 A;  4UQI M;  1I2S A;  3S7N A;  3O87 A;  3VV4 A;  5FQ9 A;  3HJI A;  4K91 A;  4NKP A;  2J9P A;  3BFG A;  1NRJ A;  1ZG4 A;  2V20 A;  4E3I A;  3HLE A;  2R9W A;  2OAP 1;  4U0X A;  3M2J A;  2ZOH A;  5TJJ A;  1KVL A;  1SCW A;  3UPP A;  2ZQD A;  3S1Y A;  2HGV A;  3LCE A;  3QHY A;  3BLS A;  1S1Y A;  4IUH A;  4HNB A;  1BUE A;  1H8Z A;  4Y2F A;  3DTI A;  3PBN A;  4PM9 A;  3IX8 A;  5F6A A;  3IWI A;  2R9X A;  4AFI A;  3CPT B;  4JF4 A;  1K0K A;  2V1A A;  5HAP A;  4X69 A;  4BL2 A;  4RX2 A;  4HP9 A;  3LY3 A;  4QWO A;  4FUW A;  2OAQ 1;  3SOI A;  3IS2 A;  4E04 A;  1BLS A;  2PR6 A;  3G2Z A;  4RQ9 A;  3CUE A;  2JE5 A;  4JGQ A;  4Y13 A;  1L0E A;  2IWB A;  3ZG7 B;  3IXD A;  1LL8 A;  3N8R A;  1ACF A;  4DMZ A;  4WEL A;  4HBT A;  2HJE A;  5TBM B;  1KE0 A;  3VSK A;  4S2J A;  1YLY A;  4OOM A;  1FSY A;  3OPL A;  2G7U A;  4N1H A;  1NLY A;  4BQM A;  3EQV A;  3LIA A;  2VGK A;  1PFL A;  2Z6D A;  3W4P A;  1PZO A;  5EVE A;  3P01 A;  1LI0 A;  5TR7 A;  2X01 A;  4IBX A;  5FEF A;  3PTE A;  5G4Z A;  5AQ7 A;  1CK3 A;  3OOV A;  4JXS A;  3ZCZ A;  2A2L A;  3E2L A;  3IBR A;  1T1A A;  3MS6 A;  4IVK A;  3HLG A;  4KZ4 A;  3KSF A;  3CAX A;  2QMI A;  3I7J A;  4P85 A;  3MSH A;  4K08 A;  1LL5 A;  1XP4 A;  3IHB A;  4N92 A;  3UE6 A;  1UGU A;  4GD6 A;  5DTS A;  5GHZ A;  5A90 A;  1C3B A;  1ZHH B;  5DJT A;  2X02 A;  2ZC4 B;  4QHC A;  3S22 A;  5EPH A;  2NUT C;  5KSH A;  2PT7 A;  4R70 A;  3ZG9 B;  1QMF A;  1NJ4 A;  2K2N A;  2Q9M A;  5HWV A;  5GLA A;  4ZAM A;  3CJM A;  1PIO A;  1YLJ A;  4PKY A;  4QB8 A;  4R4S A;  2J8Y A;  1BT5 A;  5L2F A;  1S67 L;  4ZJ3 A;  1LSW A;  4YIN A;  1YKD A;  2O9C A;  1RCJ A;  2JBF A;  2Z2L B;  4JXW A;  1K4E A;  4LFU A;  3GDI A;  1D7E A;  2HP9 A;  2XF3 A;  5TBM A;  3UB5 P;  3ULF A;  4LCM A;  5CER A;  2EX9 A;  4EES A;  2HDU A;  1S0W A;  2BG1 A;  4BBU A;  4KZ7 A;  5CXW A;  3L7H A;  2QWS A;  2XFT A;  4PMA A;  3OBF A;  3D3O A;  1E3U D;  1SZV A;  3MXR A;  3PBQ A;  2PAV P;  1NWZ A;  3MKE A;  1T1C A;  5EV0 A;  4UQI S;  4Q0H A;  1CEF A;  3T4K A;  3NUL A;  1ERO A;  3Q7V B;  3BWL A;  1XGJ A;  2A49 A;  4DE3 A;  1FR1 A;  2HP6 A;  5AVF A;  2VEA A;  3GRJ A;  4NET A;  1RGY A;  2Y2M A;  3C38 A;  4R1G A;  2W3E A;  5GL9 A;  1SKF A;  4GOG A;  3C4O A;  3G35 A;  5F68 A;  4WUJ A;  4X56 A;  3SH8 A;  3BFC A;  3TE8 A;  1SKO B;  1PI4 A;  3P7N A;  3QP6 A;  1TDL A;  4XXR A;  5F82 A;  2W3D A;  3DBA A;  3AGE A;  1S4R A;  3N8L A;  5I5L A;  3MZE A;  3MQ0 A;  4ETZ A;  4KZ6 A;  3UMD A;  3GMW A;  2Y2L A;  3OLO A;  2K31 A;  4K0X A;  2W1T A;  1W63 Q;  2HP5 A;  1ES4 A;  2ZQ8 A;  1JTD A;  2LB5 A;  4X55 A;  1KDS A;  4PM6 A;  1RGZ A;  1FCN A;  3UDF A;  4G3W A;  3IXH A;  3MXQ A;  3P09 A;  1VQQ A;  4XUZ A;  1GHM A;  1MZU A;  3A3I A;  2YKH A;  2Y2O A;  4OQH A;  1WYB A;  3F1N B;  1FOF A;  3KYE A;  1PYY A;  5M1A A;  4WZ5 A;  3E4O A;  3PAG A;  2W1R A;  3MKF A;  2W3G A;  2FFF B;  4I38 A;  3QNB A;  1EI5 A;  1LT0 A;  2WAE A;  1K55 A;  3IF6 C;  1IYP A;  3T1X A;  2PU4 A;  3FWL A;  4OON A;  4BEN A;  4OP8 A;  4JGP A;  3PHY A;  5EEC A;  5HD5 A;  1XFN A;  4PM8 A;  4CLC C;  4O01 A;  4EBL A;  4I3A A;  1DRM A;  2MJ6 A;  4K0W A;  3C8C A;  4HI4 A;  1YSP A;  3T1R A;  3S7P A;  4B4X A;  4Y0T A;  2ZQC A;  3R7W B;  1PW1 A;  4LV2 A;  1AXB A;  5AQ9 A;  2XD1 A;  2P08 A;  2Y55 A;  1NYM A;  4Q8I A;  1G68 A;  2Z6C A;  2WYX A;  1IFQ A;  2P7J A;  5EM0 A;  3WS5 A;  2ACG A;  5EOO A;  3Q07 A;  2ZC6 B;  3ISG A;  3VP3 A;  2JKG A;  1YMX A;  2L4R A;  1O7E A;  3H7W B;  1ERQ A;  1MKI A;  1KVM A;  1K25 A;  3CI6 A;  2X71 A;  4R3J A;  4PKY G;  2V9A A;  1J3W A;  2WGI A;  3CZD A;  3ZNT A;  2P9V B;  4Z9Q A;  4GS9 B;  2XRN A;  3S4X A;  2V0U A;  1ZTU A;  4GNU A;  4ESP A;  3RXX A;  2J7V A;  1XJ4 A;  4N9K A;  3C4P A;  1Y54 A;  5DVA A;  1MC0 A;  1TS7 A;  4YNR A;  3ZDJ A;  1W63 M;  4EER A;  2C5W B;  1WE4 A;  1XJ3 A;  4N1X A;  3KO6 A;  1KDW A;  1VHM A;  2XEP A;  1XJ6 A;  5HDD A;  3HUM A;  5CEC A;  2V1B A;  2H5S A;  2PD8 A;  4LRZ E;  2Y91 A;  3ZVT A;  1Q2P A;  5FSR A;  2VA0 A;  4LPZ A;  3MFD A;  3JVU A;  4EU0 A;  2OWH A;  2R78 A;  1K4F A;  3MZD A;  3DWK A;  3CLO A;  4GZB A;  3V39 A;  4KZ5 A;  4E3J A;  1LL9 A;  3PR6 A;  4BBT A;  5CHJ A;  1I5Q A;  1HTZ A;  1RP5 A;  3IF6 A;  1F98 A;  5DFY A;  2EX2 A;  4Y0U A;  1H8Y A;  1P97 A;  5DF9 A;  3MQQ A;  4ZDX A;  2K7S A;  1SDN A;  3A3J A;  3GQZ A;  3AGD A;  5M19 A;  3OPH A;  1JWV A;  3TJZ C;  4RVA A;  4R38 A;  3LFV A;  3EEH A;  3HLW A;  4G3K A;  1BLP A;  1L0G A;  4LV0 A;  1LI9 A;  2OLV A;  5KSC A;  2WK0 A;  2J3T C;  3H9W A;  3OPR A;  4JGO A;  2W1T B;  4KG6 A;  2V2F F;  2EX6 A;  2WGV A;  3U4L P;  1JVJ A;  4QJG A;  2RL3 A;  5FDS A;  3MJQ A;  3F1O B;  1CJF A;  2M1C A;  3LR4 A;  2I72 A;  2ZD8 A;  4GHI A;  1IKI A;  1ES5 A;  4HJ4 A;  3NHQ A;  1M40 A;  3H82 A;  4S2M A;  4NXB A;  4KUK A;  2CC1 A;  3G32 A;  4YOF A;  3WWX A;  5L07 A;  2E8J A;  1OT6 A;  3SS5 A;  3K3C A;  3HL9 A;  4EEU A;  1N9L A;  2EWW A;  4GDB A;  2ZM8 A;  1JTG A;  1L0D A;  3BQA A;  5D3O A;  4U0T A;  4BD1 A;  1TF1 A;  3HBR A;  3VOY A;  3FZC A;  3G30 A;  2JKT M;  3E4Q A;  4EUV A;  4NEE D;  3ZHH A;  3V3S A;  3SW1 A;  1TVF A;  4HJ6 A;  5L09 A;  4BD0 A;  3A0R A;  5CEB A;  1TEM A;  4KQO A;  2YKF A;  2ZBB A;  4QU3 A;  2WKE A;  4RX3 A;  2P74 A;  1YSQ A;  4S2P A;  5HZH A;  4H6J B;  1OJG A;  3E0Y A;  3NBL A;  1NLZ A;  1PRQ A;  1VB6 A;  2Y8H A;  3LID A;  5GLD A;  2IWD A;  4MN5 A;  3V3R A;  1N9B A;  5F83 A;  4ARZ B;  4U3T A;  3T4S A;  2EX8 A;  3NY4 A;  4L9F A;  4FTX A;  4E3K A;  3RTY A;  3G34 A;  1ESI A;  4EET B;  2LB9 A;  2PYP A;  3BEB A;  3DTK A;  2O9B A;  3TSG A;  2UV0 E;  3KX0 X;  2M7V A;  2WKR A;  3QP4 A;  4RA7 A;  4DN0 A;  5E2H A;  1PWG A;  3GR2 A;  1ONG A;  4LV1 A;  1ONH A;  1OPX A;  1G6A A;  5DF8 A;  3N7W A;  5FEG A;  3IS2 B;  4OLD A;  1BSG A;  1NZO A;  3O86 A;  2IWC A;  4Y7P A;  4HIA A;  1MWU A;  3HJK A;  3QP2 A;  1LLB A;  1W8Y A;  2DNS A;  4X53 A;  3ZVW A;  4ZJ2 A;  2J9O A;  4Y17 A;  1P9W A;  5JYO A;  4DJ3 A;  4JKT A;  5EVI B;  1PI5 A;  3T4L A;  4WLA A;  3SH9 A;  2HDR A;  2QYB A;  4PM5 A;  4H8R A;  2XA7 M;  1D06 A;  4MEZ A;  4D60 A;  1PWC A;  4LRY C;  3CPT A;  4N9L A;  4UA6 A;  1FCM A;  2JHE A;  1T19 A;  3E98 A;  2KLI A;  4DDS A;  3EEA A;  1SKO A;  4MNR A;  3F1N A;  2HZ5 A;  4WZ5 C;  3JYI A;  1EWZ A;  2Y2N A;  5L8M A;  1ES3 A;  3T4T A;  1FIK A;  1GHP A;  3PXP A;  1E3U A;  4FCF A;  4DE2 A;  3IX3 A;  3SS3 A;  1G5U A;  4I39 A;  5IU1 A;  4S2O A;  2XQZ A;  4JF6 A;  3UN7 A;  3MFX A;  1YMS A;  4X25 A;  3F1P B;  2V8C A;  4A5R A;  2PR5 A;  1F2K A;  1T1B A;  4L9G A;  3BFE A;  4GHI B;  5U47 A;  5HX9 A;  1LSV A;  2L0W A;  1L2S A;  3G4P A;  2ZM0 A;  3OPP A;  3KYQ A;  4GKU A;  3UB8 A;  3EWK A;  4LEN A;  2OOL A;  3CUE C;  4C75 A;  1YLW A;  4JGR A;  4MLL A;  4KG5 A;  1V9Z A;  1STZ A;  3E2K A;  4BMW A;  3CWF A;  3DWZ A;  1KGG A;  3BM6 A;  1S1Z A;  4M4X A;  3JVV A;  2JKT I;  3FV7 A;  2Y2J A;  3LO7 A;  5FDH A;  2G2U A;  4OQG A;  1F9I A;  4KZ3 A;  4II7 A;  1NY0 A;  4EQ1 A;  3LR3 A;  2DCF A;  4LGW A;  2Y59 A;  5AQB A;  1VET A;  5CTM A;  2JKF A;  1DP8 A;  5DTK A;  5A91 A;  4OP5 A;  5FI2 A;  4E6X A;  2JKR M;  1XA7 A;  3D4F A;  4ID4 A;  4KZB A;  2VGJ A;  4Y0O A;  1ESU A;  1GSV A;  1L3L A;  4E3O A;  1P0Z A;  4GJ4 A;  1HVB A;  3KYZ A;  3OZH A;  2VV7 A;  1K57 C;  5E43 A;  4DF6 A;  2VK3 A;  4ZTK A;  2PU2 A;  1VET B;  2BAS A;  3B33 A;  3VFF A;  3KSG A;  5A8B A;  1QME A;  3IWQ A;  3FYZ A;  3T4J A;  4E3M A;  3BJN A;  3VE4 A;  5MC7 A;  3BFD A;  1GHI A;  1GSX A;  5HWT A;  5I94 A;  3ZG0 A;  3WS4 A;  4S2I A;  3M2K A;  3MBZ A;  5F5Y A;  2GJ3 A; 
#chains in the Genus database with same CATH homology
 4AFI A;  1MKM A;  1OT9 A;  2V1A A;  3U2A A;  2WKP A;  5K5B A;  3PR6 A;  4HP9 A;  4BBT A;  4HJ3 A;  2OAQ 1;  4KUO A;  1F98 A;  5DFY A;  3IS2 A;  4E04 A;  4BWI A;  3LR0 A;  4IJG A;  2A24 B;  2L1M A;  4ZRR A;  5J4E A;  1P9R A;  1OTD A;  1P97 A;  2PR6 A;  2EWV A;  4RQ9 A;  2P04 A;  1H8M A;  3CUE A;  4JGQ A;  4P6Z S;  5DKL A;  5DF9 A;  3MQQ A;  2K7S A;  1BYW A;  1LSX A;  1LL8 A;  2ZMV A;  3KSH A;  4QPR A;  4DMZ A;  4WEL A;  4PHT A;  3TJZ C;  2HJE A;  5TBM B;  4XT2 B;  2I9V A;  4R38 A;  4NXF A;  3LFV A;  3EEH A;  4OOM A;  4O0P A;  4MCW A;  4G3K A;  2B02 A;  5DKK A;  1G28 A;  2G7U A;  1NLY A;  2GNX A;  1X0O A;  2J3T C;  3EQV A;  3H9W A;  3LIA A;  4FSF A;  4GLQ A;  4JGO A;  4B93 A;  3IBJ A;  2W1T B;  3ZQ5 A;  4IHQ A;  4LRX C;  2Z6D A;  5HPI A;  1DP9 A;  3P01 A;  5J7E A;  2VGL M;  2PD7 A;  4R6L A;  4UEY A;  3CIT A;  3PBR A;  3VOL A;  3MJQ A;  3F1O B;  2VKS A;  2VLG A;  2VV8 A;  1S4S A;  5G4Z A;  3OOV A;  2M1C A;  2PHY A;  2A2L A;  3LR4 A;  3IBR A;  1T1A A;  4FOF A;  2IA2 A;  3KSF A;  4BBV A;  4GHI A;  3CAX A;  2VX8 A;  2H28 A;  1WA9 A;  2M7U A;  4K08 A;  4WEK A;  4HJ4 A;  3UE6 A;  1UGU A;  3G6O A;  3NHQ A;  3H82 A;  4NXB A;  4BJP A;  4KUK A;  1ZHH B;  3FPW A;  3LR5 A;  4ARZ A;  5FL3 A;  5DJT A;  3NOT C;  5IS1 A;  1TS6 A;  4YOF A;  4P6Z M;  2NUT C;  4Z1W A;  5KSH A;  3LIF A;  4Q0J A;  2PT7 A;  4R70 A;  4WL9 A;  1OT6 A;  3MR0 A;  3K3C A;  2K2N A;  1OTE A;  5HWV A;  4EEU A;  1N9L A;  4NXE A;  2EWW A;  4G3V A;  3BQ8 A;  4WEJ A;  4PKY A;  3S7Q A;  2HF6 A;  5HDC A;  3PBT A;  2NUP C;  1S67 L;  3BQA A;  4ME4 A;  3NOP C;  4DJ2 A;  1LSW A;  1TF1 A;  3BW6 A;  1YKD A;  2O9C A;  5HPF A;  3ZYT A;  3MF0 A;  2JKT M;  3S7O A;  3GDI A;  3E4Q A;  3EGX C;  3OC2 A;  4EUV A;  2XRO A;  4NEE D;  1D7E A;  5TBM A;  3SW1 A;  4I3J A;  4HJ6 A;  2W27 A;  4YWZ A;  5HL6 A;  2D01 A;  3ULF A;  2V0W A;  2ZMF A;  3A0R A;  4EES A;  2QHK A;  4XT2 A;  5J3W A;  4KQO A;  4BBU A;  2YKF A;  4MMN A;  5DFX A;  2ZBB A;  1OTA A;  2QWS A;  3OBF A;  1TS8 A;  4OOL A;  3D3O A;  2D02 A;  3LUQ A;  1OJ5 A;  3R4K A;  1YSQ A;  3PBQ A;  1NWZ A;  5HZH A;  1T1C A;  4H6J B;  4UQI S;  4Q0H A;  1IOU A;  3T4K A;  4O8G A;  1OJG A;  5C5K A;  3E0Y A;  1GSW A;  4MN7 A;  2QJ5 A;  2KDK A;  3BWL A;  1JNU A;  1NLZ A;  4L9E A;  4GS9 A;  1YAX A;  1VB6 A;  2Y8H A;  3LID A;  3LYX A;  4MN6 A;  2QKP A;  5DJU A;  4HH2 A;  4MN5 A;  5AVF A;  4CLC E;  1N9O A;  4ARZ B;  3T4S A;  2VEA A;  3A0S A;  4HP4 A;  2J3W A;  4HHD A;  3TW8 A;  3H82 B;  4L9F A;  4Y3I A;  3C38 A;  4B9O A;  3EOI A;  3RTY A;  2W3E A;  2W3H A;  3T4O A;  3F1P A;  4EET B;  2LB9 A;  2PYP A;  3B47 A;  5F68 A;  2O9B A;  5HSQ A;  4WUJ A;  3KX0 X;  4ETX A;  3W2Z A;  2M7V A;  3H7W A;  2WKR A;  3TE8 A;  2O9A A;  1KOU A;  5HWW A;  2VV6 A;  3P7N A;  4DN0 A;  1UWN X;  1OPX A;  2INW A;  4PAU A;  2W3D A;  1S66 L;  3DBA A;  4L0L A;  1OTB A;  3IS2 B;  4CQH A;  5HD3 A;  1S4R A;  5I5L A;  2FZ0 A;  3MQ0 A;  1TS0 A;  1Y28 A;  4ETZ A;  3UMD A;  3VE3 A;  4HH3 A;  3UE3 A;  1TD5 A;  3BY8 A;  3OLO A;  2K31 A;  4HIA A;  3HJK A;  5F69 A;  2W1T A;  1W63 Q;  3LI9 A;  3TRC A;  4WF0 A;  1EW0 A;  1P9W A;  2LB5 A;  5HDS A;  3EGD C;  4KQD A;  4DJ3 A;  5EFW A;  4R3A A;  1XJ2 A;  3T4L A;  4WLA A;  4G3W A;  3OCL A;  3MXQ A;  5CX7 A;  4WN5 A;  4EW7 A;  1UWP X;  2QYB A;  1MZU A;  2VZW A;  2JN7 A;  3UB9 A;  2DMW A;  2XA7 M;  2YKH A;  1D06 A;  2XSS A;  2PYR A;  3O5Y A;  4CLC B;  4LRY C;  3UB7 A;  3F1N B;  1G6O A;  3E4O A;  2JHE A;  1T19 A;  3E98 A;  2CMN A;  2W0N A;  2W3G A;  2W1R A;  4HY8 A;  5AVE A;  4EXO A;  2HV1 A;  2KLI A;  3B42 A;  3EEA A;  1H3Q A;  4I38 A;  2VGL S;  3F1N A;  1LT0 A;  4I5S A;  5L8M A;  3T4T A;  4HQA A;  3PXP A;  4JGP A;  3PHY A;  3FG8 A;  5HD5 A;  3D72 A;  4I39 A;  2OWJ A;  5IU1 A;  1XFN A;  3FC7 A;  3MFX A;  3A0V A;  3EQU A;  3F1P B;  4EEP A;  5AJG A;  4CLC C;  2PR5 A;  3V67 A;  1T1B A;  4O01 A;  4L9G A;  4F3L B;  3UB6 A;  4GHI B;  4I3A A;  1DRM A;  2MJ6 A;  2PDR A;  3HCY A;  1LSV A;  3C8C A;  4HI4 A;  4I3I A;  1YSP A;  3RFB A;  2L0W A;  3S7P A;  4HOI A;  4GW9 A;  3MQO A;  3KSI A;  3R7W B;  3LIB A;  5G4Y A;  4IUK A;  2FH5 A;  2JKR I;  3KYQ A;  3UB8 A;  3EWK A;  2OOL A;  1F5M A;  3CUE C;  3K2N A;  2W3F A;  3E4P A;  5LBR A;  2GX5 A;  2P08 A;  4JGR A;  4H6J A;  1V9Z A;  2VJW A;  3FPV A;  1STZ A;  3LI8 A;  4BMW A;  3F1O A;  2GZA A;  3CWF A;  2Z6C A;  3BY9 A;  4GCZ A;  1IFQ A;  4CLC A;  2P7J A;  1S1Z A;  4M4X A;  3RH8 B;  2XA7 S;  4Q0I A;  3JVV A;  3NJA A;  3C30 A;  2JKT I;  2L4R A;  3UME A;  3H7W B;  3T4Q A;  2J3T D;  3C2W A;  3OCN A;  1F9I A;  2EA9 A;  4NXG A;  4II7 A;  3LIE A;  3CI6 A;  3K3D A;  4EQ1 A;  3LR3 A;  3PBO A;  4PKY G;  2KX6 A;  2V9A A;  1T18 A;  3PBS A;  2Y79 A;  3ICY A;  1N9N A;  3T50 A;  2KOI A;  1V9Y A;  4GS9 B;  2XRN A;  4MDZ A;  2V0U A;  1ZTU A;  1XFQ A;  1DP8 A;  4LLO B;  1OTI A;  1XJ4 A;  2A24 A;  3NOU C;  2ZOI A;  3LIC A;  5KIZ A;  1DP6 A;  1MC0 A;  2JKR M;  1TS7 A;  2O99 A;  3R7W A;  2J80 A;  4YNR A;  2B18 A;  4UQI M;  2O0Y A;  3S7N A;  3VV4 A;  1W63 M;  1GSV A;  4EER A;  3PYP A;  3HJI A;  1P0Z A;  1XJ3 A;  4GJ4 A;  3KO6 A;  2WKQ A;  4NKP A;  1VHM A;  3KYZ A;  1NRJ A;  2VV7 A;  2QJ7 A;  2BAS A;  3B33 A;  1XJ6 A;  3KSG A;  5A8B A;  5HDD A;  3T4J A;  2V1B A;  2OAP 1;  3BJN A;  2PD8 A;  4LRZ E;  3VE4 A;  5IT5 A;  4F3L A;  2ZOH A;  1ODV A;  5TJJ A;  3MMH A;  2VA0 A;  4CLC D;  5MC7 A;  4LPZ A;  2HGV A;  4Y5F A;  1S1Y A;  1GSX A;  4IUH A;  5HWT A;  3JVU A;  4EU0 A;  4HNB A;  2OWH A;  2HJ9 C;  2R78 A;  3GEC A;  4Y2F A;  5F5Y A;  3CLO A;  2GJ3 A;  3PBN A;  5F6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...