5IS1A

Crystal structure of the extracellular domain of sensor histidine kinase yycg from staphylococcus aureus at 2.0 angstrom resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
142
Chain Sequence
NNLEKELLDNFKKNITQYAKQLEISIEKVYDEKGSNAQKDIQNLLSEYANRQEIGEIRFIDKDQIIIATTKQSNRSLINQKANDSSVQKALSLGQSNDHLILKDYGGGKDRVWVYNIPVKVDKKVIGNIYIESKINDVYNQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine kinase
publication title Structural Studies on the Extracellular Domain of Sensor Histidine Kinase YycG from Staphylococcus aureus and Its Functional Implications
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 44
structure length 142
sequence length 143
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2016-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5is1A00
4GS9B 4H6JB 1X0OA 1OTDA 4HP9A 4M4XA 2OWHA 4EW7A 3MQQA 1T1CA 1BYWA 4L9FA 4HJ4A 1OTIA 3E4QA 2OWJA 4NXBA 3NJAA 4L9GA 3VOLA 1OJ5A 3F1NA 4E04A 1LSXA 3G6OA 4I5SA 3H82B 3CAXA 2KX6A 4I3JA 4PKYA 2V0WA 3KX0X 2HV1A 3UB8A 5I5LA 4EERA 3K3CA 2OOLA 3UE6A 3H9WA 4NXGA 1F9IA 2ZOHA 3LICA 2I9VA 2INWA 2A24A 3UB9A 2EA9A 1T1BA 2QJ7A 4EEUA 3F1PB 3B33A 1XFQA 1JNUA 3IBRA 4WUJA 5AVEA 2VEAA 3K3DA 1S4SA 4LRXC 1EW0A 3LIEA 1OTAA 4EXOA 2V1BA 1V9YA 2V1AA 1GSWA 4XT2A 3HJIA 2ZOIA 2CMNA 5EFWA 2YKHA 1TS6A 1MZUA 2D02A 1OTEA 5HWWA 3F1OB 2PR5A 4HHDA 4JGPA 1DP8A 1S1YA 1T19A 1XFNA 1P0ZA 2JHEA 2PYRA 2K7SA 2PD8A 2PD7A 4GCZA 3E4PA 3H7WB 1S4RA 5HWTA 1F98A 5HD5A 2JN7A 4I3IA 3A0SA 3MFXA 1OTBA 1OJGA 2QKPA 1TS7A 4NXFA 1DP9A 5F69A 3VE4A 1LL8A 5DKLA 2PHYA 3PHYA 1V9ZA 1N9LA 5TBMA 2QJ5A 2PDRA 1KOUA 3CLOA 2BASA 2VV8A 4LLOB 3A0RA 3MJQA 1P97A 3PYPA 3P7NA 3BY9A 4I39A 3IS2A 1N9OA 4XT2B 3OLOA 4EETB 3UB6A 3LUQA 3LI8A 4GS9A 4L9EA 4WL9A 4F3LB 1GSXA 3LIAA 4BBVA 5HWVA 4R70A 5KIZA 4NXEA 3RTYA 4HJ6A 4DJ3A 4LPZA 4KQDA 3NOPC 3UMDA 4JGOA 3BWLA 4HNBA 4HOIA 2L4RA 2R78A 2KDKA 3C2WA 4HI4A 4MN6A 4R3AA 2WKPA 1XJ6A 4HJ3A 2L1MA 2QHKA 1S1ZA 3VE3A 2VV7A 5J4EA 1OT6A 4YWZA 3CWFA 1ODVA 4HQAA 1N9NA 2L0WA 3F1NB 4R6LA 5J7EA 1NWZA 1LT0A 5HDCA 2W27A 3F1PA 1D06A 1XJ3A 4JGRA 4K08A 3ULFA 3LIBA 1VB6A 4LRZE 4LRYC 4I3AA 2GJ3A 2V0UA 2Z6CA 3T50A 3UMEA 2B02A 2YKFA 1LSVA 2P7JA 4HIAA 3NOUC 1Y28A 2A24B 4GHIA 3C8CA 3SW1A 5IS1A 3LI9A 5AVFA 4B9OA 5HZHA 1LSWA 3LIDA 1UWNX 3GECA 2D01A 3GDIA 5J3WA 5DJTA 3F1OA 2PR6A 3D72A 4HH2A 4EESA 3A0VA 3MXQA 2VV6A 3H7WA 4KUOA 3RH8B 2QWSA 2WKRA 3LIFA 3NHQA 3E4OA 4HY8A 4JGQA 4RQ9A 1TS8A 1D7EA 4EQ1A 4H6JA 4WLAA 2Z6DA 1GSVA 1T1AA 5IU1A 5F5YA 1DP6A 4GW9A 2H28A 2VLGA 4EEPA 5HD3A 3BY8A 3H82A 3FC7A 5F68A 4DJ2A 2PYPA 5G4YA 4PKYG 5A8BA 2ZBBA 3LYXA 1OT9A 1S66L 3ZQ5A 3EWKA 4MN5A 4WN5A 3MR0A 1G28A 2W0NA 1XJ4A 5DJUA 3HJKA 4GHIB 2V9AA 4F3LA 3UB7A 1DRMA 1WA9A 4KUKA 2WKQA 3FG8A 5HDDA 4R38A 1S67L 5TBMB 4BBTA 4I38A 5HDSA 1T18A 3ICYA 1UGUA 4HP4A 5HSQA 3MQOA 5G4ZA 4HH3A 2M1CA 5F6AA 5DKKA 1XJ2A 1TS0A 4WF0A 1UWPX 3NOTC 3EEHA 4BBUA 3IS2B 2J80A
chains in the Genus database with same CATH superfamily
1X0OA 1SKFA 2VGJA 4HP9A 4M4XA 2OWHA 3IH9A 4D60A 1PNEA 1GA9A 5K5BA 2R9WA 5GHZA 5DF7A 4R4RA 4O8GA 3GQZA 3SH9A 3F1NA 3W2ZA 2OLUA 3ZG5A 3IXDA 1XGIA 1XP4A 3CAXA 5C5KA 3W8KA 4B93A 3Q81A 2V0WA 2ZC3B 2XFSA 4BENA 1SDNA 5E2EA 2HP5A 1L0FA 3S1YA 1FSWA 3CZDA 3IF6A 2X71A 3H9WA 4IVKA 5E2HA 1EI5A 4NXGA 1J9MA 3QP8A 4DDYA 2HDUA 2WYXA 3UY6A 2A24A 4MLLA 3IXBA 2V8FA 2PT7A 3SS4A 2EX2A 3B33A 3HLBA 1H8ZA 1NLZA 3MF0A 3E0YA 3BM6A 3W4PA 2KLIA 1JNUA 1ZG6A 5FASA 1KGFA 2VEAA 3DTMA 1S4SA 3NC8A 2DNSA 1OTAA 2OV5A 3UPOA 3IQAA 3IXHA 4K0XA 4GOGA 3M2KA 3SH8A 1PWGA 2ZOIA 2V1ZA 2W3FA 4R0QA 3EEAA 1SKOB 4S2JA 4NKPA 2O9AA 5HL6A 1OTEA 4PM9A 4KZ4A 3B3XA 3F1OB 4E6WA 2IA2A 3SOIA 5HX9A 4CLCD 1T19A 3WS1A 1P0ZA 3IX3A 2PYRA 4XUXA 1ESIA 2WKHA 3QP2A 3PAGA 3H7WB 3O87A 1NYMA 2B18A 3LEQA 4GNUA 4I3IA 2W1TA 3MFXA 1Q2PA 3FPWA 2Y2QA 4G3VA 2XR0A 4UEYA 5F82A 1P9WA 5DVAA 5F69A 3IF6C 4FCFA 3Q7VA 4R1GA 4E3KA 2ZM2A 1ES5A 2XF3A 1V9ZA 3HLGA 4KZ5A 5EVIB 3ZDJA 4EWFA 3VOZA 3G2ZA 3GSGA 4OQGA 3NECA 2VV8A 3NI9A 5EOEA 1VETA 3A0RA 1BZAA 4QB8A 3P7NA 2Y2LA 4MBFA 3IS2A 4XT2B 1GHPA 2IWBA 4EETB 3KSFA 5GLBA 2RCXA 4N1XA 1VQQA 1C3BA 4BBVA 3NY4A 5HWVA 3PBOA 1YLYA 5GL9A 1F5MA 2IWCA 4LV0A 4LFUA 3RTYA 3CI6A 4Q8IA 3LR5A 3UMDA 3BWLA 1ERMA 3R7WA 3UN7A 4DE1A 4HBTA 3C4PA 3N7WA 3V67A 3V50A 1H0MA 2R78A 3HCYA 3SS5A 1K25A 5D3OA 4OH0A 3WRZA 3C2WA 4HI4A 1NRFA 5HARA 4R3AA 2WGIA 2WKPA 4HJ3A 2L1MA 5M18A 1XXMA 1ZG4A 3MMHA 5DF9A 5EOOA 2L0WA 1XGJA 4KZBA 3HUOA 4DKIA 2GX5A 4GDNA 1NWZA 4FD8A 3ZCZA 3D9YA 3U4LP 2W27A 4MDZA 3UDFA 5EV0A 4KZ8A 3CMZA 4K08A 3UPNA 4LRZE 3IWIA 4LV2A 4MN7A 4X25A 4GZBA 4NETA 3VP0A 1K6SA 4S2LA 3VP3A 1K0KA 3FV7A 4Y3IA 1ERQA 4EUZA 4E3IA 4ETZA 1ALQA 3NOUC 2ZM0A 3VMAA 3N8LA 2W3DA 1LSWA 3TG9A 3GRJA 3LIDA 3ISGA 3OBFA 3DTKA 1IEMA 1FCNA 3UPPA 5J3WA 5EPHA 1E4DA 3KYQA 3RFBA 1YM1A 3W4OA 5DTTA 3B42A 4HH2A 3MXQA 4ZJ1A 2K31A 4KUOA 4EU0A 4G3WA 2XA7M 1PW8A 5EVIC 3RH8B 5A92A 2QWSA 3G2YA 3Q7ZA 4RQ9A 3T1SA 3DAVA 5DFYA 3PTEA 1BT5A 3HLWA 5GLCA 4EQ1A 4H6JA 2J7VA 3DTIA 1G6OA 1L0DA 1XA1A 3T4SA 1DJBA 1CEFA 3RJUA 2XDMA 1TD5A 2FFYA 3T4TA 4RYEA 1CK3A 5FQIA 5F68A 3DWZA 5G4YA 4QY5A 3HLEA 3BYDA 2O99A 1PYYA 4P6BA 4BL2A 5A8BA 5HPFA 1HTZA 4LCLA 2WAEA 3N4IA 4MN5A 3WRTA 4U0TA 4D2OA 3W4QA 3OC2A 3IX8A 4BD0A 4B88A 3HUNA 4OPYA 5DJUA 2PU2A 3HJKA 4OLDA 4GHIB 3ZG0A 1YLJA 3MZEA 4ZTKA 1QMEA 3UB7A 1DRMA 3NDGA 4DRTA 1FILA 5HDDA 3S7NA 2XQZA 3S4XA 1ONHA 2PBYA 4CLCB 1HLUP 5HDSA 5FATA 2WZZA 3ICYA 1UGUA 4KG5A 5FI2A 3ZVWA 4KZAA 4NK3A 3N6IA 1WYCA 2HGVA 4HH3A 4GJ4A 4LV3A 4WF0A 1UWPX 3OCLA 3EEHA 5F1GA 4BBUA 4XUZA 3IXGA 3BFCA 3KYZA 3JVVA 4WEJA 5AQBA 3JPUA 4OLGA 5TFQA 2FZ0A 3KSGA 4QJGA 1BYWA 4ID4A 1VHMA 1Z09A 4HJ4A 3OPHA 4K0WA 3V5MA 2R9XA 4WYYA 5CXWA 3QP1A 1YKDA 2VKSA 2XH9A 4I5SA 3H82B 2E8IA 2G7UA 4II7A 1O07A 3A3FA 1L0GA 4A5RA 5KSHA 3IBJA 3K3CA 3UE6A 2HP9A 1H8MA 4C75A 4KG6A 3LICA 5F83A 3FWLA 2INWA 1GCEA 4Y5FA 1EROA 2EX6A 3UB9A 1TVFA 1XA7A 1T1BA 4XXRA 1O7EA 5KSCA 2QJ7A 1K55A 1SCWA 2LB9A 2Z2LB 3KYEA 3F1PB 4DMZA 3V3SA 2VK3A 1XFQA 2Y2HA 3N8RA 5FQMA 4KZ9A 4OOYA 4R23A 5AVEA 4Q0IA 3G32A 2ZC4B 3K3DA 4JXWA 1EW0A 4EXOA 1KDWA 2V1BA 5EE8A 4E3OA 4S2PA 4YNRA 5CHMA 3LCEA 4C3QA 3UB5P 1LL5A 5E43A 4YINA 4NEED 3VV4A 5EFWA 1MZUA 4B4ZA 4CJNA 1CI8A 4OQIA 5HWWA 2JKTI 3E2LA 4JGPA 3G31A 3T1XA 2PD8A 3L7HA 1BUEA 5AQ9A 1I2SA 2HJEA 1S4RA 5HD5A 1TS7A 1LLBA 4ESPA 3IF6B 5FEGA 4PM5A 5IHVA 1IFQA 2Y59A 2Y2PA 1DP9A 3C5AA 3IHAA 1K54C 3RXWA 3AGDA 1YQSA 4MEZA 3EGDC 3OPPA 5DKLA 1SDEA 2DCFA 3PHYA 4KQRA 4ME4A 3ZG7B 4KG2A 3BFEA 1N9LA 3UE0A 1NY0A 3DWKA 2GNXA 5TBMA 3IWQA 5AQAA 2ZQ8A 2PDRA 3Q07A 2BASA 4LGWA 3UDXA 3ZGAB 1P97A 3PYPA 2VZWA 3BJNA 4NG2A 2EWVA 1N9OA 4U3TA 3PXPA 3OLOA 3CHWP 1GSXA 1J3WA 3HLFA 3LIAA 5L8MA 4R70A 4QU3A 5TR7A 2XFTA 3A3DA 3OPRA 2OAQ1 2UWXA 4DJ3A 2ZMAA 4KQDA 4PHTA 4JGOA 5HAIA 3VSKA 1IYSA 4HNBA 4WZ5C 3KO6A 5FQJA 3GR2A 1NLYA 5FI7A 4IHQA 3T1RA 2EX8A 2QHKA 4GD8A 3M6HA 4GLQA 2VV7A 5HAPA 2ZLYA 3BFDA 4Y15A 1GHMA 4HQAA 1H3QA 4DE3A 2P74A 2Y4AA 1MC0A 3S22A 5HDCA 3Q7VB 1D06A 4N1HA 1N4OA 2Y2JA 4IVIA 1YLWA 3ULFA 3LIBA 1VB6A 3EQUA 3FKVA 3C4OA 2A2LA 3MKEA 4LRYC 5CHJA 3U2AA 4I3AA 2GJ3A 1RCJA 2Z6CA 2B02A 2H5SA 1CJFA 1PW1A 4OPRA 4QD4A 5GHXA 4KZ7A 2ZQDA 1KE0A 4O7DA 1W5DA 1JVJA 3E2KA 3MZFA 4OVDA 2EX9A 5IS1A 5AVFA 4B9OA 5HZHA 1SKOA 1LI0A 5TGFA 3V3RA 3GECA 3GMWA 4OPZA 2EFUA 3F1OA 2EFXA 3BLSA 5JYPA 4FUWA 2BLSA 3D72A 3GTCA 4EESA 1JWZA 4CQHA 3H7WA 4ZJ3A 2IWDA 3BQAA 4EBPA 2G2UA 1MPLA 2WKRA 3E4OA 4HY8A 2JKRM 1MKIA 2X02A 4C6YA 5GLAA 1ES3A 3DW0A 4WLAA 2Z6DA 4Y17A 1PFLA 5IU1A 2J9PA 1VM1A 1CEGA 1IYOA 2VLGA 3IF5A 4IBRA 4BQMA 4EEPA 1CF0A 5A93A 4X69A 3FC7A 4JPMA 1PIOA 3BFGA 1F2KA 2XRNA 4OOLA 5FQQA 2ZBBA 3LYXA 1S66L 1OPXA 1YLZA 2ZL1A 4DN0A 3EWKA 4LV1A 3VP2A 3MQ0A 1IYQA 5FQKA 1L2SA 3P09A 1KVLA 2ZJ9A 3QHYA 5F1FA 3QNBA 1RGZA 1XJ4A 5JYOA 1DJCA 4JXGA 4E3LA 3EQVA 1CQAA 2JBFA 2WADA 2XLNA 2HF6A 4R3BA 5L2FA 4Z1WA 5U47A 5TJJA 3T12B 4KUKA 1YLPA 1L0EA 3TE8A 2FFFB 4HEFA 4BBTA 5EM0A 4I38A 1T18A 5FA7A 4CPKA 4HP4A 5HSQA 3HUMA 1LHYA 2WZXA 5G4ZA 4X1LA 3WS5A 2GZAA 2ZD8A 1D1JA 5CTNA 3OCNA 2QYBA 2Y2KA 4CLCE 3WWXA 4U0XA 4GS9B 3Q1FA 2ZC7A 3IWOA 4H6JB 3FZCA 1OTDA 4O01A 3MZDA 3MQQA 4Y0UA 1T1CA 3RXXA 4OP5A 5FSRA 3T4JA 4S2NA 5E2FA 4EBLA 2A3UA 3NJAA 4L9GA 3VOLA 4S2MA 1OJ5A 1MXOA 2ZM8A 5EM1A 1LSXA 3S7PA 1CI9A 4PAUA 3LY4A 1U60A 5CX7A 1BSGA 4OKPA 4GB7A 2WK0A 3O5YA 1GHIA 3BRMA 3CUEA 2I72A 2ZQ9A 5AQ7A 5I5LA 3HVFA 4EERA 2H10A 1RP5A 2M7VA 4Y7PA 1F9IA 4JF5A 3ZHHA 3C30A 3A3JA 3SZTA 2LB5A 3BECA 2I9VA 4P0MA 1W63Q 1PZOA 4EEUA 3LO7A 3NULA 2ACGA 4ZJ2A 3C38A 5EUAA 4IBXA 1AWIA 5FDSA 3IH8A 3C7VA 1FOFA 4ZAMA 3OZHA 1Y4OA 1V9YA 2V1AA 4UA9A 5GLDA 1NXYA 4HESA 1YMXA 2CMNA 3CPTA 5CERA 2ZMFA 1TS6A 2D02A 1K57A 1GA0A 3BW6A 3AGFA 3LR0A 4JF6A 2PR5A 3CITA 3KSIA 4HHDA 1DP8A 1S1YA 5DF8A 1W8YA 2Y2MA 3O3VA 1XFNA 2JHEA 2WKEA 2K7SA 1PWCA 2RL3A 3E4PA 2ZMVA 3FPVA 2WGWB 3ZG8B 2ZQCA 1WE4A 2DRWA 5HWTA 3QNCA 3IT9A 4ARZB 2XGNA 1OTBA 1OJGA 5L10A 3M6BA 5A90A 2QKPA 4KQQA 4S2IA 4NXFA 3TW8A 1VEUB 5CHUA 1JWPA 2P9VA 2W3HA 3WS4A 1JTDA 3LFVA 5CRFA 3TRCA 4BLMA 5IT5A 4OONA 1I5QA 4P85A 4X55A 4K91A 3PAEA 4GN2A 4CLCA 2QJ5A 4WM9A 3NBLA 4E3NA 1FIKA 1LI9A 3HLCA 1M6KA 3D4FA 4LLOB 3MJQA 3SH7A 1YPRA 4DXCA 4MMNA 3UO9A 3BY9A 4I39A 1H8YA 4GKUA 2ZC5B 1K4FA 2EXAA 3FKWA 3LUQA 1BULA 4L9EA 4F3LB 1G5UA 1ES2A 2PRFA 3G4PA 2VGLS 4JKTA 3LR4A 5KIZA 4NXEA 4HJ6A 4LPZA 3NOPC 3CJMA 4FTXA 4PM6A 2Y79A 2L4RA 1G68A 4P6ZM 5FEFA 1XKZA 1FQGA 1XX2A 2JCHA 1MWSA 5CEBA 3JYIA 1XJ6A 3CG5A 1PZPA 4F94A 1ZKJA 1YSPA 5J4EA 2HZ5A 2OLVA 1W79A 1OT6A 3T4KA 5EVLA 2M7UA 3N8SA 1MY8A 3F1NB 4R6LA 1PWDA 4EUVA 4RX3A 1LT0A 3F1PA 4JGRA 2OSUA 3MBZA 1SHVA 4ZRRA 3GVBA 4ZDXA 4Q0JA 3UMEA 2YKFA 3A3EA 3T4OA 1IOUA 1LSVA 2P7JA 4IJGA 1ZTUA 3A3IA 2GDNA 2J8YA 5FAQA 2PU4A 1Y28A 2A24B 4N9LA 5DTSA 1FR1A 3BLMA 2J3WA 3C8CA 2Y2OA 3SW1A 3UE3A 3LI9A 3G35A 4MNRA 1UWNX 1E3UA 2HDQA 1KGEA 5J8XA 4EV4A 3AGEA 1MKMA 5CECA 5M1AA 1KGGA 2J3TC 3R4KA 1K55C 2PR6A 4FSFA 2VX8A 1OMEA 3PBTA 1P9RA 4JGQA 2Q9NA 2MJ6A 4OQ0A 1NZUA 5M19A 1D7EA 4OOMA 3VP4A 4KZ3A 1KE3A 1T1AA 1W7FA 1K6RA 2JE5A 1BLHA 1DP6A 1IELA 1W8QA 2W3GA 4PM8A 2H28A 4AFIA 3BY8A 4PM7A 3EGXC 3L9KA 4UHUA 3B47A 4UA7A 4DJ2A 3P98A 1QMFA 4P6ZS 2PYPA 4R3JA 5HL1A 4FH4A 4DE2A 2XD5A 2W1TB 1OT9A 4KZ6A 3ZQ5A 5LBRA 4YOFA 4S2KA 4WN5A 4Z9QA 1SZVA 5HPIA 1G28A 2HDRA 1JTGA 2V9AA 3MFDA 2W3EA 4BD1A 3DBAA 1WYBA 1FSYA 1FCMA 1ESUA 2Q0OA 4Y13A 2NUPC 3GV9A 3HL9A 1VETB 1H5XA 2ZQAA 1NJ4A 3LR3A 2M1CA 2PAVP 5DKKA 5HFOA 3BFFA 1TS0A 4OQHA 3IS2B 3FYZA 1TDGA 1MWRA 2J80A 4BL3A 5FQ9A 1DJAA 5CGXA 2ZC6B 1NZOA 3Q82A 3ITBA 5AJGA 2J3TD 4EW7A 1K56A 1Y54A 4EQIA 3KSHA 4L9FA 5G18A 1OTIA 3E4QA 2OWJA 1TF1A 4IEDA 1IKIA 4NXBA 4X6TA 4BMWA 4R4SA 4QHCA 4E04A 3G6OA 3VFFA 4WELA 3R7WB 1HD8A 1BTLA 2H0YA 2KX6A 4I3JA 4PKYA 4YFMA 2HJ9C 1YLTA 1MWTA 3KX0X 3QP5A 2WAFA 4M3KA 5HAQA 5FL3A 2H0TA 2HV1A 3UB8A 2ZL1B 2OOLA 5BOHA 1RGYA 2ZOHA 2Y55A 3ZG9B 4P87A 3PBNA 2EA9A 5DFXA 5KMWA 4Y2FA 2BTFP 3NIAA 2X01A 3LEZA 4JXSA 3MXSA 2EXBA 1Q2QA 2OAP1 4ZBEA 5EVIA 3IBRA 3VSLA 2W1RA 4WUJA 5CGSA 1NYYA 4LRXC 3LIEA 4MCWA 4QY6A 1GSWA 4XT2A 3HJIA 2HP6A 1ONGA 1JWVA 3ZVTA 4X1MA 3T1QB 2YKHA 2B95A 3SS3A 4MBHA 2K2NA 1K4EA 1E3UD 1KVMA 4OPQA 4GDBA 1IYPA 2Y2NA 2Y2IA 2PD7A 4GCZA 1FR6A 4WMCA 5EECA 2Y8HA 5CTMA 2XROA 2C5WB 3ZNYA 1F98A 2JN7A 4DXBA 3A0SA 2JC7A 2Y91A 4N9KA 1FCOA 2VA0A 1HVBA 1M40A 3IX4A 2JKRI 1PI5A 2E8JA 5HW3A 3T4QA 2A49A 1TEMA 1ZC2A 2QZ6A 1LL9A 3MS6A 2QMIA 2BG1A 3VP1A 3VE4A 5L07A 1LL8A 3MXRA 1S0WA 5L09A 2PHYA 4OP8A 3S7OA 1KDSA 2O0YA 4N92A 1BLPA 1KOUA 3CLOA 1W63M 3MKFA 4JF4A 3HBRA 4O0PA 2UV0E 4RA7A 2VJWA 3PBSA 4IUKA 4Y0OA 3UDIA 2AVXA 4DE0A 3TOIA 3UB6A 3CPTB 1EWZA 3LI8A 4GS9A 4WL9A 2J9OA 4E3MA 1YT4A 3O86A 4KENB 1MBLA 2VGLM 1PRQA 5DTKA 5MC7A 2XSSA 1HZOA 3K2NA 4ETXA 4HOIA 2DMWA 2Y2GA 1STZA 4LENA 2KDKA 2V20A 4MN6A 4E6XA 3UE1A 1K38A 2EWWA 3P01A 4UAAA 1MWUA 1S1ZA 3VE3A 4JBFA 4WBGA 1ACFA 1TDLA 4YWZA 3CWFA 1ODVA 1N9NA 4GD6A 1K56D 2P9VB 3MSHA 1L3LA 4PMAA 5J7EA 5FDHA 4LCMA 4UA6A 3EOIA 4S2NC 3ZNTA 1XJ3A 3OPLA 3JVUA 3PR6A 4IUHA 1Z6FA 3NDEA 2V0UA 3T50A 3TJZC 4X53A 3V39A 4DDSA 3D3OA 2CC1A 3WS2A 3O88A 3LGOA 3I7JA 2C6WB 2QPNA 4UQIM 3CUEC 4HIAA 3T4LA 1BLCA 4BJPA 4E3JA 3BQ8A 1YSQA 4GHIA 3NCKA 4Y0TA 3OOVA 2JKTM 3DTEA 2D01A 1ES4A 5GHYA 3GDIA 5CEDA 2NUTC 5DJTA 2KOIA 3VOYA 3UNWA 2WGVA 5EVID 3A0VA 2G2WA 4H8RA 2VV6A 2XA7S 1AXBA 2V2FF 2WGWA 4QWOA 3LIFA 3NHQA 1E25A 4DF6A 4RX2A 1N9BA 1TS8A 1XPBA 3LY3A 2FH5A 4ARZA 1ZHHB 5CGWA 4L0LA 1K54A 2WUQA 3ZYTA 1GSVA 1YAXA 5FAOA 2XEPA 3TSGA 1BLSA 4X68A 4KQOA 5I94A 5F5YA 1I2WA 4EBNA 1IKGA 1PI4A 2O9CA 1VEUA 4JLFA 4GW9A 2Z2MB 2O9BA 3HREA 4S2OA 2V8CA 4X56A 5HD3A 2ZQ7A 1K57C 3HLDA 3S7QA 3H82A 3IHBA 3C7UA 2P04A 4B4XA 5E2GA 1A0KA 4Q0HA 3PBQA 4PKYG 1NRJA 3VFHA 5FI6A 4WMCD 3MR0A 4G3KA 4HBUA 5KZHA 2HDSA 3G34A 2W0NA 2B5RA 1KE4A 2XK1A 2VGKA 4FOFA 2WKIA 4RVAA 1YMSA 3E98A 4F3LA 3PBRA 4QPRA 1S6RA 2HPBA 1WA9A 3BEBA 4PPRA 4MBKA 3ITAA 2JKGA 3M2JA 3QP4A 2PBDP 2WKQA 3FG8A 4R38A 3ZFZA 5EVEA 1S67L 4WZ4A 5FAPA 4WZ5A 5TBMB 1G6AA 4JXVA 4BWIA 2XD1A 3QP6A 2P08A 4FH2A 3MQOA 3WS0A 4CLCC 2JKFA 5F6AA 4WEKA 4UQIS 1XJ2A 1DY6A 5A91A 3G30A 3NOTC 2Q9MA
chains in the Genus database with same CATH topology
4GS9B 4H6JB 3KYZA 3JVVA 1X0OA 4WEJA 1OTDA 4HP9A 4O01A 4M4XA 2OWHA 5AJGA 2FZ0A 2J3TD 4EW7A 3MQQA 3KSGA 1T1CA 3KSHA 1BYWA 4L9FA 3T4JA 1VHMA 4HJ4A 1OTIA 3E4QA 2OWJA 1TF1A 4NXBA 5K5BA 4BMWA 4O8GA 3NJAA 4L9GA 3VOLA 1OJ5A 3F1NA 3W2ZA 4E04A 1LSXA 1YKDA 2VKSA 3G6OA 3S7PA 4WELA 4I5SA 4PAUA 3H82B 3CAXA 5C5KA 3R7WB 4B93A 2KX6A 4I3JA 5CX7A 4PKYA 2G7UA 4II7A 2HJ9C 2V0WA 3KX0X 3O5YA 3CUEA 5FL3A 2HV1A 5KSHA 3UB8A 3IBJA 5I5LA 4EERA 3K3CA 2OOLA 3UE6A 2M7VA 1H8MA 3H9WA 4NXGA 1F9IA 2ZOHA 3C30A 3LICA 2LB5A 2I9VA 2INWA 4Y5FA 2A24A 3UB9A 3PBNA 2EA9A 5DFXA 1T1BA 1W63Q 4Y2FA 2QJ7A 2PT7A 2LB9A 4EEUA 3F1PB 3B33A 4DMZA 1NLZA 1XFQA 3C38A 3MF0A 3E0YA 2OAP1 2KLIA 1JNUA 3IBRA 2W1RA 4WUJA 5AVEA 2VEAA 4Q0IA 3K3DA 1S4SA 4LRXC 1EW0A 3LIEA 1OTAA 4EXOA 2V1BA 1V9YA 4MCWA 2V1AA 4YNRA 1GSWA 4XT2A 3HJIA 2ZOIA 2CMNA 2W3FA 3EEAA 4NEED 2ZMFA 3VV4A 5EFWA 4NKPA 2YKHA 1TS6A 1MZUA 2D02A 2O9AA 5HL6A 1OTEA 3BW6A 2K2NA 5HWWA 3LR0A 2JKTI 3F1OB 2PR5A 2IA2A 3CITA 3KSIA 4HHDA 4JGPA 1DP8A 1S1YA 4CLCD 1T19A 1XFNA 1P0ZA 2JHEA 2PYRA 2K7SA 2PD8A 2PD7A 4GCZA 3E4PA 3H7WB 2ZMVA 3FPVA 2Y8HA 2B18A 2XROA 2HJEA 1S4RA 5HWTA 1F98A 5HD5A 2JN7A 4I3IA 3A0SA 2W1TA 3MFXA 4ARZB 1OTBA 1OJGA 2VA0A 2QKPA 1TS7A 2JKRI 3FPWA 4G3VA 1IFQA 4UEYA 3T4QA 4NXFA 1DP9A 3TW8A 1P9WA 2W3HA 5F69A 3VE4A 3LFVA 3TRCA 1LL8A 3EGDC 5IT5A 5DKLA 2PHYA 3PHYA 4ME4A 3S7OA 1V9ZA 2O0YA 1N9LA 4CLCA 2GNXA 5TBMA 2QJ5A 2PDRA 1KOUA 3CLOA 1W63M 2BASA 2VV8A 4LLOB 3A0RA 3MJQA 4O0PA 1P97A 3PYPA 2VZWA 2VJWA 3P7NA 3PBSA 4MMNA 4IUKA 3BJNA 3BY9A 4I39A 2EWVA 3IS2A 1N9OA 4XT2B 3PXPA 3OLOA 4EETB 3KSFA 3LUQA 3UB6A 3LI8A 4GS9A 4L9EA 4WL9A 4F3LB 1GSXA 3LIAA 5L8MA 4BBVA 5HWVA 3PBOA 4R70A 1F5MA 2VGLS 2VGLM 3LR4A 5KIZA 4NXEA 2OAQ1 3RTYA 4HJ6A 4DJ3A 4LPZA 4KQDA 3CI6A 3NOPC 4PHTA 5MC7A 3LR5A 3UMDA 4JGOA 3BWLA 2XSSA 3R7WA 2Y79A 3K2NA 4ETXA 4HNBA 4HOIA 2DMWA 3V67A 2L4RA 2R78A 1STZA 3KO6A 3HCYA 4P6ZM 2KDKA 1NLYA 3C2WA 4HI4A 4MN6A 2EWWA 4IHQA 4R3AA 2WKPA 3P01A 1XJ6A 4HJ3A 2L1MA 2QHKA 1S1ZA 3MMHA 3VE3A 5DF9A 4GLQA 2VV7A 1YSPA 5J4EA 1OT6A 3T4KA 4YWZA 3CWFA 1ODVA 4HQAA 2M7UA 1N9NA 1H3QA 2L0WA 3F1NB 4R6LA 2GX5A 5J7EA 1MC0A 4EUVA 1NWZA 1LT0A 3EOIA 5HDCA 2W27A 3F1PA 4MDZA 1D06A 1XJ3A 4JGRA 3JVUA 4K08A 3ULFA 3LIBA 1VB6A 3EQUA 3PR6A 4LRZE 4IUHA 2A2LA 4LRYC 4ZRRA 4MN7A 3U2AA 4I3AA 2GJ3A 4Q0JA 2V0UA 2Z6CA 3T50A 3TJZC 3UMEA 2B02A 2YKFA 4Y3IA 3T4OA 3D3OA 1IOUA 1LSVA 2P7JA 4ETZA 4IJGA 1ZTUA 4UQIM 3CUEC 4HIAA 3NOUC 1Y28A 3T4LA 4BJPA 2A24B 3BQ8A 1YSQA 4GHIA 2J3WA 3C8CA 3SW1A 3UE3A 5IS1A 3LI9A 5AVFA 4B9OA 2W3DA 5HZHA 3OOVA 1LSWA 2JKTM 3LIDA 1UWNX 3GECA 3OBFA 2D01A 3GDIA 5J3WA 2NUTC 5DJTA 3F1OA 1MKMA 2KOIA 3KYQA 3RFBA 2J3TC 3R4KA 2PR6A 3D72A 3B42A 4HH2A 4EESA 3A0VA 3MXQA 4CQHA 4FSFA 2VV6A 2K31A 2VX8A 3H7WA 4KUOA 4EU0A 2XA7S 3PBTA 2XA7M 4G3WA 3BQAA 1P9RA 3RH8B 2QWSA 2WKRA 3LIFA 3NHQA 3E4OA 4HY8A 4JGQA 4RQ9A 2JKRM 2MJ6A 1TS8A 5DFYA 1D7EA 4OOMA 2FH5A 4ARZA 1ZHHB 4EQ1A 4H6JA 4L0LA 1G6OA 3ZYTA 4WLAA 3T4SA 2Z6DA 1GSVA 1YAXA 1T1AA 4KQOA 5IU1A 5F5YA 2O9CA 1DP6A 2W3GA 4GW9A 2H28A 2O9BA 2VLGA 4EEPA 1TD5A 3T4TA 5HD3A 4AFIA 3BY8A 3S7QA 3EGXC 3H82A 3FC7A 5F68A 2P04A 3B47A 4DJ2A 2XRNA 4P6ZS 4OOLA 4Q0HA 2PYPA 3PBQA 5G4YA 2O99A 4PKYG 1NRJA 5A8BA 5HPFA 2ZBBA 2W1TB 3LYXA 1OT9A 1OPXA 1S66L 3ZQ5A 5LBRA 4DN0A 3EWKA 4YOFA 4MN5A 3MQ0A 4WN5A 3MR0A 4G3KA 3OC2A 5HPIA 1G28A 2W0NA 1XJ4A 5DJUA 3HJKA 4GHIB 4FOFA 2V9AA 3EQVA 3E98A 4F3LA 3PBRA 4QPRA 2W3EA 3UB7A 1DRMA 2HF6A 1WA9A 4Z1WA 3DBAA 5TJJA 3S7NA 4KUKA 2WKQA 3FG8A 5HDDA 4R38A 3TE8A 1S67L 4CLCB 5TBMB 4BBTA 4I38A 5HDSA 2NUPC 1T18A 3ICYA 1UGUA 4BWIA 4HP4A 2P08A 5HSQA 3LR3A 3MQOA 5G4ZA 2HGVA 4CLCC 4HH3A 2M1CA 4UQIS 4GJ4A 4WEKA 5F6AA 5DKKA 2GZAA 1XJ2A 1TS0A 4WF0A 1UWPX 3NOTC 3EEHA 3OCLA 3OCNA 2QYBA 4BBUA 3IS2B 2J80A 4CLCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GS9 B;  4H6J B;  1X0O A;  1OTD A;  4HP9 A;  4M4X A;  2OWH A;  4EW7 A;  3MQQ A;  1T1C A;  1BYW A;  4L9F A;  4HJ4 A;  1OTI A;  3E4Q A;  2OWJ A;  4NXB A;  3NJA A;  4L9G A;  3VOL A;  1OJ5 A;  3F1N A;  4E04 A;  1LSX A;  3G6O A;  4I5S A;  3H82 B;  3CAX A;  2KX6 A;  4I3J A;  4PKY A;  2V0W A;  3KX0 X;  2HV1 A;  3UB8 A;  5I5L A;  4EER A;  3K3C A;  2OOL A;  3UE6 A;  3H9W A;  4NXG A;  1F9I A;  2ZOH A;  3LIC A;  2I9V A;  2INW A;  2A24 A;  3UB9 A;  2EA9 A;  1T1B A;  2QJ7 A;  4EEU A;  3F1P B;  3B33 A;  1XFQ A;  1JNU A;  3IBR A;  4WUJ A;  5AVE A;  2VEA A;  3K3D A;  1S4S A;  4LRX C;  1EW0 A;  3LIE A;  1OTA A;  4EXO A;  2V1B A;  1V9Y A;  2V1A A;  1GSW A;  4XT2 A;  3HJI A;  2ZOI A;  2CMN A;  5EFW A;  2YKH A;  1TS6 A;  1MZU A;  2D02 A;  1OTE A;  5HWW A;  3F1O B;  2PR5 A;  4HHD A;  4JGP A;  1DP8 A;  1S1Y A;  1T19 A;  1XFN A;  1P0Z A;  2JHE A;  2PYR A;  2K7S A;  2PD8 A;  2PD7 A;  4GCZ A;  3E4P A;  3H7W B;  1S4R A;  5HWT A;  1F98 A;  5HD5 A;  2JN7 A;  4I3I A;  3A0S A;  3MFX A;  1OTB A;  1OJG A;  2QKP A;  1TS7 A;  4NXF A;  1DP9 A;  5F69 A;  3VE4 A;  1LL8 A;  5DKL A;  2PHY A;  3PHY A;  1V9Z A;  1N9L A;  5TBM A;  2QJ5 A;  2PDR A;  1KOU A;  3CLO A;  2BAS A;  2VV8 A;  4LLO B;  3A0R A;  3MJQ A;  1P97 A;  3PYP A;  3P7N A;  3BY9 A;  4I39 A;  3IS2 A;  1N9O A;  4XT2 B;  3OLO A;  4EET B;  3UB6 A;  3LUQ A;  3LI8 A;  4GS9 A;  4L9E A;  4WL9 A;  4F3L B;  1GSX A;  3LIA A;  4BBV A;  5HWV A;  4R70 A;  5KIZ A;  4NXE A;  3RTY A;  4HJ6 A;  4DJ3 A;  4LPZ A;  4KQD A;  3NOP C;  3UMD A;  4JGO A;  3BWL A;  4HNB A;  4HOI A;  2L4R A;  2R78 A;  2KDK A;  3C2W A;  4HI4 A;  4MN6 A;  4R3A A;  2WKP A;  1XJ6 A;  4HJ3 A;  2L1M A;  2QHK A;  1S1Z A;  3VE3 A;  2VV7 A;  5J4E A;  1OT6 A;  4YWZ A;  3CWF A;  1ODV A;  4HQA A;  1N9N A;  2L0W A;  3F1N B;  4R6L A;  5J7E A;  1NWZ A;  1LT0 A;  5HDC A;  2W27 A;  3F1P A;  1D06 A;  1XJ3 A;  4JGR A;  4K08 A;  3ULF A;  3LIB A;  1VB6 A;  4LRZ E;  4LRY C;  4I3A A;  2GJ3 A;  2V0U A;  2Z6C A;  3T50 A;  3UME A;  2B02 A;  2YKF A;  1LSV A;  2P7J A;  4HIA A;  3NOU C;  1Y28 A;  2A24 B;  4GHI A;  3C8C A;  3SW1 A;  5IS1 A;  3LI9 A;  5AVF A;  4B9O A;  5HZH A;  1LSW A;  3LID A;  1UWN X;  3GEC A;  2D01 A;  3GDI A;  5J3W A;  5DJT A;  3F1O A;  2PR6 A;  3D72 A;  4HH2 A;  4EES A;  3A0V A;  3MXQ A;  2VV6 A;  3H7W A;  4KUO A;  3RH8 B;  2QWS A;  2WKR A;  3LIF A;  3NHQ A;  3E4O A;  4HY8 A;  4JGQ A;  4RQ9 A;  1TS8 A;  1D7E A;  4EQ1 A;  4H6J A;  4WLA A;  2Z6D A;  1GSV A;  1T1A A;  5IU1 A;  5F5Y A;  1DP6 A;  4GW9 A;  2H28 A;  2VLG A;  4EEP A;  5HD3 A;  3BY8 A;  3H82 A;  3FC7 A;  5F68 A;  4DJ2 A;  2PYP A;  5G4Y A;  4PKY G;  5A8B A;  2ZBB A;  3LYX A;  1OT9 A;  1S66 L;  3ZQ5 A;  3EWK A;  4MN5 A;  4WN5 A;  3MR0 A;  1G28 A;  2W0N A;  1XJ4 A;  5DJU A;  3HJK A;  4GHI B;  2V9A A;  4F3L A;  3UB7 A;  1DRM A;  1WA9 A;  4KUK A;  2WKQ A;  3FG8 A;  5HDD A;  4R38 A;  1S67 L;  5TBM B;  4BBT A;  4I38 A;  5HDS A;  1T18 A;  3ICY A;  1UGU A;  4HP4 A;  5HSQ A;  3MQO A;  5G4Z A;  4HH3 A;  2M1C A;  5F6A A;  5DKK A;  1XJ2 A;  1TS0 A;  4WF0 A;  1UWP X;  3NOT C;  3EEH A;  4BBU A;  3IS2 B;  2J80 A; 
#chains in the Genus database with same CATH topology
 1X0O A;  1SKF A;  2VGJ A;  4HP9 A;  4M4X A;  2OWH A;  3IH9 A;  4D60 A;  1PNE A;  1GA9 A;  5K5B A;  2R9W A;  5GHZ A;  5DF7 A;  4R4R A;  4O8G A;  3GQZ A;  3SH9 A;  3F1N A;  3W2Z A;  2OLU A;  3ZG5 A;  3IXD A;  1XGI A;  1XP4 A;  3CAX A;  5C5K A;  3W8K A;  4B93 A;  3Q81 A;  2V0W A;  2ZC3 B;  2XFS A;  4BEN A;  1SDN A;  5E2E A;  2HP5 A;  1L0F A;  3S1Y A;  1FSW A;  3CZD A;  3IF6 A;  2X71 A;  3H9W A;  4IVK A;  5E2H A;  1EI5 A;  4NXG A;  1J9M A;  3QP8 A;  4DDY A;  2HDU A;  2WYX A;  3UY6 A;  2A24 A;  4MLL A;  3IXB A;  2V8F A;  2PT7 A;  3SS4 A;  2EX2 A;  3B33 A;  3HLB A;  1H8Z A;  1NLZ A;  3MF0 A;  3E0Y A;  3BM6 A;  3W4P A;  2KLI A;  1JNU A;  1ZG6 A;  5FAS A;  1KGF A;  2VEA A;  3DTM A;  1S4S A;  3NC8 A;  2DNS A;  1OTA A;  2OV5 A;  3UPO A;  3IQA A;  3IXH A;  4K0X A;  4GOG A;  3M2K A;  3SH8 A;  1PWG A;  2ZOI A;  2V1Z A;  2W3F A;  4R0Q A;  3EEA A;  1SKO B;  4S2J A;  4NKP A;  2O9A A;  5HL6 A;  1OTE A;  4PM9 A;  4KZ4 A;  3B3X A;  3F1O B;  4E6W A;  2IA2 A;  3SOI A;  5HX9 A;  4CLC D;  1T19 A;  3WS1 A;  1P0Z A;  3IX3 A;  2PYR A;  4XUX A;  1ESI A;  2WKH A;  3QP2 A;  3PAG A;  3H7W B;  3O87 A;  1NYM A;  2B18 A;  3LEQ A;  4GNU A;  4I3I A;  2W1T A;  3MFX A;  1Q2P A;  3FPW A;  2Y2Q A;  4G3V A;  2XR0 A;  4UEY A;  5F82 A;  1P9W A;  5DVA A;  5F69 A;  3IF6 C;  4FCF A;  3Q7V A;  4R1G A;  4E3K A;  2ZM2 A;  1ES5 A;  2XF3 A;  1V9Z A;  3HLG A;  4KZ5 A;  5EVI B;  3ZDJ A;  4EWF A;  3VOZ A;  3G2Z A;  3GSG A;  4OQG A;  3NEC A;  2VV8 A;  3NI9 A;  5EOE A;  1VET A;  3A0R A;  1BZA A;  4QB8 A;  3P7N A;  2Y2L A;  4MBF A;  3IS2 A;  4XT2 B;  1GHP A;  2IWB A;  4EET B;  3KSF A;  5GLB A;  2RCX A;  4N1X A;  1VQQ A;  1C3B A;  4BBV A;  3NY4 A;  5HWV A;  3PBO A;  1YLY A;  5GL9 A;  1F5M A;  2IWC A;  4LV0 A;  4LFU A;  3RTY A;  3CI6 A;  4Q8I A;  3LR5 A;  3UMD A;  3BWL A;  1ERM A;  3R7W A;  3UN7 A;  4DE1 A;  4HBT A;  3C4P A;  3N7W A;  3V67 A;  3V50 A;  1H0M A;  2R78 A;  3HCY A;  3SS5 A;  1K25 A;  5D3O A;  4OH0 A;  3WRZ A;  3C2W A;  4HI4 A;  1NRF A;  5HAR A;  4R3A A;  2WGI A;  2WKP A;  4HJ3 A;  2L1M A;  5M18 A;  1XXM A;  1ZG4 A;  3MMH A;  5DF9 A;  5EOO A;  2L0W A;  1XGJ A;  4KZB A;  3HUO A;  4DKI A;  2GX5 A;  4GDN A;  1NWZ A;  4FD8 A;  3ZCZ A;  3D9Y A;  3U4L P;  2W27 A;  4MDZ A;  3UDF A;  5EV0 A;  4KZ8 A;  3CMZ A;  4K08 A;  3UPN A;  4LRZ E;  3IWI A;  4LV2 A;  4MN7 A;  4X25 A;  4GZB A;  4NET A;  3VP0 A;  1K6S A;  4S2L A;  3VP3 A;  1K0K A;  3FV7 A;  4Y3I A;  1ERQ A;  4EUZ A;  4E3I A;  4ETZ A;  1ALQ A;  3NOU C;  2ZM0 A;  3VMA A;  3N8L A;  2W3D A;  1LSW A;  3TG9 A;  3GRJ A;  3LID A;  3ISG A;  3OBF A;  3DTK A;  1IEM A;  1FCN A;  3UPP A;  5J3W A;  5EPH A;  1E4D A;  3KYQ A;  3RFB A;  1YM1 A;  3W4O A;  5DTT A;  3B42 A;  4HH2 A;  3MXQ A;  4ZJ1 A;  2K31 A;  4KUO A;  4EU0 A;  4G3W A;  2XA7 M;  1PW8 A;  5EVI C;  3RH8 B;  5A92 A;  2QWS A;  3G2Y A;  3Q7Z A;  4RQ9 A;  3T1S A;  3DAV A;  5DFY A;  3PTE A;  1BT5 A;  3HLW A;  5GLC A;  4EQ1 A;  4H6J A;  2J7V A;  3DTI A;  1G6O A;  1L0D A;  1XA1 A;  3T4S A;  1DJB A;  1CEF A;  3RJU A;  2XDM A;  1TD5 A;  2FFY A;  3T4T A;  4RYE A;  1CK3 A;  5FQI A;  5F68 A;  3DWZ A;  5G4Y A;  4QY5 A;  3HLE A;  3BYD A;  2O99 A;  1PYY A;  4P6B A;  4BL2 A;  5A8B A;  5HPF A;  1HTZ A;  4LCL A;  2WAE A;  3N4I A;  4MN5 A;  3WRT A;  4U0T A;  4D2O A;  3W4Q A;  3OC2 A;  3IX8 A;  4BD0 A;  4B88 A;  3HUN A;  4OPY A;  5DJU A;  2PU2 A;  3HJK A;  4OLD A;  4GHI B;  3ZG0 A;  1YLJ A;  3MZE A;  4ZTK A;  1QME A;  3UB7 A;  1DRM A;  3NDG A;  4DRT A;  1FIL A;  5HDD A;  3S7N A;  2XQZ A;  3S4X A;  1ONH A;  2PBY A;  4CLC B;  1HLU P;  5HDS A;  5FAT A;  2WZZ A;  3ICY A;  1UGU A;  4KG5 A;  5FI2 A;  3ZVW A;  4KZA A;  4NK3 A;  3N6I A;  1WYC A;  2HGV A;  4HH3 A;  4GJ4 A;  4LV3 A;  4WF0 A;  1UWP X;  3OCL A;  3EEH A;  5F1G A;  4BBU A;  4XUZ A;  3IXG A;  3BFC A;  3KYZ A;  3JVV A;  4WEJ A;  5AQB A;  3JPU A;  4OLG A;  5TFQ A;  2FZ0 A;  3KSG A;  4QJG A;  1BYW A;  4ID4 A;  1VHM A;  1Z09 A;  4HJ4 A;  3OPH A;  4K0W A;  3V5M A;  2R9X A;  4WYY A;  5CXW A;  3QP1 A;  1YKD A;  2VKS A;  2XH9 A;  4I5S A;  3H82 B;  2E8I A;  2G7U A;  4II7 A;  1O07 A;  3A3F A;  1L0G A;  4A5R A;  5KSH A;  3IBJ A;  3K3C A;  3UE6 A;  2HP9 A;  1H8M A;  4C75 A;  4KG6 A;  3LIC A;  5F83 A;  3FWL A;  2INW A;  1GCE A;  4Y5F A;  1ERO A;  2EX6 A;  3UB9 A;  1TVF A;  1XA7 A;  1T1B A;  4XXR A;  1O7E A;  5KSC A;  2QJ7 A;  1K55 A;  1SCW A;  2LB9 A;  2Z2L B;  3KYE A;  3F1P B;  4DMZ A;  3V3S A;  2VK3 A;  1XFQ A;  2Y2H A;  3N8R A;  5FQM A;  4KZ9 A;  4OOY A;  4R23 A;  5AVE A;  4Q0I A;  3G32 A;  2ZC4 B;  3K3D A;  4JXW A;  1EW0 A;  4EXO A;  1KDW A;  2V1B A;  5EE8 A;  4E3O A;  4S2P A;  4YNR A;  5CHM A;  3LCE A;  4C3Q A;  3UB5 P;  1LL5 A;  5E43 A;  4YIN A;  4NEE D;  3VV4 A;  5EFW A;  1MZU A;  4B4Z A;  4CJN A;  1CI8 A;  4OQI A;  5HWW A;  2JKT I;  3E2L A;  4JGP A;  3G31 A;  3T1X A;  2PD8 A;  3L7H A;  1BUE A;  5AQ9 A;  1I2S A;  2HJE A;  1S4R A;  5HD5 A;  1TS7 A;  1LLB A;  4ESP A;  3IF6 B;  5FEG A;  4PM5 A;  5IHV A;  1IFQ A;  2Y59 A;  2Y2P A;  1DP9 A;  3C5A A;  3IHA A;  1K54 C;  3RXW A;  3AGD A;  1YQS A;  4MEZ A;  3EGD C;  3OPP A;  5DKL A;  1SDE A;  2DCF A;  3PHY A;  4KQR A;  4ME4 A;  3ZG7 B;  4KG2 A;  3BFE A;  1N9L A;  3UE0 A;  1NY0 A;  3DWK A;  2GNX A;  5TBM A;  3IWQ A;  5AQA A;  2ZQ8 A;  2PDR A;  3Q07 A;  2BAS A;  4LGW A;  3UDX A;  3ZGA B;  1P97 A;  3PYP A;  2VZW A;  3BJN A;  4NG2 A;  2EWV A;  1N9O A;  4U3T A;  3PXP A;  3OLO A;  3CHW P;  1GSX A;  1J3W A;  3HLF A;  3LIA A;  5L8M A;  4R70 A;  4QU3 A;  5TR7 A;  2XFT A;  3A3D A;  3OPR A;  2OAQ 1;  2UWX A;  4DJ3 A;  2ZMA A;  4KQD A;  4PHT A;  4JGO A;  5HAI A;  3VSK A;  1IYS A;  4HNB A;  4WZ5 C;  3KO6 A;  5FQJ A;  3GR2 A;  1NLY A;  5FI7 A;  4IHQ A;  3T1R A;  2EX8 A;  2QHK A;  4GD8 A;  3M6H A;  4GLQ A;  2VV7 A;  5HAP A;  2ZLY A;  3BFD A;  4Y15 A;  1GHM A;  4HQA A;  1H3Q A;  4DE3 A;  2P74 A;  2Y4A A;  1MC0 A;  3S22 A;  5HDC A;  3Q7V B;  1D06 A;  4N1H A;  1N4O A;  2Y2J A;  4IVI A;  1YLW A;  3ULF A;  3LIB A;  1VB6 A;  3EQU A;  3FKV A;  3C4O A;  2A2L A;  3MKE A;  4LRY C;  5CHJ A;  3U2A A;  4I3A A;  2GJ3 A;  1RCJ A;  2Z6C A;  2B02 A;  2H5S A;  1CJF A;  1PW1 A;  4OPR A;  4QD4 A;  5GHX A;  4KZ7 A;  2ZQD A;  1KE0 A;  4O7D A;  1W5D A;  1JVJ A;  3E2K A;  3MZF A;  4OVD A;  2EX9 A;  5IS1 A;  5AVF A;  4B9O A;  5HZH A;  1SKO A;  1LI0 A;  5TGF A;  3V3R A;  3GEC A;  3GMW A;  4OPZ A;  2EFU A;  3F1O A;  2EFX A;  3BLS A;  5JYP A;  4FUW A;  2BLS A;  3D72 A;  3GTC A;  4EES A;  1JWZ A;  4CQH A;  3H7W A;  4ZJ3 A;  2IWD A;  3BQA A;  4EBP A;  2G2U A;  1MPL A;  2WKR A;  3E4O A;  4HY8 A;  2JKR M;  1MKI A;  2X02 A;  4C6Y A;  5GLA A;  1ES3 A;  3DW0 A;  4WLA A;  2Z6D A;  4Y17 A;  1PFL A;  5IU1 A;  2J9P A;  1VM1 A;  1CEG A;  1IYO A;  2VLG A;  3IF5 A;  4IBR A;  4BQM A;  4EEP A;  1CF0 A;  5A93 A;  4X69 A;  3FC7 A;  4JPM A;  1PIO A;  3BFG A;  1F2K A;  2XRN A;  4OOL A;  5FQQ A;  2ZBB A;  3LYX A;  1S66 L;  1OPX A;  1YLZ A;  2ZL1 A;  4DN0 A;  3EWK A;  4LV1 A;  3VP2 A;  3MQ0 A;  1IYQ A;  5FQK A;  1L2S A;  3P09 A;  1KVL A;  2ZJ9 A;  3QHY A;  5F1F A;  3QNB A;  1RGZ A;  1XJ4 A;  5JYO A;  1DJC A;  4JXG A;  4E3L A;  3EQV A;  1CQA A;  2JBF A;  2WAD A;  2XLN A;  2HF6 A;  4R3B A;  5L2F A;  4Z1W A;  5U47 A;  5TJJ A;  3T12 B;  4KUK A;  1YLP A;  1L0E A;  3TE8 A;  2FFF B;  4HEF A;  4BBT A;  5EM0 A;  4I38 A;  1T18 A;  5FA7 A;  4CPK A;  4HP4 A;  5HSQ A;  3HUM A;  1LHY A;  2WZX A;  5G4Z A;  4X1L A;  3WS5 A;  2GZA A;  2ZD8 A;  1D1J A;  5CTN A;  3OCN A;  2QYB A;  2Y2K A;  4CLC E;  3WWX A;  4U0X A;  4GS9 B;  3Q1F A;  2ZC7 A;  3IWO A;  4H6J B;  3FZC A;  1OTD A;  4O01 A;  3MZD A;  3MQQ A;  4Y0U A;  1T1C A;  3RXX A;  4OP5 A;  5FSR A;  3T4J A;  4S2N A;  5E2F A;  4EBL A;  2A3U A;  3NJA A;  4L9G A;  3VOL A;  4S2M A;  1OJ5 A;  1MXO A;  2ZM8 A;  5EM1 A;  1LSX A;  3S7P A;  1CI9 A;  4PAU A;  3LY4 A;  1U60 A;  5CX7 A;  1BSG A;  4OKP A;  4GB7 A;  2WK0 A;  3O5Y A;  1GHI A;  3BRM A;  3CUE A;  2I72 A;  2ZQ9 A;  5AQ7 A;  5I5L A;  3HVF A;  4EER A;  2H10 A;  1RP5 A;  2M7V A;  4Y7P A;  1F9I A;  4JF5 A;  3ZHH A;  3C30 A;  3A3J A;  3SZT A;  2LB5 A;  3BEC A;  2I9V A;  4P0M A;  1W63 Q;  1PZO A;  4EEU A;  3LO7 A;  3NUL A;  2ACG A;  4ZJ2 A;  3C38 A;  5EUA A;  4IBX A;  1AWI A;  5FDS A;  3IH8 A;  3C7V A;  1FOF A;  4ZAM A;  3OZH A;  1Y4O A;  1V9Y A;  2V1A A;  4UA9 A;  5GLD A;  1NXY A;  4HES A;  1YMX A;  2CMN A;  3CPT A;  5CER A;  2ZMF A;  1TS6 A;  2D02 A;  1K57 A;  1GA0 A;  3BW6 A;  3AGF A;  3LR0 A;  4JF6 A;  2PR5 A;  3CIT A;  3KSI A;  4HHD A;  1DP8 A;  1S1Y A;  5DF8 A;  1W8Y A;  2Y2M A;  3O3V A;  1XFN A;  2JHE A;  2WKE A;  2K7S A;  1PWC A;  2RL3 A;  3E4P A;  2ZMV A;  3FPV A;  2WGW B;  3ZG8 B;  2ZQC A;  1WE4 A;  2DRW A;  5HWT A;  3QNC A;  3IT9 A;  4ARZ B;  2XGN A;  1OTB A;  1OJG A;  5L10 A;  3M6B A;  5A90 A;  2QKP A;  4KQQ A;  4S2I A;  4NXF A;  3TW8 A;  1VEU B;  5CHU A;  1JWP A;  2P9V A;  2W3H A;  3WS4 A;  1JTD A;  3LFV A;  5CRF A;  3TRC A;  4BLM A;  5IT5 A;  4OON A;  1I5Q A;  4P85 A;  4X55 A;  4K91 A;  3PAE A;  4GN2 A;  4CLC A;  2QJ5 A;  4WM9 A;  3NBL A;  4E3N A;  1FIK A;  1LI9 A;  3HLC A;  1M6K A;  3D4F A;  4LLO B;  3MJQ A;  3SH7 A;  1YPR A;  4DXC A;  4MMN A;  3UO9 A;  3BY9 A;  4I39 A;  1H8Y A;  4GKU A;  2ZC5 B;  1K4F A;  2EXA A;  3FKW A;  3LUQ A;  1BUL A;  4L9E A;  4F3L B;  1G5U A;  1ES2 A;  2PRF A;  3G4P A;  2VGL S;  4JKT A;  3LR4 A;  5KIZ A;  4NXE A;  4HJ6 A;  4LPZ A;  3NOP C;  3CJM A;  4FTX A;  4PM6 A;  2Y79 A;  2L4R A;  1G68 A;  4P6Z M;  5FEF A;  1XKZ A;  1FQG A;  1XX2 A;  2JCH A;  1MWS A;  5CEB A;  3JYI A;  1XJ6 A;  3CG5 A;  1PZP A;  4F94 A;  1ZKJ A;  1YSP A;  5J4E A;  2HZ5 A;  2OLV A;  1W79 A;  1OT6 A;  3T4K A;  5EVL A;  2M7U A;  3N8S A;  1MY8 A;  3F1N B;  4R6L A;  1PWD A;  4EUV A;  4RX3 A;  1LT0 A;  3F1P A;  4JGR A;  2OSU A;  3MBZ A;  1SHV A;  4ZRR A;  3GVB A;  4ZDX A;  4Q0J A;  3UME A;  2YKF A;  3A3E A;  3T4O A;  1IOU A;  1LSV A;  2P7J A;  4IJG A;  1ZTU A;  3A3I A;  2GDN A;  2J8Y A;  5FAQ A;  2PU4 A;  1Y28 A;  2A24 B;  4N9L A;  5DTS A;  1FR1 A;  3BLM A;  2J3W A;  3C8C A;  2Y2O A;  3SW1 A;  3UE3 A;  3LI9 A;  3G35 A;  4MNR A;  1UWN X;  1E3U A;  2HDQ A;  1KGE A;  5J8X A;  4EV4 A;  3AGE A;  1MKM A;  5CEC A;  5M1A A;  1KGG A;  2J3T C;  3R4K A;  1K55 C;  2PR6 A;  4FSF A;  2VX8 A;  1OME A;  3PBT A;  1P9R A;  4JGQ A;  2Q9N A;  2MJ6 A;  4OQ0 A;  1NZU A;  5M19 A;  1D7E A;  4OOM A;  3VP4 A;  4KZ3 A;  1KE3 A;  1T1A A;  1W7F A;  1K6R A;  2JE5 A;  1BLH A;  1DP6 A;  1IEL A;  1W8Q A;  2W3G A;  4PM8 A;  2H28 A;  4AFI A;  3BY8 A;  4PM7 A;  3EGX C;  3L9K A;  4UHU A;  3B47 A;  4UA7 A;  4DJ2 A;  3P98 A;  1QMF A;  4P6Z S;  2PYP A;  4R3J A;  5HL1 A;  4FH4 A;  4DE2 A;  2XD5 A;  2W1T B;  1OT9 A;  4KZ6 A;  3ZQ5 A;  5LBR A;  4YOF A;  4S2K A;  4WN5 A;  4Z9Q A;  1SZV A;  5HPI A;  1G28 A;  2HDR A;  1JTG A;  2V9A A;  3MFD A;  2W3E A;  4BD1 A;  3DBA A;  1WYB A;  1FSY A;  1FCM A;  1ESU A;  2Q0O A;  4Y13 A;  2NUP C;  3GV9 A;  3HL9 A;  1VET B;  1H5X A;  2ZQA A;  1NJ4 A;  3LR3 A;  2M1C A;  2PAV P;  5DKK A;  5HFO A;  3BFF A;  1TS0 A;  4OQH A;  3IS2 B;  3FYZ A;  1TDG A;  1MWR A;  2J80 A;  4BL3 A;  5FQ9 A;  1DJA A;  5CGX A;  2ZC6 B;  1NZO A;  3Q82 A;  3ITB A;  5AJG A;  2J3T D;  4EW7 A;  1K56 A;  1Y54 A;  4EQI A;  3KSH A;  4L9F A;  5G18 A;  1OTI A;  3E4Q A;  2OWJ A;  1TF1 A;  4IED A;  1IKI A;  4NXB A;  4X6T A;  4BMW A;  4R4S A;  4QHC A;  4E04 A;  3G6O A;  3VFF A;  4WEL A;  3R7W B;  1HD8 A;  1BTL A;  2H0Y A;  2KX6 A;  4I3J A;  4PKY A;  4YFM A;  2HJ9 C;  1YLT A;  1MWT A;  3KX0 X;  3QP5 A;  2WAF A;  4M3K A;  5HAQ A;  5FL3 A;  2H0T A;  2HV1 A;  3UB8 A;  2ZL1 B;  2OOL A;  5BOH A;  1RGY A;  2ZOH A;  2Y55 A;  3ZG9 B;  4P87 A;  3PBN A;  2EA9 A;  5DFX A;  5KMW A;  4Y2F A;  2BTF P;  3NIA A;  2X01 A;  3LEZ A;  4JXS A;  3MXS A;  2EXB A;  1Q2Q A;  2OAP 1;  4ZBE A;  5EVI A;  3IBR A;  3VSL A;  2W1R A;  4WUJ A;  5CGS A;  1NYY A;  4LRX C;  3LIE A;  4MCW A;  4QY6 A;  1GSW A;  4XT2 A;  3HJI A;  2HP6 A;  1ONG A;  1JWV A;  3ZVT A;  4X1M A;  3T1Q B;  2YKH A;  2B95 A;  3SS3 A;  4MBH A;  2K2N A;  1K4E A;  1E3U D;  1KVM A;  4OPQ A;  4GDB A;  1IYP A;  2Y2N A;  2Y2I A;  2PD7 A;  4GCZ A;  1FR6 A;  4WMC A;  5EEC A;  2Y8H A;  5CTM A;  2XRO A;  2C5W B;  3ZNY A;  1F98 A;  2JN7 A;  4DXB A;  3A0S A;  2JC7 A;  2Y91 A;  4N9K A;  1FCO A;  2VA0 A;  1HVB A;  1M40 A;  3IX4 A;  2JKR I;  1PI5 A;  2E8J A;  5HW3 A;  3T4Q A;  2A49 A;  1TEM A;  1ZC2 A;  2QZ6 A;  1LL9 A;  3MS6 A;  2QMI A;  2BG1 A;  3VP1 A;  3VE4 A;  5L07 A;  1LL8 A;  3MXR A;  1S0W A;  5L09 A;  2PHY A;  4OP8 A;  3S7O A;  1KDS A;  2O0Y A;  4N92 A;  1BLP A;  1KOU A;  3CLO A;  1W63 M;  3MKF A;  4JF4 A;  3HBR A;  4O0P A;  2UV0 E;  4RA7 A;  2VJW A;  3PBS A;  4IUK A;  4Y0O A;  3UDI A;  2AVX A;  4DE0 A;  3TOI A;  3UB6 A;  3CPT B;  1EWZ A;  3LI8 A;  4GS9 A;  4WL9 A;  2J9O A;  4E3M A;  1YT4 A;  3O86 A;  4KEN B;  1MBL A;  2VGL M;  1PRQ A;  5DTK A;  5MC7 A;  2XSS A;  1HZO A;  3K2N A;  4ETX A;  4HOI A;  2DMW A;  2Y2G A;  1STZ A;  4LEN A;  2KDK A;  2V20 A;  4MN6 A;  4E6X A;  3UE1 A;  1K38 A;  2EWW A;  3P01 A;  4UAA A;  1MWU A;  1S1Z A;  3VE3 A;  4JBF A;  4WBG A;  1ACF A;  1TDL A;  4YWZ A;  3CWF A;  1ODV A;  1N9N A;  4GD6 A;  1K56 D;  2P9V B;  3MSH A;  1L3L A;  4PMA A;  5J7E A;  5FDH A;  4LCM A;  4UA6 A;  3EOI A;  4S2N C;  3ZNT A;  1XJ3 A;  3OPL A;  3JVU A;  3PR6 A;  4IUH A;  1Z6F A;  3NDE A;  2V0U A;  3T50 A;  3TJZ C;  4X53 A;  3V39 A;  4DDS A;  3D3O A;  2CC1 A;  3WS2 A;  3O88 A;  3LGO A;  3I7J A;  2C6W B;  2QPN A;  4UQI M;  3CUE C;  4HIA A;  3T4L A;  1BLC A;  4BJP A;  4E3J A;  3BQ8 A;  1YSQ A;  4GHI A;  3NCK A;  4Y0T A;  3OOV A;  2JKT M;  3DTE A;  2D01 A;  1ES4 A;  5GHY A;  3GDI A;  5CED A;  2NUT C;  5DJT A;  2KOI A;  3VOY A;  3UNW A;  2WGV A;  5EVI D;  3A0V A;  2G2W A;  4H8R A;  2VV6 A;  2XA7 S;  1AXB A;  2V2F F;  2WGW A;  4QWO A;  3LIF A;  3NHQ A;  1E25 A;  4DF6 A;  4RX2 A;  1N9B A;  1TS8 A;  1XPB A;  3LY3 A;  2FH5 A;  4ARZ A;  1ZHH B;  5CGW A;  4L0L A;  1K54 A;  2WUQ A;  3ZYT A;  1GSV A;  1YAX A;  5FAO A;  2XEP A;  3TSG A;  1BLS A;  4X68 A;  4KQO A;  5I94 A;  5F5Y A;  1I2W A;  4EBN A;  1IKG A;  1PI4 A;  2O9C A;  1VEU A;  4JLF A;  4GW9 A;  2Z2M B;  2O9B A;  3HRE A;  4S2O A;  2V8C A;  4X56 A;  5HD3 A;  2ZQ7 A;  1K57 C;  3HLD A;  3S7Q A;  3H82 A;  3IHB A;  3C7U A;  2P04 A;  4B4X A;  5E2G A;  1A0K A;  4Q0H A;  3PBQ A;  4PKY G;  1NRJ A;  3VFH A;  5FI6 A;  4WMC D;  3MR0 A;  4G3K A;  4HBU A;  5KZH A;  2HDS A;  3G34 A;  2W0N A;  2B5R A;  1KE4 A;  2XK1 A;  2VGK A;  4FOF A;  2WKI A;  4RVA A;  1YMS A;  3E98 A;  4F3L A;  3PBR A;  4QPR A;  1S6R A;  2HPB A;  1WA9 A;  3BEB A;  4PPR A;  4MBK A;  3ITA A;  2JKG A;  3M2J A;  3QP4 A;  2PBD P;  2WKQ A;  3FG8 A;  4R38 A;  3ZFZ A;  5EVE A;  1S67 L;  4WZ4 A;  5FAP A;  4WZ5 A;  5TBM B;  1G6A A;  4JXV A;  4BWI A;  2XD1 A;  3QP6 A;  2P08 A;  4FH2 A;  3MQO A;  3WS0 A;  4CLC C;  2JKF A;  5F6A A;  4WEK A;  4UQI S;  1XJ2 A;  1DY6 A;  5A91 A;  3G30 A;  3NOT C;  2Q9M A; 
#chains in the Genus database with same CATH homology
 4GS9 B;  4H6J B;  3KYZ A;  3JVV A;  1X0O A;  4WEJ A;  1OTD A;  4HP9 A;  4O01 A;  4M4X A;  2OWH A;  5AJG A;  2FZ0 A;  2J3T D;  4EW7 A;  3MQQ A;  3KSG A;  1T1C A;  3KSH A;  1BYW A;  4L9F A;  3T4J A;  1VHM A;  4HJ4 A;  1OTI A;  3E4Q A;  2OWJ A;  1TF1 A;  4NXB A;  5K5B A;  4BMW A;  4O8G A;  3NJA A;  4L9G A;  3VOL A;  1OJ5 A;  3F1N A;  3W2Z A;  4E04 A;  1LSX A;  1YKD A;  2VKS A;  3G6O A;  3S7P A;  4WEL A;  4I5S A;  4PAU A;  3H82 B;  3CAX A;  5C5K A;  3R7W B;  4B93 A;  2KX6 A;  4I3J A;  5CX7 A;  4PKY A;  2G7U A;  4II7 A;  2HJ9 C;  2V0W A;  3KX0 X;  3O5Y A;  3CUE A;  5FL3 A;  2HV1 A;  5KSH A;  3UB8 A;  3IBJ A;  5I5L A;  4EER A;  3K3C A;  2OOL A;  3UE6 A;  2M7V A;  1H8M A;  3H9W A;  4NXG A;  1F9I A;  2ZOH A;  3C30 A;  3LIC A;  2LB5 A;  2I9V A;  2INW A;  4Y5F A;  2A24 A;  3UB9 A;  3PBN A;  2EA9 A;  5DFX A;  1T1B A;  1W63 Q;  4Y2F A;  2QJ7 A;  2PT7 A;  2LB9 A;  4EEU A;  3F1P B;  3B33 A;  4DMZ A;  1NLZ A;  1XFQ A;  3C38 A;  3MF0 A;  3E0Y A;  2OAP 1;  2KLI A;  1JNU A;  3IBR A;  2W1R A;  4WUJ A;  5AVE A;  2VEA A;  4Q0I A;  3K3D A;  1S4S A;  4LRX C;  1EW0 A;  3LIE A;  1OTA A;  4EXO A;  2V1B A;  1V9Y A;  4MCW A;  2V1A A;  4YNR A;  1GSW A;  4XT2 A;  3HJI A;  2ZOI A;  2CMN A;  2W3F A;  3EEA A;  4NEE D;  2ZMF A;  3VV4 A;  5EFW A;  4NKP A;  2YKH A;  1TS6 A;  1MZU A;  2D02 A;  2O9A A;  5HL6 A;  1OTE A;  3BW6 A;  2K2N A;  5HWW A;  3LR0 A;  2JKT I;  3F1O B;  2PR5 A;  2IA2 A;  3CIT A;  3KSI A;  4HHD A;  4JGP A;  1DP8 A;  1S1Y A;  4CLC D;  1T19 A;  1XFN A;  1P0Z A;  2JHE A;  2PYR A;  2K7S A;  2PD8 A;  2PD7 A;  4GCZ A;  3E4P A;  3H7W B;  2ZMV A;  3FPV A;  2Y8H A;  2B18 A;  2XRO A;  2HJE A;  1S4R A;  5HWT A;  1F98 A;  5HD5 A;  2JN7 A;  4I3I A;  3A0S A;  2W1T A;  3MFX A;  4ARZ B;  1OTB A;  1OJG A;  2VA0 A;  2QKP A;  1TS7 A;  2JKR I;  3FPW A;  4G3V A;  1IFQ A;  4UEY A;  3T4Q A;  4NXF A;  1DP9 A;  3TW8 A;  1P9W A;  2W3H A;  5F69 A;  3VE4 A;  3LFV A;  3TRC A;  1LL8 A;  3EGD C;  5IT5 A;  5DKL A;  2PHY A;  3PHY A;  4ME4 A;  3S7O A;  1V9Z A;  2O0Y A;  1N9L A;  4CLC A;  2GNX A;  5TBM A;  2QJ5 A;  2PDR A;  1KOU A;  3CLO A;  1W63 M;  2BAS A;  2VV8 A;  4LLO B;  3A0R A;  3MJQ A;  4O0P A;  1P97 A;  3PYP A;  2VZW A;  2VJW A;  3P7N A;  3PBS A;  4MMN A;  4IUK A;  3BJN A;  3BY9 A;  4I39 A;  2EWV A;  3IS2 A;  1N9O A;  4XT2 B;  3PXP A;  3OLO A;  4EET B;  3KSF A;  3LUQ A;  3UB6 A;  3LI8 A;  4GS9 A;  4L9E A;  4WL9 A;  4F3L B;  1GSX A;  3LIA A;  5L8M A;  4BBV A;  5HWV A;  3PBO A;  4R70 A;  1F5M A;  2VGL S;  2VGL M;  3LR4 A;  5KIZ A;  4NXE A;  2OAQ 1;  3RTY A;  4HJ6 A;  4DJ3 A;  4LPZ A;  4KQD A;  3CI6 A;  3NOP C;  4PHT A;  5MC7 A;  3LR5 A;  3UMD A;  4JGO A;  3BWL A;  2XSS A;  3R7W A;  2Y79 A;  3K2N A;  4ETX A;  4HNB A;  4HOI A;  2DMW A;  3V67 A;  2L4R A;  2R78 A;  1STZ A;  3KO6 A;  3HCY A;  4P6Z M;  2KDK A;  1NLY A;  3C2W A;  4HI4 A;  4MN6 A;  2EWW A;  4IHQ A;  4R3A A;  2WKP A;  3P01 A;  1XJ6 A;  4HJ3 A;  2L1M A;  2QHK A;  1S1Z A;  3MMH A;  3VE3 A;  5DF9 A;  4GLQ A;  2VV7 A;  1YSP A;  5J4E A;  1OT6 A;  3T4K A;  4YWZ A;  3CWF A;  1ODV A;  4HQA A;  2M7U A;  1N9N A;  1H3Q A;  2L0W A;  3F1N B;  4R6L A;  2GX5 A;  5J7E A;  1MC0 A;  4EUV A;  1NWZ A;  1LT0 A;  3EOI A;  5HDC A;  2W27 A;  3F1P A;  4MDZ A;  1D06 A;  1XJ3 A;  4JGR A;  3JVU A;  4K08 A;  3ULF A;  3LIB A;  1VB6 A;  3EQU A;  3PR6 A;  4LRZ E;  4IUH A;  2A2L A;  4LRY C;  4ZRR A;  4MN7 A;  3U2A A;  4I3A A;  2GJ3 A;  4Q0J A;  2V0U A;  2Z6C A;  3T50 A;  3TJZ C;  3UME A;  2B02 A;  2YKF A;  4Y3I A;  3T4O A;  3D3O A;  1IOU A;  1LSV A;  2P7J A;  4ETZ A;  4IJG A;  1ZTU A;  4UQI M;  3CUE C;  4HIA A;  3NOU C;  1Y28 A;  3T4L A;  4BJP A;  2A24 B;  3BQ8 A;  1YSQ A;  4GHI A;  2J3W A;  3C8C A;  3SW1 A;  3UE3 A;  5IS1 A;  3LI9 A;  5AVF A;  4B9O A;  2W3D A;  5HZH A;  3OOV A;  1LSW A;  2JKT M;  3LID A;  1UWN X;  3GEC A;  3OBF A;  2D01 A;  3GDI A;  5J3W A;  2NUT C;  5DJT A;  3F1O A;  1MKM A;  2KOI A;  3KYQ A;  3RFB A;  2J3T C;  3R4K A;  2PR6 A;  3D72 A;  3B42 A;  4HH2 A;  4EES A;  3A0V A;  3MXQ A;  4CQH A;  4FSF A;  2VV6 A;  2K31 A;  2VX8 A;  3H7W A;  4KUO A;  4EU0 A;  2XA7 S;  3PBT A;  2XA7 M;  4G3W A;  3BQA A;  1P9R A;  3RH8 B;  2QWS A;  2WKR A;  3LIF A;  3NHQ A;  3E4O A;  4HY8 A;  4JGQ A;  4RQ9 A;  2JKR M;  2MJ6 A;  1TS8 A;  5DFY A;  1D7E A;  4OOM A;  2FH5 A;  4ARZ A;  1ZHH B;  4EQ1 A;  4H6J A;  4L0L A;  1G6O A;  3ZYT A;  4WLA A;  3T4S A;  2Z6D A;  1GSV A;  1YAX A;  1T1A A;  4KQO A;  5IU1 A;  5F5Y A;  2O9C A;  1DP6 A;  2W3G A;  4GW9 A;  2H28 A;  2O9B A;  2VLG A;  4EEP A;  1TD5 A;  3T4T A;  5HD3 A;  4AFI A;  3BY8 A;  3S7Q A;  3EGX C;  3H82 A;  3FC7 A;  5F68 A;  2P04 A;  3B47 A;  4DJ2 A;  2XRN A;  4P6Z S;  4OOL A;  4Q0H A;  2PYP A;  3PBQ A;  5G4Y A;  2O99 A;  4PKY G;  1NRJ A;  5A8B A;  5HPF A;  2ZBB A;  2W1T B;  3LYX A;  1OT9 A;  1OPX A;  1S66 L;  3ZQ5 A;  5LBR A;  4DN0 A;  3EWK A;  4YOF A;  4MN5 A;  3MQ0 A;  4WN5 A;  3MR0 A;  4G3K A;  3OC2 A;  5HPI A;  1G28 A;  2W0N A;  1XJ4 A;  5DJU A;  3HJK A;  4GHI B;  4FOF A;  2V9A A;  3EQV A;  3E98 A;  4F3L A;  3PBR A;  4QPR A;  2W3E A;  3UB7 A;  1DRM A;  2HF6 A;  1WA9 A;  4Z1W A;  3DBA A;  5TJJ A;  3S7N A;  4KUK A;  2WKQ A;  3FG8 A;  5HDD A;  4R38 A;  3TE8 A;  1S67 L;  4CLC B;  5TBM B;  4BBT A;  4I38 A;  5HDS A;  2NUP C;  1T18 A;  3ICY A;  1UGU A;  4BWI A;  4HP4 A;  2P08 A;  5HSQ A;  3LR3 A;  3MQO A;  5G4Z A;  2HGV A;  4CLC C;  4HH3 A;  2M1C A;  4UQI S;  4GJ4 A;  4WEK A;  5F6A A;  5DKK A;  2GZA A;  1XJ2 A;  1TS0 A;  4WF0 A;  1UWP X;  3NOT C;  3EEH A;  3OCL A;  3OCN A;  2QYB A;  4BBU A;  3IS2 B;  2J80 A;  4CLC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...