5IS1A

Crystal structure of the extracellular domain of sensor histidine kinase yycg from staphylococcus aureus at 2.0 angstrom resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
142
Chain Sequence
b'NNLEKELLDNFKKNITQYAKQLEISIEKVYDEKGSNAQKDIQNLLSEYANRQEIGEIRFIDKDQIIIATTKQSNRSLINQKANDSSVQKALSLGQSNDHLILKDYGGGKDRVWVYNIPVKVDKKVIGNIYIESKINDVYNQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine kinase
publication title Structural Studies on the Extracellular Domain of Sensor Histidine Kinase YycG from Staphylococcus aureus and Its Functional Implications
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 44
structure length 142
sequence length 143
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2016-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5is1A00
4I3JA 3LIBA 2JHEA 2QWSA 2PHYA 2V0UA 3UE6A 3A0RA 4EESA 2YKHA 3IS2B 1OT9A 1XJ3A 4EQ1A 4WL9A 3BY8A 2V1AA 1OTBA 2PD7A 2V9AA 3VE3A 3E4OA 3PYPA 4HJ6A 3K3CA 2QHKA 5G4YA 1GSWA 4R6LA 2PR5A 5J3WA 4NXFA 4HOIA 2KDKA 4EEUA 5HWWA 2EA9A 4NXBA 3K3DA 1S1YA 4WLAA 4GW9A 4HY8A 3B33A 1OT6A 5HDCA 4GS9B 3GECA 2VV8A 3NOTC 2L4RA 3NOUC 1V9ZA 5J4EA 1DP9A 3UMEA 5F68A 1ODVA 4KUKA 5KIZA 3H9WA 2PD8A 2V1BA 2P7JA 1OJGA 3UMDA 4B9OA 2K7SA 1LSWA 4XT2B 1T1AA 4BBVA 5F6AA 4I5SA 3PHYA 3UB8A 3LIDA 3FC7A 1EW0A 4BBUA 3LI8A 1OTIA 3KX0X 5HD5A 2OWHA 3H82A 4HP9A 1XJ6A 1T1CA 4L9GA 4DJ2A 4EXOA 3E4PA 1S66L 4KQDA 2QJ7A 1F98A 3CWFA 2GJ3A 4JGOA 2W0NA 2PR6A 1D06A 3H82B 3VE4A 1LT0A 4R38A 2I9VA 3IBRA 5HDSA 3MR0A 1JNUA 2ZBBA 4L9EA 1N9NA 4HHDA 4MN6A 4JGPA 2J80A 4LRYC 2L1MA 3ICYA 1OTEA 3CLOA 3NJAA 1D7EA 5I5LA 4WN5A 4HP4A 3EWKA 5HSQA 4GS9A 1VB6A 5HZHA 2CMNA 1T1BA 2OOLA 4WUJA 1T18A 2WKPA 4R70A 3F1NA 4KUOA 5F5YA 4GCZA 4PKYG 2Z6CA 2M1CA 3CAXA 3HJKA 4MN5A 2OWJA 1MZUA 5HWVA 1GSXA 4GHIA 4RQ9A 1LL8A 1LSVA 2VV6A 5DKLA 4HJ3A 3F1NB 4BBTA 1UGUA 3EEHA 5DJTA 1BYWA 4XT2A 1N9LA 5HD3A 1LSXA 4GHIB 1DP8A 3NHQA 3MFXA 1TS0A 3E4QA 2INWA 4HH2A 3UB7A 2ZOIA 1DP6A 4I38A 1DRMA 5G4ZA 4EEPA 3LIFA 1V9YA 1S1ZA 5DKKA 3LUQA 3UB6A 3LYXA 2PYRA 4I39A 2WKQA 3LICA 5IU1A 3OLOA 3MQQA 4LLOB 1Y28A 4LRZE 4HNBA 3LIEA 4H6JA 3F1OB 1XJ4A 3GDIA 4M4XA 4K08A 1S67L 2PYPA 1GSVA 3LI9A 1P0ZA 3MQOA 1F9IA 3H7WB 3ZQ5A 2V0WA 1UWNX 4HQAA 1TS7A 1UWPX 4LPZA 4HI4A 1OTDA 1XFNA 3HJIA 2Z6DA 1T19A 4H6JB 5EFWA 2QJ5A 1XFQA 4I3AA 4WF0A 3RTYA 1XJ2A 2BASA 2H28A 3RH8B 3P7NA 3NOPC 2A24A 2VLGA 3A0VA 4HJ4A 4YWZA 3FG8A 2W27A 1KOUA 1P97A 1S4SA 2VEAA 3VOLA 3D72A 4EERA 1TS8A 2D02A 4HH3A 5TBMA 4NXEA 2B02A 1OTAA 2QKPA 1OJ5A 2A24B 2VV7A 5IS1A 4I3IA 4E04A 5J7EA 4EETB 3UB9A 5DJUA 2WKRA 5TBMB 4F3LA 2PDRA 1X0OA 1WA9A 5AVEA 2L0WA 4DJ3A 4L9FA 3C8CA 3A0SA 2ZOHA 4EW7A 4JGRA 4F3LB 2HV1A 2KX6A 2YKFA 5A8BA 5F69A 1G28A 1TS6A 2R78A 3F1OA 4NXGA 3BY9A 3F1PA 1NWZA 3G6OA 3H7WA 5AVFA 3ULFA 2D01A 3MXQA 3LIAA 4JGQA 4PKYA 1S4RA 1N9OA 5HWTA 3SW1A 4HIAA 2JN7A 3IS2A 5HDDA 3T50A 3C2WA 3F1PB 4LRXC 4R3AA 3MJQA 3BWLA
chains in the Genus database with same CATH superfamily
1H8MA 1BLCA 3SS3A 1GHIA 1WYBA 1RGYA 2EX9A 4ME4A 1A0KA 3IS2B 3KYQA 4PHTA 1XJ3A 1M40A 1ZG6A 2G2WA 4WMCA 1DJAA 3DTEA 3BY8A 5HAIA 5HW3A 2Y2MA 3T4JA 3PBSA 4G3VA 3DTIA 4ZRRA 1J3WA 1FSYA 3PYPA 2P74A 2QHKA 5EOOA 2J3TD 4OPYA 2ZC5B 5J3WA 4HOIA 3CJMA 5FQMA 3HLCA 1YAXA 3JYIA 3K3DA 4FOFA 4NXBA 1E3UD 4KZ9A 3RXXA 4WELA 4HY8A 2LB9A 5TFQA 4DXCA 3IF5A 4P6ZM 1LHYA 4X6TA 4WZ5C 3PAGA 4GS9B 4A5RA 3SH7A 3NY4A 1RGZA 2L4RA 4JXGA 2ZM0A 3GTCA 1V9ZA 1KDWA 5I94A 3CMZA 3FPWA 1ODVA 1JTDA 1LI0A 3WS4A 3H9WA 3S7OA 3ITBA 4HESA 3CZDA 2VA0A 2Y4AA 2Y2HA 4PM5A 5CHMA 3QNBA 5FQIA 2P7JA 3UMDA 1FQGA 2K7SA 1LSWA 4X1LA 2W3EA 2A3UA 5C5KA 3KYZA 3ITAA 3LIDA 2ZJ9A 5E2GA 1K57C 3GMWA 1H5XA 4OP5A 4BBUA 1OTIA 4QJGA 4GDBA 4HP9A 1BULA 2O99A 2PT7A 4L9GA 4DXBA 4GN2A 5AQBA 5EVID 1VHMA 1F98A 2Y2PA 3G31A 3ZVTA 2PU2A 4R0QA 4JGOA 2XF3A 3E2LA 1BUEA 3V67A 4RVAA 2VKSA 1OMEA 1FR1A 4QB8A 3QP4A 1Q2PA 3DAVA 4S2KA 1OPXA 3MR0A 4S2JA 3N8LA 2XSSA 3IX3A 1MWUA 2Y2LA 1L2SA 1N9NA 4MN6A 2Y59A 3G34A 3HLEA 1FR6A 1JVJA 2XR0A 2L1MA 1ES2A 2Y8HA 3CLOA 3NJAA 2ZC3B 1D7EA 4WN5A 4OH0A 1DY6A 2ZQ7A 4GS9A 2PAVP 2OOLA 3HUMA 5L8MA 4WUJA 4R70A 1E25A 1W63Q 4LV1A 5F5YA 1L0DA 1ZG4A 4GCZA 4P0MA 5DF8A 5A91A 3CAXA 2V2FF 4ARZB 1FIKA 5EVEA 4MN5A 1MZUA 3Q81A 2IWCA 1LSVA 4EBLA 4BL2A 4GB7A 5M18A 2ZQ8A 3V39A 4BBTA 3ZCZA 1CK3A 5DJTA 4Y15A 5DFXA 1BYWA 1IYPA 4GD6A 1IYQA 1LSXA 5KZHA 3N7WA 2H0TA 3S7PA 2JKFA 3NHQA 2VK3A 1TS0A 2H0YA 3AGDA 3B47A 3OPHA 3G32A 2EX2A 1J9MA 4MLLA 1PI5A 2ZC7A 4WEKA 5F1FA 4DE1A 1JWPA 2Z2LB 4CLCD 3CUEC 1E4DA 2RL3A 1SZVA 5IHVA 5DTTA 5G4ZA 1KE4A 2P04A 3UB6A 4KZAA 5DF9A 4UAAA 3IQAA 5EM1A 2WKQA 1TVFA 5FEFA 3LICA 4MNRA 2J9PA 3MQQA 1PI4A 4S2NA 4HNBA 1EI5A 4XUZA 3MKFA 3BQ8A 5FQKA 2ZMFA 3G2ZA 4GLQA 4EBPA 1P0ZA 3QP1A 3H7WB 4ZTKA 2HJEA 1UWNX 4N1HA 1TS7A 1XPBA 3EQUA 5EV0A 1S6RA 4O01A 2Z6DA 2XLNA 4H6JB 2QJ5A 4LV0A 4QWOA 3W4QA 3GQZA 2HDQA 1XFQA 1Z6FA 4WF0A 3FKWA 1K55C 3OZHA 1LL5A 1XJ2A 3S22A 2A24A 3ISGA 4HEFA 2X02A 3FG8A 4OPQA 2VGJA 2HP6A 5EE8A 3TG9A 2WAEA 2W27A 3SS5A 4DKIA 3T4QA 2VEAA 1AWIA 1ERMA 3BJNA 2XK1A 2JKRM 4KZ5A 1WE4A 1OJ5A 1YT4A 4QY6A 4QY5A 3RXWA 5IS1A 4B88A 4I3IA 2JCHA 5L07A 5EOEA 1YLPA 4P6BA 4QD4A 4EETB 2XFSA 3PTEA 2V20A 3UE3A 3WWXA 5TGFA 4LCLA 3E0YA 2ZD8A 3HBRA 2GDNA 3C38A 1KE0A 1ERQA 2L0WA 3QP2A 4DRTA 3AGEA 3C8CA 2ZQDA 5FAOA 4F3LB 4MBKA 4D60A 1XXMA 4OQGA 3PBRA 1VEUB 5GLDA 1G28A 3G4PA 1TS6A 2R78A 4NXGA 4D2OA 1PWCA 3H7WA 3IWOA 1N4OA 2Y91A 4Q0IA 3CHWP 4OPZA 1JWZA 3LFVA 3IXBA 1N9OA 4FSFA 3M2JA 5FQ9A 2BTFP 3C2WA 3O86A 3WS0A 5HPFA 3ZFZA 3HLDA 2HP5A 4WZ4A 4I3JA 4Y0OA 3IF6B 1K4EA 3S1YA 4R3JA 4LV3A 3VMAA 3UE6A 5GLCA 2EFUA 2YKHA 5JYOA 1F2KA 4UA9A 3WS1A 4PM9A 4EQ1A 4X68A 3QP6A 2WADA 3T1RA 1ONGA 1VQQA 1MWRA 1TDGA 3E4OA 1SKOA 2J7VA 4HJ6A 3KSGA 1G6OA 1IYSA 3HREA 4LGWA 2WGWB 4R1GA 4NXFA 3T4LA 3TW8A 4YINA 5HWWA 2EA9A 4WLAA 3L7HA 3B33A 4NEED 4BMWA 4OLDA 2VX8A 2O9AA 4U0TA 4KZ6A 1TD5A 2HF6A 1G6AA 3NOTC 3MBZA 1PZOA 1K0KA 3CITA 5GHZA 5FI6A 4X56A 1IELA 4BWIA 1VEUA 4MBHA 2JE5A 4KUKA 2K31A 4BD1A 2OAP1 2OLUA 2P9VB 3NDEA 1YMXA 3V50A 3M6HA 2EX6A 2V1BA 3G30A 4B93A 1WYCA 4PAUA 1OJGA 3O5YA 3VFHA 4B9OA 4E3LA 4XT2B 2NUTC 5F6AA 1H0MA 3B42A 3UB8A 4OQ0A 3B3XA 3UDFA 4O0PA 2WUQA 5MC7A 5FI2A 4EUVA 2OWHA 4RX2A 4UEYA 2DNSA 3H82A 2JKRI 4OONA 1T1CA 5EVLA 3IXDA 4EXOA 1ES5A 3IF6A 2R9WA 4KQDA 4QU3A 5CXWA 3IXGA 4OOMA 5EPHA 1NYYA 5A92A 2XROA 2Y2QA 4L0LA 2ACGA 2Q9MA 2WZXA 4OKPA 3U4LP 4ID4A 1IYOA 1F5MA 2WGVA 4NETA 1BTLA 1LT0A 4R38A 2I9VA 5HDSA 4G3WA 2OLVA 4ZDXA 3VP0A 5AQAA 2ZQCA 3HLBA 2ZBBA 4P87A 5FDHA 4JGPA 3FWLA 2J80A 2WGWA 3MXRA 5TJJA 3G2YA 3QNCA 1SKFA 4X69A 2EFXA 3T4KA 4KQOA 2KLIA 5E43A 3ZG9B 2XFTA 4Y7PA 3EWKA 1AXBA 2G7UA 2CMNA 2B95A 2VGLS 4LV2A 4ZJ2A 3LEZA 2WKPA 4CLCE 3F1NA 4PMAA 1I5QA 3V3RA 5L09A 4PKYG 1HVBA 1GA9A 2XA7S 5AQ9A 2Z6CA 2M1CA 3MF0A 4MMNA 3FPVA 3HJKA 2WK0A 2OWJA 3MZFA 2P9VA 4GHIA 3IH8A 2AVXA 1UGUA 3EEHA 2HJ9C 1ES4A 4JXVA 4KZ4A 5F82A 3UPOA 4Y0UA 4XT2A 4ESPA 5HD3A 4DE3A 4PM8A 1W79A 1K56A 5FQQA 1H8YA 5FQJA 5HARA 1PWDA 2INWA 3A3IA 1BLSA 2IWBA 3UB7A 4XUXA 1E3UA 3NECA 1PZPA 3OC2A 2ZOIA 1K38A 2G2UA 3KO6A 3E98A 4DN0A 3KSIA 3VOYA 4UQIS 1QMFA 1D1JA 1DRMA 1IOUA 4EEPA 2I72A 3HLGA 5JYPA 2Q0OA 3LUQA 4S2OA 3LYXA 2A2LA 4I39A 5AQ7A 3ZVWA 2E8JA 5CHJA 5IU1A 2VGKA 4OQIA 3IX4A 3UE0A 3T1QB 3LIEA 4S2LA 1JWVA 1XJ4A 4M4XA 5GHXA 3BFCA 2XRNA 4K08A 3FYZA 2WKIA 2ZLYA 1GSVA 4CJNA 3MQOA 1F9IA 2ZMAA 2ZC6B 5FAQA 4HQAA 4MN7A 4LPZA 4HI4A 1L0EA 3PR6A 3MMHA 3SS4A 1T19A 3CG5A 5EFWA 4KZBA 5CX7A 4I3AA 2KOIA 5TR7A 5EVIA 4UA6A 2XD1A 2H28A 3RH8B 2JKGA 2VLGA 3A0VA 4YWZA 1KOUA 3OBFA 1P97A 1BLPA 4KG6A 3BLSA 3VOLA 3D72A 4EERA 4XXRA 1TS8A 2IA2A 4NXEA 3WRZA 1OTAA 5E2FA 1FILA 3M6BA 2GZAA 3DWZA 2A24B 1PW8A 2RCXA 3S4XA 3A3EA 1K4FA 3N8SA 4O8GA 4YFMA 3C30A 1IEMA 4OLGA 5J7EA 2XEPA 5CHUA 3FKVA 1H8ZA 2FFFB 4GDNA 2B18A 2WKRA 3ZG7B 4S2PA 2VGLM 1YPRA 1X0OA 1K54A 4FH2A 2XH9A 1GA0A 3BFFA 5AVEA 2ZM8A 3ZNTA 4U0XA 2Y2JA 4EUZA 4Y3IA 1MC0A 2WKEA 3DWKA 3VSKA 4JGRA 3E2KA 3LR4A 4Q0HA 4PM7A 2YKFA 2R9XA 4GD8A 4S2NC 4KQQA 3SZTA 3NI9A 4OP8A 3UPNA 3ZNYA 4N9LA 3KYEA 2Q9NA 3GR2A 1EROA 2Y79A 3O87A 3DTMA 2XDMA 1NWZA 3G6OA 1PWGA 2D01A 1CEGA 3T1SA 3QHYA 4K91A 4E3MA 2JC7A 3U2AA 1ONHA 3UO9A 4KG2A 3P01A 1S4RA 2JKTM 3SW1A 3IHBA 4E3JA 2EXBA 3G35A 3LR0A 3M2KA 5GHYA 4IUHA 2LB5A 4R3AA 3HVFA 5HL6A 3LY4A 1YLJA 3R7WA 3LIBA 2JHEA 2QWSA 5LBRA 3TSGA 2WKHA 2V0UA 4DE0A 2FZ0A 4EESA 3HUNA 4UQIM 5HL1A 2W3FA 2BLSA 2GNXA 4KG5A 4C75A 5CECA 1MBLA 2O0YA 4JPMA 3BFEA 5GL9A 3LR3A 1W5DA 1ESIA 1OT9A 2ZMVA 4WL9A 4OOLA 1QMEA 4EU0A 2V1AA 1OTBA 2PD7A 2M7VA 3N6IA 4OVDA 3VE3A 4KZ8A 1MKIA 5HPIA 5E2EA 4E3KA 5G4YA 1GSWA 3LO7A 4JF4A 1KDSA 2PR5A 3BRMA 4NK3A 2NUPC 2KDKA 4EEUA 1N9BA 1S1YA 3PBOA 2IWDA 4GW9A 2DRWA 4IVKA 4JKTA 1MPLA 1ZC2A 1G68A 1OT6A 1SKOB 5CTMA 2W1TA 2V8CA 3S7QA 1P9WA 3GECA 2QZ6A 1LLBA 3A3DA 2VV8A 3W2ZA 3NOUC 3C5AA 5HAQA 1DP9A 5E2HA 1FCMA 5F68A 3PBTA 4KZ3A 2HZ5A 3NCKA 4X1MA 5FAPA 4GZBA 2PD8A 1O07A 3SH8A 4ETZA 3Q82A 3V3SA 2FH5A 1U60A 1MY8A 2PRFA 1T1AA 3Q07A 4BBVA 5FEGA 1YKDA 1SCWA 5FA7A 3FC7A 1IFQA 1EW0A 4HBTA 4FH4A 2O9BA 3KX0X 5HD5A 1ZHHB 3OPLA 3UPPA 3UY6A 2OAQ1 4IEDA 5FASA 1S66L 4RX3A 1PW1A 3CWFA 1KVMA 2GJ3A 2W0NA 3NDGA 2C5WB 2PR6A 2GX5A 4LFUA 3H82B 4S2IA 5CTNA 3IT9A 5EM0A 2PU4A 1PFLA 3HL9A 1JNUA 4L9EA 1JTGA 2W3GA 3IXHA 5FI7A 5J8XA 3T4OA 3OPRA 5G18A 5KSHA 1OTEA 5I5LA 4RYEA 4X53A 5HSQA 1KGEA 4IBXA 1T1BA 1NY0A 4E6XA 1W8QA 2EWVA 3EGXC 3UNWA 1P9RA 4KUOA 1NRFA 1STZA 1KGGA 1HTZA 1IKGA 4Y0TA 2JKTI 3LCEA 1PIOA 3PAEA 5HX9A 5HWVA 2W3DA 4RQ9A 1LL8A 1CQAA 2WAFA 2VV6A 4FD8A 3K2NA 4HJ3A 3F1NB 1YM1A 4WEJA 1FSWA 2Y2NA 3O3VA 3PXPA 1TEMA 1XP4A 4E6WA 4GHIB 1DJCA 1I2WA 3MFXA 3IF6C 4Y2FA 3E4QA 3VOZA 2HDRA 4HH2A 5D3OA 3A3JA 3IBJA 2EXAA 5FSRA 1VETB 2PBYA 2XD5A 3OCNA 4MDZA 1CF0A 4I38A 2V1ZA 1GHMA 4WMCD 1V9YA 1S1ZA 4CPKA 5DKKA 4K0XA 4ETXA 5HAPA 2PYRA 3GSGA 3VP2A 5GLBA 4GNUA 4ZJ3A 5L10A 4LLOB 1Y28A 2J9OA 4LRZE 5FL3A 3IHAA 3GRJA 4GJ4A 3IWQA 4YOFA 4GOGA 4N1XA 4N9KA 2X01A 2A49A 1UWPX 4KZ7A 3N8RA 5DTSA 4IBRA 3HJIA 3GV9A 2V8FA 4H8RA 2EWWA 5BOHA 3CPTA 2XGNA 1BT5A 4BJPA 3JVUA 1K25A 4NKPA 4U3TA 2Y2GA 2QYBA 3BYDA 5AJGA 1RCJA 1XKZA 4R4RA 1L0FA 2H10A 1K56D 4LCMA 3V5MA 3C7UA 2D02A 4HH3A 5TBMA 5EVIB 4EBNA 1BZAA 2J3TC 3VP4A 1YSPA 3ZDJA 2VV7A 3T4TA 4C6YA 4E04A 1Y54A 3BLMA 2ZC4B 3HLFA 3BFDA 3VP3A 3UB9A 3Q7VA 4S2MA 5F1GA 1VETA 3MS6A 5KSCA 4R4SA 2FFYA 4B4XA 1W7FA 2PDRA 3P98A 4JF5A 3W8KA 2UWXA 3JPUA 2P08A 3UB5P 2HGVA 5CEDA 1WA9A 1LL9A 3Q7ZA 3UN7A 1IKIA 3SOIA 4L9FA 4Y5FA 2BG1A 2ZL1A 4WZ5A 3ZG0A 2HPBA 1TDLA 3KSHA 4EW7A 1ALQA 3TOIA 1ES3A 4DDSA 1NYMA 3ZG8B 5F69A 3MFDA 3BY9A 4Y17A 2C6WB 3F1PA 2EX8A 1XA1A 3ULFA 4R3BA 1VM1A 2VJWA 4EWFA 1Y4OA 4JGQA 1LI9A 4ZJ1A 5HWTA 5EVIC 1FCNA 2JN7A 3IS2A 3T50A 1MKMA 5M1AA 3P09A 5L2FA 4LRXC 3MJQA 1K57A 4X55A 4BLMA 4JXSA 5CRFA 1MWSA 4DE2A 4IVIA 5EUAA 2PHYA 3A0RA 5CEBA 3T12B 4Q0JA 3WS2A 2ZQ9A 3EGDC 2QPNA 3VP1A 3R7WB 2UV0E 1Z09A 1RP5A 1CI9A 3PBQA 2V9AA 4MBFA 2M7UA 1PYYA 4CLCB 1M6KA 3K3CA 5F83A 1W63M 4R6LA 1HLUP 4Y13A 5M19A 1K54C 2HP9A 1KVLA 3OCLA 1XA7A 3Q1FA 4JF6A 1DJBA 2H5SA 5A90A 2Y2OA 5KMWA 2O9CA 2WGIA 3BEBA 2B5RA 5HDCA 4BL3A 5CGSA 3ZYTA 4IUKA 3CI6A 3BFGA 2K2NA 1ZKJA 2JBFA 5J4EA 3UMEA 5EECA 4II7A 4DDYA 3WRTA 4AFIA 2XA7M 5KIZA 3I7JA 2W1TB 3HLWA 1YLTA 1O7EA 3UDXA 4DF6A 1ACFA 2X71A 4I5SA 3PHYA 4PM6A 3LI8A 4WBGA 4E3NA 4WM9A 1XJ6A 4DJ2A 3RJUA 3E4PA 4CLCC 2QJ7A 1W8YA 2DMWA 4KQRA 3LY3A 4O7DA 4P85A 4M3KA 3LR5A 3NULA 2J3WA 3N4IA 2Y2KA 2W1RA 1D06A 3EOIA 1NLYA 3VE4A 3CUEA 3IBRA 1BLHA 4CLCA 1YLWA 3OPPA 4FUWA 3A3FA 4HHDA 4R23A 4LRYC 4X25A 2Y55A 4DMZA 3DBAA 1GHPA 4B4ZA 3VV4A 4FTXA 3BQAA 4ARZA 1MXOA 4C3QA 3ICYA 1S0WA 1NZUA 2VZWA 4N92A 1Q2QA 3D3OA 3NC8A 4HP4A 1VB6A 5HZHA 3JVVA 1BSGA 5DVAA 4EV4A 1H3QA 1T18A 2HDSA 5CERA 4MEZA 3AGFA 1NLZA 1L0GA 4OOYA 5U47A 3C7VA 4BENA 3KSFA 4YNRA 1GSXA 3W4OA 4WYYA 4JBFA 4QHCA 1K55A 4OPRA 4GKUA 5DKLA 3C4PA 3BW6A 3ZHHA 3FZCA 2WYXA 1N9LA 2CC1A 3EEAA 4KENB 1XGJA 1HD8A 4NG2A 3O88A 1DP8A 2J8YA 1CI8A 1FOFA 4OQHA 2W3HA 3UDIA 1SHVA 3TE8A 1HZOA 4K0WA 1L3LA 3T1XA 3ZGAB 3WS5A 5FDSA 3VFFA 3MZDA 4UA7A 2HDUA 1GCEA 3D4FA 1YLZA 1K6RA 4FCFA 2QMIA 1DP6A 1MWTA 2WZZA 1XGIA 3LIFA 2OV5A 4BD0A 3BECA 1FCOA 4ZAMA 4Q8IA 3S7NA 5GLAA 2DCFA 3OLOA 3MKEA 3EQVA 4H6JA 3DW0A 4QPRA 1PNEA 3F1OB 3GDIA 1YLYA 3TRCA 1S67L 2PYPA 5DTKA 3LI9A 5DFYA 1ESUA 3RFBA 3ZQ5A 2V0WA 4P6ZS 4E3OA 1OTDA 3LGOA 1XFNA 3W4PA 3RTYA 4RA7A 3VSLA 2Y2IA 1TF1A 2BASA 4Z9QA 3P7NA 3NOPC 4HBUA 4E3IA 3QP5A 1EWZA 4HJ4A 2OSUA 1YMSA 4MCWA 1XX2A 3OOVA 1NZOA 3HCYA 1S4SA 3LEQA 1NXYA 3CPTB 2B02A 5K5BA 2QKPA 2ZM2A 3TJZC 4PPRA 4BQMA 1K6SA 3IWIA 4JXWA 1NJ4A 5DJUA 5TBMB 2ZQAA 4F3LA 3NBLA 1SDEA 3GVBA 4IHQA 1KE3A 3MSHA 4CQHA 4G3KA 1YQSA 4IJGA 4DJ3A 1YSQA 5DF7A 3ZG5A 3NIAA 3Q7VB 3A0SA 4Z1WA 3MQ0A 2ZOHA 3FV7A 3MXSA 3BM6A 5A93A 3IH9A 5IT5A 1ZTUA 2HV1A 3C4OA 1G5UA 3IX8A 1CEFA 2KX6A 3MZEA 5A8BA 5HFOA 4F94A 2Z2MB 1CJFA 5CGXA 3T4SA 3QP8A 3F1OA 5FATA 4EQIA 5AVFA 2XQZA 2ZL1B 1PRQA 1KGFA 4LENA 1I2SA 1SDNA 5CGWA 3MXQA 4JLFA 3PBNA 3R4KA 2E8IA 4ZBEA 2PBDP 3HUOA 3LIAA 4PKYA 3D9YA 4HIAA 3SH9A 3L9KA 5HDDA 2MJ6A 1C3BA 4UHUA 1NRJA 3F1PB 3DTKA 3UE1A 3BWLA
chains in the Genus database with same CATH topology
5HPFA 3R7WA 1H8MA 4I3JA 3LIBA 2JHEA 2QWSA 5LBRA 4ME4A 2PHYA 2V0UA 3UE6A 3A0RA 2FZ0A 4EESA 2YKHA 4UQIM 4Q0JA 2W3FA 2GNXA 3IS2B 2O0YA 3EGDC 3KYQA 3LR3A 4PHTA 1OT9A 1XJ3A 4EQ1A 2ZMVA 4WL9A 4OOLA 4EU0A 3R7WB 3BY8A 2V1AA 3T4JA 3PBSA 4G3VA 1OTBA 2PD7A 4ZRRA 2M7VA 3PBQA 2V9AA 3VE3A 3E4OA 2M7UA 4CLCB 3PYPA 4HJ6A 3KSGA 1G6OA 5HPIA 3K3CA 2QHKA 5G4YA 2J3TD 1GSWA 1W63M 4R6LA 2PR5A 5J3WA 4NXFA 3T4LA 3TW8A 4HOIA 2NUPC 2KDKA 4EEUA 3OCLA 5HWWA 2EA9A 1YAXA 4FOFA 3K3DA 4NXBA 1S1YA 3PBOA 4WELA 4GW9A 4HY8A 4WLAA 3B33A 2LB9A 4NEED 4P6ZM 4BMWA 1OT6A 2O9CA 2VX8A 2O9AA 5HDCA 2W1TA 3ZYTA 3S7QA 4GS9B 1P9WA 4IUKA 1TD5A 3GECA 2HF6A 3CI6A 2VV8A 3W2ZA 3NOTC 2L4RA 3NOUC 2K2NA 3CITA 1V9ZA 5J4EA 1DP9A 4BWIA 3UMEA 5F68A 3PBTA 3FPWA 4II7A 1ODVA 4KUKA 2K31A 2OAP1 4AFIA 2XA7M 5KIZA 3H9WA 3S7OA 2W1TB 2PD8A 2VA0A 4ETZA 2V1BA 4B93A 2P7JA 1OJGA 4PAUA 2FH5A 3O5YA 3UMDA 4B9OA 2K7SA 1LSWA 4XT2B 1T1AA 2W3EA 2NUTC 4BBVA 5F6AA 5C5KA 4I5SA 3KYZA 1YKDA 3PHYA 3B42A 3LIDA 3FC7A 3UB8A 1IFQA 4O0PA 1EW0A 5MC7A 4BBUA 3LI8A 1OTIA 2O9BA 3KX0X 5HD5A 4EUVA 2OWHA 1ZHHB 4UEYA 3H82A 2JKRI 4HP9A 2O99A 1XJ6A 2PT7A 1T1CA 4L9GA 2OAQ1 4DJ2A 4EXOA 3E4PA 1S66L 4KQDA 4CLCC 1VHMA 2QJ7A 1F98A 2DMWA 4OOMA 2XROA 3CWFA 2GJ3A 4JGOA 4L0LA 2W0NA 3LR5A 3V67A 2VKSA 2J3WA 1F5MA 2PR6A 2GX5A 2W1RA 1D06A 3EOIA 1NLYA 3H82B 3VE4A 1LT0A 4R38A 2I9VA 3CUEA 3IBRA 5HDSA 4G3WA 1OPXA 3MR0A 4CLCA 1JNUA 2XSSA 2ZBBA 4L9EA 1N9NA 4HHDA 4MN6A 4JGPA 2J80A 2W3GA 4LRYC 5TJJA 4DMZA 3DBAA 3T4OA 3T4KA 2L1MA 3VV4A 3BQAA 4KQOA 4ARZA 5KSHA 2KLIA 3ICYA 2Y8HA 1OTEA 3CLOA 3NJAA 1D7EA 2VZWA 5I5LA 4WN5A 3D3OA 4HP4A 3EWKA 5HSQA 4GS9A 1VB6A 2G7UA 5HZHA 2CMNA 1T1BA 3JVVA 2VGLS 2OOLA 5L8MA 2EWVA 1H3QA 3EGXC 1T18A 4WUJA 2WKPA 4CLCE 4R70A 3F1NA 1W63Q 1P9RA 4KUOA 5F5YA 4GCZA 1STZA 4PKYG 2XA7S 1NLZA 2Z6CA 2M1CA 3CAXA 3MF0A 4MMNA 4ARZB 3FPVA 2JKTI 3HJKA 4MN5A 2OWJA 1MZUA 3KSFA 1GSXA 4YNRA 2W3DA 4GHIA 4RQ9A 5HWVA 1LL8A 1LSVA 2VV6A 5DKLA 3K2NA 3BW6A 4HJ3A 3F1NB 4BBTA 1UGUA 3EEHA 2HJ9C 5DJTA 4WEJA 5DFXA 1BYWA 4XT2A 3PXPA 1N9LA 3EEAA 5HD3A 1LSXA 4GHIB 1DP8A 3S7PA 3NHQA 3MFXA 4Y2FA 1TS0A 2W3HA 3TE8A 3E4QA 3B47A 2INWA 4HH2A 3UB7A 3IBJA 3OC2A 2ZOIA 4WEKA 3KO6A 3E98A 4DN0A 3KSIA 3OCNA 4MDZA 4CLCD 3CUEC 4UQIS 1DP6A 4I38A 1DRMA 1IOUA 5G4ZA 4EEPA 3LIFA 1V9YA 1S1ZA 2P04A 5DKKA 3LUQA 3UB6A 4ETXA 3LYXA 5DF9A 2PYRA 2A2LA 4I39A 2WKQA 3S7NA 3LICA 5IU1A 3OLOA 3MQQA 4LLOB 1Y28A 4LRZE 3EQVA 4HNBA 5FL3A 3LIEA 4H6JA 4QPRA 3BQ8A 2ZMFA 3F1OB 1XJ4A 3GDIA 4M4XA 4GJ4A 2XRNA 3TRCA 4K08A 4GLQA 1S67L 2PYPA 1GSVA 3LI9A 1P0ZA 3MQOA 5DFYA 1F9IA 3H7WB 4YOFA 3RFBA 3ZQ5A 2V0WA 2HJEA 1UWNX 4HQAA 4MN7A 1TS7A 1UWPX 3EQUA 4LPZA 4P6ZS 4HI4A 1OTDA 1XFNA 3PR6A 3MMHA 4O01A 3HJIA 2Z6DA 1T19A 4H6JB 5EFWA 2QJ5A 2EWWA 5CX7A 1XFQA 4I3AA 2KOIA 4WF0A 4BJPA 3RTYA 3JVUA 1XJ2A 1TF1A 2BASA 4NKPA 2H28A 3RH8B 3P7NA 3NOPC 2A24A 2VLGA 3A0VA 4HJ4A 2QYBA 4YWZA 3FG8A 5AJGA 2W27A 1KOUA 4MCWA 3T4QA 3OBFA 1P97A 3OOVA 3HCYA 1S4SA 2VEAA 3VOLA 3D72A 4EERA 1TS8A 2D02A 2IA2A 4HH3A 5TBMA 4NXEA 3BJNA 2B02A 5K5BA 1OTAA 2J3TC 2JKRM 2QKPA 1YSPA 2GZAA 1OJ5A 2A24B 2VV7A 5IS1A 4I3IA 3TJZC 3T4TA 4O8GA 3C30A 4E04A 5J7EA 4EETB 3UE3A 3UB9A 5DJUA 2B18A 2WKRA 5TBMB 3E0YA 4F3LA 2PDRA 2VGLM 4IHQA 2P08A 1X0OA 2HGVA 4CQHA 1WA9A 4G3KA 3C38A 5AVEA 4IJGA 2L0WA 4DJ3A 1YSQA 4L9FA 4Y5FA 3C8CA 3A0SA 4Y3IA 4Z1WA 3MQ0A 1MC0A 2ZOHA 3KSHA 4EW7A 4JGRA 3LR4A 4Q0HA 4F3LB 5IT5A 1ZTUA 2HV1A 2KX6A 2YKFA 5A8BA 3PBRA 5F69A 3T4SA 1G28A 1TS6A 2R78A 3F1OA 4NXGA 3BY9A 2Y79A 3F1PA 1NWZA 3G6OA 3H7WA 5AVFA 3ULFA 2D01A 4Q0IA 3MXQA 2VJWA 3PBNA 3R4KA 3U2AA 3P01A 3LFVA 3LIAA 4JGQA 4PKYA 1S4RA 1N9OA 2JKTM 4FSFA 5HWTA 4HIAA 3SW1A 2JN7A 3IS2A 2MJ6A 5HDDA 3T50A 1MKMA 1NRJA 3LR0A 3C2WA 3F1PB 4IUHA 4LRXC 2LB5A 4R3AA 3MJQA 5HL6A 3BWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I3J A;  3LIB A;  2JHE A;  2QWS A;  2PHY A;  2V0U A;  3UE6 A;  3A0R A;  4EES A;  2YKH A;  3IS2 B;  1OT9 A;  1XJ3 A;  4EQ1 A;  4WL9 A;  3BY8 A;  2V1A A;  1OTB A;  2PD7 A;  2V9A A;  3VE3 A;  3E4O A;  3PYP A;  4HJ6 A;  3K3C A;  2QHK A;  5G4Y A;  1GSW A;  4R6L A;  2PR5 A;  5J3W A;  4NXF A;  4HOI A;  2KDK A;  4EEU A;  5HWW A;  2EA9 A;  4NXB A;  3K3D A;  1S1Y A;  4WLA A;  4GW9 A;  4HY8 A;  3B33 A;  1OT6 A;  5HDC A;  4GS9 B;  3GEC A;  2VV8 A;  3NOT C;  2L4R A;  3NOU C;  1V9Z A;  5J4E A;  1DP9 A;  3UME A;  5F68 A;  1ODV A;  4KUK A;  5KIZ A;  3H9W A;  2PD8 A;  2V1B A;  2P7J A;  1OJG A;  3UMD A;  4B9O A;  2K7S A;  1LSW A;  4XT2 B;  1T1A A;  4BBV A;  5F6A A;  4I5S A;  3PHY A;  3UB8 A;  3LID A;  3FC7 A;  1EW0 A;  4BBU A;  3LI8 A;  1OTI A;  3KX0 X;  5HD5 A;  2OWH A;  3H82 A;  4HP9 A;  1XJ6 A;  1T1C A;  4L9G A;  4DJ2 A;  4EXO A;  3E4P A;  1S66 L;  4KQD A;  2QJ7 A;  1F98 A;  3CWF A;  2GJ3 A;  4JGO A;  2W0N A;  2PR6 A;  1D06 A;  3H82 B;  3VE4 A;  1LT0 A;  4R38 A;  2I9V A;  3IBR A;  5HDS A;  3MR0 A;  1JNU A;  2ZBB A;  4L9E A;  1N9N A;  4HHD A;  4MN6 A;  4JGP A;  2J80 A;  4LRY C;  2L1M A;  3ICY A;  1OTE A;  3CLO A;  3NJA A;  1D7E A;  5I5L A;  4WN5 A;  4HP4 A;  3EWK A;  5HSQ A;  4GS9 A;  1VB6 A;  5HZH A;  2CMN A;  1T1B A;  2OOL A;  4WUJ A;  1T18 A;  2WKP A;  4R70 A;  3F1N A;  4KUO A;  5F5Y A;  4GCZ A;  4PKY G;  2Z6C A;  2M1C A;  3CAX A;  3HJK A;  4MN5 A;  2OWJ A;  1MZU A;  5HWV A;  1GSX A;  4GHI A;  4RQ9 A;  1LL8 A;  1LSV A;  2VV6 A;  5DKL A;  4HJ3 A;  3F1N B;  4BBT A;  1UGU A;  3EEH A;  5DJT A;  1BYW A;  4XT2 A;  1N9L A;  5HD3 A;  1LSX A;  4GHI B;  1DP8 A;  3NHQ A;  3MFX A;  1TS0 A;  3E4Q A;  2INW A;  4HH2 A;  3UB7 A;  2ZOI A;  1DP6 A;  4I38 A;  1DRM A;  5G4Z A;  4EEP A;  3LIF A;  1V9Y A;  1S1Z A;  5DKK A;  3LUQ A;  3UB6 A;  3LYX A;  2PYR A;  4I39 A;  2WKQ A;  3LIC A;  5IU1 A;  3OLO A;  3MQQ A;  4LLO B;  1Y28 A;  4LRZ E;  4HNB A;  3LIE A;  4H6J A;  3F1O B;  1XJ4 A;  3GDI A;  4M4X A;  4K08 A;  1S67 L;  2PYP A;  1GSV A;  3LI9 A;  1P0Z A;  3MQO A;  1F9I A;  3H7W B;  3ZQ5 A;  2V0W A;  1UWN X;  4HQA A;  1TS7 A;  1UWP X;  4LPZ A;  4HI4 A;  1OTD A;  1XFN A;  3HJI A;  2Z6D A;  1T19 A;  4H6J B;  5EFW A;  2QJ5 A;  1XFQ A;  4I3A A;  4WF0 A;  3RTY A;  1XJ2 A;  2BAS A;  2H28 A;  3RH8 B;  3P7N A;  3NOP C;  2A24 A;  2VLG A;  3A0V A;  4HJ4 A;  4YWZ A;  3FG8 A;  2W27 A;  1KOU A;  1P97 A;  1S4S A;  2VEA A;  3VOL A;  3D72 A;  4EER A;  1TS8 A;  2D02 A;  4HH3 A;  5TBM A;  4NXE A;  2B02 A;  1OTA A;  2QKP A;  1OJ5 A;  2A24 B;  2VV7 A;  5IS1 A;  4I3I A;  4E04 A;  5J7E A;  4EET B;  3UB9 A;  5DJU A;  2WKR A;  5TBM B;  4F3L A;  2PDR A;  1X0O A;  1WA9 A;  5AVE A;  2L0W A;  4DJ3 A;  4L9F A;  3C8C A;  3A0S A;  2ZOH A;  4EW7 A;  4JGR A;  4F3L B;  2HV1 A;  2KX6 A;  2YKF A;  5A8B A;  5F69 A;  1G28 A;  1TS6 A;  2R78 A;  3F1O A;  4NXG A;  3BY9 A;  3F1P A;  1NWZ A;  3G6O A;  3H7W A;  5AVF A;  3ULF A;  2D01 A;  3MXQ A;  3LIA A;  4JGQ A;  4PKY A;  1S4R A;  1N9O A;  5HWT A;  3SW1 A;  4HIA A;  2JN7 A;  3IS2 A;  5HDD A;  3T50 A;  3C2W A;  3F1P B;  4LRX C;  4R3A A;  3MJQ A;  3BWL A; 
#chains in the Genus database with same CATH topology
 1H8M A;  1BLC A;  3SS3 A;  1GHI A;  1WYB A;  1RGY A;  2EX9 A;  4ME4 A;  1A0K A;  3IS2 B;  3KYQ A;  4PHT A;  1XJ3 A;  1M40 A;  1ZG6 A;  2G2W A;  4WMC A;  1DJA A;  3DTE A;  3BY8 A;  5HAI A;  5HW3 A;  2Y2M A;  3T4J A;  3PBS A;  4G3V A;  3DTI A;  4ZRR A;  1J3W A;  1FSY A;  3PYP A;  2P74 A;  2QHK A;  5EOO A;  2J3T D;  4OPY A;  2ZC5 B;  5J3W A;  4HOI A;  3CJM A;  5FQM A;  3HLC A;  1YAX A;  3JYI A;  3K3D A;  4FOF A;  4NXB A;  1E3U D;  4KZ9 A;  3RXX A;  4WEL A;  4HY8 A;  2LB9 A;  5TFQ A;  4DXC A;  3IF5 A;  4P6Z M;  1LHY A;  4X6T A;  4WZ5 C;  3PAG A;  4GS9 B;  4A5R A;  3SH7 A;  3NY4 A;  1RGZ A;  2L4R A;  4JXG A;  2ZM0 A;  3GTC A;  1V9Z A;  1KDW A;  5I94 A;  3CMZ A;  3FPW A;  1ODV A;  1JTD A;  1LI0 A;  3WS4 A;  3H9W A;  3S7O A;  3ITB A;  4HES A;  3CZD A;  2VA0 A;  2Y4A A;  2Y2H A;  4PM5 A;  5CHM A;  3QNB A;  5FQI A;  2P7J A;  3UMD A;  1FQG A;  2K7S A;  1LSW A;  4X1L A;  2W3E A;  2A3U A;  5C5K A;  3KYZ A;  3ITA A;  3LID A;  2ZJ9 A;  5E2G A;  1K57 C;  3GMW A;  1H5X A;  4OP5 A;  4BBU A;  1OTI A;  4QJG A;  4GDB A;  4HP9 A;  1BUL A;  2O99 A;  2PT7 A;  4L9G A;  4DXB A;  4GN2 A;  5AQB A;  5EVI D;  1VHM A;  1F98 A;  2Y2P A;  3G31 A;  3ZVT A;  2PU2 A;  4R0Q A;  4JGO A;  2XF3 A;  3E2L A;  1BUE A;  3V67 A;  4RVA A;  2VKS A;  1OME A;  1FR1 A;  4QB8 A;  3QP4 A;  1Q2P A;  3DAV A;  4S2K A;  1OPX A;  3MR0 A;  4S2J A;  3N8L A;  2XSS A;  3IX3 A;  1MWU A;  2Y2L A;  1L2S A;  1N9N A;  4MN6 A;  2Y59 A;  3G34 A;  3HLE A;  1FR6 A;  1JVJ A;  2XR0 A;  2L1M A;  1ES2 A;  2Y8H A;  3CLO A;  3NJA A;  2ZC3 B;  1D7E A;  4WN5 A;  4OH0 A;  1DY6 A;  2ZQ7 A;  4GS9 A;  2PAV P;  2OOL A;  3HUM A;  5L8M A;  4WUJ A;  4R70 A;  1E25 A;  1W63 Q;  4LV1 A;  5F5Y A;  1L0D A;  1ZG4 A;  4GCZ A;  4P0M A;  5DF8 A;  5A91 A;  3CAX A;  2V2F F;  4ARZ B;  1FIK A;  5EVE A;  4MN5 A;  1MZU A;  3Q81 A;  2IWC A;  1LSV A;  4EBL A;  4BL2 A;  4GB7 A;  5M18 A;  2ZQ8 A;  3V39 A;  4BBT A;  3ZCZ A;  1CK3 A;  5DJT A;  4Y15 A;  5DFX A;  1BYW A;  1IYP A;  4GD6 A;  1IYQ A;  1LSX A;  5KZH A;  3N7W A;  2H0T A;  3S7P A;  2JKF A;  3NHQ A;  2VK3 A;  1TS0 A;  2H0Y A;  3AGD A;  3B47 A;  3OPH A;  3G32 A;  2EX2 A;  1J9M A;  4MLL A;  1PI5 A;  2ZC7 A;  4WEK A;  5F1F A;  4DE1 A;  1JWP A;  2Z2L B;  4CLC D;  3CUE C;  1E4D A;  2RL3 A;  1SZV A;  5IHV A;  5DTT A;  5G4Z A;  1KE4 A;  2P04 A;  3UB6 A;  4KZA A;  5DF9 A;  4UAA A;  3IQA A;  5EM1 A;  2WKQ A;  1TVF A;  5FEF A;  3LIC A;  4MNR A;  2J9P A;  3MQQ A;  1PI4 A;  4S2N A;  4HNB A;  1EI5 A;  4XUZ A;  3MKF A;  3BQ8 A;  5FQK A;  2ZMF A;  3G2Z A;  4GLQ A;  4EBP A;  1P0Z A;  3QP1 A;  3H7W B;  4ZTK A;  2HJE A;  1UWN X;  4N1H A;  1TS7 A;  1XPB A;  3EQU A;  5EV0 A;  1S6R A;  4O01 A;  2Z6D A;  2XLN A;  4H6J B;  2QJ5 A;  4LV0 A;  4QWO A;  3W4Q A;  3GQZ A;  2HDQ A;  1XFQ A;  1Z6F A;  4WF0 A;  3FKW A;  1K55 C;  3OZH A;  1LL5 A;  1XJ2 A;  3S22 A;  2A24 A;  3ISG A;  4HEF A;  2X02 A;  3FG8 A;  4OPQ A;  2VGJ A;  2HP6 A;  5EE8 A;  3TG9 A;  2WAE A;  2W27 A;  3SS5 A;  4DKI A;  3T4Q A;  2VEA A;  1AWI A;  1ERM A;  3BJN A;  2XK1 A;  2JKR M;  4KZ5 A;  1WE4 A;  1OJ5 A;  1YT4 A;  4QY6 A;  4QY5 A;  3RXW A;  5IS1 A;  4B88 A;  4I3I A;  2JCH A;  5L07 A;  5EOE A;  1YLP A;  4P6B A;  4QD4 A;  4EET B;  2XFS A;  3PTE A;  2V20 A;  3UE3 A;  3WWX A;  5TGF A;  4LCL A;  3E0Y A;  2ZD8 A;  3HBR A;  2GDN A;  3C38 A;  1KE0 A;  1ERQ A;  2L0W A;  3QP2 A;  4DRT A;  3AGE A;  3C8C A;  2ZQD A;  5FAO A;  4F3L B;  4MBK A;  4D60 A;  1XXM A;  4OQG A;  3PBR A;  1VEU B;  5GLD A;  1G28 A;  3G4P A;  1TS6 A;  2R78 A;  4NXG A;  4D2O A;  1PWC A;  3H7W A;  3IWO A;  1N4O A;  2Y91 A;  4Q0I A;  3CHW P;  4OPZ A;  1JWZ A;  3LFV A;  3IXB A;  1N9O A;  4FSF A;  3M2J A;  5FQ9 A;  2BTF P;  3C2W A;  3O86 A;  3WS0 A;  5HPF A;  3ZFZ A;  3HLD A;  2HP5 A;  4WZ4 A;  4I3J A;  4Y0O A;  3IF6 B;  1K4E A;  3S1Y A;  4R3J A;  4LV3 A;  3VMA A;  3UE6 A;  5GLC A;  2EFU A;  2YKH A;  5JYO A;  1F2K A;  4UA9 A;  3WS1 A;  4PM9 A;  4EQ1 A;  4X68 A;  3QP6 A;  2WAD A;  3T1R A;  1ONG A;  1VQQ A;  1MWR A;  1TDG A;  3E4O A;  1SKO A;  2J7V A;  4HJ6 A;  3KSG A;  1G6O A;  1IYS A;  3HRE A;  4LGW A;  2WGW B;  4R1G A;  4NXF A;  3T4L A;  3TW8 A;  4YIN A;  5HWW A;  2EA9 A;  4WLA A;  3L7H A;  3B33 A;  4NEE D;  4BMW A;  4OLD A;  2VX8 A;  2O9A A;  4U0T A;  4KZ6 A;  1TD5 A;  2HF6 A;  1G6A A;  3NOT C;  3MBZ A;  1PZO A;  1K0K A;  3CIT A;  5GHZ A;  5FI6 A;  4X56 A;  1IEL A;  4BWI A;  1VEU A;  4MBH A;  2JE5 A;  4KUK A;  2K31 A;  4BD1 A;  2OAP 1;  2OLU A;  2P9V B;  3NDE A;  1YMX A;  3V50 A;  3M6H A;  2EX6 A;  2V1B A;  3G30 A;  4B93 A;  1WYC A;  4PAU A;  1OJG A;  3O5Y A;  3VFH A;  4B9O A;  4E3L A;  4XT2 B;  2NUT C;  5F6A A;  1H0M A;  3B42 A;  3UB8 A;  4OQ0 A;  3B3X A;  3UDF A;  4O0P A;  2WUQ A;  5MC7 A;  5FI2 A;  4EUV A;  2OWH A;  4RX2 A;  4UEY A;  2DNS A;  3H82 A;  2JKR I;  4OON A;  1T1C A;  5EVL A;  3IXD A;  4EXO A;  1ES5 A;  3IF6 A;  2R9W A;  4KQD A;  4QU3 A;  5CXW A;  3IXG A;  4OOM A;  5EPH A;  1NYY A;  5A92 A;  2XRO A;  2Y2Q A;  4L0L A;  2ACG A;  2Q9M A;  2WZX A;  4OKP A;  3U4L P;  4ID4 A;  1IYO A;  1F5M A;  2WGV A;  4NET A;  1BTL A;  1LT0 A;  4R38 A;  2I9V A;  5HDS A;  4G3W A;  2OLV A;  4ZDX A;  3VP0 A;  5AQA A;  2ZQC A;  3HLB A;  2ZBB A;  4P87 A;  5FDH A;  4JGP A;  3FWL A;  2J80 A;  2WGW A;  3MXR A;  5TJJ A;  3G2Y A;  3QNC A;  1SKF A;  4X69 A;  2EFX A;  3T4K A;  4KQO A;  2KLI A;  5E43 A;  3ZG9 B;  2XFT A;  4Y7P A;  3EWK A;  1AXB A;  2G7U A;  2CMN A;  2B95 A;  2VGL S;  4LV2 A;  4ZJ2 A;  3LEZ A;  2WKP A;  4CLC E;  3F1N A;  4PMA A;  1I5Q A;  3V3R A;  5L09 A;  4PKY G;  1HVB A;  1GA9 A;  2XA7 S;  5AQ9 A;  2Z6C A;  2M1C A;  3MF0 A;  4MMN A;  3FPV A;  3HJK A;  2WK0 A;  2OWJ A;  3MZF A;  2P9V A;  4GHI A;  3IH8 A;  2AVX A;  1UGU A;  3EEH A;  2HJ9 C;  1ES4 A;  4JXV A;  4KZ4 A;  5F82 A;  3UPO A;  4Y0U A;  4XT2 A;  4ESP A;  5HD3 A;  4DE3 A;  4PM8 A;  1W79 A;  1K56 A;  5FQQ A;  1H8Y A;  5FQJ A;  5HAR A;  1PWD A;  2INW A;  3A3I A;  1BLS A;  2IWB A;  3UB7 A;  4XUX A;  1E3U A;  3NEC A;  1PZP A;  3OC2 A;  2ZOI A;  1K38 A;  2G2U A;  3KO6 A;  3E98 A;  4DN0 A;  3KSI A;  3VOY A;  4UQI S;  1QMF A;  1D1J A;  1DRM A;  1IOU A;  4EEP A;  2I72 A;  3HLG A;  5JYP A;  2Q0O A;  3LUQ A;  4S2O A;  3LYX A;  2A2L A;  4I39 A;  5AQ7 A;  3ZVW A;  2E8J A;  5CHJ A;  5IU1 A;  2VGK A;  4OQI A;  3IX4 A;  3UE0 A;  3T1Q B;  3LIE A;  4S2L A;  1JWV A;  1XJ4 A;  4M4X A;  5GHX A;  3BFC A;  2XRN A;  4K08 A;  3FYZ A;  2WKI A;  2ZLY A;  1GSV A;  4CJN A;  3MQO A;  1F9I A;  2ZMA A;  2ZC6 B;  5FAQ A;  4HQA A;  4MN7 A;  4LPZ A;  4HI4 A;  1L0E A;  3PR6 A;  3MMH A;  3SS4 A;  1T19 A;  3CG5 A;  5EFW A;  4KZB A;  5CX7 A;  4I3A A;  2KOI A;  5TR7 A;  5EVI A;  4UA6 A;  2XD1 A;  2H28 A;  3RH8 B;  2JKG A;  2VLG A;  3A0V A;  4YWZ A;  1KOU A;  3OBF A;  1P97 A;  1BLP A;  4KG6 A;  3BLS A;  3VOL A;  3D72 A;  4EER A;  4XXR A;  1TS8 A;  2IA2 A;  4NXE A;  3WRZ A;  1OTA A;  5E2F A;  1FIL A;  3M6B A;  2GZA A;  3DWZ A;  2A24 B;  1PW8 A;  2RCX A;  3S4X A;  3A3E A;  1K4F A;  3N8S A;  4O8G A;  4YFM A;  3C30 A;  1IEM A;  4OLG A;  5J7E A;  2XEP A;  5CHU A;  3FKV A;  1H8Z A;  2FFF B;  4GDN A;  2B18 A;  2WKR A;  3ZG7 B;  4S2P A;  2VGL M;  1YPR A;  1X0O A;  1K54 A;  4FH2 A;  2XH9 A;  1GA0 A;  3BFF A;  5AVE A;  2ZM8 A;  3ZNT A;  4U0X A;  2Y2J A;  4EUZ A;  4Y3I A;  1MC0 A;  2WKE A;  3DWK A;  3VSK A;  4JGR A;  3E2K A;  3LR4 A;  4Q0H A;  4PM7 A;  2YKF A;  2R9X A;  4GD8 A;  4S2N C;  4KQQ A;  3SZT A;  3NI9 A;  4OP8 A;  3UPN A;  3ZNY A;  4N9L A;  3KYE A;  2Q9N A;  3GR2 A;  1ERO A;  2Y79 A;  3O87 A;  3DTM A;  2XDM A;  1NWZ A;  3G6O A;  1PWG A;  2D01 A;  1CEG A;  3T1S A;  3QHY A;  4K91 A;  4E3M A;  2JC7 A;  3U2A A;  1ONH A;  3UO9 A;  4KG2 A;  3P01 A;  1S4R A;  2JKT M;  3SW1 A;  3IHB A;  4E3J A;  2EXB A;  3G35 A;  3LR0 A;  3M2K A;  5GHY A;  4IUH A;  2LB5 A;  4R3A A;  3HVF A;  5HL6 A;  3LY4 A;  1YLJ A;  3R7W A;  3LIB A;  2JHE A;  2QWS A;  5LBR A;  3TSG A;  2WKH A;  2V0U A;  4DE0 A;  2FZ0 A;  4EES A;  3HUN A;  4UQI M;  5HL1 A;  2W3F A;  2BLS A;  2GNX A;  4KG5 A;  4C75 A;  5CEC A;  1MBL A;  2O0Y A;  4JPM A;  3BFE A;  5GL9 A;  3LR3 A;  1W5D A;  1ESI A;  1OT9 A;  2ZMV A;  4WL9 A;  4OOL A;  1QME A;  4EU0 A;  2V1A A;  1OTB A;  2PD7 A;  2M7V A;  3N6I A;  4OVD A;  3VE3 A;  4KZ8 A;  1MKI A;  5HPI A;  5E2E A;  4E3K A;  5G4Y A;  1GSW A;  3LO7 A;  4JF4 A;  1KDS A;  2PR5 A;  3BRM A;  4NK3 A;  2NUP C;  2KDK A;  4EEU A;  1N9B A;  1S1Y A;  3PBO A;  2IWD A;  4GW9 A;  2DRW A;  4IVK A;  4JKT A;  1MPL A;  1ZC2 A;  1G68 A;  1OT6 A;  1SKO B;  5CTM A;  2W1T A;  2V8C A;  3S7Q A;  1P9W A;  3GEC A;  2QZ6 A;  1LLB A;  3A3D A;  2VV8 A;  3W2Z A;  3NOU C;  3C5A A;  5HAQ A;  1DP9 A;  5E2H A;  1FCM A;  5F68 A;  3PBT A;  4KZ3 A;  2HZ5 A;  3NCK A;  4X1M A;  5FAP A;  4GZB A;  2PD8 A;  1O07 A;  3SH8 A;  4ETZ A;  3Q82 A;  3V3S A;  2FH5 A;  1U60 A;  1MY8 A;  2PRF A;  1T1A A;  3Q07 A;  4BBV A;  5FEG A;  1YKD A;  1SCW A;  5FA7 A;  3FC7 A;  1IFQ A;  1EW0 A;  4HBT A;  4FH4 A;  2O9B A;  3KX0 X;  5HD5 A;  1ZHH B;  3OPL A;  3UPP A;  3UY6 A;  2OAQ 1;  4IED A;  5FAS A;  1S66 L;  4RX3 A;  1PW1 A;  3CWF A;  1KVM A;  2GJ3 A;  2W0N A;  3NDG A;  2C5W B;  2PR6 A;  2GX5 A;  4LFU A;  3H82 B;  4S2I A;  5CTN A;  3IT9 A;  5EM0 A;  2PU4 A;  1PFL A;  3HL9 A;  1JNU A;  4L9E A;  1JTG A;  2W3G A;  3IXH A;  5FI7 A;  5J8X A;  3T4O A;  3OPR A;  5G18 A;  5KSH A;  1OTE A;  5I5L A;  4RYE A;  4X53 A;  5HSQ A;  1KGE A;  4IBX A;  1T1B A;  1NY0 A;  4E6X A;  1W8Q A;  2EWV A;  3EGX C;  3UNW A;  1P9R A;  4KUO A;  1NRF A;  1STZ A;  1KGG A;  1HTZ A;  1IKG A;  4Y0T A;  2JKT I;  3LCE A;  1PIO A;  3PAE A;  5HX9 A;  5HWV A;  2W3D A;  4RQ9 A;  1LL8 A;  1CQA A;  2WAF A;  2VV6 A;  4FD8 A;  3K2N A;  4HJ3 A;  3F1N B;  1YM1 A;  4WEJ A;  1FSW A;  2Y2N A;  3O3V A;  3PXP A;  1TEM A;  1XP4 A;  4E6W A;  4GHI B;  1DJC A;  1I2W A;  3MFX A;  3IF6 C;  4Y2F A;  3E4Q A;  3VOZ A;  2HDR A;  4HH2 A;  5D3O A;  3A3J A;  3IBJ A;  2EXA A;  5FSR A;  1VET B;  2PBY A;  2XD5 A;  3OCN A;  4MDZ A;  1CF0 A;  4I38 A;  2V1Z A;  1GHM A;  4WMC D;  1V9Y A;  1S1Z A;  4CPK A;  5DKK A;  4K0X A;  4ETX A;  5HAP A;  2PYR A;  3GSG A;  3VP2 A;  5GLB A;  4GNU A;  4ZJ3 A;  5L10 A;  4LLO B;  1Y28 A;  2J9O A;  4LRZ E;  5FL3 A;  3IHA A;  3GRJ A;  4GJ4 A;  3IWQ A;  4YOF A;  4GOG A;  4N1X A;  4N9K A;  2X01 A;  2A49 A;  1UWP X;  4KZ7 A;  3N8R A;  5DTS A;  4IBR A;  3HJI A;  3GV9 A;  2V8F A;  4H8R A;  2EWW A;  5BOH A;  3CPT A;  2XGN A;  1BT5 A;  4BJP A;  3JVU A;  1K25 A;  4NKP A;  4U3T A;  2Y2G A;  2QYB A;  3BYD A;  5AJG A;  1RCJ A;  1XKZ A;  4R4R A;  1L0F A;  2H10 A;  1K56 D;  4LCM A;  3V5M A;  3C7U A;  2D02 A;  4HH3 A;  5TBM A;  5EVI B;  4EBN A;  1BZA A;  2J3T C;  3VP4 A;  1YSP A;  3ZDJ A;  2VV7 A;  3T4T A;  4C6Y A;  4E04 A;  1Y54 A;  3BLM A;  2ZC4 B;  3HLF A;  3BFD A;  3VP3 A;  3UB9 A;  3Q7V A;  4S2M A;  5F1G A;  1VET A;  3MS6 A;  5KSC A;  4R4S A;  2FFY A;  4B4X A;  1W7F A;  2PDR A;  3P98 A;  4JF5 A;  3W8K A;  2UWX A;  3JPU A;  2P08 A;  3UB5 P;  2HGV A;  5CED A;  1WA9 A;  1LL9 A;  3Q7Z A;  3UN7 A;  1IKI A;  3SOI A;  4L9F A;  4Y5F A;  2BG1 A;  2ZL1 A;  4WZ5 A;  3ZG0 A;  2HPB A;  1TDL A;  3KSH A;  4EW7 A;  1ALQ A;  3TOI A;  1ES3 A;  4DDS A;  1NYM A;  3ZG8 B;  5F69 A;  3MFD A;  3BY9 A;  4Y17 A;  2C6W B;  3F1P A;  2EX8 A;  1XA1 A;  3ULF A;  4R3B A;  1VM1 A;  2VJW A;  4EWF A;  1Y4O A;  4JGQ A;  1LI9 A;  4ZJ1 A;  5HWT A;  5EVI C;  1FCN A;  2JN7 A;  3IS2 A;  3T50 A;  1MKM A;  5M1A A;  3P09 A;  5L2F A;  4LRX C;  3MJQ A;  1K57 A;  4X55 A;  4BLM A;  4JXS A;  5CRF A;  1MWS A;  4DE2 A;  4IVI A;  5EUA A;  2PHY A;  3A0R A;  5CEB A;  3T12 B;  4Q0J A;  3WS2 A;  2ZQ9 A;  3EGD C;  2QPN A;  3VP1 A;  3R7W B;  2UV0 E;  1Z09 A;  1RP5 A;  1CI9 A;  3PBQ A;  2V9A A;  4MBF A;  2M7U A;  1PYY A;  4CLC B;  1M6K A;  3K3C A;  5F83 A;  1W63 M;  4R6L A;  1HLU P;  4Y13 A;  5M19 A;  1K54 C;  2HP9 A;  1KVL A;  3OCL A;  1XA7 A;  3Q1F A;  4JF6 A;  1DJB A;  2H5S A;  5A90 A;  2Y2O A;  5KMW A;  2O9C A;  2WGI A;  3BEB A;  2B5R A;  5HDC A;  4BL3 A;  5CGS A;  3ZYT A;  4IUK A;  3CI6 A;  3BFG A;  2K2N A;  1ZKJ A;  2JBF A;  5J4E A;  3UME A;  5EEC A;  4II7 A;  4DDY A;  3WRT A;  4AFI A;  2XA7 M;  5KIZ A;  3I7J A;  2W1T B;  3HLW A;  1YLT A;  1O7E A;  3UDX A;  4DF6 A;  1ACF A;  2X71 A;  4I5S A;  3PHY A;  4PM6 A;  3LI8 A;  4WBG A;  4E3N A;  4WM9 A;  1XJ6 A;  4DJ2 A;  3RJU A;  3E4P A;  4CLC C;  2QJ7 A;  1W8Y A;  2DMW A;  4KQR A;  3LY3 A;  4O7D A;  4P85 A;  4M3K A;  3LR5 A;  3NUL A;  2J3W A;  3N4I A;  2Y2K A;  2W1R A;  1D06 A;  3EOI A;  1NLY A;  3VE4 A;  3CUE A;  3IBR A;  1BLH A;  4CLC A;  1YLW A;  3OPP A;  4FUW A;  3A3F A;  4HHD A;  4R23 A;  4LRY C;  4X25 A;  2Y55 A;  4DMZ A;  3DBA A;  1GHP A;  4B4Z A;  3VV4 A;  4FTX A;  3BQA A;  4ARZ A;  1MXO A;  4C3Q A;  3ICY A;  1S0W A;  1NZU A;  2VZW A;  4N92 A;  1Q2Q A;  3D3O A;  3NC8 A;  4HP4 A;  1VB6 A;  5HZH A;  3JVV A;  1BSG A;  5DVA A;  4EV4 A;  1H3Q A;  1T18 A;  2HDS A;  5CER A;  4MEZ A;  3AGF A;  1NLZ A;  1L0G A;  4OOY A;  5U47 A;  3C7V A;  4BEN A;  3KSF A;  4YNR A;  1GSX A;  3W4O A;  4WYY A;  4JBF A;  4QHC A;  1K55 A;  4OPR A;  4GKU A;  5DKL A;  3C4P A;  3BW6 A;  3ZHH A;  3FZC A;  2WYX A;  1N9L A;  2CC1 A;  3EEA A;  4KEN B;  1XGJ A;  1HD8 A;  4NG2 A;  3O88 A;  1DP8 A;  2J8Y A;  1CI8 A;  1FOF A;  4OQH A;  2W3H A;  3UDI A;  1SHV A;  3TE8 A;  1HZO A;  4K0W A;  1L3L A;  3T1X A;  3ZGA B;  3WS5 A;  5FDS A;  3VFF A;  3MZD A;  4UA7 A;  2HDU A;  1GCE A;  3D4F A;  1YLZ A;  1K6R A;  4FCF A;  2QMI A;  1DP6 A;  1MWT A;  2WZZ A;  1XGI A;  3LIF A;  2OV5 A;  4BD0 A;  3BEC A;  1FCO A;  4ZAM A;  4Q8I A;  3S7N A;  5GLA A;  2DCF A;  3OLO A;  3MKE A;  3EQV A;  4H6J A;  3DW0 A;  4QPR A;  1PNE A;  3F1O B;  3GDI A;  1YLY A;  3TRC A;  1S67 L;  2PYP A;  5DTK A;  3LI9 A;  5DFY A;  1ESU A;  3RFB A;  3ZQ5 A;  2V0W A;  4P6Z S;  4E3O A;  1OTD A;  3LGO A;  1XFN A;  3W4P A;  3RTY A;  4RA7 A;  3VSL A;  2Y2I A;  1TF1 A;  2BAS A;  4Z9Q A;  3P7N A;  3NOP C;  4HBU A;  4E3I A;  3QP5 A;  1EWZ A;  4HJ4 A;  2OSU A;  1YMS A;  4MCW A;  1XX2 A;  3OOV A;  1NZO A;  3HCY A;  1S4S A;  3LEQ A;  1NXY A;  3CPT B;  2B02 A;  5K5B A;  2QKP A;  2ZM2 A;  3TJZ C;  4PPR A;  4BQM A;  1K6S A;  3IWI A;  4JXW A;  1NJ4 A;  5DJU A;  5TBM B;  2ZQA A;  4F3L A;  3NBL A;  1SDE A;  3GVB A;  4IHQ A;  1KE3 A;  3MSH A;  4CQH A;  4G3K A;  1YQS A;  4IJG A;  4DJ3 A;  1YSQ A;  5DF7 A;  3ZG5 A;  3NIA A;  3Q7V B;  3A0S A;  4Z1W A;  3MQ0 A;  2ZOH A;  3FV7 A;  3MXS A;  3BM6 A;  5A93 A;  3IH9 A;  5IT5 A;  1ZTU A;  2HV1 A;  3C4O A;  1G5U A;  3IX8 A;  1CEF A;  2KX6 A;  3MZE A;  5A8B A;  5HFO A;  4F94 A;  2Z2M B;  1CJF A;  5CGX A;  3T4S A;  3QP8 A;  3F1O A;  5FAT A;  4EQI A;  5AVF A;  2XQZ A;  2ZL1 B;  1PRQ A;  1KGF A;  4LEN A;  1I2S A;  1SDN A;  5CGW A;  3MXQ A;  4JLF A;  3PBN A;  3R4K A;  2E8I A;  4ZBE A;  2PBD P;  3HUO A;  3LIA A;  4PKY A;  3D9Y A;  4HIA A;  3SH9 A;  3L9K A;  5HDD A;  2MJ6 A;  1C3B A;  4UHU A;  1NRJ A;  3F1P B;  3DTK A;  3UE1 A;  3BWL A; 
#chains in the Genus database with same CATH homology
 5HPF A;  3R7W A;  1H8M A;  4I3J A;  3LIB A;  2JHE A;  2QWS A;  5LBR A;  4ME4 A;  2PHY A;  2V0U A;  3UE6 A;  3A0R A;  2FZ0 A;  4EES A;  2YKH A;  4UQI M;  4Q0J A;  2W3F A;  2GNX A;  3IS2 B;  2O0Y A;  3EGD C;  3KYQ A;  3LR3 A;  4PHT A;  1OT9 A;  1XJ3 A;  4EQ1 A;  2ZMV A;  4WL9 A;  4OOL A;  4EU0 A;  3R7W B;  3BY8 A;  2V1A A;  3T4J A;  3PBS A;  4G3V A;  1OTB A;  2PD7 A;  4ZRR A;  2M7V A;  3PBQ A;  2V9A A;  3VE3 A;  3E4O A;  2M7U A;  4CLC B;  3PYP A;  4HJ6 A;  3KSG A;  1G6O A;  5HPI A;  3K3C A;  2QHK A;  5G4Y A;  2J3T D;  1GSW A;  1W63 M;  4R6L A;  2PR5 A;  5J3W A;  4NXF A;  3T4L A;  3TW8 A;  4HOI A;  2NUP C;  2KDK A;  4EEU A;  3OCL A;  5HWW A;  2EA9 A;  1YAX A;  4FOF A;  3K3D A;  4NXB A;  1S1Y A;  3PBO A;  4WEL A;  4GW9 A;  4HY8 A;  4WLA A;  3B33 A;  2LB9 A;  4NEE D;  4P6Z M;  4BMW A;  1OT6 A;  2O9C A;  2VX8 A;  2O9A A;  5HDC A;  2W1T A;  3ZYT A;  3S7Q A;  4GS9 B;  1P9W A;  4IUK A;  1TD5 A;  3GEC A;  2HF6 A;  3CI6 A;  2VV8 A;  3W2Z A;  3NOT C;  2L4R A;  3NOU C;  2K2N A;  3CIT A;  1V9Z A;  5J4E A;  1DP9 A;  4BWI A;  3UME A;  5F68 A;  3PBT A;  3FPW A;  4II7 A;  1ODV A;  4KUK A;  2K31 A;  2OAP 1;  4AFI A;  2XA7 M;  5KIZ A;  3H9W A;  3S7O A;  2W1T B;  2PD8 A;  2VA0 A;  4ETZ A;  2V1B A;  4B93 A;  2P7J A;  1OJG A;  4PAU A;  2FH5 A;  3O5Y A;  3UMD A;  4B9O A;  2K7S A;  1LSW A;  4XT2 B;  1T1A A;  2W3E A;  2NUT C;  4BBV A;  5F6A A;  5C5K A;  4I5S A;  3KYZ A;  1YKD A;  3PHY A;  3B42 A;  3LID A;  3FC7 A;  3UB8 A;  1IFQ A;  4O0P A;  1EW0 A;  5MC7 A;  4BBU A;  3LI8 A;  1OTI A;  2O9B A;  3KX0 X;  5HD5 A;  4EUV A;  2OWH A;  1ZHH B;  4UEY A;  3H82 A;  2JKR I;  4HP9 A;  2O99 A;  1XJ6 A;  2PT7 A;  1T1C A;  4L9G A;  2OAQ 1;  4DJ2 A;  4EXO A;  3E4P A;  1S66 L;  4KQD A;  4CLC C;  1VHM A;  2QJ7 A;  1F98 A;  2DMW A;  4OOM A;  2XRO A;  3CWF A;  2GJ3 A;  4JGO A;  4L0L A;  2W0N A;  3LR5 A;  3V67 A;  2VKS A;  2J3W A;  1F5M A;  2PR6 A;  2GX5 A;  2W1R A;  1D06 A;  3EOI A;  1NLY A;  3H82 B;  3VE4 A;  1LT0 A;  4R38 A;  2I9V A;  3CUE A;  3IBR A;  5HDS A;  4G3W A;  1OPX A;  3MR0 A;  4CLC A;  1JNU A;  2XSS A;  2ZBB A;  4L9E A;  1N9N A;  4HHD A;  4MN6 A;  4JGP A;  2J80 A;  2W3G A;  4LRY C;  5TJJ A;  4DMZ A;  3DBA A;  3T4O A;  3T4K A;  2L1M A;  3VV4 A;  3BQA A;  4KQO A;  4ARZ A;  5KSH A;  2KLI A;  3ICY A;  2Y8H A;  1OTE A;  3CLO A;  3NJA A;  1D7E A;  2VZW A;  5I5L A;  4WN5 A;  3D3O A;  4HP4 A;  3EWK A;  5HSQ A;  4GS9 A;  1VB6 A;  2G7U A;  5HZH A;  2CMN A;  1T1B A;  3JVV A;  2VGL S;  2OOL A;  5L8M A;  2EWV A;  1H3Q A;  3EGX C;  1T18 A;  4WUJ A;  2WKP A;  4CLC E;  4R70 A;  3F1N A;  1W63 Q;  1P9R A;  4KUO A;  5F5Y A;  4GCZ A;  1STZ A;  4PKY G;  2XA7 S;  1NLZ A;  2Z6C A;  2M1C A;  3CAX A;  3MF0 A;  4MMN A;  4ARZ B;  3FPV A;  2JKT I;  3HJK A;  4MN5 A;  2OWJ A;  1MZU A;  3KSF A;  1GSX A;  4YNR A;  2W3D A;  4GHI A;  4RQ9 A;  5HWV A;  1LL8 A;  1LSV A;  2VV6 A;  5DKL A;  3K2N A;  3BW6 A;  4HJ3 A;  3F1N B;  4BBT A;  1UGU A;  3EEH A;  2HJ9 C;  5DJT A;  4WEJ A;  5DFX A;  1BYW A;  4XT2 A;  3PXP A;  1N9L A;  3EEA A;  5HD3 A;  1LSX A;  4GHI B;  1DP8 A;  3S7P A;  3NHQ A;  3MFX A;  4Y2F A;  1TS0 A;  2W3H A;  3TE8 A;  3E4Q A;  3B47 A;  2INW A;  4HH2 A;  3UB7 A;  3IBJ A;  3OC2 A;  2ZOI A;  4WEK A;  3KO6 A;  3E98 A;  4DN0 A;  3KSI A;  3OCN A;  4MDZ A;  4CLC D;  3CUE C;  4UQI S;  1DP6 A;  4I38 A;  1DRM A;  1IOU A;  5G4Z A;  4EEP A;  3LIF A;  1V9Y A;  1S1Z A;  2P04 A;  5DKK A;  3LUQ A;  3UB6 A;  4ETX A;  3LYX A;  5DF9 A;  2PYR A;  2A2L A;  4I39 A;  2WKQ A;  3S7N A;  3LIC A;  5IU1 A;  3OLO A;  3MQQ A;  4LLO B;  1Y28 A;  4LRZ E;  3EQV A;  4HNB A;  5FL3 A;  3LIE A;  4H6J A;  4QPR A;  3BQ8 A;  2ZMF A;  3F1O B;  1XJ4 A;  3GDI A;  4M4X A;  4GJ4 A;  2XRN A;  3TRC A;  4K08 A;  4GLQ A;  1S67 L;  2PYP A;  1GSV A;  3LI9 A;  1P0Z A;  3MQO A;  5DFY A;  1F9I A;  3H7W B;  4YOF A;  3RFB A;  3ZQ5 A;  2V0W A;  2HJE A;  1UWN X;  4HQA A;  4MN7 A;  1TS7 A;  1UWP X;  3EQU A;  4LPZ A;  4P6Z S;  4HI4 A;  1OTD A;  1XFN A;  3PR6 A;  3MMH A;  4O01 A;  3HJI A;  2Z6D A;  1T19 A;  4H6J B;  5EFW A;  2QJ5 A;  2EWW A;  5CX7 A;  1XFQ A;  4I3A A;  2KOI A;  4WF0 A;  4BJP A;  3RTY A;  3JVU A;  1XJ2 A;  1TF1 A;  2BAS A;  4NKP A;  2H28 A;  3RH8 B;  3P7N A;  3NOP C;  2A24 A;  2VLG A;  3A0V A;  4HJ4 A;  2QYB A;  4YWZ A;  3FG8 A;  5AJG A;  2W27 A;  1KOU A;  4MCW A;  3T4Q A;  3OBF A;  1P97 A;  3OOV A;  3HCY A;  1S4S A;  2VEA A;  3VOL A;  3D72 A;  4EER A;  1TS8 A;  2D02 A;  2IA2 A;  4HH3 A;  5TBM A;  4NXE A;  3BJN A;  2B02 A;  5K5B A;  1OTA A;  2J3T C;  2JKR M;  2QKP A;  1YSP A;  2GZA A;  1OJ5 A;  2A24 B;  2VV7 A;  5IS1 A;  4I3I A;  3TJZ C;  3T4T A;  4O8G A;  3C30 A;  4E04 A;  5J7E A;  4EET B;  3UE3 A;  3UB9 A;  5DJU A;  2B18 A;  2WKR A;  5TBM B;  3E0Y A;  4F3L A;  2PDR A;  2VGL M;  4IHQ A;  2P08 A;  1X0O A;  2HGV A;  4CQH A;  1WA9 A;  4G3K A;  3C38 A;  5AVE A;  4IJG A;  2L0W A;  4DJ3 A;  1YSQ A;  4L9F A;  4Y5F A;  3C8C A;  3A0S A;  4Y3I A;  4Z1W A;  3MQ0 A;  1MC0 A;  2ZOH A;  3KSH A;  4EW7 A;  4JGR A;  3LR4 A;  4Q0H A;  4F3L B;  5IT5 A;  1ZTU A;  2HV1 A;  2KX6 A;  2YKF A;  5A8B A;  3PBR A;  5F69 A;  3T4S A;  1G28 A;  1TS6 A;  2R78 A;  3F1O A;  4NXG A;  3BY9 A;  2Y79 A;  3F1P A;  1NWZ A;  3G6O A;  3H7W A;  5AVF A;  3ULF A;  2D01 A;  4Q0I A;  3MXQ A;  2VJW A;  3PBN A;  3R4K A;  3U2A A;  3P01 A;  3LFV A;  3LIA A;  4JGQ A;  4PKY A;  1S4R A;  1N9O A;  2JKT M;  4FSF A;  5HWT A;  4HIA A;  3SW1 A;  2JN7 A;  3IS2 A;  2MJ6 A;  5HDD A;  3T50 A;  1MKM A;  1NRJ A;  3LR0 A;  3C2W A;  3F1P B;  4IUH A;  4LRX C;  2LB5 A;  4R3A A;  3MJQ A;  5HL6 A;  3BWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...