5IS1A

Crystal structure of the extracellular domain of sensor histidine kinase yycg from staphylococcus aureus at 2.0 angstrom resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
142
Chain Sequence
NNLEKELLDNFKKNITQYAKQLEISIEKVYDEKGSNAQKDIQNLLSEYANRQEIGEIRFIDKDQIIIATTKQSNRSLINQKANDSSVQKALSLGQSNDHLILKDYGGGKDRVWVYNIPVKVDKKVIGNIYIESKINDVYNQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies on the Extracellular Domain of Sensor Histidine Kinase YycG from Staphylococcus aureus and Its Functional Implications
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
molecule keywords Histidine kinase
total genus 44
structure length 142
sequence length 143
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2016-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5is1A00
4R6LA 3H82B 3VOLA 2QJ7A 1VB6A 4I3IA 5HD3A 4GHIB 2KX6A 4RQ9A 1F98A 2WKQA 2D01A 2VV7A 5HWTA 4PKYA 2W0NA 4BBVA 4EW7A 1DP9A 1OT6A 1LL8A 4GHIA 2YKFA 4LRZE 4M4XA 4WN5A 2B02A 4WLAA 1XJ2A 3ULFA 3LICA 3LIBA 4MN6A 3FG8A 5J7EA 1V9ZA 2PR5A 3A0RA 3F1NA 2PYPA 4HY8A 2OWJA 4HQAA 3F1PB 3NHQA 3OLOA 4WL9A 5DJTA 5DJUA 5DKLA 2VV8A 4JGQA 1N9NA 1UWPX 2VV6A 3E4QA 3LYXA 3MQQA 2V9AA 3KX0X 4I5SA 1OT9A 4LRXC 4MN5A 1P97A 3H7WB 1T19A 3PYPA 4WF0A 3EEHA 2HV1A 2PYRA 4JGOA 3G6OA 1TS0A 4EEUA 4EXOA 2JN7A 4I38A 3UMDA 5HDDA 3CAXA 4EERA 3ICYA 3H7WA 3MR0A 4NXGA 3FC7A 4EETB 4F3LB 3C8CA 4PKYG 5HDCA 2ZOIA 3BY9A 3LI8A 4NXBA 1S67L 5HSQA 3NOTC 2L4RA 4I3JA 3A0SA 1OTDA 1GSWA 3IS2A 2JHEA 2PR6A 3NOPC 4GS9A 1TS7A 3RTYA 5I5LA 3UB6A 4R70A 4KUKA 4EQ1A 2I9VA 2V0UA 4NXFA 3LIEA 3A0VA 1LSVA 5HWVA 2QWSA 1XJ6A 2BASA 5F5YA 1S66L 3MXQA 4WUJA 5AVEA 5HDSA 2WKRA 4HI4A 2ZBBA 1Y28A 4E04A 4I3AA 5F69A 3T50A 1BYWA 5F68A 2L0WA 2CMNA 1OTAA 3C2WA 2OOLA 1OTEA 1S4SA 1TS8A 3GECA 4HJ6A 3CLOA 2QJ5A 4EEPA 2A24A 1T1BA 2QKPA 3MQOA 4HNBA 4DJ3A 3P7NA 3RH8B 3LIFA 3UB7A 1G28A 1WA9A 4HH2A 4B9OA 2A24B 5IU1A 4I39A 4HH3A 1DP6A 3BY8A 3H82A 1N9LA 1XJ3A 3F1NB 1GSXA 4K08A 1TS6A 4BBUA 5J4EA 4H6JB 2VEAA 4HJ4A 1OTBA 3NJAA 5A8BA 2GJ3A 4R38A 5DKKA 1UWNX 2M1CA 3LI9A 1N9OA 3UE6A 3SW1A 2K7SA 2H28A 1S1YA 5EFWA 3F1OB 4H6JA 5F6AA 5HWWA 2PHYA 2EA9A 4GW9A 1P0ZA 3BWLA 2J80A 5HZHA 2PD7A 3PHYA 4NXEA 3MFXA 3F1PA 3F1OA 4KUOA 2L1MA 3UB9A 1NWZA 3NOUC 2ZOHA 3HJKA 2INWA 3IBRA 1LSXA 3EWKA 3K3CA 2V1BA 4KQDA 4YWZA 2Z6DA 1DRMA 3LIAA 1OJGA 3HJIA 5J3WA 4JGRA 3E4PA 4LRYC 1KOUA 1XFQA 1EW0A 1D06A 1DP8A 4GS9B 2YKHA 1LT0A 1T1AA 1T1CA 2PDRA 3E4OA 3LUQA 4R3AA 1T18A 2PD8A 4BBTA 3B33A 5TBMA 4DJ2A 2VLGA 2W27A 4EESA 1OJ5A 5AVFA 4F3LA 4L9GA 2KDKA 1S1ZA 2QHKA 3LIDA 1D7EA 4GCZA 3VE3A 4HJ3A 4L9FA 4XT2B 1S4RA 3UB8A 1XFNA 5TBMB 2R78A 3IS2B 5HD5A 3ZQ5A 5IS1A 2V1AA 1ODVA 1JNUA 3CWFA 1LSWA 3MJQA 3UMEA 4HIAA 4HOIA 2P7JA 1V9YA 3GDIA 4LLOB 5G4ZA 4XT2A 5G4YA 1MZUA 1F9IA 1XJ4A 1UGUA 2V0WA 4HP9A 4LPZA 1OTIA 2Z6CA 3K3DA 4HP4A 3VE4A 3D72A 4JGPA 4L9EA 1GSVA 2OWHA 1X0OA 3H9WA 4HHDA 5KIZA 2D02A 2WKPA
chains in the Genus database with same CATH superfamily
3VOLA 4E3OA 5GLCA 5CTMA 2KX6A 3WS4A 4DXBA 1SZVA 4X1LA 4JF5A 1BLPA 1NY0A 4G3VA 3VV4A 5FL3A 1ZC2A 3O3VA 2M7VA 5DKLA 5DJUA 4XXRA 4WZ5C 2HZ5A 4ZBEA 5G4ZA 3H7WB 3IF6C 3G6OA 4DN0A 1F5MA 5EVIA 1Z6FA 3VOZA 2HP9A 1YPRA 3G2YA 1MWSA 2WGWA 3CITA 1PFLA 4OQHA 1YSQA 2RL3A 4R70A 2X02A 5CECA 4YINA 2W1TB 3A0VA 3MXRA 4EQIA 3MXQA 2ZBBA 1ES2A 2JKRI 4PM5A 2PU4A 1JVJA 2W3DA 5FQ9A 4E6XA 1YLYA 2QZ6A 3DTKA 4WZ4A 3D9YA 4H6JB 4HEFA 3KYQA 4OQIA 5DTSA 1P0ZA 4X68A 3OCNA 3HJKA 4KQRA 1IYQA 3PBOA 5HARA 3HUOA 4GS9B 3W4OA 5EUAA 3IHBA 1D7EA 4CLCB 4XT2B 2OV5A 3V39A 3QP5A 4ZAMA 2HDRA 3LGOA 4HP9A 4OP5A 1OMEA 5JYPA 3MXSA 4BD1A 2Q9NA 2WKPA 3S1YA 4Y0OA 1CQAA 5HWTA 4UA6A 5FDSA 3FWLA 2PU2A 2WZZA 3O86A 4IBXA 4DE2A 3BQAA 4X56A 3EEHA 3IX8A 3GMWA 5EVEA 5HDDA 3C5AA 2JCHA 3H7WA 3VP1A 4EETB 5HPFA 2ZMVA 3M2KA 5HSQA 1GSWA 2JKTM 2I9VA 1GA0A 4OH0A 1NZOA 2WKRA 4I3AA 4N9KA 2L0WA 3JYIA 3ITAA 3QNBA 5CEDA 2HDSA 4JXVA 1ZTUA 2PT7A 3IXHA 4UA7A 1RGZA 3IT9A 3BY8A 1XJ3A 3LEQA 3CI6A 2OSUA 1CK3A 5HX9A 5KMWA 3DBAA 5EE8A 1PW8A 2PHYA 3R7WA 3HLDA 5A91A 5TFQA 1SKFA 4UHUA 2FH5A 1YSPA 5FQIA 1PI5A 3E4PA 5A92A 4FH4A 4Q8IA 2JC7A 2Y2GA 2Y79A 2ZLYA 3FYZA 3PBSA 3N8LA 1IFQA 1S1ZA 1IKIA 5F1GA 3CWFA 4R1GA 2M7UA 5EVID 3SH9A 2Z6CA 3B3XA 1TEMA 4MN7A 1ESIA 4S2OA 4R6LA 5TJJA 4OPZA 5FQMA 3S7PA 3M2JA 1DP9A 3BQ8A 3KSHA 3JVUA 4MN6A 4WL9A 1FR6A 1SKOB 3D4FA 3QP6A 4UQIS 4BD0A 4CLCC 1TS0A 2XSSA 4QJGA 2GZAA 3UMDA 4H8RA 2EWVA 3MR0A 4NXGA 2HDUA 2H0TA 1BSGA 1NYMA 3M6HA 3NBLA 4OONA 2XDMA 4LENA 1K54C 2B18A 3ZG7B 5L09A 4E04A 3T1QB 1Y28A 3Q1FA 3C7UA 2G2UA 3O5YA 3HREA 4EBPA 4DKIA 2JKFA 1L2SA 1OPXA 5E2EA 3K2NA 4BWIA 2XA7M 3L7HA 1K56D 3ZG8B 3GVBA 5EPHA 5F1FA 4B93A 3B47A 3UO9A 5HAPA 4JF6A 4KZBA 3Q7ZA 1SDNA 3NCKA 2JE5A 4LV2A 5HL6A 3SH7A 3MFXA 3F1PA 2ZOHA 1E3UD 2ZQDA 1S0WA 2XGNA 1XFQA 5LBRA 3LR5A 3T4KA 4S2IA 1MWRA 1EWZA 5FATA 3HUMA 1S4RA 3IS2B 3W2ZA 2V8FA 3UPPA 5FQKA 3HLCA 5G4YA 4Q0IA 2P9VA 3MMHA 5AJGA 4OQ0A 4QY5A 5CXWA 1PWCA 4R4SA 1KDSA 1KE0A 4BBVA 2O9CA 3S7QA 2Q0OA 5FEFA 1XXMA 2GNXA 4HY8A 3F1NA 1BULA 3NIAA 3LYXA 2V9AA 2O9BA 3VMAA 4LV1A 2Y91A 3UPNA 3V50A 3SS3A 2A2LA 3MKFA 1ES4A 2HDQA 3E2LA 3CJMA 4K91A 3NOPC 5CERA 3OBFA 3VFHA 1BUEA 2HGVA 5M19A 4DE3A 3VP2A 5HDSA 2QWSA 4WUJA 5DTKA 1G6OA 2JBFA 1L0FA 1BTLA 2UV0E 5DVAA 3G2ZA 3IXBA 2ZQ9A 4UEYA 3OPLA 2WUQA 4HNBA 2NUTC 1PZOA 3BYDA 4AFIA 2V2FF 5HAQA 1OTBA 1G6AA 3LI9A 1TDGA 2B95A 2ZMFA 3ZVTA 2XRNA 4ARZA 3UDIA 2Y2JA 4MDZA 5G18A 2QMIA 4ID4A 1VEUB 4ZDXA 2Z6DA 1E25A 3EQUA 1NZUA 2BTFP 4G3WA 3N6IA 3P01A 2Y55A 3MSHA 4L9FA 5HD5A 3CPTA 4QU3A 2P7JA 3OPHA 3TOIA 1YMSA 4HESA 3D72A 1GSVA 5HL1A 1IELA 2EX2A 2RCXA 4PM7A 1VB6A 1W8QA 1OT6A 4GHIA 1ONHA 2YKFA 4KZ4A 4EV4A 4WLAA 1XJ2A 2OWJA 5I94A 4NK3A 2VV8A 3VFFA 3IXDA 4DDYA 5M1AA 5GHYA 3UDFA 3T4LA 4EU0A 3KYEA 4F94A 4P6ZS 2L4RA 1QMFA 2LB9A 5HFOA 2PR6A 4S2LA 3V3RA 1CJFA 5I5LA 4E6WA 2B5RA 2XD1A 2V0UA 1JTDA 3PBTA 5E2FA 1W63M 2DNSA 2CC1A 3RFBA 2WADA 3SOIA 1CI9A 4P6BA 4Y2FA 4EEPA 2A24A 1VETB 3VOYA 4BL3A 2E8JA 4DJ3A 2VX8A 1ZKJA 1UWNX 3R7WB 2VA0A 1N9BA 4LCLA 1FIKA 1HZOA 1K4EA 2WGWB 4MNRA 1HD8A 1C3BA 3E4OA 5FQQA 2J9PA 5AQAA 1VM1A 2Y2PA 4C6YA 4MBKA 2XD5A 4L9GA 4GCZA 5CEBA 3WWXA 2VK3A 1XP4A 1FSWA 3QNCA 4RYEA 4BLMA 4PAUA 2EXBA 2PAVP 4E3MA 1OTIA 3G32A 4HBTA 3H9WA 1KE3A 3NJAA 4ZJ3A 2EFXA 4MLLA 4PPRA 1H3QA 3NY4A 3HBRA 1ERQA 4M4XA 4RA7A 3ZG5A 1IYSA 2WKIA 4YOFA 2O9AA 2XROA 1BT5A 1Q2QA 4BL2A 3TW8A 2HV1A 3CUEC 3JPUA 3UNWA 2J3WA 4CLCA 2ZOIA 3BY9A 4NXBA 1S67L 3IBJA 1H8YA 5HPIA 2G2WA 1RGYA 4NXFA 1W63Q 2PBYA 1CEFA 2ZD8A 3MZEA 3DTEA 5TR7A 5HW3A 3DAVA 2XR0A 3IXGA 2Z2MB 3CUEA 3RH8B 4PM8A 1G68A 3BFCA 2QPNA 5L8MA 3HVFA 5F82A 3EGXC 3ZGAB 1KVMA 3UB5P 1ES5A 5DF9A 3MBZA 5HWWA 4BJPA 2PD7A 4Q0JA 4Y17A 3TG9A 4NG2A 3EWKA 3WS1A 1JTGA 4JGRA 4P0MA 4R3AA 5TBMA 2Y2LA 2KDKA 4FSFA 1E3UA 4HOIA 5FI2A 3MZFA 4NKPA 4Y0TA 3PTEA 1L0DA 4L9EA 2K2NA 3H82B 4B4ZA 1HVBA 3ZDJA 1LI0A 1TD5A 1ZG4A 1Z09A 1BLHA 3W4QA 5C5KA 2BG1A 4ETZA 5CHMA 3I7JA 3OZHA 3R4KA 4JGQA 4IVIA 4I5SA 4L0LA 4LRXC 5F6AA 2W3HA 3M6BA 4LFUA 1MKIA 2JN7A 3E98A 1ZG6A 1K57A 2IWDA 3NOTC 4I3JA 1DY6A 3UPOA 3RXWA 4IJGA 2E8IA 3Q07A 3RTYA 2Y2OA 2VGKA 5HAIA 2FFFB 4JXWA 5FQJA 2WGVA 4KZ7A 1A0KA 3P7NA 3LIFA 2H0YA 3IWIA 3WRTA 4N92A 4B9OA 4UQIM 2ZM8A 3G31A 3DTIA 4K08A 4P85A 5EV0A 3FPVA 3UE3A 3SZTA 2JKRM 2GX5A 5TGFA 1SDEA 3QP8A 1CEGA 2WYXA 4S2NA 2OAP1 1GHIA 3N8SA 5L10A 4EESA 3QP4A 4KQOA 4GZBA 2ZQ8A 3KSIA 5L07A 1O7EA 3UB8A 3WS2A 2R78A 3ZQ5A 3ZNYA 4GKUA 2Y2IA 1TVFA 1MWUA 2V0WA 1UGUA 4S2NC 3G35A 3VE4A 5FDHA 4Z9QA 3E0YA 4LV3A 5DFYA 2P08A 1YLJA 3G34A 4IEDA 1H5XA 4N1HA 4LRZE 3LIBA 3U4LP 2PR5A 4WMCD 2P74A 2WGIA 4MMNA 1K6RA 1CI8A 1UWPX 3MQQA 1K4FA 1KGGA 4GDNA 3BECA 2C6WB 2ZQ7A 1LL5A 1KVLA 1WYCA 1FOFA 3AGEA 3QHYA 4E3JA 1TS7A 4NETA 3LIEA 3P98A 3BW6A 5F5YA 1CF0A 5D3OA 5DF7A 5CHJA 3A3DA 1BYWA 4OPQA 1BZAA 1MKMA 1VETA 4IHQA 4RVAA 2VJWA 2OLUA 4ZJ1A 2QKPA 1PW1A 4O01A 3PBRA 2G7UA 3VP0A 3MF0A 1H0MA 2J3TD 3T12B 1ONGA 3E2KA 4FUWA 4E3NA 4ESPA 2J7VA 2J80A 2ZC3B 5AQ7A 2VGLS 4KQDA 1GCEA 5MC7A 2ZC4B 5GLBA 2W1RA 3LY4A 3LR3A 4LRYC 3W4PA 2HJEA 2W3FA 3LUQA 1K54A 4LGWA 4WEKA 5IS1A 4KZ5A 1ODVA 3UMEA 4MBFA 3MKEA 3GDIA 1W8YA 2W1TA 2R9WA 1WYBA 3K3DA 2OWHA 3IF6A 3L9KA 4X53A 2O0YA 2V20A 4EUVA 1F98A 4RX2A 4EW7A 3C4OA 4QY6A 3ULFA 1I5QA 2P04A 1V9ZA 3WS0A 5BOHA 3OC2A 5AQBA 4X1MA 4BQMA 1PWGA 4YWZA 3LFVA 1FCNA 3O88A 3FPWA 3CAXA 4JF4A 1RCJA 3S4XA 1NJ4A 2XFTA 2XEPA 1HTZA 3PBNA 4EQ1A 3HUNA 2XH9A 1NLYA 1YT4A 4N9LA 1PZPA 3CMZA 5F68A 1S4SA 3GECA 2VKSA 4GD8A 3UN7A 3UB7A 4C3QA 3MS6A 1N9LA 3GTCA 3T1SA 3S7NA 3EOIA 3UE6A 4Y13A 3HLFA 2EA9A 5EVIB 4GNUA 4KUOA 2L1MA 2W3GA 4QPRA 2JKGA 3FKWA 1XGJA 4UA9A 1DP8A 3Q7VA 1VEUA 5CGXA 2ZMAA 4BBTA 3DWKA 2W27A 4OLDA 3BM6A 4ME4A 3CG5A 4Y3IA 3OOVA 3TE8A 4K0WA 4N1XA 2J8YA 2WAFA 2ZQAA 1MC0A 3JVVA 4JGPA 5E2HA 3C4PA 1PIOA 4I3IA 4IBRA 1O07A 4DDSA 3A0RA 3TJZC 4HQAA 4LCMA 4MN5A 1OT9A 4ETXA 4JGOA 3GSGA 3Q7VB 4D60A 2DRWA 5FASA 3T4TA 4ZTKA 4WYYA 1ZHHB 1EI5A 3C38A 3UDXA 4KUKA 3B42A 1LSVA 1E4DA 5AVEA 4FOFA 1JWZA 1MBLA 3PBQA 1YM1A 1P9RA 4GJ4A 2QJ5A 4CPKA 1M40A 4U3TA 1G28A 1JWVA 1DJAA 1PYYA 1DP6A 3H82A 2XK1A 1G5UA 2Q9MA 5DKKA 1LHYA 4UAAA 2EXAA 1S1YA 3ZHHA 5HZHA 2OLVA 2INWA 3QP2A 3HJIA 1S6RA 3SS5A 4IUHA 5EFWA 3SW1A 2OAQ1 1NRJA 4KG2A 5CTNA 3WRZA 1IYOA 4PHTA 4PM6A 4WZ5A 4IVKA 4U0XA 4A5RA 2WKEA 2ZL1A 4S2MA 3BFGA 2VGJA 2Y2HA 5GL9A 4WN5A 1J3WA 2A3UA 5DJTA 1FCMA 3QP1A 3UB9A 1P97A 3BFEA 3PYPA 5KZHA 5J8XA 2VGLM 1W79A 2HJ9C 4B4XA 1XKZA 3LI8A 3IH9A 2JHEA 3Q82A 4ZRRA 4Y7PA 5HWVA 4JXGA 1XJ6A 1RP5A 2KOIA 5F69A 3P09A 1MXOA 3HL9A 2A49A 4DRTA 1OTAA 3C2WA 1OTEA 1VHMA 3OPPA 5AQ9A 1F2KA 1K55C 4II7A 4GDBA 4KQQA 3ZCZA 1AWIA 4PM9A 2M1CA 1N9OA 2K7SA 5EM0A 2DCFA 4CJNA 3PHYA 4NXEA 3AGDA 3F1OA 3UY6A 1LSXA 3ZFZA 3LIAA 1KOUA 2YKHA 1T1AA 2X71A 3B33A 4DJ2A 3BJNA 2QHKA 5GLDA 4DMZA 5TBMB 1XPBA 4OOMA 2BLSA 3CZDA 3MZDA 4CQHA 1STZA 3N4IA 4FTXA 1X0OA 1PNEA 4HHDA 4WELA 2EX6A 1LL9A 4GHIB 3DW0A 2D01A 1I2SA 1K25A 1VQQA 5EOEA 3FG8A 5J7EA 3VSKA 3F1PB 3Q81A 4JPMA 2VV6A 4D2OA 4B88A 1T19A 2PYRA 4EXOA 1FILA 3C30A 2O99A 4ARZB 2Y2KA 2ZM2A 3PR6A 4DF6A 5EVLA 1JWPA 5FAPA 4JBFA 2ZQCA 5E43A 1YQSA 3IS2A 3BLSA 1KGFA 5CGWA 2ZC5B 4Y5FA 4EWFA 3DTMA 1H8ZA 1W7FA 3FZCA 2VZWA 5JYOA 5IHVA 2OOLA 5A93A 1ACFA 1BLSA 1XA7A 1T1BA 3AGFA 2I72A 3NULA 4X69A 4HH2A 5IU1A 4I39A 1L0EA 3FKVA 1GSXA 4EBLA 4HJ4A 2IWCA 2K31A 3LY3A 3N7WA 1GHPA 4GW9A 4KG6A 1LI9A 1NWZA 3NOUC 4WM9A 3BFFA 4O7DA 4RX3A 2R9XA 5FA7A 5FI7A 1LT0A 1EROA 4EBNA 1T18A 1KGEA 4XUZA 5AVFA 4YNRA 1N4OA 1MPLA 1XX2A 4S2PA 2IWBA 3D3OA 4LV0A 3A3FA 2IA2A 4HIAA 4E3LA 1ALQA 5CGSA 4HP4A 1FQGA 1PWDA 2D02A 3EGDC 2P9VB 3LCEA 2WKQA 4BENA 2VV7A 4DE0A 4U0TA 2ZM0A 1LL8A 2V1ZA 2UWXA 4OPYA 1TF1A 4KZ6A 2PYPA 3NHQA 3G4PA 4WBGA 1L0GA 4MBHA 3UB6A 2HPBA 4JLFA 4G3KA 3S7OA 3NECA 4GOGA 3VSLA 4Q0HA 1BLCA 3ICYA 3LR0A 3NDEA 1OTDA 4GS9A 4KG5A 5DTTA 2LB5A 3T4JA 1DJBA 2AVXA 4HI4A 3IH8A 3IF6B 3HLWA 3S22A 4FD8A 2Y59A 4HH3A 3A3EA 5EM1A 1NLZA 1TS6A 3IHAA 4R38A 3ITBA 4O8GA 1YKDA 2H28A 2EX8A 3TRCA 3IWOA 2J9OA 2FFYA 3VP4A 3LO7A 1ES3A 1IKGA 1DRMA 4OVDA 5J3WA 5FAOA 2PD8A 5F83A 4E3IA 4F3LA 3VE3A 3LIDA 2H10A 1SHVA 1YLWA 1GA9A 5GHXA 4QHCA 2WKHA 4LLOB 4X55A 1F9IA 2X01A 3KYZA 1K56A 5KIZA 2ZL1B 1IEMA 4IUKA 3HLBA 4RQ9A 3N8RA 2W0NA 3NC8A 1DJCA 3IQAA 1SKOA 3MQ0A 3GRJA 3V67A 4P6ZM 3E4QA 1K57C 4EERA 2EX9A 5K5BA 3BLMA 4F3LB 5HDCA 1WE4A 4NEED 3V3SA 3A0SA 1K0KA 2HP6A 4OOYA 5U47A 1U60A 3TSGA 2ZC6B 3IF5A 3GV9A 3T50A 5EOOA 1YLTA 1NYYA 4MEZA 3BEBA 4WMCA 2CMNA 4R3JA 2Y2QA 1FCOA 1NXYA 1Y4OA 3T1RA 3RJUA 5KSCA 1D1JA 3T4SA 2A24B 2XF3A 4R4RA 5A90A 5A8BA 3LEZA 2HP5A 3UE0A 3F1OB 4H6JA 5GHZA 3BWLA 3RXXA 4OP8A 1L3LA 4GD6A 3ZG0A 3GR2A 3OPRA 3K3CA 3NDGA 1K38A 1OJGA 2WAEA 4R3BA 1D06A 4GLQA 1T1CA 1LLBA 2PDRA 4O0PA 1MY8A 2EFUA 3KSFA 2HF6A 1XFNA 1K55A 4YFMA 2ZC7A 4XT2A 3HCYA 3CHWP 2ACGA 4XUXA 1ESUA 2EWWA 3IX3A 3LR4A 5HD3A 4KENB 2ZJ9A 1Q2PA 3ZNTA 4PKYA 1J9MA 1MWTA 2WZXA 2B02A 1NRFA 4KZAA 5DF8A 3OLOA 1YAXA 3SS4A 3KX0X 4DE1A 4Y15A 5FSRA 4CLCD 4I38A 2C5WB 1YMXA 2XFSA 1FR1A 1AXBA 5DFXA 5E2GA 3ZG9B 3T1XA 3G30A 5FEGA 1ERMA 2JKTI 2Y2NA 4C75A 4MCWA 4E3KA 3WS5A 4JKTA 4PMAA 1P9WA 2BASA 1S66L 2PRFA 4QB8A 4HJ6A 4HBUA 3W8KA 3ZVWA 4M3KA 4X25A 3KO6A 1TDLA 3BFDA 3FV7A 4OQGA 4BBUA 4OKPA 2GJ3A 3HLEA 3MFDA 1I2WA 2Y4AA 4OLGA 4FH2A 2J3TC 1IYPA 3IBRA 2V1BA 3IWQA 1SCWA 1EW0A 2GDNA 4OPRA 2VLGA 3CPTB 1OJ5A 4Y0UA 2Y2MA 5CHUA 4GB7A 5FI6A 1YLZA 1JNUA 4KZ3A 2H5SA 4X6TA 1M6KA 4Z1WA 1MZUA 3V5MA 5FAQA 1KDWA 1FSYA 5CRFA 3ZYTA 4S2KA 3U2AA 4WEJA 2QJ7A 2XLNA 2XQZA 3EQVA 3BRMA 3C7VA 5KSHA 4OOLA 3LICA 2FZ0A 1N9NA 4ZJ2A 3NI9A 1PRQA 3EEAA 4WF0A 4FCFA 4EEUA 3PXPA 4R23A 3ISGA 4KZ8A 1GHMA 3T4QA 3FC7A 5IT5A 1KE4A 2PBDP 3C8CA 4PKYG 5L2FA 4DXCA 5J4EA 3GQZA 3IX4A 3DWZA 1H8MA 2NUPC 2QYBA 1PI4A 2XA7S 3KSGA 3VP3A 3PAEA 1Y54A 4GN2A 1YLPA 1TS8A 3HLGA 3UE1A 3CLOA 3MQOA 5M18A 1WA9A 2W3EA 4R0QA 3A3IA 1HLUP 4K0XA 3T4OA 3F1NB 4P87A 2VEAA 2DMWA 1QMEA 1W5DA 1XA1A 3A3JA 4JXSA 5GLAA 2WK0A 5EECA 2KLIA 4BMWA 4S2JA 4QD4A 2V8CA 3PAGA 3SH8A 5EVIC 3OCLA 5CX7A 3O87A 4HJ3A 1IOUA 2V1AA 1LSWA 3MJQA 4EUZA 1V9YA 1K6SA 2Y8HA 2MJ6A 1XJ4A 4LPZA 4KZ9A 4CLCE 1XGIA 2Z2LB 4QWOA
chains in the Genus database with same CATH topology
3EGDC 3VOLA 2O0YA 1VB6A 2KX6A 4EUVA 1F98A 2WKQA 2VV7A 4EW7A 1OT6A 1LL8A 4G3VA 2YKFA 4GHIA 3VV4A 1TF1A 1XJ2A 4WLAA 2P04A 5FL3A 3ULFA 1V9ZA 2PYPA 2OWJA 5DKLA 2M7VA 3NHQA 5DJUA 2VV8A 3OC2A 5G4ZA 3UB6A 3H7WB 4YWZA 3LFVA 3G6OA 4G3KA 3S7OA 1F5MA 4DN0A 3FPWA 3CAXA 4Q0HA 3T4LA 3ICYA 4EU0A 3LR0A 3CITA 4P6ZS 2L4RA 2LB9A 1OTDA 2PR6A 4GS9A 1YSQA 5I5LA 4R70A 3PBNA 4EQ1A 2LB5A 2V0UA 2W1TB 3A0VA 3T4JA 3PBTA 1NLYA 3MXQA 4HI4A 2ZBBA 1W63M 2JKRI 5F68A 3RFBA 1S4SA 3GECA 4Y2FA 4EEPA 2A24A 2W3DA 2VKSA 4DJ3A 2VX8A 3UB7A 4HH3A 1N9LA 1NLZA 1TS6A 4H6JB 3S7NA 4R38A 1UWNX 3R7WB 3KYQA 3EOIA 4O8GA 1YKDA 3UE6A 2H28A 2VA0A 3TRCA 2EA9A 1P0ZA 3OCNA 4KUOA 2L1MA 2W3GA 4QPRA 3HJKA 3PBOA 1DRMA 1DP8A 4GS9B 5J3WA 3E4OA 2PD8A 4BBTA 2W27A 4F3LA 4L9GA 3VE3A 3LIDA 4GCZA 1D7EA 4ME4A 4CLCB 4Y3IA 4XT2B 3OOVA 3TE8A 4LLOB 4PAUA 1F9IA 4HP9A 1OTIA 3KYZA 1MC0A 3JVVA 4JGPA 5KIZA 3H9WA 3NJAA 2WKPA 1H3QA 4IUKA 4I3IA 4RQ9A 5HWTA 2W0NA 4M4XA 4YOFA 3A0RA 3TJZC 3MQ0A 4HQAA 2O9AA 3V67A 2XROA 4P6ZM 3BQAA 4MN5A 3E4QA 3TW8A 1OT9A 4ETXA 3EEHA 2HV1A 3CUEC 4JGOA 5HDDA 4EERA 3T4TA 3H7WA 5K5BA 5HPFA 4EETB 4F3LB 2J3WA 5HDCA 4CLCA 2ZMVA 2ZOIA 3BY9A 4NXBA 1S67L 5HSQA 3IBJA 4NEED 1ZHHB 3A0SA 1GSWA 3C38A 5HPIA 4KUKA 2JKTM 2I9VA 3B42A 4NXFA 1W63Q 1LSVA 5AVEA 4FOFA 2WKRA 3PBQA 4I3AA 3T50A 2L0WA 2CMNA 1P9RA 4GJ4A 2QJ5A 3CUEA 3RH8B 1ZTUA 2PT7A 1G28A 3T4SA 2A24B 1DP6A 3BY8A 3H82A 1XJ3A 5L8MA 3CI6A 3EGXC 5A8BA 3DBAA 5DKKA 1S1YA 3F1OB 4H6JA 5DF9A 5HWWA 2PHYA 3BWLA 3R7WA 4BJPA 5HZHA 2PD7A 4Q0JA 2INWA 3EWKA 3K3CA 2FH5A 1YSPA 1OJGA 3HJIA 4JGRA 3E4PA 4IUHA 5EFWA 1D06A 2OAQ1 4GLQA 3SW1A 1T1CA 2PDRA 4O0PA 4R3AA 1NRJA 3PBSA 2Y79A 5TBMA 3KSFA 1IFQA 2KDKA 1S1ZA 4FSFA 2HF6A 1XFNA 3CWFA 2M7UA 4HOIA 4XT2A 3HCYA 4NKPA 4PHTA 2Z6CA 4L9EA 4MN7A 3LR4A 2EWWA 2K2NA 4R6LA 3H82B 5TJJA 5HD3A 1TD5A 3S7PA 4PKYA 1DP9A 3BQ8A 4WN5A 3KSHA 2B02A 3JVUA 4MN6A 5C5KA 4ETZA 4WL9A 5DJTA 3OLOA 3R4KA 4UQIS 1YAXA 4JGQA 3UB9A 4I5SA 3KX0X 4L0LA 4LRXC 5F6AA 1P97A 2W3HA 3PYPA 4CLCC 1TS0A 2XSSA 4CLCD 2JN7A 4I38A 2GZAA 2VGLM 3UMDA 3E98A 2EWVA 3MR0A 4NXGA 2HJ9C 3LI8A 5DFXA 3NOTC 4I3JA 4IJGA 2JHEA 3RTYA 2JKTI 4MCWA 4ZRRA 2B18A 5HWVA 1P9WA 1XJ6A 2BASA 1S66L 4E04A 1Y28A 2KOIA 5F69A 3O5YA 1OTAA 3C2WA 1OTEA 1VHMA 4HJ6A 3P7NA 1OPXA 3LIFA 3K2NA 4BWIA 2XA7M 4B9OA 4UQIM 3KO6A 4K08A 4BBUA 4II7A 4B93A 3B47A 3FPVA 3UE3A 2GJ3A 2M1CA 1N9OA 2JKRM 2K7SA 2GX5A 5HL6A 3PHYA 4NXEA 3MFXA 3F1PA 3F1OA 2J3TC 2ZOHA 3IBRA 1LSXA 2V1BA 3LIAA 2OAP1 1KOUA 1XFQA 1EW0A 2YKHA 1T1AA 5LBRA 3LR5A 3T4KA 3B33A 4DJ2A 3BJNA 2VLGA 4EESA 1OJ5A 4KQOA 2QHKA 4DMZA 3KSIA 3UB8A 1S4RA 5TBMB 2R78A 3IS2B 4OOMA 3W2ZA 3ZQ5A 1JNUA 4Z1WA 4CQHA 5G4YA 1MZUA 4Q0IA 2V0WA 1UGUA 1STZA 3VE4A 3MMHA 1X0OA 4HHDA 5AJGA 4WELA 3ZYTA 3E0YA 3U2AA 4WEJA 2QJ7A 5DFYA 4GHIB 2P08A 2D01A 3EQVA 4BBVA 2O9CA 3S7QA 4LRZE 5KSHA 4OOLA 3LICA 3LIBA 3FG8A 5J7EA 2GNXA 2PR5A 4HY8A 3F1NA 3F1PB 4MMNA 2FZ0A 1N9NA 1UWPX 2VV6A 3LYXA 3MQQA 2V9AA 2O9BA 3EEAA 4WF0A 1T19A 4EEUA 3PXPA 2PYRA 4EXOA 3C30A 2O99A 4ARZB 3PR6A 3T4QA 3FC7A 5IT5A 3C8CA 2A2LA 4PKYG 3IS2A 5J4EA 3NOPC 1TS7A 3OBFA 2HGVA 3LIEA 4Y5FA 1H8MA 2QWSA 2QYBA 3BW6A 5F5YA 4WUJA 5HDSA 2NUPC 1G6OA 2XA7S 3KSGA 1BYWA 1MKMA 2VZWA 4IHQA 2VJWA 2OOLA 1TS8A 3CLOA 1T1BA 2QKPA 3MQOA 4UEYA 4HNBA 4O01A 1WA9A 2NUTC 2W3EA 3PBRA 4HH2A 2G7UA 5IU1A 4I39A 3MF0A 4AFIA 3T4OA 3F1NB 1GSXA 2VEAA 4HJ4A 1OTBA 2J3TD 3LI9A 2K31A 2DMWA 2ZMFA 4GW9A 2J80A 2XRNA 4ARZA 1NWZA 3NOUC 2VGLS 4MDZA 4KQDA 2KLIA 2Z6DA 4BMWA 5MC7A 3EQUA 2W1RA 3LR3A 4LRYC 2HJEA 2W3FA 1LT0A 3LUQA 4G3WA 1T18A 3OCLA 5CX7A 4WEKA 5AVFA 3P01A 4YNRA 4HJ3A 4L9FA 1IOUA 3D3OA 5HD5A 5IS1A 2V1AA 1ODVA 3UMEA 1LSWA 3MJQA 2IA2A 4HIAA 2P7JA 1V9YA 3GDIA 2Y8HA 2MJ6A 2W1TA 1XJ4A 4LPZA 4HP4A 3K3DA 3D72A 4CLCE 1GSVA 2OWHA 2D02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R6L A;  3H82 B;  3VOL A;  2QJ7 A;  1VB6 A;  4I3I A;  5HD3 A;  4GHI B;  2KX6 A;  4RQ9 A;  1F98 A;  2WKQ A;  2D01 A;  2VV7 A;  5HWT A;  4PKY A;  2W0N A;  4BBV A;  4EW7 A;  1DP9 A;  1OT6 A;  1LL8 A;  4GHI A;  2YKF A;  4LRZ E;  4M4X A;  4WN5 A;  2B02 A;  4WLA A;  1XJ2 A;  3ULF A;  3LIC A;  3LIB A;  4MN6 A;  3FG8 A;  5J7E A;  1V9Z A;  2PR5 A;  3A0R A;  3F1N A;  2PYP A;  4HY8 A;  2OWJ A;  4HQA A;  3F1P B;  3NHQ A;  3OLO A;  4WL9 A;  5DJT A;  5DJU A;  5DKL A;  2VV8 A;  4JGQ A;  1N9N A;  1UWP X;  2VV6 A;  3E4Q A;  3LYX A;  3MQQ A;  2V9A A;  3KX0 X;  4I5S A;  1OT9 A;  4LRX C;  4MN5 A;  1P97 A;  3H7W B;  1T19 A;  3PYP A;  4WF0 A;  3EEH A;  2HV1 A;  2PYR A;  4JGO A;  3G6O A;  1TS0 A;  4EEU A;  4EXO A;  2JN7 A;  4I38 A;  3UMD A;  5HDD A;  3CAX A;  4EER A;  3ICY A;  3H7W A;  3MR0 A;  4NXG A;  3FC7 A;  4EET B;  4F3L B;  3C8C A;  4PKY G;  5HDC A;  2ZOI A;  3BY9 A;  3LI8 A;  4NXB A;  1S67 L;  5HSQ A;  3NOT C;  2L4R A;  4I3J A;  3A0S A;  1OTD A;  1GSW A;  3IS2 A;  2JHE A;  2PR6 A;  3NOP C;  4GS9 A;  1TS7 A;  3RTY A;  5I5L A;  3UB6 A;  4R70 A;  4KUK A;  4EQ1 A;  2I9V A;  2V0U A;  4NXF A;  3LIE A;  3A0V A;  1LSV A;  5HWV A;  2QWS A;  1XJ6 A;  2BAS A;  5F5Y A;  1S66 L;  3MXQ A;  4WUJ A;  5AVE A;  5HDS A;  2WKR A;  4HI4 A;  2ZBB A;  1Y28 A;  4E04 A;  4I3A A;  5F69 A;  3T50 A;  1BYW A;  5F68 A;  2L0W A;  2CMN A;  1OTA A;  3C2W A;  2OOL A;  1OTE A;  1S4S A;  1TS8 A;  3GEC A;  4HJ6 A;  3CLO A;  2QJ5 A;  4EEP A;  2A24 A;  1T1B A;  2QKP A;  3MQO A;  4HNB A;  4DJ3 A;  3P7N A;  3RH8 B;  3LIF A;  3UB7 A;  1G28 A;  1WA9 A;  4HH2 A;  4B9O A;  2A24 B;  5IU1 A;  4I39 A;  4HH3 A;  1DP6 A;  3BY8 A;  3H82 A;  1N9L A;  1XJ3 A;  3F1N B;  1GSX A;  4K08 A;  1TS6 A;  4BBU A;  5J4E A;  4H6J B;  2VEA A;  4HJ4 A;  1OTB A;  3NJA A;  5A8B A;  2GJ3 A;  4R38 A;  5DKK A;  1UWN X;  2M1C A;  3LI9 A;  1N9O A;  3UE6 A;  3SW1 A;  2K7S A;  2H28 A;  1S1Y A;  5EFW A;  3F1O B;  4H6J A;  5F6A A;  5HWW A;  2PHY A;  2EA9 A;  4GW9 A;  1P0Z A;  3BWL A;  2J80 A;  5HZH A;  2PD7 A;  3PHY A;  4NXE A;  3MFX A;  3F1P A;  3F1O A;  4KUO A;  2L1M A;  3UB9 A;  1NWZ A;  3NOU C;  2ZOH A;  3HJK A;  2INW A;  3IBR A;  1LSX A;  3EWK A;  3K3C A;  2V1B A;  4KQD A;  4YWZ A;  2Z6D A;  1DRM A;  3LIA A;  1OJG A;  3HJI A;  5J3W A;  4JGR A;  3E4P A;  4LRY C;  1KOU A;  1XFQ A;  1EW0 A;  1D06 A;  1DP8 A;  4GS9 B;  2YKH A;  1LT0 A;  1T1A A;  1T1C A;  2PDR A;  3E4O A;  3LUQ A;  4R3A A;  1T18 A;  2PD8 A;  4BBT A;  3B33 A;  5TBM A;  4DJ2 A;  2VLG A;  2W27 A;  4EES A;  1OJ5 A;  5AVF A;  4F3L A;  4L9G A;  2KDK A;  1S1Z A;  2QHK A;  3LID A;  1D7E A;  4GCZ A;  3VE3 A;  4HJ3 A;  4L9F A;  4XT2 B;  1S4R A;  3UB8 A;  1XFN A;  5TBM B;  2R78 A;  3IS2 B;  5HD5 A;  3ZQ5 A;  5IS1 A;  2V1A A;  1ODV A;  1JNU A;  3CWF A;  1LSW A;  3MJQ A;  3UME A;  4HIA A;  4HOI A;  2P7J A;  1V9Y A;  3GDI A;  4LLO B;  5G4Z A;  4XT2 A;  5G4Y A;  1MZU A;  1F9I A;  1XJ4 A;  1UGU A;  2V0W A;  4HP9 A;  4LPZ A;  1OTI A;  2Z6C A;  3K3D A;  4HP4 A;  3VE4 A;  3D72 A;  4JGP A;  4L9E A;  1GSV A;  2OWH A;  1X0O A;  3H9W A;  4HHD A;  5KIZ A;  2D02 A;  2WKP A; 
#chains in the Genus database with same CATH topology
 3VOL A;  4E3O A;  5GLC A;  5CTM A;  2KX6 A;  3WS4 A;  4DXB A;  1SZV A;  4X1L A;  4JF5 A;  1BLP A;  1NY0 A;  4G3V A;  3VV4 A;  5FL3 A;  1ZC2 A;  3O3V A;  2M7V A;  5DKL A;  5DJU A;  4XXR A;  4WZ5 C;  2HZ5 A;  4ZBE A;  5G4Z A;  3H7W B;  3IF6 C;  3G6O A;  4DN0 A;  1F5M A;  5EVI A;  1Z6F A;  3VOZ A;  2HP9 A;  1YPR A;  3G2Y A;  1MWS A;  2WGW A;  3CIT A;  1PFL A;  4OQH A;  1YSQ A;  2RL3 A;  4R70 A;  2X02 A;  5CEC A;  4YIN A;  2W1T B;  3A0V A;  3MXR A;  4EQI A;  3MXQ A;  2ZBB A;  1ES2 A;  2JKR I;  4PM5 A;  2PU4 A;  1JVJ A;  2W3D A;  5FQ9 A;  4E6X A;  1YLY A;  2QZ6 A;  3DTK A;  4WZ4 A;  3D9Y A;  4H6J B;  4HEF A;  3KYQ A;  4OQI A;  5DTS A;  1P0Z A;  4X68 A;  3OCN A;  3HJK A;  4KQR A;  1IYQ A;  3PBO A;  5HAR A;  3HUO A;  4GS9 B;  3W4O A;  5EUA A;  3IHB A;  1D7E A;  4CLC B;  4XT2 B;  2OV5 A;  3V39 A;  3QP5 A;  4ZAM A;  2HDR A;  3LGO A;  4HP9 A;  4OP5 A;  1OME A;  5JYP A;  3MXS A;  4BD1 A;  2Q9N A;  2WKP A;  3S1Y A;  4Y0O A;  1CQA A;  5HWT A;  4UA6 A;  5FDS A;  3FWL A;  2PU2 A;  2WZZ A;  3O86 A;  4IBX A;  4DE2 A;  3BQA A;  4X56 A;  3EEH A;  3IX8 A;  3GMW A;  5EVE A;  5HDD A;  3C5A A;  2JCH A;  3H7W A;  3VP1 A;  4EET B;  5HPF A;  2ZMV A;  3M2K A;  5HSQ A;  1GSW A;  2JKT M;  2I9V A;  1GA0 A;  4OH0 A;  1NZO A;  2WKR A;  4I3A A;  4N9K A;  2L0W A;  3JYI A;  3ITA A;  3QNB A;  5CED A;  2HDS A;  4JXV A;  1ZTU A;  2PT7 A;  3IXH A;  4UA7 A;  1RGZ A;  3IT9 A;  3BY8 A;  1XJ3 A;  3LEQ A;  3CI6 A;  2OSU A;  1CK3 A;  5HX9 A;  5KMW A;  3DBA A;  5EE8 A;  1PW8 A;  2PHY A;  3R7W A;  3HLD A;  5A91 A;  5TFQ A;  1SKF A;  4UHU A;  2FH5 A;  1YSP A;  5FQI A;  1PI5 A;  3E4P A;  5A92 A;  4FH4 A;  4Q8I A;  2JC7 A;  2Y2G A;  2Y79 A;  2ZLY A;  3FYZ A;  3PBS A;  3N8L A;  1IFQ A;  1S1Z A;  1IKI A;  5F1G A;  3CWF A;  4R1G A;  2M7U A;  5EVI D;  3SH9 A;  2Z6C A;  3B3X A;  1TEM A;  4MN7 A;  1ESI A;  4S2O A;  4R6L A;  5TJJ A;  4OPZ A;  5FQM A;  3S7P A;  3M2J A;  1DP9 A;  3BQ8 A;  3KSH A;  3JVU A;  4MN6 A;  4WL9 A;  1FR6 A;  1SKO B;  3D4F A;  3QP6 A;  4UQI S;  4BD0 A;  4CLC C;  1TS0 A;  2XSS A;  4QJG A;  2GZA A;  3UMD A;  4H8R A;  2EWV A;  3MR0 A;  4NXG A;  2HDU A;  2H0T A;  1BSG A;  1NYM A;  3M6H A;  3NBL A;  4OON A;  2XDM A;  4LEN A;  1K54 C;  2B18 A;  3ZG7 B;  5L09 A;  4E04 A;  3T1Q B;  1Y28 A;  3Q1F A;  3C7U A;  2G2U A;  3O5Y A;  3HRE A;  4EBP A;  4DKI A;  2JKF A;  1L2S A;  1OPX A;  5E2E A;  3K2N A;  4BWI A;  2XA7 M;  3L7H A;  1K56 D;  3ZG8 B;  3GVB A;  5EPH A;  5F1F A;  4B93 A;  3B47 A;  3UO9 A;  5HAP A;  4JF6 A;  4KZB A;  3Q7Z A;  1SDN A;  3NCK A;  2JE5 A;  4LV2 A;  5HL6 A;  3SH7 A;  3MFX A;  3F1P A;  2ZOH A;  1E3U D;  2ZQD A;  1S0W A;  2XGN A;  1XFQ A;  5LBR A;  3LR5 A;  3T4K A;  4S2I A;  1MWR A;  1EWZ A;  5FAT A;  3HUM A;  1S4R A;  3IS2 B;  3W2Z A;  2V8F A;  3UPP A;  5FQK A;  3HLC A;  5G4Y A;  4Q0I A;  2P9V A;  3MMH A;  5AJG A;  4OQ0 A;  4QY5 A;  5CXW A;  1PWC A;  4R4S A;  1KDS A;  1KE0 A;  4BBV A;  2O9C A;  3S7Q A;  2Q0O A;  5FEF A;  1XXM A;  2GNX A;  4HY8 A;  3F1N A;  1BUL A;  3NIA A;  3LYX A;  2V9A A;  2O9B A;  3VMA A;  4LV1 A;  2Y91 A;  3UPN A;  3V50 A;  3SS3 A;  2A2L A;  3MKF A;  1ES4 A;  2HDQ A;  3E2L A;  3CJM A;  4K91 A;  3NOP C;  5CER A;  3OBF A;  3VFH A;  1BUE A;  2HGV A;  5M19 A;  4DE3 A;  3VP2 A;  5HDS A;  2QWS A;  4WUJ A;  5DTK A;  1G6O A;  2JBF A;  1L0F A;  1BTL A;  2UV0 E;  5DVA A;  3G2Z A;  3IXB A;  2ZQ9 A;  4UEY A;  3OPL A;  2WUQ A;  4HNB A;  2NUT C;  1PZO A;  3BYD A;  4AFI A;  2V2F F;  5HAQ A;  1OTB A;  1G6A A;  3LI9 A;  1TDG A;  2B95 A;  2ZMF A;  3ZVT A;  2XRN A;  4ARZ A;  3UDI A;  2Y2J A;  4MDZ A;  5G18 A;  2QMI A;  4ID4 A;  1VEU B;  4ZDX A;  2Z6D A;  1E25 A;  3EQU A;  1NZU A;  2BTF P;  4G3W A;  3N6I A;  3P01 A;  2Y55 A;  3MSH A;  4L9F A;  5HD5 A;  3CPT A;  4QU3 A;  2P7J A;  3OPH A;  3TOI A;  1YMS A;  4HES A;  3D72 A;  1GSV A;  5HL1 A;  1IEL A;  2EX2 A;  2RCX A;  4PM7 A;  1VB6 A;  1W8Q A;  1OT6 A;  4GHI A;  1ONH A;  2YKF A;  4KZ4 A;  4EV4 A;  4WLA A;  1XJ2 A;  2OWJ A;  5I94 A;  4NK3 A;  2VV8 A;  3VFF A;  3IXD A;  4DDY A;  5M1A A;  5GHY A;  3UDF A;  3T4L A;  4EU0 A;  3KYE A;  4F94 A;  4P6Z S;  2L4R A;  1QMF A;  2LB9 A;  5HFO A;  2PR6 A;  4S2L A;  3V3R A;  1CJF A;  5I5L A;  4E6W A;  2B5R A;  2XD1 A;  2V0U A;  1JTD A;  3PBT A;  5E2F A;  1W63 M;  2DNS A;  2CC1 A;  3RFB A;  2WAD A;  3SOI A;  1CI9 A;  4P6B A;  4Y2F A;  4EEP A;  2A24 A;  1VET B;  3VOY A;  4BL3 A;  2E8J A;  4DJ3 A;  2VX8 A;  1ZKJ A;  1UWN X;  3R7W B;  2VA0 A;  1N9B A;  4LCL A;  1FIK A;  1HZO A;  1K4E A;  2WGW B;  4MNR A;  1HD8 A;  1C3B A;  3E4O A;  5FQQ A;  2J9P A;  5AQA A;  1VM1 A;  2Y2P A;  4C6Y A;  4MBK A;  2XD5 A;  4L9G A;  4GCZ A;  5CEB A;  3WWX A;  2VK3 A;  1XP4 A;  1FSW A;  3QNC A;  4RYE A;  4BLM A;  4PAU A;  2EXB A;  2PAV P;  4E3M A;  1OTI A;  3G32 A;  4HBT A;  3H9W A;  1KE3 A;  3NJA A;  4ZJ3 A;  2EFX A;  4MLL A;  4PPR A;  1H3Q A;  3NY4 A;  3HBR A;  1ERQ A;  4M4X A;  4RA7 A;  3ZG5 A;  1IYS A;  2WKI A;  4YOF A;  2O9A A;  2XRO A;  1BT5 A;  1Q2Q A;  4BL2 A;  3TW8 A;  2HV1 A;  3CUE C;  3JPU A;  3UNW A;  2J3W A;  4CLC A;  2ZOI A;  3BY9 A;  4NXB A;  1S67 L;  3IBJ A;  1H8Y A;  5HPI A;  2G2W A;  1RGY A;  4NXF A;  1W63 Q;  2PBY A;  1CEF A;  2ZD8 A;  3MZE A;  3DTE A;  5TR7 A;  5HW3 A;  3DAV A;  2XR0 A;  3IXG A;  2Z2M B;  3CUE A;  3RH8 B;  4PM8 A;  1G68 A;  3BFC A;  2QPN A;  5L8M A;  3HVF A;  5F82 A;  3EGX C;  3ZGA B;  1KVM A;  3UB5 P;  1ES5 A;  5DF9 A;  3MBZ A;  5HWW A;  4BJP A;  2PD7 A;  4Q0J A;  4Y17 A;  3TG9 A;  4NG2 A;  3EWK A;  3WS1 A;  1JTG A;  4JGR A;  4P0M A;  4R3A A;  5TBM A;  2Y2L A;  2KDK A;  4FSF A;  1E3U A;  4HOI A;  5FI2 A;  3MZF A;  4NKP A;  4Y0T A;  3PTE A;  1L0D A;  4L9E A;  2K2N A;  3H82 B;  4B4Z A;  1HVB A;  3ZDJ A;  1LI0 A;  1TD5 A;  1ZG4 A;  1Z09 A;  1BLH A;  3W4Q A;  5C5K A;  2BG1 A;  4ETZ A;  5CHM A;  3I7J A;  3OZH A;  3R4K A;  4JGQ A;  4IVI A;  4I5S A;  4L0L A;  4LRX C;  5F6A A;  2W3H A;  3M6B A;  4LFU A;  1MKI A;  2JN7 A;  3E98 A;  1ZG6 A;  1K57 A;  2IWD A;  3NOT C;  4I3J A;  1DY6 A;  3UPO A;  3RXW A;  4IJG A;  2E8I A;  3Q07 A;  3RTY A;  2Y2O A;  2VGK A;  5HAI A;  2FFF B;  4JXW A;  5FQJ A;  2WGV A;  4KZ7 A;  1A0K A;  3P7N A;  3LIF A;  2H0Y A;  3IWI A;  3WRT A;  4N92 A;  4B9O A;  4UQI M;  2ZM8 A;  3G31 A;  3DTI A;  4K08 A;  4P85 A;  5EV0 A;  3FPV A;  3UE3 A;  3SZT A;  2JKR M;  2GX5 A;  5TGF A;  1SDE A;  3QP8 A;  1CEG A;  2WYX A;  4S2N A;  2OAP 1;  1GHI A;  3N8S A;  5L10 A;  4EES A;  3QP4 A;  4KQO A;  4GZB A;  2ZQ8 A;  3KSI A;  5L07 A;  1O7E A;  3UB8 A;  3WS2 A;  2R78 A;  3ZQ5 A;  3ZNY A;  4GKU A;  2Y2I A;  1TVF A;  1MWU A;  2V0W A;  1UGU A;  4S2N C;  3G35 A;  3VE4 A;  5FDH A;  4Z9Q A;  3E0Y A;  4LV3 A;  5DFY A;  2P08 A;  1YLJ A;  3G34 A;  4IED A;  1H5X A;  4N1H A;  4LRZ E;  3LIB A;  3U4L P;  2PR5 A;  4WMC D;  2P74 A;  2WGI A;  4MMN A;  1K6R A;  1CI8 A;  1UWP X;  3MQQ A;  1K4F A;  1KGG A;  4GDN A;  3BEC A;  2C6W B;  2ZQ7 A;  1LL5 A;  1KVL A;  1WYC A;  1FOF A;  3AGE A;  3QHY A;  4E3J A;  1TS7 A;  4NET A;  3LIE A;  3P98 A;  3BW6 A;  5F5Y A;  1CF0 A;  5D3O A;  5DF7 A;  5CHJ A;  3A3D A;  1BYW A;  4OPQ A;  1BZA A;  1MKM A;  1VET A;  4IHQ A;  4RVA A;  2VJW A;  2OLU A;  4ZJ1 A;  2QKP A;  1PW1 A;  4O01 A;  3PBR A;  2G7U A;  3VP0 A;  3MF0 A;  1H0M A;  2J3T D;  3T12 B;  1ONG A;  3E2K A;  4FUW A;  4E3N A;  4ESP A;  2J7V A;  2J80 A;  2ZC3 B;  5AQ7 A;  2VGL S;  4KQD A;  1GCE A;  5MC7 A;  2ZC4 B;  5GLB A;  2W1R A;  3LY4 A;  3LR3 A;  4LRY C;  3W4P A;  2HJE A;  2W3F A;  3LUQ A;  1K54 A;  4LGW A;  4WEK A;  5IS1 A;  4KZ5 A;  1ODV A;  3UME A;  4MBF A;  3MKE A;  3GDI A;  1W8Y A;  2W1T A;  2R9W A;  1WYB A;  3K3D A;  2OWH A;  3IF6 A;  3L9K A;  4X53 A;  2O0Y A;  2V20 A;  4EUV A;  1F98 A;  4RX2 A;  4EW7 A;  3C4O A;  4QY6 A;  3ULF A;  1I5Q A;  2P04 A;  1V9Z A;  3WS0 A;  5BOH A;  3OC2 A;  5AQB A;  4X1M A;  4BQM A;  1PWG A;  4YWZ A;  3LFV A;  1FCN A;  3O88 A;  3FPW A;  3CAX A;  4JF4 A;  1RCJ A;  3S4X A;  1NJ4 A;  2XFT A;  2XEP A;  1HTZ A;  3PBN A;  4EQ1 A;  3HUN A;  2XH9 A;  1NLY A;  1YT4 A;  4N9L A;  1PZP A;  3CMZ A;  5F68 A;  1S4S A;  3GEC A;  2VKS A;  4GD8 A;  3UN7 A;  3UB7 A;  4C3Q A;  3MS6 A;  1N9L A;  3GTC A;  3T1S A;  3S7N A;  3EOI A;  3UE6 A;  4Y13 A;  3HLF A;  2EA9 A;  5EVI B;  4GNU A;  4KUO A;  2L1M A;  2W3G A;  4QPR A;  2JKG A;  3FKW A;  1XGJ A;  4UA9 A;  1DP8 A;  3Q7V A;  1VEU A;  5CGX A;  2ZMA A;  4BBT A;  3DWK A;  2W27 A;  4OLD A;  3BM6 A;  4ME4 A;  3CG5 A;  4Y3I A;  3OOV A;  3TE8 A;  4K0W A;  4N1X A;  2J8Y A;  2WAF A;  2ZQA A;  1MC0 A;  3JVV A;  4JGP A;  5E2H A;  3C4P A;  1PIO A;  4I3I A;  4IBR A;  1O07 A;  4DDS A;  3A0R A;  3TJZ C;  4HQA A;  4LCM A;  4MN5 A;  1OT9 A;  4ETX A;  4JGO A;  3GSG A;  3Q7V B;  4D60 A;  2DRW A;  5FAS A;  3T4T A;  4ZTK A;  4WYY A;  1ZHH B;  1EI5 A;  3C38 A;  3UDX A;  4KUK A;  3B42 A;  1LSV A;  1E4D A;  5AVE A;  4FOF A;  1JWZ A;  1MBL A;  3PBQ A;  1YM1 A;  1P9R A;  4GJ4 A;  2QJ5 A;  4CPK A;  1M40 A;  4U3T A;  1G28 A;  1JWV A;  1DJA A;  1PYY A;  1DP6 A;  3H82 A;  2XK1 A;  1G5U A;  2Q9M A;  5DKK A;  1LHY A;  4UAA A;  2EXA A;  1S1Y A;  3ZHH A;  5HZH A;  2OLV A;  2INW A;  3QP2 A;  3HJI A;  1S6R A;  3SS5 A;  4IUH A;  5EFW A;  3SW1 A;  2OAQ 1;  1NRJ A;  4KG2 A;  5CTN A;  3WRZ A;  1IYO A;  4PHT A;  4PM6 A;  4WZ5 A;  4IVK A;  4U0X A;  4A5R A;  2WKE A;  2ZL1 A;  4S2M A;  3BFG A;  2VGJ A;  2Y2H A;  5GL9 A;  4WN5 A;  1J3W A;  2A3U A;  5DJT A;  1FCM A;  3QP1 A;  3UB9 A;  1P97 A;  3BFE A;  3PYP A;  5KZH A;  5J8X A;  2VGL M;  1W79 A;  2HJ9 C;  4B4X A;  1XKZ A;  3LI8 A;  3IH9 A;  2JHE A;  3Q82 A;  4ZRR A;  4Y7P A;  5HWV A;  4JXG A;  1XJ6 A;  1RP5 A;  2KOI A;  5F69 A;  3P09 A;  1MXO A;  3HL9 A;  2A49 A;  4DRT A;  1OTA A;  3C2W A;  1OTE A;  1VHM A;  3OPP A;  5AQ9 A;  1F2K A;  1K55 C;  4II7 A;  4GDB A;  4KQQ A;  3ZCZ A;  1AWI A;  4PM9 A;  2M1C A;  1N9O A;  2K7S A;  5EM0 A;  2DCF A;  4CJN A;  3PHY A;  4NXE A;  3AGD A;  3F1O A;  3UY6 A;  1LSX A;  3ZFZ A;  3LIA A;  1KOU A;  2YKH A;  1T1A A;  2X71 A;  3B33 A;  4DJ2 A;  3BJN A;  2QHK A;  5GLD A;  4DMZ A;  5TBM B;  1XPB A;  4OOM A;  2BLS A;  3CZD A;  3MZD A;  4CQH A;  1STZ A;  3N4I A;  4FTX A;  1X0O A;  1PNE A;  4HHD A;  4WEL A;  2EX6 A;  1LL9 A;  4GHI B;  3DW0 A;  2D01 A;  1I2S A;  1K25 A;  1VQQ A;  5EOE A;  3FG8 A;  5J7E A;  3VSK A;  3F1P B;  3Q81 A;  4JPM A;  2VV6 A;  4D2O A;  4B88 A;  1T19 A;  2PYR A;  4EXO A;  1FIL A;  3C30 A;  2O99 A;  4ARZ B;  2Y2K A;  2ZM2 A;  3PR6 A;  4DF6 A;  5EVL A;  1JWP A;  5FAP A;  4JBF A;  2ZQC A;  5E43 A;  1YQS A;  3IS2 A;  3BLS A;  1KGF A;  5CGW A;  2ZC5 B;  4Y5F A;  4EWF A;  3DTM A;  1H8Z A;  1W7F A;  3FZC A;  2VZW A;  5JYO A;  5IHV A;  2OOL A;  5A93 A;  1ACF A;  1BLS A;  1XA7 A;  1T1B A;  3AGF A;  2I72 A;  3NUL A;  4X69 A;  4HH2 A;  5IU1 A;  4I39 A;  1L0E A;  3FKV A;  1GSX A;  4EBL A;  4HJ4 A;  2IWC A;  2K31 A;  3LY3 A;  3N7W A;  1GHP A;  4GW9 A;  4KG6 A;  1LI9 A;  1NWZ A;  3NOU C;  4WM9 A;  3BFF A;  4O7D A;  4RX3 A;  2R9X A;  5FA7 A;  5FI7 A;  1LT0 A;  1ERO A;  4EBN A;  1T18 A;  1KGE A;  4XUZ A;  5AVF A;  4YNR A;  1N4O A;  1MPL A;  1XX2 A;  4S2P A;  2IWB A;  3D3O A;  4LV0 A;  3A3F A;  2IA2 A;  4HIA A;  4E3L A;  1ALQ A;  5CGS A;  4HP4 A;  1FQG A;  1PWD A;  2D02 A;  3EGD C;  2P9V B;  3LCE A;  2WKQ A;  4BEN A;  2VV7 A;  4DE0 A;  4U0T A;  2ZM0 A;  1LL8 A;  2V1Z A;  2UWX A;  4OPY A;  1TF1 A;  4KZ6 A;  2PYP A;  3NHQ A;  3G4P A;  4WBG A;  1L0G A;  4MBH A;  3UB6 A;  2HPB A;  4JLF A;  4G3K A;  3S7O A;  3NEC A;  4GOG A;  3VSL A;  4Q0H A;  1BLC A;  3ICY A;  3LR0 A;  3NDE A;  1OTD A;  4GS9 A;  4KG5 A;  5DTT A;  2LB5 A;  3T4J A;  1DJB A;  2AVX A;  4HI4 A;  3IH8 A;  3IF6 B;  3HLW A;  3S22 A;  4FD8 A;  2Y59 A;  4HH3 A;  3A3E A;  5EM1 A;  1NLZ A;  1TS6 A;  3IHA A;  4R38 A;  3ITB A;  4O8G A;  1YKD A;  2H28 A;  2EX8 A;  3TRC A;  3IWO A;  2J9O A;  2FFY A;  3VP4 A;  3LO7 A;  1ES3 A;  1IKG A;  1DRM A;  4OVD A;  5J3W A;  5FAO A;  2PD8 A;  5F83 A;  4E3I A;  4F3L A;  3VE3 A;  3LID A;  2H10 A;  1SHV A;  1YLW A;  1GA9 A;  5GHX A;  4QHC A;  2WKH A;  4LLO B;  4X55 A;  1F9I A;  2X01 A;  3KYZ A;  1K56 A;  5KIZ A;  2ZL1 B;  1IEM A;  4IUK A;  3HLB A;  4RQ9 A;  3N8R A;  2W0N A;  3NC8 A;  1DJC A;  3IQA A;  1SKO A;  3MQ0 A;  3GRJ A;  3V67 A;  4P6Z M;  3E4Q A;  1K57 C;  4EER A;  2EX9 A;  5K5B A;  3BLM A;  4F3L B;  5HDC A;  1WE4 A;  4NEE D;  3V3S A;  3A0S A;  1K0K A;  2HP6 A;  4OOY A;  5U47 A;  1U60 A;  3TSG A;  2ZC6 B;  3IF5 A;  3GV9 A;  3T50 A;  5EOO A;  1YLT A;  1NYY A;  4MEZ A;  3BEB A;  4WMC A;  2CMN A;  4R3J A;  2Y2Q A;  1FCO A;  1NXY A;  1Y4O A;  3T1R A;  3RJU A;  5KSC A;  1D1J A;  3T4S A;  2A24 B;  2XF3 A;  4R4R A;  5A90 A;  5A8B A;  3LEZ A;  2HP5 A;  3UE0 A;  3F1O B;  4H6J A;  5GHZ A;  3BWL A;  3RXX A;  4OP8 A;  1L3L A;  4GD6 A;  3ZG0 A;  3GR2 A;  3OPR A;  3K3C A;  3NDG A;  1K38 A;  1OJG A;  2WAE A;  4R3B A;  1D06 A;  4GLQ A;  1T1C A;  1LLB A;  2PDR A;  4O0P A;  1MY8 A;  2EFU A;  3KSF A;  2HF6 A;  1XFN A;  1K55 A;  4YFM A;  2ZC7 A;  4XT2 A;  3HCY A;  3CHW P;  2ACG A;  4XUX A;  1ESU A;  2EWW A;  3IX3 A;  3LR4 A;  5HD3 A;  4KEN B;  2ZJ9 A;  1Q2P A;  3ZNT A;  4PKY A;  1J9M A;  1MWT A;  2WZX A;  2B02 A;  1NRF A;  4KZA A;  5DF8 A;  3OLO A;  1YAX A;  3SS4 A;  3KX0 X;  4DE1 A;  4Y15 A;  5FSR A;  4CLC D;  4I38 A;  2C5W B;  1YMX A;  2XFS A;  1FR1 A;  1AXB A;  5DFX A;  5E2G A;  3ZG9 B;  3T1X A;  3G30 A;  5FEG A;  1ERM A;  2JKT I;  2Y2N A;  4C75 A;  4MCW A;  4E3K A;  3WS5 A;  4JKT A;  4PMA A;  1P9W A;  2BAS A;  1S66 L;  2PRF A;  4QB8 A;  4HJ6 A;  4HBU A;  3W8K A;  3ZVW A;  4M3K A;  4X25 A;  3KO6 A;  1TDL A;  3BFD A;  3FV7 A;  4OQG A;  4BBU A;  4OKP A;  2GJ3 A;  3HLE A;  3MFD A;  1I2W A;  2Y4A A;  4OLG A;  4FH2 A;  2J3T C;  1IYP A;  3IBR A;  2V1B A;  3IWQ A;  1SCW A;  1EW0 A;  2GDN A;  4OPR A;  2VLG A;  3CPT B;  1OJ5 A;  4Y0U A;  2Y2M A;  5CHU A;  4GB7 A;  5FI6 A;  1YLZ A;  1JNU A;  4KZ3 A;  2H5S A;  4X6T A;  1M6K A;  4Z1W A;  1MZU A;  3V5M A;  5FAQ A;  1KDW A;  1FSY A;  5CRF A;  3ZYT A;  4S2K A;  3U2A A;  4WEJ A;  2QJ7 A;  2XLN A;  2XQZ A;  3EQV A;  3BRM A;  3C7V A;  5KSH A;  4OOL A;  3LIC A;  2FZ0 A;  1N9N A;  4ZJ2 A;  3NI9 A;  1PRQ A;  3EEA A;  4WF0 A;  4FCF A;  4EEU A;  3PXP A;  4R23 A;  3ISG A;  4KZ8 A;  1GHM A;  3T4Q A;  3FC7 A;  5IT5 A;  1KE4 A;  2PBD P;  3C8C A;  4PKY G;  5L2F A;  4DXC A;  5J4E A;  3GQZ A;  3IX4 A;  3DWZ A;  1H8M A;  2NUP C;  2QYB A;  1PI4 A;  2XA7 S;  3KSG A;  3VP3 A;  3PAE A;  1Y54 A;  4GN2 A;  1YLP A;  1TS8 A;  3HLG A;  3UE1 A;  3CLO A;  3MQO A;  5M18 A;  1WA9 A;  2W3E A;  4R0Q A;  3A3I A;  1HLU P;  4K0X A;  3T4O A;  3F1N B;  4P87 A;  2VEA A;  2DMW A;  1QME A;  1W5D A;  1XA1 A;  3A3J A;  4JXS A;  5GLA A;  2WK0 A;  5EEC A;  2KLI A;  4BMW A;  4S2J A;  4QD4 A;  2V8C A;  3PAG A;  3SH8 A;  5EVI C;  3OCL A;  5CX7 A;  3O87 A;  4HJ3 A;  1IOU A;  2V1A A;  1LSW A;  3MJQ A;  4EUZ A;  1V9Y A;  1K6S A;  2Y8H A;  2MJ6 A;  1XJ4 A;  4LPZ A;  4KZ9 A;  4CLC E;  1XGI A;  2Z2L B;  4QWO A; 
#chains in the Genus database with same CATH homology
 3EGD C;  3VOL A;  2O0Y A;  1VB6 A;  2KX6 A;  4EUV A;  1F98 A;  2WKQ A;  2VV7 A;  4EW7 A;  1OT6 A;  1LL8 A;  4G3V A;  2YKF A;  4GHI A;  3VV4 A;  1TF1 A;  1XJ2 A;  4WLA A;  2P04 A;  5FL3 A;  3ULF A;  1V9Z A;  2PYP A;  2OWJ A;  5DKL A;  2M7V A;  3NHQ A;  5DJU A;  2VV8 A;  3OC2 A;  5G4Z A;  3UB6 A;  3H7W B;  4YWZ A;  3LFV A;  3G6O A;  4G3K A;  3S7O A;  1F5M A;  4DN0 A;  3FPW A;  3CAX A;  4Q0H A;  3T4L A;  3ICY A;  4EU0 A;  3LR0 A;  3CIT A;  4P6Z S;  2L4R A;  2LB9 A;  1OTD A;  2PR6 A;  4GS9 A;  1YSQ A;  5I5L A;  4R70 A;  3PBN A;  4EQ1 A;  2LB5 A;  2V0U A;  2W1T B;  3A0V A;  3T4J A;  3PBT A;  1NLY A;  3MXQ A;  4HI4 A;  2ZBB A;  1W63 M;  2JKR I;  5F68 A;  3RFB A;  1S4S A;  3GEC A;  4Y2F A;  4EEP A;  2A24 A;  2W3D A;  2VKS A;  4DJ3 A;  2VX8 A;  3UB7 A;  4HH3 A;  1N9L A;  1NLZ A;  1TS6 A;  4H6J B;  3S7N A;  4R38 A;  1UWN X;  3R7W B;  3KYQ A;  3EOI A;  4O8G A;  1YKD A;  3UE6 A;  2H28 A;  2VA0 A;  3TRC A;  2EA9 A;  1P0Z A;  3OCN A;  4KUO A;  2L1M A;  2W3G A;  4QPR A;  3HJK A;  3PBO A;  1DRM A;  1DP8 A;  4GS9 B;  5J3W A;  3E4O A;  2PD8 A;  4BBT A;  2W27 A;  4F3L A;  4L9G A;  3VE3 A;  3LID A;  4GCZ A;  1D7E A;  4ME4 A;  4CLC B;  4Y3I A;  4XT2 B;  3OOV A;  3TE8 A;  4LLO B;  4PAU A;  1F9I A;  4HP9 A;  1OTI A;  3KYZ A;  1MC0 A;  3JVV A;  4JGP A;  5KIZ A;  3H9W A;  3NJA A;  2WKP A;  1H3Q A;  4IUK A;  4I3I A;  4RQ9 A;  5HWT A;  2W0N A;  4M4X A;  4YOF A;  3A0R A;  3TJZ C;  3MQ0 A;  4HQA A;  2O9A A;  3V67 A;  2XRO A;  4P6Z M;  3BQA A;  4MN5 A;  3E4Q A;  3TW8 A;  1OT9 A;  4ETX A;  3EEH A;  2HV1 A;  3CUE C;  4JGO A;  5HDD A;  4EER A;  3T4T A;  3H7W A;  5K5B A;  5HPF A;  4EET B;  4F3L B;  2J3W A;  5HDC A;  4CLC A;  2ZMV A;  2ZOI A;  3BY9 A;  4NXB A;  1S67 L;  5HSQ A;  3IBJ A;  4NEE D;  1ZHH B;  3A0S A;  1GSW A;  3C38 A;  5HPI A;  4KUK A;  2JKT M;  2I9V A;  3B42 A;  4NXF A;  1W63 Q;  1LSV A;  5AVE A;  4FOF A;  2WKR A;  3PBQ A;  4I3A A;  3T50 A;  2L0W A;  2CMN A;  1P9R A;  4GJ4 A;  2QJ5 A;  3CUE A;  3RH8 B;  1ZTU A;  2PT7 A;  1G28 A;  3T4S A;  2A24 B;  1DP6 A;  3BY8 A;  3H82 A;  1XJ3 A;  5L8M A;  3CI6 A;  3EGX C;  5A8B A;  3DBA A;  5DKK A;  1S1Y A;  3F1O B;  4H6J A;  5DF9 A;  5HWW A;  2PHY A;  3BWL A;  3R7W A;  4BJP A;  5HZH A;  2PD7 A;  4Q0J A;  2INW A;  3EWK A;  3K3C A;  2FH5 A;  1YSP A;  1OJG A;  3HJI A;  4JGR A;  3E4P A;  4IUH A;  5EFW A;  1D06 A;  2OAQ 1;  4GLQ A;  3SW1 A;  1T1C A;  2PDR A;  4O0P A;  4R3A A;  1NRJ A;  3PBS A;  2Y79 A;  5TBM A;  3KSF A;  1IFQ A;  2KDK A;  1S1Z A;  4FSF A;  2HF6 A;  1XFN A;  3CWF A;  2M7U A;  4HOI A;  4XT2 A;  3HCY A;  4NKP A;  4PHT A;  2Z6C A;  4L9E A;  4MN7 A;  3LR4 A;  2EWW A;  2K2N A;  4R6L A;  3H82 B;  5TJJ A;  5HD3 A;  1TD5 A;  3S7P A;  4PKY A;  1DP9 A;  3BQ8 A;  4WN5 A;  3KSH A;  2B02 A;  3JVU A;  4MN6 A;  5C5K A;  4ETZ A;  4WL9 A;  5DJT A;  3OLO A;  3R4K A;  4UQI S;  1YAX A;  4JGQ A;  3UB9 A;  4I5S A;  3KX0 X;  4L0L A;  4LRX C;  5F6A A;  1P97 A;  2W3H A;  3PYP A;  4CLC C;  1TS0 A;  2XSS A;  4CLC D;  2JN7 A;  4I38 A;  2GZA A;  2VGL M;  3UMD A;  3E98 A;  2EWV A;  3MR0 A;  4NXG A;  2HJ9 C;  3LI8 A;  5DFX A;  3NOT C;  4I3J A;  4IJG A;  2JHE A;  3RTY A;  2JKT I;  4MCW A;  4ZRR A;  2B18 A;  5HWV A;  1P9W A;  1XJ6 A;  2BAS A;  1S66 L;  4E04 A;  1Y28 A;  2KOI A;  5F69 A;  3O5Y A;  1OTA A;  3C2W A;  1OTE A;  1VHM A;  4HJ6 A;  3P7N A;  1OPX A;  3LIF A;  3K2N A;  4BWI A;  2XA7 M;  4B9O A;  4UQI M;  3KO6 A;  4K08 A;  4BBU A;  4II7 A;  4B93 A;  3B47 A;  3FPV A;  3UE3 A;  2GJ3 A;  2M1C A;  1N9O A;  2JKR M;  2K7S A;  2GX5 A;  5HL6 A;  3PHY A;  4NXE A;  3MFX A;  3F1P A;  3F1O A;  2J3T C;  2ZOH A;  3IBR A;  1LSX A;  2V1B A;  3LIA A;  2OAP 1;  1KOU A;  1XFQ A;  1EW0 A;  2YKH A;  1T1A A;  5LBR A;  3LR5 A;  3T4K A;  3B33 A;  4DJ2 A;  3BJN A;  2VLG A;  4EES A;  1OJ5 A;  4KQO A;  2QHK A;  4DMZ A;  3KSI A;  3UB8 A;  1S4R A;  5TBM B;  2R78 A;  3IS2 B;  4OOM A;  3W2Z A;  3ZQ5 A;  1JNU A;  4Z1W A;  4CQH A;  5G4Y A;  1MZU A;  4Q0I A;  2V0W A;  1UGU A;  1STZ A;  3VE4 A;  3MMH A;  1X0O A;  4HHD A;  5AJG A;  4WEL A;  3ZYT A;  3E0Y A;  3U2A A;  4WEJ A;  2QJ7 A;  5DFY A;  4GHI B;  2P08 A;  2D01 A;  3EQV A;  4BBV A;  2O9C A;  3S7Q A;  4LRZ E;  5KSH A;  4OOL A;  3LIC A;  3LIB A;  3FG8 A;  5J7E A;  2GNX A;  2PR5 A;  4HY8 A;  3F1N A;  3F1P B;  4MMN A;  2FZ0 A;  1N9N A;  1UWP X;  2VV6 A;  3LYX A;  3MQQ A;  2V9A A;  2O9B A;  3EEA A;  4WF0 A;  1T19 A;  4EEU A;  3PXP A;  2PYR A;  4EXO A;  3C30 A;  2O99 A;  4ARZ B;  3PR6 A;  3T4Q A;  3FC7 A;  5IT5 A;  3C8C A;  2A2L A;  4PKY G;  3IS2 A;  5J4E A;  3NOP C;  1TS7 A;  3OBF A;  2HGV A;  3LIE A;  4Y5F A;  1H8M A;  2QWS A;  2QYB A;  3BW6 A;  5F5Y A;  4WUJ A;  5HDS A;  2NUP C;  1G6O A;  2XA7 S;  3KSG A;  1BYW A;  1MKM A;  2VZW A;  4IHQ A;  2VJW A;  2OOL A;  1TS8 A;  3CLO A;  1T1B A;  2QKP A;  3MQO A;  4UEY A;  4HNB A;  4O01 A;  1WA9 A;  2NUT C;  2W3E A;  3PBR A;  4HH2 A;  2G7U A;  5IU1 A;  4I39 A;  3MF0 A;  4AFI A;  3T4O A;  3F1N B;  1GSX A;  2VEA A;  4HJ4 A;  1OTB A;  2J3T D;  3LI9 A;  2K31 A;  2DMW A;  2ZMF A;  4GW9 A;  2J80 A;  2XRN A;  4ARZ A;  1NWZ A;  3NOU C;  2VGL S;  4MDZ A;  4KQD A;  2KLI A;  2Z6D A;  4BMW A;  5MC7 A;  3EQU A;  2W1R A;  3LR3 A;  4LRY C;  2HJE A;  2W3F A;  1LT0 A;  3LUQ A;  4G3W A;  1T18 A;  3OCL A;  5CX7 A;  4WEK A;  5AVF A;  3P01 A;  4YNR A;  4HJ3 A;  4L9F A;  1IOU A;  3D3O A;  5HD5 A;  5IS1 A;  2V1A A;  1ODV A;  3UME A;  1LSW A;  3MJQ A;  2IA2 A;  4HIA A;  2P7J A;  1V9Y A;  3GDI A;  2Y8H A;  2MJ6 A;  2W1T A;  1XJ4 A;  4LPZ A;  4HP4 A;  3K3D A;  3D72 A;  4CLC E;  1GSV A;  2OWH A;  2D02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...