5ISZD

Crystal structure of ls01-tcr/m1-hla-a*02 complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
200
structure length
200
Chain Sequence
LNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCAFDTNAGKSTFGDGTTLTVKPNIQNPDPAVYQLRDSASSAKSVCLFTDFDSQTNVSQSKDDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Broad TCR repertoire and diverse structural solutions for recognition of an immunodominant CD8(+) T cell epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 34
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2016-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iszD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iszD02
1FFNB 2NW3B 3GSVA 3WIFA 1IBGH 3TBWB 3RVVD 2GY5A 1NC4B 4H25B 1GAFH 2R0ZH 2VAAB 2DI8A 2AK4A 3QQ9D 3TVMA 1CF8L 2FR4A 1RJLB 1M7IA 3IAPA 1A22B 1Z9OA 3CD4A 1Q9OA 1CDGA 5IGXL 2NY6D 4UV7L 4OI7A 3VDCA 3ZL4H 1AKJB 3WL9A 5GS0D 3QEGH 5A2LH 4DVRH 1Q9WB 1VENA 2Q76B 1BHGA 4BSWB 1I7ZA 1SQ2N 4KKAC 1WBXA 3FTGA 1RZJH 4Y89A 3HZMB 1NEUA 1EA9C 5DUPH 2HN7B 1YNTB 5JTWA 3O6KL 1EIBA 2EDRA 3DX7B 2FHFA 4L9LB 1O7SA 1J8HB 5DJCA 5E8NA 3S96B 1AY1H 3C5ZB 3D39E 4R6UA 3FT3A 4OGXH 2F15A 25C8H 1CGXA 5E1AA 3MYZA 4KKCC 1OW0C 1GOFA 3STBA 1NCCL 5FIEA 5FO9A 3GB7A 3OGOE 4R7NA 3ARYA 4YNYA 3HNSL 5KW9H 1L7TH 3CNKA 2YUXA 5FYJE 3HR5A 2PYEB 3RI5K 1YEGL 4OM1L 2FIKA 3ZYOA 4YDKH 3LKNA 1OCWL 2GKIA 1AE6H 1CI5A 3NA4A 4FG6C 2VDKH 2BSTA 3QEHB 1KPVA 4MWFA 4EXKA 1BIHA 1G6VK 2MFNA 4ONFL 1DVFD 5FHAH 3Q3GB 4XVSH 5HYJE 2GUOB 1TZHB 3OG4B 4L3CA 4XTRD 2PXYB 2XKSA 5KSBA 4KMLB 1YPZF 1CQKA 2X4PB 3H0TA 3HKFA 3C6LD 2AXHA 2G60H 5EOCJ 1XZ0B 2YZ8A 12E8L 1S7QB 5F8RC 4CMMA 5K9QG 5DR5H 5E4EC 1S7RA 1UH2A 2E7LA 5DRXA 1S5HA 2QEJA 1EHAA 1FFPA 5KSVB 1R0AL 4X9BA 3OJMB 3OKEA 5EU4A 3W2DH 3B2UC 2A9NH 1N6QH 5FF6B 3FQRA 2EYTB 1RZKH 3WYRA 3V95A 3MRCA 3QUZA 4QRQB 2CLVB 4OFPA 3BGAA 5CKGA 3N85H 4G5ZL 1H0DA 2P7TA 1QUNA 4F9LC 1MLBA 4PRPA 3TNNA 2QSTA 4WGVB 2A6DA 3MBEA 1MIMH 1J0ZA 4I77L 4PJHE 1PX4A 1QLFA 3RZCA 4P4KC 2Z93A 4OB5L 2XZZA 3H3BC 1GZQB 1CXLA 1WCQA 3QUXB 5FUOH 2XWBB 4ZAKA 3V7AG 4XBPA 1F3JA 4KRPB 2O5YH 4HAGA 1K4DB 3ELAT 2D7TL 4C4KO 3O41B 5ADPH 4BA8A 4UV7H 3CC5A 3GHBL 1T7YA 3B43A 1FL6B 1BJ1H 2ADJA 1YY9D 4JFHD 4S2SB 5HGAB 4Q74A 1N4XL 1A8JH 1LVEA 1TDQA 5C92A 5BRZA 1WTGT 4Z7OF 1FPTL 3VFMA 2FB4L 3WFZA 2D03L 1LO5A 5I1KL 2E9IA 1QKZH 4OZFB 4HBCH 1MQKH 3N9GL 1BOGA 1U36A 2WBJD 4GKZA 4V1DD 5J8OA 4L4TB 1S7VA 4W68A 3DYOA 3L3KA 4LGPB 4D9RE 4WCYL 1RUKL 4YHIB 4NFDA 3T1FA 3W39A 3HS0B 5JPMA 1UWEL 2GJ6A 1C5DA 3P30H 2C3WA 2XWTA 1OF2A 4QCIB 4UT7L 1URLA 5I16B 2HFTA 5EN2A 3QWRA 3TCXA 1HIMH 4Z8FH 5JOEA 4NDMB 2CLZB 3W11D 1I1AA 4UTAL 5GZND 1MFDH 3LEVH 2IADA 4PV9B 4PJDB 3HFML 4DKFH 5EO0B 4OZIB 3L3OA 4HWBL 4DKDC 4PJ5B 4LLDB 4KHXL 3FT4A 1NQBA 3IXAB 3KPOB 5DMJB 3EFFA 3IDMB 3OGCA 3SPVA 3EJZC 4G9FD 5EWIL 2BK8A 4JDTH 4DZBA 3VWKA 2MHAA 1E28B 3GI8H 1I9EA 3KDMB 4JFXB 1DANU 4OCRL 1CFTA 4KTYA 2R4SH 4U6XB 1QNZL 3GMRB 1AGEB 4ZG1A 2BCKB 3TN0B 3CPLB 4KZDL 4R4FH 4FQXA 4PG2A 3MRMA 5KS9F 4MXWL 3C5ZA 5IESH 4D2NA 3ORJA 5E6IA 1UXSB 3O2DL 5EZIH 1IQWL 1U8HB 5D1ZD 2FATL 1PKQA 3MA7B 1NSNH 4C58B 3LKQB 3Q1SL 1T4KB 2JF1A 3N85L 1YYMH 2H2SC 5TDPA 3BQUB 3P4NA 4WWKA 3WXVH 5IBUB 1A21A 4U1LA 4OFDA 1JUFA 2CDEA 3FO9B 4F7PB 5IB4B 4Y2OA 3OTTA 3HS0A 1BQHA 5DHVB 3L6FB 3G6JF 3CAFA 1G1YA 3PHOB 1TJHL 2IWGA 2R0WH 1D5BB 3KG5A 2AJUL 3UTOA 3ARVA 1BWWA 5FUZH 5LQBL 3IVKB 3BYYA 4GUPA 3VFPB 3PL6B 3LKRB 2HFEB 4K2UL 5IG7A 4MA3B 2EDQA 2UUDH 4MD4B 2OS7A 2VC2L 3QIUA 1S7XA 3C2AH 1G6RH 5JHLH 5L2JB 2IC2A 5BRZB 3P9WB 2P5EA 5IB1B 5IVXF 3B9KA 3JXAA 4QO1A 3SKMA 1KC5H 2D03H 4AL8L 4BELD 5F1OB 4MJ4A 3X3FH 1CFTB 2BNUA 3FL7A 4F7CA 5DXWA 4HBCL 3STLA 3VXMD 1NLBH 4UQ3A 4KJYA 1UT9A 3U6RA 1NMCC 1FVEB 2APVA 1ERNA 4FQHB 3PDOA 4W81A 4ZODA 4GLRI 3I9GH 1XGQB 4R90H 1R3LB 1KJVA 4Z76B 4LLQB 3WFBL 4FFWD 5I1IH 1LK3H 3SOBL 2C26A 3P30L 1NAKH 3U30B 4YC2B 2NXYB 4M7JL 2XWTB 4QCIA 3TESA 1HOCA 4LPXA 5KANG 5CIPB 1PYWA 3KS0H 4DN4L 1MJ7H 1UQSA 2UYLA 3QEGL 4HWBH 2FEDC 1SMAA 2G5RA 4OZHB 5CJXC 3QZWB 1EZVX 4TTDC 2DJSA 5CMAA 3T8XA 2EH8L 3W11C 2V17L 1CG9B 3MJ7A 1IEAA 4Y7MA 2LU3A 5JW5A 3FQNB 4GRMA 4EIGB 3U4BH 1T7VA 3OKLA 1AY1L 2W0PA 3I6LD 1MI5A 3O8XB 4IMLB 4OGXL 1FZMB 5FCSH 5D7SH 1TPXB 2DQHH 4R3SB 4J7RA 3HMWL 2IQ9L 1QNZH 1I1AC 2VABB 4MA3A 3V0WH 4YK4C 4R4FL 3P4OB 3SDCD 3WFDH 3E3QE 3O0RH 3JV6A 3MZTA 4KKNA 1L4IA 3WUWG 3MR9B 3QWOB 4XHJC 2M26A 3AU1A 1DBBL 1FVDA 1IGYA 1QYGL 3KJ6H 1N64H 4PFEA 1FYTE 5DJ6A 1FC2D 1CLCA 4JANB 1MCLA 4Q6IA 1IAIM 2CUHA 4QTIL 3MJ8A 3QCVH 1MY7A 2P46B 3C08H 4A6YL 5HPMA 3D85D 1U3YA 4IBLT 5D1XC 3NH7L 4DAGL 3M45A 4FQXC 5KOMC 3MJ6A 5T3XD 1QQDA 1AD0B 4W70A 5CSZA 1TTFA 1UCBH 1AGBA 2HFGL 4NN5C 3TBYA 3WXWL 3X14B 1TQCB 3H6JA 3PWJA 2VQ1A 1E4JA 3H9SE 4PJ5D 1UQSB 4HH8A 1KCKA 1J8HA 3CDYA 4G6MH 4MCYB 5DJCB 3S96A 3EOAB 4G8EA 3MYJB 3LY6A 3FAXA 2WBJC 2VLMD 1BVLB 3RPIB 15C8L 5ICYA 1JF1A 4I0PA 5L8JB 3BRFA 4PY7A 1FN4A 1OB1A 1YECH 4L8BB 2EYRB 5J9PB 3GMPA 2FWOA 1NAMB 4JQXA 1ETZB 3WSQL 4F3FB 3QXAA 3C8DA 1SJVA 3WNPA 1IARB 2B0SH 3VGAB 1KULA 2VLKB 5GGSY 2BSSA 3CSBA 2EE9A 2GW5A 4UMGA 1N3NB 3WFBH 4WEMB 4P23B 3WKNA 3FZUC 2P24A 4HH9B 4NQDE 4Q6IB 2YZ1A 1CGYA 2K7QA 2OR7A 1IFHH 4CVWA 4PJHF 1FYTA 1FHGA 4YBLB 4XCNB 5IHLB 3K74B 5C0DB 1G0XA 2KPNA 1N4XH 4BKLA 3AB0C 1CGVA 3GB7B 3HG1E 2DS4A 4JZNA 5F93C 1I1YB 1KYOJ 3LKSA 4HFUH 1EEYA 5CJ5A 1BOYA 1JNHB 2JB6B 2X7LB 4QHKI 4XVTL 4GO6B 2BY2A 4JG1H 2BY0A 3UJIH 4GRMB 3QUKA 4OCWH 4PP2A 2W60B 2BXYA 2HFFB 2UY7A 3CH8A 4U2ZA 2Q8AH 1YNTA 4ZUVB 1RZGB 4NNXB 3WJLA 4ZUTA 4Y4KB 3EDKA 3VFSA 4PJFE 4YX2L 4LDLB 1OSZB 3S88H 3ARFA 2BFVL 4RWYL 5HVWA 2VDRL 2LU7A 1S9WA 2PTTB 3C60B 2UYLB 1MF2H 2C4XA 4JAMA 1CDJA 2VLME 3F7YA 4PJAB 5JOFB 4I13B 3CFBA 1M7DA 1INQB 1RD6A 4HC1H 2W0FB 3TYFA 1ZANH 5GGSB 4GRWE 1FC1A 3G04B 3HC4L 2PTUA 3C08L 4MGXA 1WBYA 2H3NA 5CKAA 4HUMB 4MXQD 3U79A 3O45A 1GHFH 5HDBE 5MERB 4TOYL 4OKVB 4QEGA 5GHWL 2R69L 2FL5B 3IDXL 4JDTL 5E2WL 4MLSA 1K5NB 1VGKA 4YPJA 3O81A 4Z7QF 2FBOJ 3MNWB 4F9LA 1RU9L 2R2HA 2R8SL 4XP6H 1SMOA 1OQXA 1UACH 1MWAB 5CZVH 3QXWA 5HHVL 5IVXB 4OF0A 4LARH 1WISA 1U92B 4KGLA 4U7MA 4YFEA 3GDBA 4LKXB 2Y25A 4HUWB 3FONB 3R0NA 2ZWLT 4J2XA 4V1DB 4OM0H 4LDOB 1AQKH 2AVGA 4APQC 4Z7WB 3V6FB 2R1XA 1YEIL 2DN7A 3EYVB 1IC4L 3BDYH 4XAKD 3HTLX 3U2SB 1IM9B 3CFCH 3SGKA 3QYCA 2AGJH 4WV1C 1HNGA 2YEZA 3IXTB 3KWWB 5EC2A 3EO0B 1KGCE 4AH2A 3RL2B 1RUAL 4HZLA 3MRFA 4P3DA 2WBJA 4PRBA 1MCIA 1FZKA 2FX7L 4QOKB 1DN0A 3UPCA 2YC1A 1MREL 4U1NB 4M00A 5ACLA 1CQYA 4HIJB 4M1GL 6CGTA 2Q7YB 2DTML 3QCUL 4O2FA 3HAEH 2F54D 2RBLA 2ESVE 2QHRL 5DD1H 5EU7E 4PJEB 1SEBB 3MQIA 1U8QB 3NAAL 4X6CB 2NY1C 2DJUA 5KVDL 2IMMA 4FFYH 3LSOA 3IFNL 3MRIB 1DUYB 1J11A 3RY6A 1HHKA 5F7HA 1MWAL 3THMH 1GGBH 2DAVA 4FZEH 3U0WH 1P7HL 1N5AB 4GW5A 2CRYA 4XWOC 2J8UF 4WO4D 5AYUH 3VFNB 4IEFB 5GGTA 4YXLH 5B3JE 4ZOCA 4FABL 2DQGH 1FORL 2BC4A 2NPLX 4JFFE 5INCA 1YEJH 3MODL 2EIZB 1R5WB 3WN5B 1XMWA 3HE7B 4M5YH 5ESVA 1N0LA 1K9TA 4XNQA 2BSRA 4PYGA 3F5WA 2VDRH 4Z7UA 2AEQL 4QHUB 4NO0A 5D2NA 1RUPL 3TO2A 3U0TB 4U6VH 4I2XB 1IGFL 1KCVH 3TA3D 1IGTB 4LNRA 3GSVB 4O5LL 2X4QA 1BQUA 3BHBA 4WDIA 4UNTA 1T2QH 1YEHL 4GBXC 4NC1C 2W1NA 4DN4H 1AXTH 5ID0B 3B2VH 4YE4H 3WEXB 2EYSB 4S1DC 1RFDH 1MJ8H 4HWUA 3E8UL 1ITBB 3VI4F 4CMMB 1TLKA 3GSNA 1NDMA 1W72A 1KLUA 2BVPB 1RURL 1K8IA 1OGTB 1RIHH 3VFVA 2HKHL 5F7EL 3MJ9A 1YY8A 1NGWA 4G42B 1ZE3C 3P9MB 3EGSA 1IM3A 5K9JL 2FX9L 1HSAA 5KJRH 1QTYT 2AEPL 4NIKB 3VI3E 4PJ7F 4XWGH 2NXYC 3GSRB 3KJ6L 3INUL 3OKDB 4OM1H 4JKWA 2CGRL 5INCB 2HYMA 1WZ1L 3VWJC 4CVZB 5CWSA 3MZGB 1ZT1A 1A7PL 4G7VH 2DQDL 1J12A 3ESVF 1ZHBA 3QDMA 1F6FB 1E6JL 5E2UL 1H3PL 4A6YH 3BPOB 4TPRH 4XVSL 3PWLA 4TUJB 1WC7B 1F13A 5E95B 4QHNA 2FHCA 3DETD 5LCVL 1NAML 4PUBH 4TSCL 1MAJA 5EIIB 3BVNA 1WSST 3PWLB 3ZT6A 2A74B 4UDTB 3QDGD 4G43A 2VE6B 4MNQE 3B6SB 3RBSA 2NCMA 1CT8B 4PRPE 2QHRH 4BQ8A 2WV3A 3QXDA 1NUGA 3IJYB 1YUHA 4FFYL 2YPVH 3KR3H 4O2CA 2GITA 2NW2A 4OF8A 4X9GA 3BZ4A 1JTTA 1OARH 4PIRF 2EDXA 4HS8H 3UTSE 5CCKL 4C56B 1TZIB 4WI6A 4XMKH 1XGTA 1KNOB 4YXLL 3BSZL 3RDTB 3HG1A 1K8IB 2I60H 3GEWB 2BVPA 5I75B 3RKPA 1A47A 5IOPB 3TBSB 4FQQA 5A1AA 3LN5A 2HVKB 1EO5A 3BQUD 3DO7A 4HUXA 2MTPA 3UTPD 4NJAH 3W0WB 1KPRB 2J3SA 3BEVB 1HDMB 4HH9A 2VZOA 4E42A 5BJTB 3IDJA 4J1UB 3KPRA 2FD6H 2A6JB 4OLYH 3AGVA 2XA8H 5C0FB 1YEHH 4MSWA 4X4ZA 1CZ8L 5KN5A 3GHBH 1AXTL 4J3OC 3WJJA 3Q5TA 3LPGA 4LLYA 4WTZA 1A7QL 4MNHA 4JZJA 4LCUB 4KK5C 4P3CL 2DD8L 5FYKU 1IQDA 3DROA 4XC3H 2N7AA 2QQLL 1OVZA 1FYHB 3ULVH 4L8CA 2VNCA 2CO6B 5I1KH 3UJIL 5EO9A 5CD3A 2WK2A 5DSCA 3O6FC 4D0DA 4PJIB 3BZ4B 3VGHA 4NHCL 2V2TB 3G5ZB 4YFLF 1TXKA 3GMMB 1YN7A 5HGBB 3PL6C 2HP4A 4RX4D 5DUMH 4JFDA 5D7JB 1RHHB 1HZHL 1S9WB 3C60A 5IJVB 4F57H 5JLZA 1RUKH 1FH5H 1FSKB 1U3HD 2BVQA 1KPUB 2NTSP 2QADD 3CUPA 4JFFB 2IH1A 4JZOB 4NWTL 4JFYA 2RCSL 2CGRH 2N1KA 2DQUL 4PRIB 5CSZB 5ELIA 5C0EB 2DLFH 1CL7I 4JQVA 4Z18A 3WIHA 5ALCH 1J1OH 4DTGL 2GI7A 1P4LA 2BNRD 1C16A 3WDIA 1KACB 2M2DA 3KLHD 3LEVL 1FZOB 3MGOB 4QOKE 1HCVA 3O2WH 4YZFF 5E70A 4RX4A 1A6UL 5TQ0L 4PB9H 3VDBA 4J1UA 4U1GC 5C09E 3BEVA 1IAOA 3OR6A 2XOTA 3FO0L 4G3YH 4R0LA 4X6DF 4XPGL 4NCC1 5I9QC 4XWOD 3QRGH 5C08E 2KZWA 1NEZG 4OD3H 1VESA 1TVBB 3HAEA 1ADQH 1JE6A 3EYQD 1AQDA 2ESVB 5E00B 2JCCE 3I3DA 1DBJL 4UZGA 5DJ2B 4MD0B 2W0LA 3U4EA 5F96H 1OGTA 5KVEL 4UUJA 4KRPC 3FFDB 3D2UD 4QNPF 4LRIA 1MPAH 5EBGA 3V7MA 3MLVH 4AEHH 4G9DA 3BFOA 2CRMA 2J6EH 4Y4HB 4OV5A 4N8VA 4KDVA 3ZDYE 1IC4H 3RGVD 2UVEA 4GS7C 5SWSA 2AI0L 4U0RC 4JVWA 3VD7A 1HK6A 1H3VA 5BW7C 5TH2B 1JF1B 4LVHB 2IG2L 4O02L 3HI5L 3AREB 1TVHA 4WTXA 5F7WC 5GZNC 3OJ2C 2JIXD 3N1MC 4FP8H 1KB5A 1UZ6F 4WDIB 4I4WB 3L5HA 2UWEA 3CFIC 2F54B 1F8TL 1AD9A 3IJHB 2MKLC 5E7BA 3ZDZE 2VZTA 1LO4H 1BD2D 4ODXA 4AENB 4LLQA 3FO2B 4PLKD 3O11A 4R0LC 4RGMC 1QRND 1RMFH 5I1JL 1NFDF 1XCQA 1E4WL 5IEHA 4UT9H 1I8MB 2B1AH 4JR9L 2VZVA 3U48A 4X6DB 3DURA 4ZFOA 4K9EH 2BSRB 4Q9CA 5I66B 3L9RB 4R2GB 3VXTA 3K0WA 5TF0A 3RY6C 1QFPA 3RZCD 1G6RL 3HE6A 1BBDH 5J1AA 4LASL 1MCNA 4L3EA 4BYHA 5DJDB 4P5TC 5E5RB 5HHPB 3HAEB 1A1MB 3MTRA 3LAFA 1HSAB 2Q87A 1JGEA 3RWDB 2DQGL 3PJSA 4I5BB 5DUML 3BJ91 5JUEH 1A1OB 4XP1L 1G6RB 3X3GL 3NIDE 4F57L 3MV9D 4ODWB 4PTTB 4OCXH 1KLUB 1F6AB 3TO4D 3MRPA 2AEQH 3QUMH 5FHBL 2NY2D 4XPHH 1RK1A 4HFWA 4U6VL 1JZ5A 1L0YA 4QHMB 1GZPB 4OFVA 1A1NA 2Q3ZA 3BH8A 2VLJD 3RKDC 5FO7A 2R1YA 5C9KA 4LIQL 1NAKL 3DI3B 2F53E 5DHYA 5CHNB 2WUCH 4JFEA 5JDSB 1FV1A 3QQ4A 4XX1E 4ZYKB 4FXKB 1C12A 3LZFH 5F70A 5ETUB 3SCMA 4PJBB 5B39A 3SDYH 1WAAF 1XGPA 5HHQA 3ZKMC 5EUKB 4DOHB 3U7WH 5HHNA 1LP9B 3ZE1E 1LO3L 1NUFA 1RHHA 3GHEL 3W5MA 2B2XH 2D7QA 4LQFL 3MLTB 4MQXD 4OFYA 1Q0YH 2V7HB 4CDGC 4M43H 4XPGH 1U8PA 3PHSA 3QPQC 5I2IA 2E27H 3MV11 1LE5B 1IGMH 1NFDA 2IALA 3L3HB 5I1LA 2YKLH 4L8CB 4FZ8L 1X5FA 2D4FA 1RULL 1MHCA 1XFPA 1KTDA 3ZHLA 3I6GB 4EQ3A 5J3HC 4JPKH 4P57A 3TT3H 3BZEB 5IHZA 1VERA 3NFSH 4BZ1L 5I1HH 3OR7B 1HHIB 1WZ1H 3REWA 1NMBL 1P53A 1TVDA 4OFYD 1BECA 3ECBB 4TVPL 4Q0XL 4EN3A 1QSFB 2BVUA 4QTIH 1KCSL 5DRWA 5BJTA 5FK9A 3RKDD 5H35B 4DN3H 5IB1A 4S11A 2BOBB 2PW1B 4O2FB 4ZFGH 2KZ1B 4X8XA 3RWEB 3OKOB 2X4NB 1HI6B 2WINB 4HULB 3ULVC 4PUBL 1I3RB 1P69B 4K7PX 5DJ2A 4NN6C 4KMTH 5HPMB 5KVGL 3TYFB 1D5ZB 4BQ9A 4NJ9L 2I9TB 4YWGH 1RMFL 3RL2A 3D5OF 5I1JH 3LKRA 3QG6A 4N5ED 5E8PA 1P5VA 1CL7H 4YHZH 2AJXH 2ZKHH 3BN9D 1FVCB 1NBYA 1EO8L 4IJ3C 5CBEB 3EJYC 4K8RC 3AY4A 3C09C 2YSSB 3PWNA 3FQWB 4ENEC 2J4WH 4O58H 4U6HA 1OGAE 5GJSL 1OLZA 15C8H 4PJIE 2H26B 2WLZA 1U8LA 3RVXC 2OCFD 2G5BA 5IVXA 5IM7B 4C54A 5HVHB 3N1PC 2HJLA 2RB8A 3AS0A 4LEOB 3GRWH 4NZUH 2YBRB 5ESQB 1QRKA 2P45B 2B0SL 3REWB 4UV4L 1A64A 4X80H 1T1WA 1BFOB 5BQ7B 2R0ZL 4M61B 4G6JH 1AI1H 3GGWB 5EOCL 4HJJH 5E94B 3MGTB 3UTQA 5JA9A 1X4XA 1U93A 3ULUD 1BBJB 1PAMA 1SJHB 3HB3D 4KV5F 1QBLH 1BVKB 5B4MC 2ZJSH 3OKOA 2VDOL 4QOKD 4L4VD 1OLLA 4O2EB 3A0OA 4R8WH 2PW1A 1A7BA 4P2CG 3CXDL 5DRWB 3C5SB 2R23A 3ILQC 3L7EA 5DWUL 3T3MF 4X6DA 3ILQD 1Q0YL 1RK0A 3D1MC 3S3PA 3RUGB 1YC8A 2D31A 4HKJA 3EJYD 3FFCB 4K8RD 3AMKA 5F8QC 3T0EE 5FA4A 4BJLA 3LN9A 4R97C 3OL2A 3KPTA 4H8WL 1B88A 3CH1A 4D0BA 1K3ZA 2CJUH 3GSNB 3MMEB 2VIRB 2N4IA 3WE6A 5CHNA 1KEGL 1WCBB 1T1XA 4IJ3B 4Z95H 1ADQA 4GH7B 4P9HH 3H2WA 4WEBL 1CN4A 2H26A 2HVKA 4KK9C 4OD1L 2DIBA 1MNUH 4PRIE 3WFHB 5DMIL 2XFXA 1AE6L 4Y16B 1P4BL 1EPFA 1AJ7H 3U0PA 5CEZE 4D3CL 5LGHL 4YR6B 4ODWA 2NNAA 1FAIH 5H94A 4PJAE 3NZ8A 5F1NB 1J1OL 4YHOL 2XV6B 4EUPG 2NY0D 2VR9A 4G6AC 4O51A 2J8UB 2P44B 4OLZH 5KVMC 3S34L 5C2UB 4MX7A 4QYOB 5ERWA 5HDLA 4QHUA 3SCMB 1XIWB 1FNGA 3UJTH 4YHML 4JFEB 2R1WB 1U8JB 3P9LA 1QRNE 1IC7H 2QJDA 1JPST 4G3YL 5IB5B 3JUYA 1GVIA 1U41A 1A9EA 3ZLQC 5DFWH 4YGVB 1NCAL 3HRPA 4OZGA 2AJXL 3QQ9C 2FJHB 1N8ZA 4XP6L 5T1MA 1EO8H 2XACC 4MA7L 1YEKL 4P9HC 1WZKA 5C9JB 5C0BA 2C1OA 3KPQA 4X0KA 4WUUE 1I9RH 1CR9L 4H1LH 3MREA 4LPCA 1I8IA 2BNRE 4X4YB 2Y36H 5LGKA 2NX5D 1OTUC 3T4AB 1KUMA 4ZSOB 5GJSH 1JMZA 5GGVH 4EN3D 3NCBB 1VFUA 1D6VH 2NY2C 4LSPH 3TNNB 5C0ND 1D5XB 1RJCA 4I48B 3HC3H 3V52H 3V4VH 3ZSTA 4BSWA 1AO7E 2HTLD 5J0BA 4S10A 3KYNB 5CP3A 2IBZY 3QHFL 2RFXB 1ZVSA 2J5LC 2NR6D 5T3ZD 3CVHA 4LP4A 5HHXL 4PJCB 1RUAH 5ICZB 2WIIA 1T5XB 4ODUA 1OAKH 2D0GA 2PR4L 4JG0H 1XCQB 4K23L 2VITA 2Q8BH 5FXCH 3MNVB 1BQLL 3PQYB 3GJEB 4KQ3L 1VFAA 4O51B 1ZT7B 4LHUG 1QOKA 4LU5H 2NYYC 3MGTA 1PW3A 4K9EL 4FG6D 3PGFH 3KPSE 2MSPA 1V3MA 2IPTH 4JQXC 4PJGA 1KJMA 3QPQD 2DIJA 3MV7B 1NGZB 1AFVH 3MRBB 3HR6A 2X4OA 4ZQKB 4HD9A 2LFGA 1WVZA 2ZSVA 3DO3A 3ALPA 2R1YB 2OQJB 4PRHA 4GBXD 1H3XA 5EO1A 3KYMB 3NFNB 3CGTA 1A7OH 5HI3D 3ZKXB 1YN6A 5LKNA 4EOWL 2W9EL 2HWZL 2YD9A 4RNRA 4POZC 5DHVH 4XNXH 4XP1H 3OKLB 3D69A 4IMLA 1YYLL 1JGDB 3HR5B 1GPOH 3MV8A 2EICA 5HDBF 2DWDB 1AGDB 4OD1H 1U95B 3BAEL 3JWDC 3FKUS 2PUQT 3MUGA 4M7ZC 1RUPH 3MV8E 1T21A 3EFDL 3U1SL 2J7LA 2IALB 1XGTB 2UUDK 4I3GA 5TFSL 2VL4A 2AS5M 3VFRA 4F2MB 1BQHB 1T83C 2R39A 3LZFL 4ZXBC 4UTAH 2RFXA 4LCYB 3ULSB 3DURB 1R5VA 3EOYG 5EFIA 4TVSa 4U0RB 5SWZD 1G7PB 1BQSA 3PDDA 4P2RE 5FYJL 3BJLA 1KEMH 3WS3B 1FGVH 1QLFB 3RZCB 2FGZA 4JPIB 5ENWA 2YUZA 3CSGA 4WUKH 1QFWI 3MXWL 4XNZC 1P4IH 2BJMH 1JHLH 5DJZB 5E8OA 5KN5B 2HKHH 2XKNA 2MQ3A 2BCKA 4RISH 2XY2A 4RMUA 4CDHA 5SWSB 2OZ4H 3BP7A 2EYTA 2W07A 3B4NA 1UJ3B 5EOQL 1IQWH 4EI6B 5HTSA 1DR9A 3MBXL 1DE4A 1D6VL 3RHWF 3FT2B 2DQFB 5CFHA 3HC3L 5HSFA 4YFDB 1BAFL 1XF3B 3QJFB 2NY4D 4R2GC 3WXVL 4P2RA 1TJIL 3B9KC 1AO7A 1KN2H 2C3XA 2WP3O 4P23A 5AD0B 5I8CA 4GMSL 4GQPH 1D5IH 2R29L 3BZFB 5D1QC 5FOBA 5HHNB 2M8XA 2O5XL 5ANMB 5HYFA 3RX5A 2G75B 4L3CB 5C0CA 1TZHA 1OAKL 4OAWB 5B39B 3ZDXE 2P5WE 2Q8BL 2AV1B 5DLMH 1T7WA 2Z8WC 3NPSC 35C8H 4ALAH 1B2WL 4EI5D 2VDPL 2W91A 3IJSB 3S37X 2PNDA 1NDGA 4IDJH 2P5WD 1JYVA 4W6XB 3DV4B 1LO2H 2ZOLB 5FKPB 1ND0A 4D9QD 3BW9B 3MNZA 4Y4HC 4P99A 1AP2B 5IFHL 3ABZA 2FJFB 3FCTA 3UEZA 3GMQA 3VXNB 5FO9B 5D2LF 3G5YA 4XBEL 4Q58C 3TWCH 4DKEH 1MCHA 1Z3GL 4GKSB 2IQAB 3BSZH 3QULB 1QBMH 5AEAA 4OSUL 5GGSA 4EKXA 2VLLB 2PW2B 3RX7A 1D3CA 3EDJA 2HT4C 3FFDA 4MA8H 4POUB 2DYPD 1NCDH 3LDBB 4JFXA 4WO4B 5C1MB 2VDNL 4NKOA 1JZ4A 2RR3A 4MNGA 4Y4KA 4N9GA 3J7HA 5GZOD 2XWBA 3DXAD 4RGNE 5T5NF 3HI6L 3EGSB 1JNNH 3QNXA 4Y5VC 4YHNB 1KIUA 3VCLA 4RFEB 2W65A 1SHMA 2ITCB 4RMSA 5GGUA 4KI5C 2GHWB 4UQ2A 1FFQA 1MJ7L 4QLRA 4JHZA 4OZHF 1RZ8A 3NACL 4XNYL 4P2OC 2DD8H 4XC3L 3WHE1 2X1XR 1A7NL 3W39B 2VLRE 4IOIA 2G5BB 1KJ2H 4K7FB 3OXSA 5D6CB 4GMTL 4S1RH 1CDYA 3R0MA 4U1JA 2DQEH 4H8WH 4HKXB 1T83A 4JKPL 3UDWA 1IM3B 4G8GA 4Z7WF 4WUUA 3DX9B 2OZ4L 2R56H 3QZWG 3KYOA 3CFKB 3TC9A 32C2A 2DLIA 3QUXD 3I6KA 1JGLH 3JTSA 2WLYA 4KTDL 1EHNA 2NY0B 5LGHH 1VKXB 3IDGB 2DI7A 2GITB 1CWVA 4GKOA 1UENA 3ZYIA 1I3RA 5C6WH 5E9DE 3QULA 2EYSA 1JWUB 2WAHA 4JN2A 4AG4L 3GK8H 1BVKA 5GZOC 2KDGA 2C9AA 2ICEB 2DLGA 2OSLA 4QRUB 3NH7H 1PG7H 2EE3A 1J5OL 4WWKD 1OGAA 5TE4H 2CD0A 2A74A 5I73B 1FDLH 3CK0L 4KK5D 3QDJA 2X42A 4LVOB 3U9PL 5D93C 2IAMA 3MCKA 2VDPH 2ITCA 3BKJL 3VCLB 2UZIH 1KBGL 4KHTL 5ILTL 2IFFH 3B8SA 4MA7H 1EAPA 2O5ZH 4JJ5B 2VAJA 1GGCL 1IZKA 5C0IB 1I9RL 1MJUH 2EIEA 3PIQB 5D93B 5KVEH 1DTUA 4HLZH 4LVOC 5ADOH 4KROC 2NY3D 4MA1C 3OKMA 5E00A 1F4HA 1U8PB 1UKTA 5I73C 3P11H 3CFEB 5INDB 4ZAKD 1UM5H 5MEQA 2R9HD 3EDDA 3K8LA 4GKSA 3QDHA 3JTTA 2AI0H 1X5KA 4MDIB 5I1DB 1YJDH 3NZ8B 4O02H 2O26U 4G8GB 3QBTB 4RGOH 2OK0H 2HTKD 1JWSB 5C07D 3S37H 2LQRA 1RJLA 4Z78A 4KQ3H 1GXEA 1KIRB 1WF5A 4ZPVA 1GZPA 3QXDB 1SYSA 4OZFH 5C0FA 1A2YB 4PR5A 3TBWA 2BOBA 3T2NH 4X5WB 4D9LH 3B6SA 4JR9H 5H35A 4JO3H 3V8CA 1QFUH 5C0DA 4JFYB 3WN5C 4F58H 1CFNB 3OB0H 5DRZA 1KTLA 3T65B 2GFBB 5E8PB 1UZ8B 1KJ2L 4XI5D 5CJ8A 3DMMA 4M62L 5JXAH 5DD6A 4JRXB 1OTTD 3LEYL 3MRQB 2DYPA 4DW2L 4OLEA 4PJIA 3IETB 4MNGB 5MP6L 5T1DH 2D7PA 3SKUD 3VWKB 2HWZH 5L7XH 1F4WH 2ZUQB 1UH3A 1MHEA 1YYLH 2J2ZA 4Y5VB 1GPOL 5EIQA 3VXUE 3D9AH 1WFOA 5EDXA 3V6OA 1DVFA 3QUML 5FHBH 3P9MA 1BJMA 4G6KH 5EULV 1QHPA 3H9HA 4Q6YA 3WIHL 4ZMAT 5CGTA 1WFUA 4RZCB 2A0LD 1CK0H 3AUVA 3GSXB 5ESQA 1H8OA 1NL0H 2F53B 4LHUD 3O6LH 1PBYA 1DEEB 1G7PA 2IAND 1CLYL 3D18A 4LBEB 3G04A 1NDGB 1KIRA 4ZPVB 4TOYH 2UVFA 2YC1B 4HJ0C 4TUJA 3QIUB 1H5BC 2X4OB 4ZQKA 3X14A 1U8OA 5C0CD 3GSWB 4WUKL 3W9EB 2UZIL 1JHLL 3JTSB 1KBGH 4G8IB 1EEZA 3TCLB 5HGDB 2NXZD 2Z31D 3HG1B 3IVKA 4OD2B 3DX6A 4MD0A 4EI5B 4L4TE 3R06B 1TJGL 5EU5B 1UVQA 3T2QA 1OAUH 2R0LL 2ZUWA 3NFSL 1JGDA 4R7DB 1FZJA 5FYJD 3HMXA 1AQKL 4DWHA 1WFTA 5D1QB 3VXUD 1EBPA 1TJIH 4YO0B 4AYFA 2AJZA 3KNBB 1B9ZA 1ZHLB 2X5PA 3D48R 1C16B 3H9SD 4PJ5E 2JCCB 1P4LB 4ZFGL 4GRWB 4JFPB 5MEPB 1MHHB 1L7IH 3RWDA 4ZXBD 2DQIH 4K55A 4LRIC 4QGYA 2E6QA 4MB5A 1MRDH 2F53A 1BEYL 1I4FA 1OD9A 1CXFA 2KH2B 3BI9X 2RQ8A 3NABL 1BM3H 4P5MB 3L5XL 1HSBB 3H9HB 3X11B 4JO3L 3LQZB 1INDL 3IS1X 1EVTC 3JWNC 1I7RB 3PQYA 3CLEL 5DD3L 3PWJB 3SKOA 3GMLB 1FBIH 5HGBA 3FT4B 3KPOA 3C5SA 3MCLL 4LEXH 4Y4HA 3MLZH 5CGMA 4Y5XA 3OF6D 3U0WL 1FN4B 3L3DA 1J1XL 4O58L 2YS4A 2IQAA 1ZT4A 2F8OA 4HMEA 5DTFB 2NY1D 3MLRL 4MQSB 1RZJC 3T0EB 5ICYB 4LDEB 4WI3A 3LQAH 2GSIA 2DWDA 4TSBL 1OTSD 2DYPB 1WTLA 2AABL 4Z9KB 2JJSC 2AJ3A 2VSDA 4GXUN 1EHLL 4UIKL 3T4AA 3PABA 1B0GA 1YN6B 3HPLA 3STLB 4QRPA 3IU4H 1CFNA 4F7CB 2Z8RA 1DBKH 4GKZB 2ATPA 1F2XK 4M7KH 1RZ7L 1JVKA 3DHJA 2AJZB 2BNRB 1AR2A 3NGBC 4D8PB 1AD0A 3OB0K 4PGZA 3ULVF 2Y7QB 5EBWA 4EDWL 2ZSWB 1NL0L 1S9YA 1DQLH 3U82B 5IJKC 3LRHA 2JIXB 3S36L 3E6HB 4U1SA 3GM0A 3CXDH 3JWDH 5EU7C 2AJVL 4MAUL 2V2XB 4X4MA 4PJBF 4YUEL 4AIZB 4N0RA 1EJ6A 4XZUB 5E1AB 3QDJD 5JMOC 1ES0B 4YDLB 5CEZH 5KBNC 3DV6B 3EYSH 3DSFL 1ZXQA 4TTDD 4EI6A 5SV4A 5E6ID 2FX8L 2C4FU 4ZAKC 5EBLB 1FGNH 5IVNA 2J8UE 4N8VG 4L8BA 5D72L 3KPRE 3T4YA 4L9DA 1DEEA 3TV3L 4KTDH 5C08A 4X6CA 1BX2B 3B9DA 5F44A 1P4BH 3S3SA 2J5LB 4GRLC 1FAIL 4PJCE 2YK1H 3D69B 4KU1A 1DSFH 2P47B 4NKIH 4RNRB 1W72L 4UU9B 4FQJL 4N0YH 4TPRL 3DUUA 3SY0A 1XF2A 4OIIH 3K8MA 3MRKA 2FL5A 1ED3A 5K9OA 2XY1A 4CNIA 3UTZA 4QOKA 5FF6A 3QDMB 4NQSA 3UJTL 2NY2B 3QPXH 2HTLC 3F7VA 3QISA 5J6GA 1UYWL 3K7UA 4NZRH 1H5BB 3VFGL 4AMKH 3OKNA 4K07A 4ZS7L 4HGMA 4BFGA 1BD2E 3U36A 1Q1JL 2IANE 1WUNT 1R3IL 2YWYA 4W4NA 1JCKA 4N90D 3PL6A 4NQCE 1FIEA 5E9DD 3QDGB 3WD5H 2RJMA 3FHQA 1G9EA 1AR1D 4NO5B 5DJ0A 1F3DH 3KYOB 5E6IC 5K93A 3QP3A 4ZUTB 3DX9A 1YMMB 4AIOA 4U1HB 5KSBF 4M4PA 1OAQH 3K2MC 1ZOXA 4KK6D 2HT3D 3KYMA 1CDUA 2X4SA 2B5IC 3R8QA 3HLAA 2P5EB 3LS4H 3UO1L 1I3UA 3LQAL 2L0DA 4TSBH 5BS0E 3V52L 3ECBA 3LB6D 3KPLA 3G6DL 2F5AH 4M02A 5JXED 1QPPA 4JO2L 5BV7L 2DKSA 1KJ3L 4KUCD 3E3QC 2ZCHL 3VWKC 3ULUL 1IGJB 1JRHI 3QHTC 1YNLH 3PUCA 5IW6A 4NKDB 4QHKJ 3EIFA 3S37L 1P9MC 3V4UH 1IGTA 2IH1B 4LNRB 1LO5B 3DARA 1VFAB 1JGUL 1O7VA 2EEDA 3O9WB 5CBAA 3QCTL 4N0UB 3NTCH 4FQXB 4PJEF 1D5BA 1KN4L 2CRZA 2PO6C 3QG6B 2HJKA 4PJ9B 1BPVA 1QFUL 4KXZI 1MRCL 5F89B 3HE7A 1VEMA 1EMTH 5HGGS 5IVZB 2K1MA 5CZXD 1RVFH 4HX1B 5GS0C 3LQZA 5GSVB 3WIIH 3CZFB 4F33B 1ZLSH 3LS5H 4MCZA 3DROB 3LEYH 1UGNA 1WT5C 5KG9B 3F6LA 4NN6B 3QUZD 1NCUA 1V5JA 3MROB 1S9VA 5T1DL 1I1AB 4G7YL 3L5WB 5I15L 4PD4J 4QRSA 2GTZA 5CEYB 1AO7D 1I1YA 1J0IA 1V3LA 2NXZB 1RV6X 3HG1D 2B4CC 4MNQB 1FO0A 4U3CA 5K33A 1I3GH 3BW9A 3MRRA 5EA0H 4Y16A 4OZGB 4HCRA 3TT1H 1ZT1B 2EC9T 4YHIA 2MHAB 1QBBA 2FO4B 5IQ7H 5A3ID 2XA3A 3VW3L 5F88A 4LHUB 3MRCB 4ZDHA 3CX5K 1HKLH 5ID0A 4ISVA 4R4BA 3HLAB 5D5ME 3P73A 4DTGH 1NANI 1VEOA 5TE6H 1XIWA 3KJ4C 4PV9A 4Z0XA 3O2WL 2D3VA 1VPOL 5TQ0H 1FVCA 3RUGA 3GFUA 4LSTH 3BKML 3BQUC 3OAYH 5BZDA 1KEML 5FYLL 3EZJB 1FV1B 4AT6B 1MAML 4ZTOH 1NGXB 4ZFOB 2DTSA 1AH1A 1ZVSB 2WZPD 5EC1B 2Q6WB 5AAMA 4OD3L 4UIMA 5C07A 4LAJH 5KTEL 5DMGD 2BRRL 1IAOB 3OR6B 4WV1A 3LQAC 3GMOA 1A6ZA 4GAGL 4S1QH 3B8YA 1OAXH 4POZD 4CN1A 3HMXH 3BKYH 2H1PH 3OAZH 1ZS8B 5D71H 3MJ9L 4LLMB 4AEHL 4LVNC 2ZG2A 1W0WB 4KROD 4PJ8C 2DM2A 5C2BL 1DVFB 1WC7A 3O4OC 5KG9A 1ZHLA 1PZ5A 3F5WB 3ZE0E 4MXVF 3OWEA 1JYNA 4P57B 3UYRH 4P4KD 4LHQB 1Y0LA 1EERB 1MHCB 2QQKL 5IM7A 3BGFC 4OZGF 5J7CC 1MUJB 1G7MA 1G7QB 2VH5L 2JELL 3L3IA 3X17A 3O41A 4J3WA 1W8NA 1J05A 1HHHB 4XXCC 1JIBA 1LDPH 2W0FA 3G5ZA 5FUCE 3DTXB 4LLWB 1YQ2A 2VKWA 3A67L 1OHQA 3KXFE 4GUPB 5TQ2L 3EO0A 1ZLUH 4KVNL 5DO2C 5C0AA 3VXPB 4MJ6B 3VFWA 4LLAA 5LBSH 1NGWB 2D7NA 3K46A 1XCTA 1FO0H 5EN2B 4PJBA 4O4YH 4O00A 4NP4H 4G8IA 2B7DT 3ZKND 3CFDA 1N5YL 1HWHB 1LK2B 3O3EB 4S0TD 3SE4C 2DLTA 2LAAA 5F9DC 2DDQL 2I9LA 2KKQA 5KZCB 1J1XH 4UT6H 5IMLA 4ZS6D 5J89A 4K71B 4UILL 5D7IF 2HG5A 2LVCA 5EPMB 4ENED 1GGTA 4B53A 3LMJL 4JO1L 3NVQA 4LSRL 1QBML 3SJVE 3VGBA 1DN2A 2GT9B 3ARFD 5GGQH 4FMFA 1MWAA 3S8WA 1S78C 1R6VA 3MOAH 1CXKA 4S1SH 2E7HA 4UB0L 1G1CA 5DQDH 5CBEA 3C5JB 4QRPB 4IRZH 2BVQB 4MA8L 1I3GL 3S9DB 1L6ZA 4K94L 2CMRH 2IPUG 5DYOA 3U83A 1HHIA 2P8MB 1OGAD 1HHGB 1HILA 1GCFA 4PJFA 4DJMA 5D2LE 1PD6A 5AZ2L 3DPBA 3HI6H 2VXSH 1ZT7A 4RGNB 5TE6L 2EDTA 3DRTB 4CVXB 1G9NC 4KDTA 1HQ4A 4Y5XB 1JRHH 4MDJA 5EBMB 3JV4A 3I2CH 2PYED 3BKMH 4L4VE 3GGWA 3JBG7 4DKAA 2P4AB 4KVCL 1A7NH 3QUXA 4LFHG 4ZPTA 1A4KB 3FTGB 4E5XA 1RIUH 3MCKB 5HDOA 3D0VB 1MY5A 3HE6C 1DUYA 3NA9H 5I76B 3QFJA 4G43B 4PJEA 1BLNB 1KTDB 3HNTH 1CD8A 3B9KB 5DFTA 3VJ6A 4JZOA 2CH8A 1I9IH 4XAKE 5GGVY 3T0AA 1HINL 2OL3L 3BP6B 3VXOB 5D71L 1PVHA 5C0BB 5IWLA 1JGLL 3BDXA 5T3XL 3TBYB 4M3JA 1IAMA 4I0PD 2F19H 3MJGX 4YDIL 3PWVA 4IMKC 4TVPH 2YK1L 1R5IB 5F7KC 5EC2B 1KCSH 4YAQA 4AIXA 1C08B 2FECL 2VXUL 3EYUL 4HW6A 4KDTC 1B6UA 4OZFG 2C3GA 3QIBA 4LVEA 4LCUA 4PP2B 4J12A 1R24B 3E6HA 4U1SB 3VRJB 5CZXC 5KVGH 1KIQB 2CLZA 4AMKL 5DEFA 3UTTA 2BSED 4XXDA 2WINA 1V7MH 2EE2A 1WAAA 1TZGH 4Q97A 2HTKC 1J8HE 3BO8B 1YEDB 4HZAA 5IIEA 2IEPA 4F15C 4XBPB 1KLGB 4X7EC 1QFWL 2V7NA 3QNZA 3WNLA 1ZKAA 5L2KB 2YPKA 1X4ZA 4M5ZH 1LHZA 3V5HB 2H9GB 4NSKA 3WEXA 4Y0GA 3VFTB 4E41E 1MI5B 2CK0H 3D3VD 1AD9B 3ZTNH 2PYEE 3OG6B 1DDHA 2P24B 3EUUA 4JRXE 3PHQA 5CMAB 3ULUE 2ZPKL 1Z9LA 3EOAA 4QY8B 4UB0H 1S5IL 4NZUL 2AKRB 4IRZL 3QWQB 4MD5A 1HOCB 4S0SD 2CMRL 3BPLB 5ESVB 3I02A 1R5WA 1P2CB 4NPYA 1JHTB 4X6FA 4EZMA 5EH1A 3ARGD 1KN4H 3IJHA 3BXNB 1KCRL 5I16A 4I48A 5KSAC 3GJFA 2ED7A 2X70A 5BVPL 1TVBA 3I50L 3RWJB 3MLXL 3EO1A 4E41A 2NY4B 2OJZL 1AXIB 3FRUB 1KT2A 4UAOC 2ZUTA 3TPUB 2EZ0D 1NCNA 1CLOH 5T1LA 3LS5L 5IHUH 1T6WA 1OP3H 4ZOAA 3EYOB 43C9B 4G9DB 4MS8D 2I07B 5IIEB 3NA9L 5B8CA 2GK0B 5FGCE 1G6RA 2R2CA 3NZHL 3UTTE 4I3RL 4U1NA 2BNQD 1S7XB 4J8RA 1KEGH 3UCRA 3MX0A 1FZJB 3VXQB 3BPOC 3T0ED 1ZLVK 1T3FA 4PJ9C 3MJ8B 2RIKA 1NCBL 5GRUH 5T3XH 5IBLD 1X9QA 2VLRB 3VWJB 1YMHA 2YXFA 3S97C 4YDIH 3U2SA 4D3CH 4QRPE 1FJ1A 3MCG1 3EOTL 1A5FL 1ZEAL 1H15B 1D5MA 3CLFH 5H2BA 4U7SA 5JZ7C 3VFNA 3OKMB 3CVIL 2AAVA 5KSUB 3LKOB 4Z7VA 3D18B 4LBEA 1RZIA 3HA0A 3W0WE 2BHZA 2P5EE 4H20H 1I8LA 4NQDB 2A73B 5C0EA 1IC7L 3TNMA 3I02B 1WBZB 3FB6B 1TZGL 4ZTOL 3R8BB 3QFJE 4RAHA 2ICWJ 1QSFA 1T80A 2R2HB 4TVPE 2Z35A 4I2XA 4E5XB 4OIAA 1I7RA 3Q48A 1JZ2A 3OR7A 4UTBH 1C5BH 2XYCA 3NFPB 1G7HB 3SO3C 5DURB 4IHOB 5JIHA 5D6DA 4U1KB 5DQ9A 3LEXA 3FB8B 1L9NA 3QI9D 3LVEA 3O3AB 3NCYS 4JFZH 3IKKA 2R1XB 1JTPA 2JKXA 1W0YT 3O6FA 1ZHKB 4IRSD 3MOBL 4Z7QE 1O0VA 3GO1L 3QUMA 2DICA 3RUGF 1C5CH 2V9RA 3HE7C 2QQKH 2X44D 3RX8A 3U6RB 4R97B 4Q9QL 1MCWM 5HHXH 5KSBB 1DZBA 3L1OL 4U49A 5EUKA 3VFVB 5AWNH 4PD4K 3D2UA 2ICCA 4L5FH 4LKCA 3LV3A 4KTEL 3BMWA 1KXTB 1Q9KB 4P2QE 4K7PH 3L7FA 4ZUUA 4M3KB 4LCWE 4LU5L 3KGRA 4TN9A 5FO7B 3SDAD 3OXSB 4L4TA 1TCMA 3CLEH 2XTJE 4HIHB 2NY1B 3OX8A 2I9LB 5DJ8A 3FQUB 3VG9C 2JJUA 5C6PB 3H42H 1IGCH 1KJ2A 3S4SG 3RPKA 1KB9J 1P6FA 4PJXF 3MV7D 1OL0A 5T1LB 2XIDA 2JTDA 3MLRH 4XH2B 4LSRH 3UJJH 1XH3A 2ZOKB 3BH9A 1J0KA 1U8IA 3CFEA 3FFCE 3OKYA 3Q6FA 4GBXB 1QO3B 3CFBB 5DJDA 4V1DA 4RFOH 3WN5A 4M6AA 3GJFB 4G6AD 1CU4L 4K3DH 5D8JH 4NN7C 1JGVL 3RWEA 4OFIA 3O6FD 1MUJA 4OGZA 5GIRA 1DL7H 3B9KD 1GSMA 1MCOL 1IRAY 4W4OC 4F3FA 4I3SL 4M7KL 3VH8B 3NIFF 2VQUA 4ZUVA 5KW9L 1AC6A 1QZ1A 2Y07H 3L3OB 1OAYL 3T77B 5KVFH 2APBA 3IAGC 4P5KB 5DEGB 4OCSH 1IAIH 4JY4A 3KS0J 1YEGH 5IR1B 1ZTXH 5I18H 4BZ2L 4CVXA 5L88L 1K5NA 4NDMA 2F54A 3CXHK 1Q9LB 1V05A 4MVBC 2ZNWA 4HK3N 1Z0MA 4NUGL 5ICXA 3NIGF 1KB5B 4JZJC 3KXFB 3Q0HA 2ICEA 4HK0B 5TDNB 1A6ZB 1QSFD 3BE1L 4RCAA 1R3HA 2FH8A 4P2OD 3UAJD 4M6MH 4FQIH 1UWGL 4H8WC 5TE7H 3D0LB 1I85C 4BFIB 4EN3C 4MQXC 2OTUB 2WQRA 1PKQE 1V8HA 4DK6A 3QIWC 5L2KE 3OHXB 4HXAL 2ZNXA 3QFJD 1CIDA 2HRPL 3BEWA 1TCRA 12E8H 3Q5YA 5D72H 1BIIA 4BH7A 2ADGB 3A6CH 3OJDB 5IWLC 4NO0B 1HNFA 4YEEA 4NNXA 3TV3H 2F19L 2COQA 5BZWB 1IKFH 1NAMA 1F4YL 2XFXB 1XF3A 4XNQB 2A9NL 4WGWB 1MSPA 4JCMA 4NM4H 5D96B 1DSFL 4WFGD 3FT2A 2VWEC 4FQ1L 4YXKH 4CGTA 1K6QH 2DQCH 4FQLL 2R29H 3ARXA 2O5XH 3WUZA 1LQSR 5L8KB 1O5DT 3G5XA 4GLRH 4OTXH 4ODTL 4ZFFA 1KPVB 4QRRB 1UYWH 3LIZL 4HK3J 4NZRL 5GRWA 1ULVA 3K2UL 1RK0B 2C7UB 2YA0A 4HKBA 3UBXG 3RHWK 3N1FC 5JO5B 3RJQB 3QNXB 4Y8AA 4YHNA 3GMRA 2HJFB 3U46A 1NC2A 3RBGA 5GS1B 4X6BA 5HI5C 4LSSH 1ZLWH 3BKCL 1CICA 4NOBA 4PJXB 4O2EA 4EI5C 3C8KB 1CBVL 3VXTB 5CILH 4PREA 5D7KD 3DIFB 4QXUL 2X70B 1WGOA 2ZPKH 1NBZB 2CLRB 5C7XL 3JV5A 4A6YB 1GIGL 3F58L 4MAYA 4IOSD 1FLRL 4YHLH 1JWMA 1KJ3H 2AP2A 2X6MA 5IMOB 4PJ7B 4QRRE 1U95A 1JZ7A 1UC6A 4JKMA 2ARJA 3BPCA 3U7YH 3IDUA 3HCVB 4KQ4L 5JW4N 3RJDA 2ATKA 3HZKB 1K2DA 1IE5A 5BZWA 5C8JB 3JUZA 4KJYB 2VAAA 5E5MA 4CW1B 5KVFL 1S7VB 1JHKL 1XF4A 2WBJB 3FRPG 1MCQA 1L9MA 4RQQA 5E2VL 3D39A 1AKJD 3D85A 3H9SB 4DGIH 4XVJL 3T8XB 4HJGB 43CAA 4JVUA 4XC1L 4L29A 4LMQI 2OJZH 4OCYH 5E2TH 3DRQB 2ZSVB 2AEWA 4J6RL 3ZL4L 1HYSC 5TDNA 4NN5B 3WIIL 1FIGH 4WI5A 4JRWA 4BK5A 4FQIL 5AYQA 5CIPA 2IANA 5DK2A 1WEJL 1MFCH 4NWUL 5F3BA 5MHSD 5FDYA 4KY1H 4MNQD 3VGGA 3CFDB 1P5UA 5CJBA 1CD1A 1VADA 4NQXA 4Y1AB 4HPOH 5F97E 5F71A 3OZ9H 2HRPH 3T3PE 4CMHC 2IAMC 5DUPL 2WWMC 4WFFD 3CSYB 3VFWB 1JV5A 3GI8L 4JY4B 4PRDB 4EVNA 1S9VB 2C4FT 4YIQB 2FBJH 4PJ8D 2YMXH 1JF6A 2VMFA 2AXFB 2DI9A 3HRZB 5FECA 2CDEB 1N5AA 2VO5A 3CFJA 5TF1L 3SN6N 1AGFA 3MC0A 4PLOB 3WLWD 1MJJA 4NN7B 3ZTJG 2P43B 4DZ8B 5DJZA 2QKIB 3K4DA 5CUSH 2PYFB 4MB4A 3AAZB 4XNMB 5KS9A 4Y19E 1IAKA 2X1QA 1F11A 1IKNC 3F7QA 3MA7A 4HUUB 2FRGP 3ILPB 1IC1A 2AQ3A 2X9YA 3UTSB 4ETQB 2VXVL 4U1IB 1ROWA 5EFIB 1ZA3B 3CK0H 3RGVB 2WWKO 4K71C 3TIEA 3W9DA 3MFFA 1FZKB 4RSVA 5DS8B 1MAMH 1PSKL 5K59E 3TH2T 1IAII 5I8KH 3GBNL 1DQMH 4GG6F 4HIXL 2ORBL 1UKQA 3HUJF 4HCRH 2LABA 2CIIA 4P46C 1F5WA 3LPFA 5JDSA 3JV4B 3BKYL 1KLGA 4K2UH 1NKOA 1XAUA 1SYVB 3MJ9H 4XPTH 2R4RH 3OXRA 3P11L 1KB5L 4NT6A 4OKDA 3C2AL 5IQ9B 3WNOA 5D9SB 4RDQG 2EKSB 2X89D 4M1DH 3DMMC 3S35L 1FLRH 2A9MH 1T4KA 1C5CL 5AD0A 4F7MA 2APTA 1DLHB 4G5ZH 4Z0BH 1WZLA 2P8MA 4NNPL 3RVXD 3C6SA 1U8HA 2DWEA 5I8OH 4KQ4H 1MFNA 3FOMA 4DEPB 1NLDL 3RY5A 4HWZB 4GSDL 5T33L 3O3DB 3JVGC 4H1LA 4D94A 4LAQH 4JPWH 1ACYL 1OM3H 3F7VB 5E6YA 5HYQB 3RVTC 5BV7B 3ARGC 5BS0B 4BH8B 5I19H 1ZA3A 1Y18B 2VITB 5IJKA 5I1IL 2E7CA 1FYTD 1H3WM 2VLJE 3ARBB 5DHVA 4AEFA 3DVFA 4HV8B 5ADPL 5JOFA 3T1WA 1ZHNA 1DQDH 1QRNB 3BP5B 1YUHB 3BIKB 4UILH 3UBXB 3TZVB 1II4E 1ZVYA 3B5GA 1CT8A 3LMJH 4JO1H 5KAQF 4P2OB 5CJQH 4YXHH 3AMLA 3DBXB 5JOPE 4JFDD 1QLRB 4OLXH 4PJAF 5IW1B 2YMXL 1FFOB 3O3UN 5CINL 3T3PF 3L3KB 3TZVC 4K94H 4TNWK 3HMWH 2D9QB 5I8EB 4F7TA 5JOPD 1RK1B 1FRGL 2MPAH 4P3WA 4NM8H 2JCCF 3S7GA 2AEIT 3V0WL 1MCBA 2QADC 2DM4A 1HXMB 1ZHBB 4GXUM 2VISB 3WIHH 4JM2D 4JB9L 3GSNL 1B3JA 5CWSB 4DZ8A 4HIHA 1KFAL 3DVNB 3FOMB 1UWEH 4U6TA 5JZ7D 3FQRB 2EECA 3ARGB 3IFOB 4X9HA 1CLYH 4Y4FA 3ZZ1A 4CBPA 2NY0C 4EVNB 4QYOA 3O9WD 2ATPB 2N7BA 3IU3A 1PGRB 4HAFA 4RFNC 4GAYA 4HEPG 4XNUL 1EEZB 1KG0A 2HA1A 4KHXH 2A38A 4QNPE 1M71A 4U7KA 1C5DB 1KF9B 3DXAE 4LQ1A 3RTQA 3AC0A 1MHPH 1C1EL 4BQCA 2Z31A 3H0TB 4FTVE 4P23D 3OPZL 1XGRB 5I1GL 1OAUL 2R0LH 5DVNA 2GUOA 4HS3A 3TZVA 4MJIB 4P59L 5D1ZA 4NQEB 2DMKA 1E6OH 2R0KL 3FQNA 2GYSA 1N0XH 3RIAK 1D9KA 2P5WB 3HZYB 3VRLE 4KRPD 1P7KA 4PGDA 2P8PB 3MYJA 4P46D 2YHGA 4LHUA 4FFZL 4LOUD 5LVEA 2AKRA 3VRIA 4UQ3B 3EYUH 3QUZB 1KTKE 2VDLL 2X1PA 4LOUC 2ENYA 4FFVD 4MMXC 5I8OL 3VXUA 4C56D 5FDWB 2B5IB 5EU4B 5F7YC 2Y06H 2IGFL 1RI8A 3HN3A 4U3HA 2OTWA 4N0FB 1YNKH 4JE4B 4XB7A 4KI5E 2ICWB 1DQJA 1T5WA 3DUHA 4ZNEA 5JO5A 1DBAL 1EXUB 5MEPA 3NABH 1U58A 1K4DA 5IEKA 1C7SA 3GNML 1LDSA 5KSUA 1TJHH 2IF7A 2R0WL 4RRPG 3UZVB 5I19L 1BZ9A 3WDJA 3QNZB 4MCZB 1MCCA 2KL6A 2AJUH 1U91B 1QD0A 2EDLA 1LEKA 3OAUL 3PWPE 3RVTD 3DV6A 4HIIA 1XGPB 1A6VL 4XZUA 4Y4HD 4KFZC 4AIZA 1QRNA 3MPCA 3BP5A 4QXUH 1S7WA 3L6FA 3SKMB 4DVRL 3HI1A 3SE8L 3HPJB 1NBQA 5IHBA 3BESR 4GXVL 3VXQA 4C83B 4XGZB 2XT1B 2VABA 4IRJD 2B39A 5ECJE 3QR2A 4HFUL 2OZ4A 2XQBH 3WKMH 1EHLH 1P7QD 4XB8A 4HZLB 4Z0XB 4JPVH 5DF0A 4ZXBA 2E9BA 3EKCA 3RIFK 2AXGB 4L8DA 2MPAL 5I1AB 3BUTA 7CGTA 1XR9B 1Y6NR 4Y19B 2NXYD 1CFVL 2BERA 3TBVA 1B0GB 4ETQA 4F9PA 5DQJA 4ACPA 3O4LD 5T3ZH 1A9BA 2A6KB 5D7IA 1KFAH 4XVJH 2AJSH 5HDQL 4HC1L 1PFCA 5JHDE 5D7IE 5JA8B 4GJTB 4KKAD 2VTFA 3HC4H 5C0IA 4YEFA 3P4NB 4KK8D 2J12B 3FOLB 1TETH 5EORL 3QO0A 3EYSL 4ONGH 2OR8A 4O9HL 4PREB 3BP4A 4HPOL 5B38G 4JDVA 1KENH 1MVFA 1TNNA 2EH8H 4RGNC 4HX1A 1FP5A 2FHBA 5IVZA 5FA3B 4Z7NF 1S8DA 5ITBL 4I9WD 4M8QA 3UMTA 4XPBH 5BXFB 4G8EB 3LB6C 1T0NA 2Q1EA 1BGXH 4LLVB 5BQ7A 5GRUL 1N0XL 1PKOA 3L3HA 5I1LB 1HQRA 5H37H 3W2DL 5E9DA 1RPQA 5A3IC 5MENA 4TULL 4N0YL 5FKAB 1SEQH 4ZXBB 4ODSH 3RP1A 1MFAH 5CGYC 3B5HA 4RAUA 5GIRB 3QPXL 2IH3B 2SEBB 2Y06L 1INEL 5DC4B 1YNKL 2AK4D 3UXFA 3IDIB 4P0DA 2EZ0C 1FL5B 4OLWL 2B1HH 4AEEA 4JY5L 1PSKH 4YDJB 5FUOL 4HMDA 1CDIA 1DQML 4K3EL 3GSUA 2FJGA 1BMGA 1CD1B 4NQXB 3V6ZB 5D96C 4JZNB 3LCYA 1C5BL 3LHPH 5DMKB 1KJ2B 5F9OL 1EEQA 2JJVA 5DD5L 2PXYD 4K8RH 3UZEA 1CICD 4XPTL 3NAAH 5KVDH 3CVHL 3SKJL 4KZEL 4QF1A 5MEOA 1X7QA 3VXOA 2LU4A 3UO1H 1FCGA 3ZSSA 5I0ZA 2X4UB 2OXHA 3BGFB 4M1DL 4QRPD 3FB8A 3HPJA 4X9IA 4P5TA 4PS4H 5I6XB 8FABA 4HUKB 1XIWC 3OBAA 3SCMC 1S8DB 3ZDYF 3Q6GL 4XNMA 5KS9B 3ALXA 4JDZB 5IKCA 4X8JA 4EN3B 1NGPH 2Y9RT 4OJFH 3WFCH 4QRQA 3WSQH 1G9MC 4OT1L 1OM3L 1KCUL 1JI2A 3UTSD 3VWKD 4D0DB 3BPCB 4HXBH 3TYGH 2CDFA 4XP5L 4OUUA 1BFVH 1LEIA 4I0PB 1JP5A 5GRVL 3ARRA 1T20B 4IRJA 2EO9A 4DVBB 3H9YA 4V2CB 4Q6IC 4HV8A 4OZIF 1IGCL 2XTJB 3SDXA 4P23C 5DK0A 2XQYG 2DB8A 3RTQB 3PWPA 3NPZB 1UCTA 3GKZA 2MNUA 1ZLSL 2V2WA 2BY3A 2PXYA 3P40A 5B3JF 3M8OL 4N90E 4YZFE 3V5DB 2BRQA 5CJQL 4YXHL 5EWIH 1KENL 4WUUB 2FECI 2G2RA 2WNGA 5C0JB 5HI4C 4GFTB 2ADFH 1D9KB 2P5WA 5EB9A 4XVTH 1WJ3A 1UWXK 1RURH 1N6VA 1J0YA 3VFOA 4ELMB 1RIHL 4JFPA 25C8L 4M7LT 5EPMA 2DWEB 4KAQL 1FRGH 4JRXD 3V6FA 5GRZA 1TQBB 1AO7B 3QDAA 3VW3H 5IESL 1ZA6A 4YNYB 2CPCA 4XWGL 5F6IB 4OCSL 4MDIA 4MAYC 4XXDB 1T66D 2VDKL 4XAWH 3JTTB 1FVDB 5I74C 4YDVB 1Z2KA 3V0AC 3WDHA 2ICWI 2BDNH 1VPOH 4JY6A 4ONFH 4NRYA 2VR5A 3V5KB 4LSTL 1ZLWK 3VD9A 4Y16C 2VUYA 3B5TA 3IYLW 2ED8A 1ZHKA 2CK2A 2BOCB 2CRIA 3V7AE 3BE1H 4L3EE 2RHEA 4FTVA 3KLSA 3FMGL 1FZMA 2B1HL 4NZTH 3F12B 2GY7B 3V8OA 3G08A 4HGKC 1QP1A 3PGDA 5KTEH 5IW3A 2NY7H 3BVNB 4GAGH 3GSWA 4LF3A 5GRXG 5EG6C 2ADIA 3QWRD 2OTUA 3GRWA 5I1GH 4WW2C 3TPKA 2FR4B 3FT3B 2Z4QA 3ARFC 4HBQA 5TPWH 3L3JB 1YN7B 1T22A 5GGTH 4LF3B 5HGHB 1LO0L 5C0RH 3KR3L 1EH9A 2ENSA 5E99L 1N6QL 1G84A 4N0CD 5C2BH 3OKEB 1RZKL 4LP5A 2H2SD 3RZWA 1G7JB 1VFBB 1Q9WA 4N0CC 4OQTH 4AL8H 4HF5H 1IM9A 4NYLA 3TVMC 3MUGB 4OLVH 4YJZL 5DRXB 5CEXA 3D39D 5F6IC 3IT8D 2GAZA 5F7UA 1HWGB 3GI9L 1MIML 3KLAA 4X98B 5E8EA 3FB5A 1CDHA 2E9WA 1JNLH 1Q9KA 4KI5F 4BUGA 2EXWD 4LLUB 1S7SB 1G9ML 4DUXA 3K2UH 4PJIF 5FV1L 1U3JA 4NJAL 3GNMH 3SO5A 4YHYC 1ZA6B 1A4JB 1MVUA 1WIOA 5CD5C 2UV3A 2YD7A 3SOBH 3RWFA 4E42B 1QFWM 2ZP0T 1ZSDA 4NP4L 3N0PB 4CAGA 5DVLA 4HGWB 4Y19A 1A6VH 1TENA 5D5MB 4M1CC 2VLJA 4AM0A 3LEXB 4V2BA 2DF3A 4X6EA 2HFEA 2XTJC 4OLUH 3TJHC 3C09B 5DZOA 2H8PA 1F58H 4GXVH 2H3NB 4Y1AE 1DLFL 2XQBL 3BP6A 1S3KH 4YHLL 4I0PC 1T0MB 4LSUL 3CU1A 1SYVA 4GRLB 4XBGA 5DI8B 5E7FA 5IB2B 1LE9A 3CZJA 2C3HA 3HCVA 3QUYB 1IT9H 1DQQA 4NO3B 4TSAH 4PJ7A 3AAZA 3D2UB 1AHWA 1C08A 4FFVC 4L3ED 4F9PC 1MFEH 5IJVA 4R2GD 4JFDE 5EU3A 2RCSH 5ISZB 5I6XC 4NQDD 5EBMA 3ARUA 4XC1H 3TIEB 4L8SB 2H2PD 4MD5B 3MRDA 4IRSB 1PEWA 5HI5D 3QEUA 1HIML 3DRTA 1I8LC 4JHWH 1LMKA 5LAXA 2PCPB 5DQ9B 1QVOA 3DSNA 2RAMA 5JPNB 1CIUA 1N8ZB 5DK2B 4BKLB 2CIKA 1RFDL 4PB9L 5FGCB 3QHZL 1JPGA 4KY1L 5IMKA 3F12A 1A9EB 2C3VA 5JNYB 3MLYL 4QRRA 3X13B 1I9IL 4XX1G 3NGBB 2IFGA 3RRQA 1I9JH 2EDWA 3UDWC 5DD0H 3VD4A 1CDBA 3KPPA 3O3BA 1FFPB 1NEZA 2YR3A 4LKCB 4U1MB 4FN0A 5I17A 2EKSA 4MXWH 2G75A 4DGYH 1LP9E 2XNAB 3O2DH 4WO4C 4GG8B 3JVGA 1UXWB 5KSAA 1NSNL 5KS9E 1EGJL 1W72B 4ODSL 3P4OA 5BOZG 3ZYZA 4NQCB 5IEKB 1CE6B 5DGRA 1ZMYA 4GQ9H 4RA3A 4P49A 3I85A 2QQNH 3ZKNC 4OF7A 4NPYB 3MNVA 3WE6B 4Y2DD 5DS8A 3PGCA 4U1JB 2RGSA 3UROR 5HGHA 1NAMH 4BFIA 4U2YA 1M1SA 1LO4L 2EDNA 4XGZA 3PWUB 5A2IH 1G7MB 1G7QA 3N06B 4PG9A 1PYWB 1E4WH 1OT2A 1T0NB 4PLJD 2I07A 2VE6A 4MNQA 2CKBL 2YD2A 3UC0L 1EHXA 3EYFB 5FGBC 3CVHH 2IMNA 3P4LA 1B4RA 2YPVL 4HS6B 2X4UA 4POYA 1XEDA 2H9GA 1BBDL 5CSGA 3PP4L 1W0WA 4U1GB 3EDEA 4FQCL 2MMXA 1RJYA 1QPXA 4XCFL 1EK3A 2YA2A 5GS2H 2QBWA 5JXEC 3CMOH 4HIEA 2AW2A 3SDAA 4OJFL 1MCEA 4I18B 2JB5H 1YMMD 3L3IB 5D1ZC 3QIBD 3AU1B 2B20A 5JUEL 2FO1A 3JV6B 1HN1A 5IVXE 1MLBB 2QQQA 5DZNA 5I1EL 1MF2L 5BVPH 1Y18A 1CGSH 4NQTA 5AUMA 4XCCL 4XTRC 2F54E 2Y7QA 3IRPX 4J3XA 2YSSA 3DX8B 1MRFH 3KPSD 4NUJA 4K7PY 3QO1B 3RZCC 5M94B 5B21A 4EUPA 1RJZB 3M8OH 2L7JA 4RRPA 1D9KD 3TIDB 4WW2F 4QRRD 2B2XL 4LQFH 1HH9B 1B6DA 2OR9H 1JZ8A 2BHUA 1GGUA 3VXSB 1XR8A 1U6AH 2Z0BA 1NC2D 2OL3A 1T1ZB 3QFDA 5D7SL 4NO5A 5DJ0B 2D31B 3FFCA 4JFFD 4OBSA 1W0VA 3SQBA 3ARTA 1A4KA 3RAJL 3IDYC 5DMYA 4Z7UE 4EXPX 3ARZA 5HYIA 3QJFA 4PJFF 4PY7B 2R2EA 5CIPH 5IROC 3RWGB 4RAVA 1MHEB 2DQFA 2BSTB 3QEHA 5FYKL 4YDKL 4XAWL 3FN3A 5IMKB 4WU7B 1AGEA 2GJ6D 4Q0XH 2DLFL 4Y2DA 5E4EB 5GGRA 2WANA 3VXUB 2QQNL 4XHJD 2CR3A 1WBYB 2HJKB 3ZKMD 4P2QA 4M93C 4NZTL 5ACZB 3QEUB 3SPVB 4P5KA 5DEGA 1IEBA 3AM8A 5C3TA 2GSGB 3GUTB 5L2KA 3FB6A 1AXSA 4WWID 3CZFA 3SDDB 1F97A 3O4OB 5DJ8B 1KSRA 2Z9TA 3DV4A 1CL7L 1OP5H 2O93L 3G6JB 2FJGB 5J3HD 4GAFB 1R5VB 1DBJH 3PP3H 4LPTA 1J10A 4JFEE 4RBPH 3THML 3TA3B 4FQCH 5A2FA 5FM5M 1JUFB 5EU5A 3G6AB 5J12B 4JFED 1K8DA 4KK6C 2AXGA 1BIIB 3MRPB 3FO1A 1FORH 2JB5L 4L9LC 3MBEC 4FA8A 1JNLL 3BGMB 3QUMB 1P6AB 3KPNB 3BPNB 5MENB 1G9NL 1Q38A 4ZDHB 1FL3B 5BMFL 4KUZH 3WHXA 1YEFH 1ZSDB 4N0FA 3EOBA 3RWFB 2DBJA 2OMNA 1F3DJ 5DO2D 3UAJC 5IB3A 1R3JA 3IGAB 4O5LH 4Y2DB 5F7FA 4UT9L 5J4MA 2EIBA 4Z77A 1MRFL 1GRWA 3PXHA 4NT6B 5DZLA 3SKNA 3F7RA 2CXGA 2VXQL 4XI5C 1EAJA 4HIEB 2YXMA 3SDAB 1F3JB 3B2VL 4RGND 4YE4L 5HD8C 4ZFZA 2AXFA 4P2OA 3ARBC 5IK3A 2R23B 3L7EB 4X7DC 1DLFH 5CEXB 1T04B 3I75B 1FPTH 4LCWA 3UX9B 1NFDB 1XF5B 2UWEE 5L6YL 1T1ZA 5IK3B 4WFFE 4LSQL 5F7EH 2XZQH 4KPHH 4PRPB 1VKXA 3MRJB 4TSAL 3Q6FB 4GBXA 4WJ5B 1QBAA 5F1IA 3VFUB 1M71B 1AGCB 4JAMB 1H0DB 3RAJH 5CGYD 5SWSE 4E41D 4U1IA 4OZIE 5GS3A 1LEGB 5I1AA 5CP7B 3C5ZD 2D4DA 3REVB 1UG9A 4K3JL 1NKRA 4Y4FB 3OKKB 3MRLB 4NUGH 3IRZA 2A73A 2WP3T 2DQDH 4G7VL 1FL3A 1Q8MA 2X4TA 1E6JH 2JCCA 3MV9A 2YPKB 4ZFFB 5DUBA 3S34H 1I1FB 5C8JA 2GIYA 2NQCA 4TTGA 1H3GA 1SY6A 4WNQA 3V5KA 2AQ2A 4UDUA 5GHWH 43C9A 1H15A 1MEXH 5ANME 4PLKC 4TSCH 1P84J 2NY6C 4O9HH 4P48A 2X9XA 4PV8A 1WWBX 4N8PA 5EC1A 2V5RA 4LCWD 4XRCB 4EDXB 1T3FB 2UZXB 1UACL 5IBTL 5CZVL 5DDHB 2WIMA 2DKUA 4LARL 1IKFL 3TF7C 4OD2A 4EI5A 4JPKL 3LDBC 1I1RA 1OTSC 2PYEA 4BZ1H 3F8UB 2VERN 2WM0A 3AM8C 1EGJH 4HUVA 1CTOA 4KJQD 5F9AC 1LD9B 1SEQL 5DGQA 4APQA 4M4RA 3P73B 3RA7H 2GSGA 3GUTA 4QHLA 4ODBD 1UXSA 5HVHC 2E7LC 2P7TB 4CW1A 1IL1B 3H3PL 5KANI 4IRSA 4JM4H 1INEH 3VH8G 4DN3L 3RPIA 4WJ5A 2BHYA 3Q5OA 4X6CF 5GGRB 3GSXA 2LE9A 2DMBA 4NGHH 2E6JA 3SDXF 3VXRB 4JG0L 3ARSA 1NH6A 4YH6A 4ZPTB 5FUZL 5LQBH 1RUQL 2F8VA 1U3ZA 3T77A 4ETYA 1YPZB 5EU6E 1REIA 1X6LA 2ZUUA 2X05A 5FGBA 1AGBB 4XP4H 3DECA 3DVIA 1YMMA 1R0AH 3EJJX 5DT1H 5JHLL 1GGBL 2VL5B 3MV01 3F58H 3RVWD 1YMHB 3I3BA 4J3SA 3IETA 4XCFH 4NO2A 5HYSB 5C86A 2QV2A 3OV6A 4PJEE 4HDIA 3U7YL 3V0VB 4NHCH 1X5XA 3H7LA 3MODH 4KJQC 4LK4A 5F7DB 3TBSA 3C5JA 3KLDA 5F1NA 5HHMB 4XMPH 4OT1H 1NFIA 2JJWA 4LRNL 3RVUC 1RZ8B 4NQED 3OX8B 5I1EH 1P7QB 3BAEH 4X80L 5IMMB 4L4VA 1CGTA 5E5MB 3NCJH 4WY7H 3RGVA 4DGIL 2BVTA 4CL7A 3KPSB 1HH6A 3UTSA 4P2RD 1LNUA 1QSVA 5E8OB 2O5YL 3VRJA 2F58L 3MRLA 4M7JH 1T2QL 3DX7A 5DRNB 1VACB 3T2PA 5FM4A 3VI4E 5I1DA 2D7OA 5I76A 3O4LB 1CGWA 3CDGA 3PV6A 1KYOK 5J57B 5C70A 3TCLA 4RAUB 4MJ2A 4M6NL 4PBVC 4XP9L 3FO0H 1ZHNB 3VXME 5TJWK 4X99B 1QO3A 2OI9C 1WAAE 3CXHJ 5F1KC 1U6AL 4MJID 4HT1H 5JQ6L 4C55A 4QXTB 3CSYA 3SJVA 3N9GH 4M7ZB 4IDLA 2XXMB 1NGQL 3BRDA 2DQTH 4GRWF 1JYWA 5FYKE 4D0CB 3QDME 5K9JH 5KJRL 3VA6A 5GSRB 4U6YA 4PY8J 3O0RL 5CUSL 5A40E 5IW6B 1HHGA 4I1NB 5ICXB 1NUDA 1UA6L 1MNUL 1MPAL 1SJEA 1FVEA 5DMIH 1DBBH 1QA9A 1QYGH 1MJJB 4JM2C 2F8XC 4DFHA 1AGFB 3KLHC 1MHHA 4U31A 5IR1A 3KPLB 4TUKH 3C6SB 1D6EB 5LWYH 1U8MA 1BAFH 3L5JA 5E2UH 4DOHE 5LXGH 3GIVB 2BVEA 3QCVL 5DJYA 2IADB 3ES6B 3HI5H 4YDVA 4KDWA 1HDMA 3GMOB 1CE6A 1KB9K 3FMGH 3LKOA 2BVYA 3GIZH 4QTHA 2ZG3A 5JR1H 3VXSA 1Q0XH 3HZKA 5DLML 1HILB 1KJMB 5IG7B 1JWSA 3W0WD 4RA0C 3WXWH 1CDCA 3H7BA 4HUNB 1G7IA 4R0LB 4RGMB 3JWOL 4ODVL 4HQQH 5J06A 1RHFA 5E5UB 2C1PB 1OW0A 1UWXH 1TZIA 2HT3C 3L3GA 1LO0H 3MLUH 4KZDH 4FQPA 5CCKH 3AREC 2FATH 2FZ3B 4PB0H 4XMKL 1FE8H 4Y5YA 3BZDA 4Z78B 1J87A 5D2LA 3QDMD 1CICB 4WVRA 3VG0L 1K2DB 1ZAGA 5A2JH 1P1ZA 4IIQB 2VISA 3O6MH 3GI9H 2ITDB 3S5LA 2YUWA 4LAQL 4I5BA 4B7IA 4B0MM 1KPUA 3FFCD 4JFFA 3X3GH 3HPLB 3B9EA 4I18A 4HKBB 3VMNA 3TN0A 4P2QB 5JIIA 3RI5F 2PR4H 3ZE2F 5ISZA 5ISZE 1IZJA 3HZMA 4HG4K 5CAYB 1A7RL 2VXTL 4WFEE 1JNNL 4J3TA 5CSBA 1EXUA 2Z92B 4PGBB 5HHOD 3C8KA 1DQDL 3QT2A 1CZ8H 4E0RB 4WI7A 2OTWB 4FFWC 3G5VA 3SE4A 2ZUYA 4OLUL 2P48B 4XNYH 3U4AA 3RWHB 1RZJL 1K4CB 4PG9B 5C0AE 4MLIA 3QUZC 3ULVL 4XMLH 1KTLB 2HT2D 4HEME 4WI9A 5L6YH 2FJFA 3FCTB 3QNYA 4LSQH 2D2OA 4KPHL 3NFNA 5EOTB 1IT9L 2W9EH 4U3XA 4YC2C 2OSLB 4MMZC 4QRUA 1NCCH 2H45A 4R26H 2NLJB 5C6TL 2Y1VA 3HNSH 8CGTA 4PR5B 2R9HC 3K4AA 2BVOA 4KGJA 2BFVH 4RWYH 4Q9RH 4HFWB 1TITA 2Y5TA 4NWTH 4R90L 3O8XD 1A0QL 1F6AA 4TUKL 4G6FD 4K9EC 2WBWB 1NMCB 3DUSA 3BHBB 4WWKC 4OFKA 5JW3L 1HHJB 2FSEB 5FHAL 3EHBD 4ZTPH 4TQEL 5F3HB 4KJPC 4JVPA 1E4XL 2VDQL 4X4XB 4Z7NE 1KIPB 3U0TA 3GK8L 5GXBB 5JORB 3DYMA 3Q3GA 3NCEB 5JQHC 1MEXL 1U2HA 2XN9B 5JR1L 2EDOA 3L95A 5FYJH 4JHBA 2VZ1A 4E0RA 4DCQA 1X5ZA 3G9AB 2V17H 5KSAD 3WUWB 1NMAH 3QRGL 1MCRA 3OPZH 3UTPE 4U1KA 2ZKHL 1LP9F 1PEZA 1UB6A 4HQQL 4MXVE 4ZS6C 1U8IB 2E7BA 4KC3B 3PNWA 2XPGB 3NN8A 3MUZ1 5HHVH 4JDVB 5GRYA 2YD4A 4J4PD 1BF2A 3GBML 5J6HB 4CJ1A 3MLVL 5F1SA 1N2RA 1P84K 1IAKB 1E4KA 4PJHA 3RA7L 5T1MB 2A6DB 1F00I 4N9GB 1T7XA 1YEIH 1CXHA 1IGJA 4Q9BA 3H3PH 1T7ZA 1OSZA 4QXGH 4GQ9L 1YDPB 5IB5A 3QDGE 4Y4FD 1OSPL 1N59A 4Z5RB 1YJDL 3SGJA 3FQTB 4PRBB 4JM2F 1JPFA 4Y4FC 1HYRC 2L4OA 3LN4A 1JL8A 4MDJB 3F65A 1LE9B 4NGHL 4MJ5A 5DQJB 3VGFA 3ZDXF 1HEZB 4G8GD 3ALWA 3SE9L 4N0UA 1W8OA 3WO4B 1MREH 4JCLA 5AZEL 2IH3A 1B2WH 3ZE2E 2VZ3A 1A7RH 2VXTH 1CXIA 2EH7H 3ULUF 1X6NA 5F9WB 2IANB 3DUSB 1L0XA 1S7QA 2ERJB 1GOHA 3LD8C 1EX0A 2I9TA 1MCDA 1DBMH 4XP4L 2OLDA 3M17B 2F53D 4B41A 1FLTX 3IFNH 1JZ6A 4KJWD 3ZT5A 5DT1L 4X6CE 4ZUWA 5EBWB 4JKKA 4C83A 1T6VN 3PP4H 3MRNB 2FB4H 1S78D 4CN4A 4FMKA 1EAPB 3WKML 1QKZL 2APFA 4U05A 1UB5B 2GTWA 4TYUA 3CCHB 3TPUA 3P0VH 1XIWD 3R4DA 4FABH 3ROLA 3PABB 4LLUA 4N5UA 4RMWA 1YMME 1N7ML 4I9WE 5MHSE 3QXAB 1KIQA 3M1BB 5C6TH 3RWIA 2MCPL 2ZUVA 3SGJC 3FB5B 4Y2DC 5EU6A 1X5HA 3D9AL 4WCYH 3MO1A 4NNYB 3BUYA 1IBGL 3VH8A 4X4ME 5T3ZL 1KLFA 1YJDC 3VE0A 2AJSL 1IGFH 5MEND 5HDQH 1KCVL 3VXRA 1I7UB 2E5EA 2F58H 3QAZB 3TBTA 2FIRT 4Z8FL 2ARJQ 1Y6KR 5D1QD 2NY5H 4ZO6A 5IGXH 3RIFF 3RU8H 3O6LL 2ILLA 2X40A 2HH0L 3HFMH 4DKFL 5EO9B 1TETL 5EORH 1I7ZB 4M7LL 4YHMH 4PJ8A 3U7WL 3QSKB 5J12C 4NHUB 3EHBC 4XP9H 4PJ7E 3P77A 2EE6A 2P49B 4LCCC 2P1YA 2V2XA 3GJFH 1U8QA 1BX2A 4F15B 1NMAL 3MV8B 4TRPL 2OM5A 3QXUA 4MNHB 4DFIA 2E27L 4JG1L 1PG7X 4OCWL 2YKLL 3BMVA 2VKXA 1CGUA 2AK4E 2GCYB 4XXCA 5FFLA 5IMLB 4WRLA 5C9JA 3AXLA 4U6HB 1U42A 1P7QA 1L7TL 2FX9H 4EDXA 4JRYA 4RMVA 3KAAA 3IDJB 1NFIB 3VGEA 2XQYK 5T1KD 1YYML 2WUBH 1NMBH 3WNNA 3L95B 5ANMA 4E41B 3V4VL 5FO8A 1Z9SA 5LXGL 3N1GC 5IOPA 3IDIA 3RVVC 4P2RB 4AG4H 4Y16D 1HHHA 2J8UA 3TH4T 4GW1A 1MI5E 5ESAB 1JHTA 4X6FB 1ZT4B 4K23H 1SBBA 1HEZA 1PY4A 3IDXH 4ZNCD 3WFEH 4MJ5B 1J18A 1J8HD 1WT5A 2LAGB 4KI5D 5DR5L 3IDYB 4UINL 4JQVC 3MA9H 2F74B 5IEHB 4OV6F 3S36X 1A3LL 3R1GL 2NY3B 5DD5H 2X41A 5A43C 3BX7C 4GW4B 1EUUA 3GZKA 3MRBA 1IEHA 1ITCA 1ZS8A 3MMEA 3D87B 3CDCA 3DI2B 4OQ1A 4AEIH 2VYRE 5FKPA 4F80A 2H6PA 3D6GA 2VJXA 3AREA 5FA4B 5J6HA 1KC5L 4GW4A 3OAYK 1G7LB 2Z4QB 3X3FL 3HC0A 2AV7A 2QSVA 3X12A 2Q6WA 1MH5A 4GG6B 3BYTA 4EOWH 3BDYL 3ARDA 2Z8VC 4LCYA 3GRWL 3CFCL 2AGJL 5H2BB 5GJTH 4XNXL 1L0QA 3QUXC 3WJLC 2MCPH 4HUVB 1QQDB 5D1QA 3OB8A 4RGOL 4GAYB 5C08D 3I9GL 1BBJA 2OBGA 3CDGB 3PV6B 3SDCA 1GC1C 1DBKL 4X9FA 1NANH 2R1WA 5EOCH 1LK3L 1I4FB 5GS1C 4QT5B 1ZGLB