5ISZD

Crystal structure of ls01-tcr/m1-hla-a*02 complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
200
structure length
200
Chain Sequence
b'LNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCAFDTNAGKSTFGDGTTLTVKPNIQNPDPAVYQLRDSASSAKSVCLFTDFDSQTNVSQSKDDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Broad TCR repertoire and diverse structural solutions for recognition of an immunodominant CD8(+) T cell epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2016-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iszD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iszD02
3WKML 4HJJH 2VLRB 4RMWA 1AXTH 1AKJD 1YNKL 4GLRH 4L8BB 2DQDL 4GFTB 2J8HA 4N68A 3T09A 2CUHA 4PFEA 1OTSC 1AP2B 3MRJB 1TXKA 3IDJB 1NMBL 4KRPD 3BGMB 1OSZB 4NZTH 1G1CA 5EZOH 3QRFM 1S7QA 4MA8H 1HH6B 4U7KA 3SQOL 2DKSA 1S7UB 3DXAE 4JR9H 4M7KH 4HG4J 2YPLA 5SWQA 1LO2H 1LO5B 2ERJC 2VH5H 1EV2E 3V0AC 1NLDL 4XVJL 2VWEC 3BQUB 4EI5C 5E0QA 5J6GA 5AD0A 1CWVA 1ZA3B 2ADFH 4FZ8L 1XGTB 3RWEA 2BSTB 3O8XD 1K6QH 3L5IA 4M7JH 3CLFH 1X5IA 5ICXB 1GZPA 3JVGC 2O61B 3QFJE 4Y4FA 4ZUVA 3MV9D 4ELKB 3RWDA 3R1GL 2XRAL 4ZAKC 5GRJL 2P5WD 2C5DC 3MNZB 4IRSA 2EKJA 4QHNA 1FG2B 5DS8B 4KPHL 4QRSB 5EZIL 4ZSOE 4WFEE 2HTLC 1PKOA 2CLZB 2VE6A 3HC4H 3QJFB 5FYLL 5I0ZA 3RVWC 5ESVA 2IAND 4JVUA 5J6HA 4OF8A 1QPXA 3FQXA 1MSPA 2NY1C 4M6MH 1R3IL 2GJJA 5KS9E 2LU3A 4PJCF 4YWGH 5KW9H 3ULUL 1U8OB 1QFUL 5E6IC 1Q1JH 1UH4A 2AJVL 3MLYL 1ZSDA 3HG1A 3WNPA 3BP5B 1RK1B 1M6OB 3W0WB 3TBSA 2C4FT 1I8IA 1HILB 3S5LB 3E3QC 1UWGL 1H3WM 1A9BB 3NAAH 4QO1A 1BEYH 2H3NA 4WFHE 4NM4H 1G7QB 4JRXB 4M5ZH 3O0RL 1JPFB 3GBML 3OZ9H 5EWIL 5BO1H 3O6MH 3BVNA 1IZKA 1MREH 4LCYA 4IDJH 5CMAA 2I9LA 3F62A 4CDHA 5I1JH 1VACA 3FOLA 1R5VA 5KSUA 3UMTA 4PJBF 3JWOL 2R8SH 3QUMH 1QZ1A 4NRYA 1OSPH 3MLRH 3QDGD 1IAKB 5EH1A 5JUEH 4NYLA 5C0EB 1LO3L 1JV5A 2Y5TA 3VXQA 1FNEA 4LSQL 5D71H 3U0PA 1R5WA 3ILPB 1HYRC 4TUKL 3MRFA 1N6QL 1W72L 3VRLF 3IDMB 3DGGB 1MVUB 4OI7A 1U3HC 1NEZB 1Q9WB 4D9QD 2XA8L 1PX4A 1G9EA 3KYNA 4YHPB 1LWRA 4HMCA 1VPOH 3WKNA 4X9FA 4WY7H 5I1EH 2R15A 3I02A 1HOCA 1YEGL 2NX5D 5GGRY 2D4DA 2QQKH 3MUGA 1L9MA 5EUOF 4QRPD 2WWKT 2I60H 1FZOA 2G2RA 4JJHA 4APQB 4QOKB 3L95B 2DWDA 4LRNH 4NJAL 2V7NB 3P11H 4CNIB 2EDXA 2H1PL 1ED3A 3CXHK 1IKNA 2ZJSL 4OFPA 3ZT5A 5ID1A 4IS6A 2Y25A 3UZEA 2DQGL 2KZ1B 3WLWD 4QT5B 4TQEH 3CFDB 3NH7H 2VDOL 1UACH 1L7TL 4UB0L 5ESAA 1OCWL 3HE7B 3KXFA 5F6HI 3X3GH 5KG9B 3VFPA 3L3GB 1MQKH 5CEYB 3F58H 2XWBA 1RHFA 1W0WA 4TSAH 4YXHH 3D9AH 4ODHH 2X9WA 5JR1H 3MRBB 2FATH 3RVUD 4CL7A 3SBWA 3RZCB 1BGXH 4NCC2 5GRZA 2A6IA 3D3VE 4M48H 4I5BA 1U3YA 1FLTX 3WNLA 1LDPH 5HDBE 4YX2H 3T4YB 1FLRH 2H6PB 4U1IA 4GG6E 1UXWB 5T33H 5SX5H 4YGVB 1QSFE 3TN0A 4F9LC 3AS1A 1XGPB 5CFHA 2HTKC 3OMZA 4X9BA 5CEXA 4U1MB 3IDUA 4RFNC 1TQBB 5CD5D 1P4IL 4ZDHB 5HHQA 3OR6A 1BMGA 4I9WD 3OXRA 4YHKH 3Q6FA 1C1EH 1DSFL 1S9XA 3QDJA 4ZOAA 5I8EA 4OIIH 2XWJB 4JZJB 4Z5RA 1NLBH 4LLVA 5BZWB 1KTRL 4PJ7E 4ZTPH 4W4OA 1HNFA 5DJZA 2H2SC 3MGOB 1ACZA 5IM7B 3T77B 5LGJB 4AIXA 3VH8G 1UZ8A 2MKWA 1JTOA 4K9EC 3ZTJH 2BVUA 1ZHLB 4Z95L 1TFHA 1QFHA 4MAUH 1CQYA 5GPRA 2F54D 4OCLC 5DLMH 1YYLH 3EHBC 1F11B 3FO0H 43C9A 4P2RA 3INUL 2B1AL 1KYOJ 1W0VA 4WDIB 2VLMD 1UZ6E 2HVKB 3FOMB 2Z4QA 2GITA 2VAAA 1KN4H 4QRQB 4NJ9H 3UTSD 3QP3A 2C3VA 2R56L 4OFYD 1MRCL 4TUJB 4Q9QH 1TJHL 1YQ2A 3U0TA 1HXMB 4RZCA 1JWUB 1FO0B 1JHTA 5CBEB 1A6AA 5I1AA 4X99B 1L7IH 2OMNA 3IFNH 3O6FD 1RZFL 4NC1E 3RX7A 5ANMB 4ONHB 1OW0A 2WBJB 1Q72L 1XIWD 3FRPG 4HIXH 2HJFB 5LXGH 3E2HC 3GMRA 5ID0A 2ICWA 4OZIE 1BP3B 2Z8WC 4EDXB 2VQ1A 1DFBL 1UYWL 5FF6A 2BNQA 1Q9OB 3WE6A 5ETUB 4X7TB 4YHZH 3DI3B 4LLQB 4KMTL 4QGTA 1E28A 1EXUA 1H5BC 1PQZA 2P24B 4WUUA 1DUZB 5E08L 5DD5L 5I9QB 1MAML 1IAIL 4YXKL 3P9MA 4JZNA 4WWID 5DUPH 3QAZB 2AV7A 4FFVC 4UQ2A 1R5IA 4ZFFB 1MPAL 2G75A 2NW2A 4J8RA 4XNZB 4YFLF 1ZHNB 4W4NA 2X1QA 1WISA 4AM0A 1UM5H 1FJ1A 2GJ6D 3D18B 2X1XR 1IEAA 4XMPH 1A02N 3WFDH 5IR1A 1FZMB 3BHBA 3R8BB 2ARJB 3O3AA 3HFMH 4JFED 5ACZA 3G9VA 4JRYB 3Q0HA 2IPTH 5HDOA 4OD3L 4R3SA 5TE6L 1QSEA 1FGNH 1OB1B 4P4RB 4MNQD 3QZWB 1F13A 2J8UA 1B90A 3V52H 5EO0B 1T1ZA 4MMXC 4O2FA 1JPST 1SEBA 3AAZA 1QFWL 1NCWL 2HFFA 4LFHD 5L9DL 1VGKB 4QRTA 3G6JA 3W2DL 3KNBA 2J8OA 5I17A 1KTKE 5CWSA 1I7UB 2DQJH 2HJKB 4KK5C 4LMQI 3CVHB 3RJQB 2RGSA 3UC0L 5D1QC 5I15L 3SEPA 3TCLA 2HLAB 5FDYA 2Z8SA 1Y0LA 2J1KA 1V3KA 4G6AD 4GOSA 2FIKB 2DIJA 4F3FA 4LLUB 5I1CH 5I1KH 4XBEH 1OARH 4OFIA 1AKJB 4L5FH 3UJJL 3MC0A 3UYPA 2VIRB 2VR4A 5MENA 5KSBF 4F2MB 1VHPA 2R39A 2FGWL 3DLQR 1KEGL 3LRSB 1KJ2B 1KPVB 3MRDB 4RMTA 1KPRA 4O4YL 3FB8A 5DT1H 4MA1C 2YXMA 3PHQB 1E6OH 3DXAD 4BUHA 3H7BA 1VESA 4LEOA 3B8YA 1FFNB 3O8XB 2K9UA 5LJYH 4HPYL 4G7YH 1IKFL 5DJXB 1HCVA 2BVPB 5F7UA 4PJIE 1KCVL 3O45A 1IGJB 1W8NA 2YKLL 4PB0H 4HZAA 4CVZB 3K4AA 4XHJC 4PPTA 1FIGL 1A3RH 5CAYB 5J13B 4U0RB 4P5KB 2H8PA 1LE9B 3LPGA 4PJ8A 1JI2A 4HF5H 4NZUH 4OLVL 5L2JB 2P5WB 1CTOA 2WQRA 4M7LT 3QFJD 5JMOC 1HSBB 1MFNA 3SE8H 1J1OH 5B21A 4FQLL 1CR9H 2OTWB 1CDBA 3MBXL 3PGCA 1TENA 4I8DA 1FSKB 5FCUL 4BKLB 5FYJH 1NFDA 2F8OA 5D7IA 3VFMA 5KVGL 1MWAB 1E4WL 1AO7E 1DBJH 4WFED 3PQYE 3PWNB 4QTHB 3MJ9L 2UZIL 5KN5B 1A1OB 5JQHC 4QXTA 4HCRH 3G08A 5GZOC 3LN4A 5FOJA 2VXUL 3KYKH 3TBVA 2MQ3A 1WFOA 1CD1B 2UY6A 3RAJH 5E24E 1T66D 4DWHA 2P5EA 2F74A 2HRPL 2OR9L 4YHOL 4HWEH 3ZKND 3G04B 4PJXF 1S8DB 5HD8C 3U7AA 1R3KB 1IGIL 2QSQA 1E6JL 3M17B 3HUJB 2D7TL 2GY7B 4TUOA 3UAJD 4WFHD 1LE5A 2BX5A 2W60A 1MI5A 2XTJE 1U8HB 1S7VA 2AABH 3C60D 3SDCC 2XIDA 4HJJL 3U6RB 3WIHH 1F5WA 5C0FA 3ESVF 5IHBA 1AXTL 5FECB 1U3ZA 1E4KC 3BMVA 5BS0A 4JFFE 4OTXH 1VFAA 4OV5A 1I85C 4U3XA 3FN0H 3VWKC 4NZTL 5FYLE 5EZOL 3QDGB 1CFVH 4BH7A 5C08B 1RULH 4HS6A 1GGUA 3KPMA 5EZLA 4W6XB 4MJ6A 1LO2L 3MUJA 3VMOA 3CPLB 25C8H 2VH5L 3PV6A 3ZYJA 3L3KA 5CD3B 3T4AA 2DDQH 2MHAB 4XCNA 3ULUE 3EO9H 2ADFL 4JPKH 1V05A 4HUUA 3TO2B 3QDJE 1PZUB 1K6QL 3T0WA 3TFKC 4BQBA 5HDLA 2VMFA 3IJYB 4JANB 4M7JL 1NJ9A 1K2DB 3VFRB 1A7QH 3ULSB 3MNWB 5A3IC 2NX5B 4NQEB 1RZKH 3SKUD 3CJJA 3MRMB 3HAEH 3HB3C 3ZSSA 1CFQB 1FORH 3PGDA 4ZQKB 4JGMA 1AC0A 1XF5A 4K8RH 3EDEA 2DAVA 4P5MA 1FHGA 1NPUA 4FP8L 5D2LA 3ARXA 1P2CB 3QYCA 4P2RE 2HT4C 4S1DD 1MJJA 3DYPA 3PDOA 3GSQB 5DZLA 4M6ML 4JQVA 4LGRB 5FGRA 4QYOB 3MRGB 4YWGL 1LO0H 4HUWB 4X4XA 1JGLH 5J1TC 4QRRE 3IKCA 5FYKH 1HDMB 4QKXB 3MV8E 1R3LB 2E9BA 4C4KT 3KR3H 1YY8B 5FKPA 3NAAL 2N1KA 1BEYL 2YD3A 3BPOC 3KWWB 5E1AA 4TSCL 2H26B 3KYMB 4ZUSA 3DV4A 5B38B 2GSIA 2XKNB 2CK2A 2FHCA 1CDJA 3MYJA 4M8QB 4M5ZL 4XMKH 2ZCHH 5JIPA 1SHMA 3D3VD 3ZYOA 3L3OA 4JG0L 5SV3A 8FABB 1P69B 1GH7A 3BSZH 3ET9F 4YHNA 1T7YA 3OZ9L 2MNUA 5BO1L 3O6ML 1F58L 2DB8A 1ZWIA 1PYWA 3MLUH 3OJMB 2QSCH 4GRLC 4JB9L 4IDJL 1IC4H 5HXMA 1QSFD 1FYTD 5I1JL 3WN5A 4Q6IC 1OAYL 1TVDA 3V6ZB 4X5XA 4JO2L 4X7FC 2BZDA 5A40E 1RUPH 1GOHA 3QUML 5F96H 3PJSA 1J0IA 1OSPL 3MLRL 2XY2A 3DROA 2LAGB 5JUEL 4OB5H 5E00A 4XHQA 1JCKA 2ED9A 2GTZB 2YPKB 4HIIB 5A1AA 1SJXA 3CSPA 2PNDA 4I1NB 3WFCH 1TNMA 2BMKA 3WYRA 5GIRA 1EBPA 4M43H 4FMKA 5HVHB 1IL1B 3L5XH 2F54B 3SGEH 4YIQA 1RU9H 1GGBH 1Q9LB 1GC1H 5E2TH 4AL8H 1QLFA 4KXZH 1HXYA 4JPIA 4HIHA 5C0DB 4JY6A 2A0LC 1MCIA 1VENA 5I8CA 3QEHB 1HHHA 2QQKL 5E8NA 4DVRH 2XN9B 4OLUH 3ROOA 1MOEA 5GGRA 2GCYA 3MFGB 2I07A 2I60L 3F7QA 4UT6H 3UTSB 4P3DA 5J7CC 4H88H 4LRNL 4HK0A 2IWGA 1IRAY 2KZWA 3T3ME 4AH2B 3P11L 1QSEE 2IG2H 3WBDA 5CJOL 5JO5B 2EDQA 2IBBA 2ID5A 4E5XA 2BSRA 4PY8I 4XGZA 3V6FA 4TQEL 4QXUH 4OD1H 3NH7L 5DD0H 1LD9B 2NYYC 3O6FB 1EO8H 3X3GL 1MQKL 4PG2C 3F58L 1XIWB 3G6DH 1D5MA 4HWBH 5JMRA 4TSAL 4YXHL 1NDMA 3D9AL 3OKLB 2BVEA 2SEBA 3ARSA 3QUZB 1IGTB 5HYSA 1GZQB 1BBDH 4NQXB 2IAMC 1XFPA 5JR1L 3WHE0 3VGFA 1S9YA 5GS1C 1BGXL 2OS7A 3C09C 4CDGC 4P3CH 5DYOB 4XAWL 3P73B 1R24B 1V7MH 4JFQB 3NFPA 3QDHA 1A22B 4YX2L 1JMXA 2EDOA 1FLRL 4P23D 4R97C 1OY3B 5T33L 4PJEB 5I74C 1OPGH 2DQCL 5AEAA 4NQUA 5BCAA 5L7XH 4HGKC 3FB6A 1FE8H 4YUEH 4KVNH 2BFVH 1X5KA 4YHKL 3OTTA 5EU6D 4HGWB 3X12B 4OIIL 1UB6B 6FABH 1S3KH 5IUSA 3ORJA 4X80H 5MI0B 5CCKH 1NLBL 2RCSL 4WI9A 3BPLC 5JOPE 5EOCH 3U7WH 5DD3L 4PREB 4ZTPL 1A9EB 2NR6D 1NC4D 4GBXA 5HSFA 4JFEB 3TF7C 1K4DA 4HAFA 4Q2ZA 5DI8B 3PDGA 4MAUL 3HZYB 1N26A 5C0AB 5DLML 4Y4FC 1YYLL 4WHYG 1HCFX 3FO0L 4RDQG 1D5ZA 3GIVB 1ORSB 2CXKA 3MA7A 1IILE 1U91B 4YBHA 4IRSC 3TYGH 1U8QB 2D9QB 3EYOA 2BXZA 2CIKB 2EH8L 4LSVH 5F89A 5AUMB 1NFDE 5E03A 3NGBC 1KB5H 4DFHA 4OZGB 5B4MC 4B5EA 4XP9H 1XR9B 4KKLD 1CE1H 3QHFH 3WXVL 1ZT7B 3D39A 4RISH 1FFQA 5F7YC 2ZSWA 3NN8B 1HHIA 1YJDH 4ZFGH 2GSGB 4ONGL 5EIIB 5D7JD 3MREB 3GSVA 1ZLUH 3BDYH 3P4MA 4OCRH 1OTTC 1INQB 3HTLX 4D9LH 5LXGL 5EO9A 2FBOJ 1C5DA 3AFLA 1EH9A 3I2CH 4MB4A 2P7TB 2Z31B 4LDOB 3P4LA 3B3IB 1ZOXA 4MJ4A 4JHAH 4JFZH 3BT2H 4NQCE 2R2BA 4YDLB 3IAGC 4X7DC 5JHLL 5GGVH 2R1XA 5HJ3A 2EXWD 4POUB 2ATKA 3PDDA 4OZHE 5HGDB 4YHZL 2NY4D 3GM8A 5CZXC 1QD0A 3DXAB 4MDIB 3RUGA 5I8KH 3DRQB 3PWJB 5BS0E 2R23B 3RTQA 3ZE0F 4XPGH 1OAXL 1EGJA 2BVYA 3LZFL 3BZ4A 1LEIB 2OCFD 3W5NA 1G7IA 4H1LB 4JDZA 4ZYKA 1G9ML 1TZIB 4L3EE 3KPRD 2DRUA 3T0VA 4NP4L 4HFUL 3QFJB 4NO2A 1INDH 3VMPA 3WFDL 1KLUB 5L88H 4DUVA 2YR3A 4TRPH 3HFML 4R4FH 3VE0A 4BYHA 4UINH 5D1XA 2IPTL 4U6TA 4ELMF 4BZ2H 2GT9A 5T5FH 1JGVH 1FGNL 4K23L 2X6MA 3RY6A 3TWCH 2NXYC 1HKLH 3V52L 4IJ3B 3QI9D 2FBJH 5T5NF 2P8LA 4MXVE 3BEVB 1AO7D 3CFKB 4GRMB 4Y0GA 3PQYD 4KRNA 1K8DB 1G6RL 3V4VH 5KS9B 4S1RH 3QQ3B 1IKNC 4RFOH 1TPXB 3BH9B 4MX7B 3O9WD 3K2UH 2DQJL 5FCSH 2CSPA 2CQVA 3QEQB 5IB5B 1JRHI 4QLRA 5DK2A 1SYVB 4PJGE 1SMOA 5AAWA 5EU7E 3BIBX 4HT1H 4Y4KD 1QFWM 4K8RC 5I2IB 5ESQA 2F5BH 5HHPA 1YEEL 4H25A 5B39A 4Z7WF 3LB6C 4PJBE 3LKPA 3BN9C 3V5HB 2R0WH 1PG7H 5KSAD 3X3FH 1N3NB 4OLEA 5I1CL 2VDPH 3C60B 3SBWC 2ICEA 3ARGA 4M7ZC 1X5JA 5IVOA 2W07A 1IZJA 1T7XA 4L5FL 3U46A 2XTJD 3LB6D 2WUCH 1K9TA 4EDWH 4QHUB 1A6UH 4CVUA 5BZDA 1RV6X 1D5BB 1X5GA 1TJGL 4XP6H 1GL4B 4JFFD 5C1MB 2V7HB 3TN0C 4CW1B 2AXFA 1EO7A 4R7DB 1VKXB 4JQXA 3B9KD 5HYIA 1AI1H 1Z5LB 2CXGA 2J8UF 5FYLD 3OHXB 2V2XB 4YR6B 3TO4A 5DT1L 1FNFA 4NQDE 3ZTNH 1E6OL 1U8LB 4F7TA 2Y6SD 4LLWB 5D72H 1ZA6B 2D7NA 1IC7H 2GUOB 4WEUD 1NGZB 3D0VB 1HN1A 3G6JF 2JCCF 3BRGC 2CO7B 1HQ4B 1XF4A 3AS0A 4DTGH 1ZHKB 2XNAB 3ULUD 1FZJB 1RY7B 3B9EA 4W4OC 3QHTC 2YD5A 4NBZB 3GMQB 4UBDD 3VXMD 1T22B 2NY2C 2GIYA 4OIAA 4L29A 5H2BB 2EDEA 4AG4L 4NKOA 4KJYA 4UI2A 1S7TA 4JJ5B 3H3PH 3SE8L 3BH8B 1EFXA 1CR9L 3D69B 2CLVB 3BZFB 1NUFA 5FYJL 2A6JA 3FFDB 1TVBB 5SWZB 1TLKA 5CUSH 4YHLL 3TJEH 1DBJL 3U2SA 3SQBA 4XNYH 1D5XA 4P2RD 3TIEA 1WC7A 2COQA 2X4OB 2IH1B 5FDWB 3LSOA 1ZLSL 2ZUYA 4HCRL 5F7HA 2X70A 3GKWH 3KYKL 3K3QA 1RUAH 4OLWH 2VDKH 2RFXA 4QRRD 3K7UA 1OF2A 5DVLA 1DE4B 3KPQA 4W81A 3HR5B 4NDMB 3MV8D 5JTWA 1OW0C 3HZVB 3QCUH 1SYSA 2VLJA 3NZHL 4HV8A 4B53A 1FL6B 4IOFC 3GSRB 5D7LA 1MHCB 1R3JA 3QWRD 4X6CB 2I5YH 3H8NA 1N4XH 4KK8D 1SVCP 4KMLB 4WI6A 2AABL 3EYSH 3WIHL 4N0UA 3VWJD 5EIVA 5TGBA 1JGDB 1FYTB 4XVTH 3TNNA 5DEGA 2DM7A 4OTXL 1ZVHA 3CZFA 3TT1H 3FN0L 1EHLH 2V2TA 4B7IA 5D7IF 2X5PA 5D8JH 1BF2A 1RULL 3FZUC 5SX5K 3IJHA 5MP6H 5HVGB 4J1UA 5D7KE 1EMTH 25C8L 5DJCA 2BP3A 4WO4D 5A2FA 3OKKB 5TPWH 3EO9L 2VC2L 4M3KB 3FZUD 2AJUH 2VDQL 1QLEH 4XPTL 1IAOB 1U8NA 5HHOA 3GNMH 1A7QL 4P9MH 3EO0A 3IDXH 1RZKL 2V5MA 2E27H 3MJGX 1VFBA 2H2PD 4I4WB 1MRFL 2V17H 2OL3L 2ZUWA 3FT4B 1G7JB 4JFPB 1H3TA 3WXWH 1BWWA 1U93A 3IXTA 3VFSB 5SX4H 1BQHG 5FGSA 3RWHA 2VZ3A 1HHKA 4KQ4L 1T6WA 1NGQL 4Z76A 1Q9KA 2DIBA 2EEAA 5CIPA 2HFGH 2IQAB 4DGVL 1IGYA 4P5TB 5HGGS 2W59A 4HHAB 3JV5A 4F15B 3C9NB 5IMLA 3Q5OA 5JORA 3QXWA 3L9RB 2NZIA 1LO0L 1JGLL 4FOMA 3HE6A 4UUJA 3ARBB 4PJ5B 3W9DB 4C58B 2PW1A 1BQLH 3TCXA 1GCFA 5FYKL 1S7WB 3BWAB 4UDTB 2B8OT 3KR3L 2YHGA 2HA1A 1KFAH 4P2QA 3D39E 3MOQA 4EKXA 1LMKA 1CICA 2GK2A 4OZIB 1DBKH 1HEZB 1A1NA 5H37G 5D9SA 3NFSL 1LNUA 2ZCHL 2OXGA 4F33A 5E1HB 5HPMA 5KVEL 4P23B 1I1AA 5JHDE 3BPCA 3QO1A 1MCKA 1CLCA 5T1DL 3BSZL 4L4TE 4DKAA 4HIEA 3RNKB 2XOTA 4KV5E 2QSCL 2P47B 4FXGB 3GMMA 4E0RA 1MIMH 3LHPH 4YJZL 1WIUA 4Y4HA 5EU6B 5C09E 4RMRA 4KJWD 1RUPL 1DQJA 5F96L 2CLRA 2HN7A 5D2LF 4XNUH 4XCCH 3BP7B 4OB5L 1JNHA 1KG0A 1NC4B 3VJ6B 2APTA 3RUGE 1NKOA 2XZZA 5JOPD 4XBPB 4XP4H 1DEEA 3KLHC 4M43L 5C0IA 2XI9A 3L5XL 2BHYA 1NANI 2BY1A 1H3VA 1GPOH 1CFSB 1MELA 5IG7B 3OGOE 4OGYH 1NDGA 1C16A 5EPMB 1DDHA 1GC1L 4PJ8C 5E2TL 4AL8L 4QCIA 4F9PA 1BFOB 4OZFA 2M2DA 2G60H 5CSZB 1M7IB 4Z7NF 1AHWA 1YEIL 1QRKA 4BFGA 4H5SA 4NKMB 1RD6A 2EDJA 4KGLA 4DVRL 4P4KD 4OLUL 2BSSB 4JO3H 3N9GH 5ISZA 2OX5A 1QFOA 2FX8H 5BVJB 5C7XL 4G6KH 3QIUD 2BDNH 3HLAA 1IBGH 4RWHA 3C5JA 4JVPA 4Y5VB 2IG2L 4QF1A 4M62H 2K3TA 4MJIA 2GAZB 5FKAB 1OAUH 1NSNH 4FG6C 5BRZE 4QXUL 4OD1L 5DD0L 5GISH 2GK0A 3V4UL 3VXSB 1FL5B 5CP7B 2QV2A 1EIBA 4G80B 4PP2B 3V5KB 4I2XE 5D7JB 1EO8L 4IRZH 3SDXA 1CE6A 3HRZA 3KGRA 2V9TA 4HWBL 1WTLA 4LLMB 3ES6A 3VD5A 3GSNA 4K71C 3PHSA 3TVMA 5FM8A 1BBDL 2OMBA 5HI4C 1T5WB 5IB1B 2AJYL 3V95A 4P3CL 3DV6A 1NQBA 1KB9J 3MRCA 1S5HB 2YUWA 2AK4A 1EGJH 1OAZL 4LSRL 1IJ9A 2W0FB 1UQSA 4UMGA 2DTMH 3R06A 1DUYA 4F7MA 5J1AB 4FFWD 2E9JA 3HZMA 1XGYH 2DLGA 2YC1A 2NY4B 4NQCD 4Z18A 3AS2A 4S1QL 4DOHE 3EKCA 4ZUWA 5ERWA 3PWPE 1JHLL 4W70A 3KJ4B 4G43A 4X6DE 1R0AH 4YUEL 1F8TH 2BFVL 5F9WB 2YMXH 3FQTB 3OX8A 3HMXH 6FABL 2C1OA 1P6AB 3MRNB 2N56A 5T5NG 5FO8B 4X80L 3P0VH 4PJIB 3KPRB 1MJ7H 3ESUF 2B5IC 1CU4H 4GKNA 4K3GA 1C5CL 3N50A 4MCYB 4PLKC 2VAJA 4L3ED 4E9LA 3OPZH 4PD4J 1FQ9C 2HVJA 3E6HB 1DVFD 1BM3H 4MD0A 1RI8A 2AJ3A 3GIZL 4Q0XL 1T21A 1JP5A 4GO6B 1KLGA 1CXIA 2X4PA 3GHBH 2NY3C 4GAFB 1I4FB 4RNRB 2VSDA 3QI9B 1M05A 1DLHB 4CKVX 1AO7B 5DRWA 3TYGL 2ZWLT 5E6ZA 4AEIH 5DHVA 4CMHC 2FZ3A 3FFCB 3O4LE 2D9CA 2VSCA 4Y5XA 4LSVL 2VDMH 4N1CA 3M1BA 5FOBB 3GFUA 1KEMH 3DO7A 4HZLB 4JFOA 3T2PA 1KB5L 3SJVB 1U8MB 3C6LD 3OKNB 2OZ4A 4JQVC 4XP9L 5ILTL 1RIVL 4OFKA 2PYFB 4F7EB 1CE1L 3QHFL 4HS8H 1ZT1B 4Y4KB 4FTVE 4RISL 5F6IB 1UJ3A 1YJDL 4ZFGL 4YK4B 5KSAB 4OKVA 3QPQC 4YFDB 2YBRB 5IMKA 2BOCA 5GZNC 5JXEA 4YAQA 2F19H 3KPOA 4OCRL 3PNWB 2XTJB 4JEGB 3QUKA 2FL5A 2G9HA 4M61B 1AD9B 5I76B 5E6YA 3RQ3A 2FJHA 2UUDH 1F90H 1A6TB 1CFTB 1OD7A 2PTVA 1AGBB 4KKNA 1CT8B 4JFFB 3BT2L 4DEPC 5D7LE 3D85B 4EQ3A 3B9KB 1JL8A 3PL6D 1VADA 4OGAC 5E2WL 5C8JA 1WQVT 4J3SA 3FO2B 4F58H 3SDDA 3WN5C 1CFBA 3RNQB 4EBQH 1QBLH 1TZGL 1BVLA 4WGWB 3VG9B 3WFHA 4Z7UE 4NQDD 4XPGL 1CXEA 3G5VA 4OGAD 4RGNC 3VXOB 4XWGL 4CJ0A 1ACYH 3IDYB 4GW1A 3MFFB 4DKEH 3V0VB 5DQ9B 5DRNA 5INDA 5GRWA 4HWZB 2EC9U 1QUNA 3CGTA 4KQ3H 3VXMB 3S98A 3KG5A 2JK5A 1Q38A 4FQ2H 2PO6A 4X4ME 3MRRB 1HIMH 4XTRC 5CZVL 3QA3B 3T0EE 1INDL 2BVOB 4ZG1A 5L88L 4TNVF 4R4FL 4BFIA 4PRBB 1V3JA 3TJHC 3BE1H 3V79C 3ARFB 4YDIL 2CDGA 4PJFA 4Y19A 1JGVL 5T5FL 2ADGA 3KPSA 4FQ1H 5HGAA 1RZGA 3TWCL 4KZDL 1CG9A 1HKLL 2CR6A 4DUXA 1YNTB 3DX8B 4F7CA 3JWDH 4P57B 5FB8B 3STZB 3V4VL 4S1RL 1RJYA 3NTCL 3IF1B 2NLJB 1EPFA 3FO1B 4QRRB 1GGCH 1NCBL 2XACC 4GUPB 5DJYA 3GHEH 1EEZA 1MLBA 4HIJA 3MV8B 4OF0A 4ZFOA 5A2IH 4Z0XB 4HT1L 2QHLA 3DURA 2CKBA 2QTEA 1MLCA 1W72B 1AGEA 1AY1H 1NL0H 4JCMA 3QIWB 4TPRH 4ZS6C 2DLHA 5DFTA 1PG7L 5FUCE 3X3FL 4BQCA 5CHNB 2ARJQ 3K4ZA 3FQRB 3S88H 4EXKA 4YHIA 5BJTA 4PRHE 1FVEB 2XPGA 3FN9A 4EDWL 1A6UL 2HG5B 4XP6L 2ENSA 2ZUUA 3NCEB 3SCMA 2CO6B 4IRJD 4LHUG 3CFEB 3MO1B 4Y5YB 4WNQB 2VQUA 3SKOA 1AI1L 4NRZA 4DKFH 2EYSA 4WO4B 4WTWA 1UKSA 5C70A 5JDSA 2ZUSA 3VFOB 5D7KD 5D72L 3IFOA 1IC7L 2CPCA 2F8VA 4JFXB 3L7FB 5L0QC 3C2AH 3ARQA 1T0NA 3MTRA 4G42B 4DTGL 3TBYB 5BV7H 3LDBB 4GBXC 4Y2DA 1I1RA 5CIPH 2VZ1A 5JLZA 5EC2A 3WO4C 1VGEH 3LQZA 3IU4H 3GJFH 2WIIA 1JUFA 1BOGB 2A73A 2NTFB 2EZ0C 2ERJB 3H3PL 3PXHA 4KC3B 1IAII 1INEH 2X4UB 3DOSA 4MD5A 2VZOA 3TJEL 1GXEA 3E1F1 4W68A 4XNYL 1CXHA 1HH9B 4GRWH 3U4EA 1IQWH 4O02H 3PHOA 4FQXD 2KKQA 5CBAB 3THMH 5TF1H 1RIUL 1BZ7B 4NO5A 4WI4A 5GS2D 5ISZE 3ZMRA 2EE6A 3GKWL 3S5LG 3ILQD 3QG7L 1IM9D 4JE4B 2VXQL 1RUAL 4OLWL 4YC2C 2B2XH 4L8BA 2JJVA 5B3NA 1SY6L 3MRJA 1AP2A 3MLTA 3W81A 2NZ9C 3BWUC 5K59F 4MAYA 5IROA 3CSYB 3IDJA 3BGMA 1OSZA 4O2EB 4CUCA 2QR0B 1HH6A 2WINB 1QR1A 1NAKH 5DRXB 3D39D 5H35B 4JKWA 3SDXE 1NMCB 1S7UA 2I5YL 3TA3A 1CTNA 1LO5A 3DUUB 3HCVB 3P4OB 5E6IB 2N7BA 1FRGH 1H0DB 3BKJL 5JHDD 3O2DL 4XCFH 3BGFC 4CN1A 2YSSB 4L4TD 2XZCL 1T2QH 3O41B 4HMDA 1XGTA 1E4XI 3O2VH 4MLSA 3GRWA 3TT1L 1EHLL 4HXBH 1J0KA 3ARZA 3T3PF 2JB6B 2YN3A 5D8JL 5DHXB 1PKQE 2Q87A 2JIXA 5ICXA 5C09D 2O61A 1ZS8B 2PN5A 4GAJH 5EOQH 3ZYZA 3MLXH 5CGYC 3GK8H 4ELKA 1EMTL 2Y1VA 4LPUA 3RTQC 4PGDB 1FP5A 3V5DB 1MRDL 3MNZA 5TPWL 1FG2A 1T1WB 5DS8A 4Z7VB 2EECA 1B0WA 1LK2B 4BSVB 2CLZA 3QJFA 2AJUL 5FYKE 4YHMH 5I75C 3OJVC 4V2BA 4KVCH 5EZJB 3GNML 1CD9B 1ZAGA 4MWFB 2Q6WB 4P9ML 3IDXL 3MRIB 4P4KB 4MS8C 5D1XC 1U8OA 1G7HB 4LPVA 1JE6A 4FXKB 4LCWE 4Q9BA 2VZSA 2YS4A 1JJUA 1IFHH 3WXWL 5JA8B 3QIUB 4WRLA 4WEMB 3RY6C 1FBIL 1WFTA 4G3YH 3BP5A 1RK1A 1M6OA 3W0WA 2JF1A 3NCBB 3BESR 1A9BA 2HFGL 2PF6A 1G7QA 4JRXA 4JY4B 4MQ7A 5E8EB 4PJDE 3U9PL 5CINH 5BRZD 2ZCLL 1OM3H 1JPFA 3KLSA 1BQLL 2NPLX 4L4VB 3VG0L 1H3GA 3FONB 4LU5H 3OGCB 3UP1A 3RGVD 4LCIL 4QHMB 3VGAB 1U2CA 1DBKL 4U1GC 5ELIA 5E2JA 3ARGC 1IAKA 3VD4A 5E8PA 1ZLUK 3QO0A 3L1OH 4DQOH 5DURB 1S9WB 3E8UH 1QFPA 2NQCA 3ILPA 4OZHB 3IDMA 3DGGA 1MVUA 5L6YL 1FC2D 3OXSB 3LHPL 1NEZA 1Q9WA 3ULVC 3EW3B 4JQXC 3PWPD 5AYQA 5IT2H 3NA4A 3KS0J 4AEHL 1BLNB 2GY5A 3P9WB 4L3CA 5FGBA 4YEFA 3TO4C 4YHPA 4POZD 2YPVH 5HHVH 2FLBT 4XNUL 5TE4H 5C0CE 3N85H 3F7PC 3MX0A 1JPSL 4XCCL 4DW2H 1AH1A 2VISA 3RU8H 2J3SA 2W9EL 4GLRI 2K7QA 2BJMH 3CFIC 5INCB 1IC5H 4APQA 1DVFB 1WK0A 4QOKA 3L95A 3RL1B 4NPYA 1BJ1J 5AG8A 4PJCB 2V7NA 3I6LE 1GPOL 4M1CC 4OGYL 1P7HL 4Y1AB 3WL9B 4AIOA 2VITB 2OZ4H 4GRWF 2LVCA 2XQBH 4QT5A 3CFDA 1I3RB 3AC0A 2G60L 1YEKH 3DVNB 3HE7A 4M1CD 3SDAD 2PW2B 3HZKB 5KG9A 3L3GA 5CEYA 3IXAB 4Q74A 2CDFA 4Z7WE 3ZLQC 2OXHA 4G6KL 1JF5A 2BDNL 1UCBL 3C6LB 4KRMB 3MRBA 3O4LD 1IBGL 3EJYC 4PRPE 5DD6B 1EFXD 1T83A 3UO1L 3NIGF 3MXWH 4M62L 1KGCE 5C2BL 1NBZB 5IFJB 3AUVA 1OAUL 1NSNL 2VN4A 4FRWA 5GISL 4AEEA 3ARVA 1JNNL 1KTDB 4WGVB 4C83B 1EUTA 1MCRA 2NY6C 3T4YA 1RZIB 4FTVD 4IRZL 2H6PA 3ZE1E 5A43C 4N8CH 1UXWA 4M5YH 4EI6B 4PJBB 3VRIB 2EDFA 2CIIB 1EFQA 4U1MA 3RY5A 2IALB 3JWDC 3DSFH 5CEZH 5EBLB 4OM1H 3JV6A 2WQ8A 1U8PA 2Y23A 4NGHH 4Q9RL 2H32H 2IQ9L 4EN3A 2RHEA 2LE9A 2XWJA 1A0QL 2X89A 4JKKA 4YBLB 4JZJA 2DTML 3QEUB 4FABH 1MCOH 5IHZB 3ARRA 5LWYL 2E7LA 1XGYL 3FKUS 5D2NB 4P0DA 3MGOA 5IM7A 3T77A 5LGJA 4CU8A 1A2YB 4P59L 1R0AL 3QFDA 4N0CD 1K4CB 2YEZB 1KIUA 3SY0B 1X5LA 3FAWA 4NHCH 1QRNE 2YMXL 2CUMA 3BD5A 5EUOB 1AD0B 2DI7A 2UWEE 4HX1B 1F11A 2X4QB 4LLDB 3GBLA 3TH2T 3HMXL 3I9GH 1XT5A 1ZHBB 1CLYH 4PP1D 3FTGB 4JM2D 2YD2A 4WDIA 3JTTB 1PJ9A 4ODSH 1MJ7L 2HVKA 3FOMA 3VD3A 2EO1A 1CU4L 3NFNA 3OPZL 4QRQA 3WJJA 2OR7A 4ZPTB 4GMSL 5IVXF 5EU3B 5T1LD 5KAQG 3T0ED 4H0IA 3WS3B 3HN3A 5IBLC 4TUJA 5IEHB 1EJ6A 1HXMA 1WZLA 1JWUA 1FO0A 3TLRA 4BELD 5CBEA 2PTTA 3VRJB 1JNJA 2OTPA 4KKCD 1JGEA 5KSVB 4UDUB 4AEIL 3S96B 2IPUG 4QHKJ 2CKBH 5ANMA 4ONHA 1ZLWK 5BV7C 2I27N 2WBJA 1TCMA 4TVPH 4KJPD 5AYUL 3LKRB 1KEML 1BX2A 2HJFA 3NPSB 5E4EB 4JCLA 4O5LH 4YFLI 1CFNA 3GJEB 3S9DB 4EDXA 4K7FB 1REIA 2AI0H 3HE6C 4HS8L 1LILA 4R2GD 43CAB 1Q9OA 2XICA 5ETUA 4K94H 4WI7A 4ZMAT 3OKMB 4LLQA 2VLRE 1UFUA 4ZXBA 2P24A 4FS0A 1CICC 3CC5B 5C07A 1DUZA 4P46D 4U1NB 5JW5B 1BIIA 1F90L 3JV0A 4OLXL 1D7FA 2J88H 1KJ3L 4PV9B 3GB7B 2F8XC 1I1AC 2VZVA 3I6KB 1YMHA 2XZQL 2DMBA 2IJ0C 1RJZA 4PRHD 3NA9H 4IRJB 5FK9B 1JZ6A 1NUNB 2XFXA 1G9NL 4ZFFA 3MRPB 2HMID 4GKZA 5FYJD 4F58L 1XGUB 4EBQL 4MHHG 4Y4HC 5I16B 1FZMA 5DHYB 4I77H 2ARJA 1H15B 3TIDA 4N0FB 4ODVH 1I9IH 5AWNH 4NIKB 3CUPB 1ACYL 1SM3L 1J9CT 4I0PD 5GGSA 1OB1A 3TH4T 4DKEL 4Y4HD 3T65B 3TZVA 3QZWA 4O58L 5EO0A 1AGCB 1DBBH 3SE3A 2VZTA 1OP3H 4BA8A 1RMFL 2C3HA 4HLJA 1F4WH 2WUBH 5JW4Q 3EZ8A 1S9VB 3BKML 3CMOL 1RUKH 5IJVB 2OM5A 4F9PC 4XB8A 5FFLA 1I7UA 2HJKA 5C0GB 1AHWC 1DANT 3CVHA 5IMMB 1DBMH 2WWKO 2Z93B 5HYJE 2HLAA 4FQXB 4PLNC 1B9ZA 3H9HB 4I3SH 3DPBA 1D6VH 2FIKA 1GAFH 1OGTB 3PIQB 1J1PH 1IM9B 4KUZL 5C3TA 3QUMB 1AKJA 4UIKH 1JNLH 4GKSB 1GGCL 4KRLB 3GHEL 1CIDA 1QP1A 3MRLB 4HSQA 3NBNA 4F2MA 4MYWB 4W6WB 3CX2A 3ME0A 1XGQA 3GRWH 3LRSA 4LNVA 1NL0L 3TVMC 1KPVA 2R4SH 4LLYB 5B22A 2IPKA 2J5LB 4EUPH 3PHQA 7FABH 5LKNA 4L4TB 1IEBB 3LN9A 1FFNA 3O8XA 4X83A 3RVXC 4N8VB 3N1MC 4XMLL 3K1KC 2DLFH 5EBGA 1IGJA 2VO5A 5C09B 3BP6B 4PJFF 5F7WC 3LEXA 4CVZA 1I8KB 3BGAA 1DCLA 2FH6A 2XG4A 3MV9A 2ZUQC 4P5KA 1LE9A 2UY7A 4DKFL 3QUXD 2X4NB 4TTGA 5L2JA 5C6TH 2P5WA 2FD6H 3SDCB 5IGXH 2YA1A 4AIZA 2OTWA 1MF2H 1TQCB 4BKLA 1X5YA 3C2AL 3W11D 2IANA 1MWAA 3AU1B 4M4RA 4P9HC 4NT6B 5ALBH 1X6NA 5FYKD 4QTHA 1SBSH 1VGEL 4J3UA 5KN5A 2DD8H 5E94B 1A1OA 4GAGH 1LO4H 1HYSC 3O3EB 2HLFD 4OQTL 1KACB 2X1OA 1XR8B 1N8ZB 1CD1A 2VB5A 1INEL 5BXFB 3WD5H 2ED8A 4LCWD 4RSVA 4RX4D 2AJXH 1DQTA 3H9YA 5CSGA 5GS3A 9CGTA 4G9FE 4G8GB 4OCXH 2W9LA 1R3KA 1IQWL 4PRAB 1J12A 3M17A 4Y5XC 3THML 4OQ1A 5BRZB 1A4KA 4TNVK 4WIQA 1IVLA 5EBMB 1U8HA 2QLVB 3VA2C 5K9KB 1FNGB 4NBYB 3U6RA 1ZTXL 3P3YA 4JO4H 2OSLB 3SO3B 5B38G 3KDMB 5FECA 1UJ3C 1OAKH 2GTWB 1IEHA 1UM4L 2R1WB 5JXEC 3WEXA 3QDGA 5D5MF 1NAKL 1FFOB 4LSTH 1OD9A 3VD7A 3FMGH 4G5ZL 2ZOKB 1TDQA 3CPLA 4LKCB 4HC1H 4G6FD 3KYAA 5CD3A 1FRGL 3LV3B 5J4MA 4DOHB 1AGDB 4XCFL 3AXLB 2E9IA 2X4SB 1T2QL 3TO2A 3PWPB 4ZUUB 1CQKA 2HT3D 3CFBB 5D6CB 4HK3J 3O2VL 2XQYG 4HXBL 1EJOH 1ZEAH 3SDDC 4XP5L 4JANA 4HPOL 3T08A 1C8PA 2VDNH 4MXQC 1K2DA 5T3ZL 3LD8C 3ULSA 3GMLB 1JYXA 5IOPB 4GAJL 2NX5A 1YPZF 2NXZD 4UU9B 4C56D 3V7MA 4HJ0C 4J3OC 3MRMA 4X7SH 4RRPG 1ZV5A 5C0CD 4QRPA 4DJMA 4K7PH 2ZSVB 2C9AA 4ZQKA 3MLWL 2O5ZH 2I24N 2PXYD 4RGOH 4NUJB 1N59B 4F57H 4YHML 3QXAB 4KUCF 2PO6C 1AXIB 3UYOD 1NC2D 4NN5C 4P48A 3I6LD 2I26N 3GSQA 4KVCL 1B0RB 3RGHA 4PRDB 4C57C 5D93B 3U0WH 1MIEL 4QYOA 3SDAB 1XZ0B 3MRGA 4PJXB 4HUWA 2Z0BA 1DQDH 3EOTH 5DQJB 5IW1B 4JGJA 4JFDE 5DFWH 2OLDA 5F1NB 4NC2B 1HDMA 3PWUA 4U7MA 1AQKL 3O4LB 1R3LA 1YDPA 1P53A 3ROLB 1YY8A 1ES0B 2BNUB 5LAXB 1IGFH 1G6VK 1S5IH 2H26A 4PRPD 3WSQH 4L8CB 1MAKA 2P45B 2XKNA 4M8QA 1A6VH 2AV1B 1KGCD 5ANME 2OR8A 5DMIL 5CINL 4H0HB 2MFNA 1JF1B 4XCYB 2EICA 4J3WA 4S10A 4J3XA 1GIGH 5F3HB 5EDXA 3O4OC 2BXYA 1B4JL 4LU5L 3ZKXC 1X7QB 4ZOCA 1LEKB 4YNYB 3V6ZA 2R9HC 1X9QA 4F7PB 2AJZA 2EIEA 4MQXC 3ZKMD 4WTZA 1S7XB 5DEZA 3QG6B 2AEQH 4HLZH 4Y7MA 3LS4H 2YPKA 2GTZA 3BISA 1VSCA 1LEGB 3L1OL 4HIIA 4DQOL 4DZBA 15C8L 2OI9B 3SCMC 2ZUTA 1A14L 4XH2B 1IL1A 2IAMB 2F54A 2UVEA 2J4WL 4LOUC 4D0CB 3EOBB 1Q9LA 4E42B 5IT2L 3CK0H 5GS1B 4Z7UB 2IFFH 5IFAH 1QRND 5DSCA 5ECJE 2DOCA 2YPVL 4JM2B 5C0DA 5TE4L 1MCBA 2DBLH 3LKOA 4ENED 1Q0YH 4KI5E 5HYEA 3QEHA 5HDQH 1BIHA 2BJML 3JSSA 5T1KD 1FNHA 4JQIH 2WAHA 4JRYE 5T1LB 3UTSA 3T0EB 4EEEA 4ZOBA 4AH2A 4OCMC 4OFYA 1KC5L 4Y2DC 1QO3B 3I50H 5I71B 3QJHB 1ZT4B 1FNAA 1NGWA 5JO5A 2R0ZH 3MBED 3MGTB 4J12A 2MSPA 1LD9A 4HW6A 1U0QA 1YEKL 3O6FA 4O9HL 2R29L 3IETB 3NVQA 3BPLB 5J6GB 4O2CB 2ZOLA 1XIWA 3ARUA 3VW3H 3V6BR 2WWMC 3NOIA 3OKLA 1KOAA 1GZQA 4NQXA 1OLZA 3IRPX 1H3PL 5GGQH 3H6JA 3L5HA 4KHXH 3MXWL 2DL9A 5DMKB 3A6BH 4ZUVB 4A6YA 5CLWA 2YA2A 1AXSB 3DMMD 5DYOA 3P73A 4R2GB 1R24A 4JFQA 3OAZH 1NMAH 3VGGA 1A3QA 3QXUA 5C0ND 4ZNEE 2C7UB 4G6JL 4N8CL 4R4ND 5FEBA 2AKRB 4PJEA 4ZOEA 1ADQL 2BC4B 1EEYA 2OJEA 4MAYC 4LGPB 5IROC 1FDLH 2E8ZA 5A16A 3OAUH 4Z8FH 5CEZL 2VLRD 4LAJH 4KKAD 4OM1L 2GYSA 3M07A 3DUHA 5IW3A 1CDHA 4HGWA 3X12A 4PRHB 3TA3C 1UB6A 4EOWH 2VZUA 4MA7H 3S35X 3STBA 2JJTA 1KBGH 4GXUN 1MCOL 1GGYA 2GJ6A 1A9EA 3T2OA 2CDEA 2IBZY 2R69H 5ABDE 4JFEA 4LHUD 2CK0H 1A6ZA 3RVVD 5DI8A 3BQUD 4NHCL 3EJZC 1EUUA 3HZYA 4YGAB 5C0AA 4I0PB 4LK4A 4U3CA 4LQFH 2QQNH 5TQ2H 4MNQA 1HHJB 1B88A 1A1MB 1ORSA 3SOBH 3MLSH 3ALXA 1U91A 2BY3A 5FV2A 5IW6B 5F44A 3ARYA 4ODSL 2VKXA 1MFCH 1BQUA 2P5WE 1F4XH 5C6WH 2CIKA 2FEDD 5K9QI 3VMNA 5HI5D 3FOLB 5AUMA 5CGTA 5KSUB 4WENB 5F93C 3MACH 3LEYH 3QUYD 4OZGA 5IB3A 1XR9A 2VXSH 4NRYB 1WVZA 4NYLB 1XF3B 1FAIH 1SEQH 1ZT7A 4OCNC 1FNEB 1PVHA 3FHAA 3GJFK 3U0PB 5K59E 1BQHB 3NN8A 3SHSA 4FNLL 5HYJD 2MJWA 4LVHB 5EIIA 3SGEI 1FAKT 3LEVH 3MREA 1FG9C 4TVPL 1A7RH 3KJ6H 2VN7A 1INQA 4KXZI 1RFDH 1PY9A 4TTDD 2R1YB 1KJVB 3MRQB 5FGCB 3C5ZD 2L0DA 3B3IA 3RKDD 1HOCB 2AI0L 3HUJE 4C4KO 3VFWB 3UYRH 5JZ7D 3T3PE 1KXQE 1MNUH 3LKSB 1FZOB 4K94L 2G2RB 4IMLB 3VXNB 1ETZB 1J0HA 1T1YB 3HC3H 1QBMH 3W82A 3L5JA 3V7AE 5FA4B 3DXAA 4MDIA 4LMQE 3DRQA 2ICWI 3PWJA 2R23A 2EIBA 3CH1B 1MCDA 2Y06L 2EE3A 3HAEB 2NTSP 1SJEA 3BPNC 1QHOA 3EYQC 1NCDH 1WFNA 1ITBB 3MUHL 1LEIA 3KXFB 5C08E 3NA9L 4PGZA 4H1LA 2XWBB 1TZIA 3QUXB 2EXYC 1PKQB 3RWJB 3QFJA 4WI8A 1KJMB 1FIEA 4U6XB 3EO1B 4H26B 3WDHA 4I77L 5IBUG 5FGBC 4M7ZB 3S36H 4ODVL 1I9IL 3C8KB 4MNHB 4H8WH 5ENWB 3FAXA 3DECA 1MFAH 4HKXB 1NBVH 4NRXB 3LQAC 5GGTH 2NX5E 4NQEE 1DBBL 3RVTC 3BEVA 3CFKA 4APQC 3GSOB 2OP4H 1K8DA 1JRHL 5KVDH 1F4WL 5ICYB 5KS9A 1BAFH 4KJQC 5F1IB 2BHUA 5FA3B 1CDYA 2VXVL 1RUKL 5EU5B 1S9XB 4LCWB 3BH9A 4MX7A 1CBVL 4N5ED 2KQMA 3P4NB 5E9DE 3QEQA 4L8SB 5IB5A 1IGML 2HKFL 1SYVA 3HE7C 3MOAH 1DBML 1T2XA 3OV6A 3RIFF 4J7RA 5DJZB 1KIPB 5I2IA 4G9FD 4I3SL 3BZDA 3UZVB 3V5HA 2VKWA 1GAFL 3BIAX 1NAMH 1T83C 3C60A 1J1PL 4NKDB 3CNKA 4KKBC 1NFKA 4UIKL 1JNLL 3VXTB 1O7SA 1W0VB 2EIZB 4QHUA 2CRYA 1D5BA 1T0PB 3V4PH 2IBZX 3RZCD 1PD6A 2BY0A 2V7HA 3GRWL 1VKXA 2YN5A 2R4SL 2AAVA 4RMQA 1TQBC 4CU7A 2QEJA 3OHXA 4G6FB 3DGCR 2V2XA 4YR6A 1PEWA 1EO5A 3UTPE 2J7LA 4UOW1 4EN3C 7FABL 4RZCB 1ZA6A 3MCG1 5AG9A 1NGZA 2PETA 4JZJC 4R0LB 1JHTB 5I1HL 1A6AB 1HQ4A 5I1AB 1ZHKA 2XNAA 4HWUA 3RBSA 3QXVA 1IARB 2R2CA 1HWHB 2E7LC 1FZJA 1CGWA 1Y18B 2DBJA 3GMQA 1XF2B 4LCCB 2NXZB 3VI3F 3ZDXE 4C56B 4ELMB 3UZQA 5H2BA 5C0CB 5C6TL 4LQ1A 2CGRH 2RJMA 4NN7B 2C4FU 2FD6L 4JJ5A 3BH8A 5AZ2L 2PXYB 3D69A 2F54E 4LDLB 5IGXL 1MF2L 1ZANL 2CLVA 2GFBB 3BZFA 1FZKB 3R8QA 4FFZH 1KCSL 3FFDA 3R0MA 1TVBA 5FF6B 2FEEL 2BNQB 1NC2B 2NW3B 3TYFA 1MCSA 5JIKA 3K2MC 5J57B 3OKEA 2A1WH 1WAAF 4R8WH 4NWUH 3WJJC 1FN4B 2HP4A 2X4OA 2XN9E 1CVRA 2IH1A 4Z0BH 1EXUB 2FLRT 3UROR 1S9KC 4GAGL 1V7NL 4P2OD 3TC9A 1I7ZB 1S78C 2KH2B 4EUPG 4PIRF 4OZ4B 4Q6YA 3B2VH 3UTQA 2UVFA 3P9MB 2AJXL 4Z7WB 4JFDD 5E5MB 1DE4A 3HR5A 5IF0B 4PRPB 1CLOH 4X8XA 5J3HD 3MRHB 1FJ1B 4LRIA 3ZE2F 3VXUD 3HZVA 2WBJC 1IEAB 3SGDH 2O5XH 3D3VA 5IR1B 3GSRA 2MMXA 4ALAL 1MHCA 5L2KB 4X6CA 1J87A 5T3ZE 4QNPE 4NUGL 4KROD 2UYLA 4NQVB 4GG6A 1LP9E 4JO4L 2DQEH 1QSFA 4X98B 1JGDA 1FYTA 2J8UB 4NHUB 3J8F7 1YEFH 1BD2E 5K9OA 3AAZB 2XZAH 4OGZA 3BD3A 2B4CH 2XT1B 2HFFB 1OGAE 2DMKA 4XPAH 3IU3B 4QRTB 3G6JB 4ZXBC 2JCCB 3FMGL 1X5FA 2Z91A 1KN2H 4HC1L 5IFHH 4BZYA 5I9QC 4PJ7A 3OKKA 4X9GA 3ZL4H 2AW2A 4NZRH 4U1KA 4I0CC 2L7UA 3FT2B 3QAZC 4PGCB 2E6QA 4XAKE 4XNZC 2R2HA 5IVXE 3U9UB 4NKQB 1IAOA 3GI8L 4KI5C 4Q7DA 2VDNL 4XWOC 4LPXA 3E0GA 3SPVA 2F58H 1JWMB 1TVHA 1KB5B 2XG5A 3HI6H 1AQDA 2MPAH 4I4WA 2RIKA 3FB5B 4CU6A 4LNRB 5T1KB 3FT4A 1G7JA 4N9GB 3VFSA 2O5ZL 3TZVC 1A6PA 1C7TA 5C0AE 1WITA 4G7VL 4RGOL 3ARPA 3DETC 4F57L 2VQTA 3SE3C 4JRYD 1KCRH 2NY5H 2IQAA 3MBEB 4XI5D 3PWVB 4P5TA 4HHAA 3C9NA 5HVFB 4A6YH 1P84J 2R4RH 3MV11 4I3GA 3L9RA 3H7BB 3EOTL 3MNVA 5E8DH 3W9DA 1KIQB 3D0LA 5AZEH 4PYGA 1URLA 1S7WA 4AK1A 3BWAA 4UDTA 2ED7A 1AC6A 4ZPVB 1JWSA 3C5SA 1N7MH 1HKFA 4BQ8A 2H8PB 3DMMB 4OZIA 5KZCD 1HEZA 1A6VL 1UWXH 4YDJA 2C3XA 1QACA 4P23A 3LPFA 3UTTE 3SKMA 1UKTA 3MROB 3S37H 3UBXI 5D7IB 3RNKA 2OK0H 4KRPC 3IGAB 3VFMB 1BREA 4FXGA 1BZ9B 4LKXA 5EU6A 4GW5B 1MFDH 4PGJA 2HWZH 4QXTB 2VXTH 2ZUXA 3LN4B 3VA6A 3BP7A 3BW9B 3LS4L 4F37F 2B1HH 1NC4A 4OFVA 3O8XC 4K3EH 2AEIT 2G5BB 3WIFB 1F4HA 1PAMA 4LHUB 3VU2A 5IMOA 3BRFA 4S2SB 4IIQA 2DQFA 1CFSA 4C54A 5IG7A 5J13C 1FYHB 5EPMA 3IDNA 2IFFL 2FECI 4I0KA 4XP1H 5IFAL 5JQ6L 3MA9H 2HT2D 1MI5B 1BFOA 2X4RB 1XGRB 2ITCB 5CSZA 1M7IA 4ZD3L 1C08A 3RPIB 4NKMA 5IB2B 5HDQL 3EDKA 2AGJH 2BSSA 3FQWA 4HGMA 2YXFA 1VFAB 5BVJA 3QUYB 4EVNB 4ONFH 5F3BB 4TOYL 1N64L 1OWWA 3RWFB 1TTGA 3MOBH 5JW4M 4XVUD 2GAZA 2R0ZL 3AS3A 5CEZE 5FKAA 3G9AB 1F00I 4MJ6B 1OP3K 5BOZG 1FL5A 4HEME 1GOGA 3U30B 5CP7A 5E7FA 4H8WC 3RHWF 4G80A 5HYJB 4PP2A 2X41A 5D7JA 2FO4A 4E41E 3VW3L 4LLMA 4PYHA 5DA4A 5FO9B 3QXDB 3F65A 3QEQE 5GGQL 2EDDA 1QBBA 3C5ZB 4PY7B 3HNTL 5IB1A 1NJ9B 1OTUD 3QH3B 3MCKB 3A6BL 5EFIA 2A83B 5EBWB 1S5HA 2NY3B 5DDHB 5JPNB 2W0FA 3BEWB 5J1AA 3IDIB 3U83A 3RFZC 5SX4I 4XPBH 3G5YB 4U1SB 1IGCH 1JTPA 5GHWH 3P9LB 4U7SA 2P1YA 4D3CH 4DKDC 5D2LB 4U6VL 1KV3A 4C55A 4XVSL 4N90E 3SKNB 1FDLL 3CXDH 4GXVH 4Q9CA 3QXTA 4Z8FL 2GEEA 1MJJB 3PDOB 1MCEA 5HHNA 1J5OH 4HKJA 3UTZA 3LKQB 4Z7OE 3FQTA 5C2UB 3DX7A 1CL7H 4MA7L 1YECH 3MRNA 2EDLA 5FO8A 2ZPKH 5FUZL 5GGUB 1QKZH 2DQIH 1ND0B 4PJIA 3KPRA 3SN6N 4DAGH 2WNGA 3UBXB 5C08D 1KELH 5J11C 1LVEA 2A6DB 4MCYA 5GS0L 2CMRH 5CJQL 4YXLL 2R69L 5FKPB 5DUMH 1BFVH 4TVPE 5F7LB 2GSIB 4UV7H 4LQFL 2QQNL 5TQ2L 2K1MA 1I4FA 4RNRA 3SOBL 4LAQH 3L3OB 4KAQH 2WSKA 3QI9A 3LQMA 4JKPL 3BX7C 1IT9H 1DLHA 2MKLC 1AO7A 1WBXB 4PLJD 3PQYA 1MFCL 3D25A 4U6HA 2GI7A 1F4XL 4NQED 4LBEB 3WN5B 1EVUA 1K8IB 4YDVB 1HI6B 4GG8A 5FOBA 3DHJA 1SJHA 4HZLA 5SWZE 1OAQH 3O9WA 3WLWC 5M94B 3MACL 3SJVA 3LEYL 1U8MA 3OKNA 2Q8AH 3O6KH 4B41A 4RGNB 2PYFA 3MGAA 4F7EA 3IAPA 1MCCA 1L4IA 1SEQL 1ZT1A 4Y4KA 5E9DD 4G9FB 1IE5A 4RQQA 3KS0H 2BNRE 3Q1SL 4LSPH 1G0XA 1BWMA 3ARDD 1KT2B 5KSAA 3RVUC 4L9LB 3MODH 4R4BA 3HNSH 2YBRA 4BH8A 4XRCA 3JUZA 4YIQB 4HAGA 4N1EA 5J89A 1YEJH 3PNWA 4HUMB 1S7RB 2FDBP 1AD9A 5FUOH 3TT3L 5I76A 4JPIB 4HIHB 1UM6L 3CH8A 1BJ1H 1A6TA 3N1GC 2C4XA 1AGBA 1Z2KA 4L1HA 1CT8A 4JFFA 3HMWH 3ROOB 4OLZH 3UYRL 3B9KA 1BQSA 4X6CE 1MNUL 5CD5C 1RHHA 2IF7A 5MEOB 4HK0B 1QBML 3RNQA 2DQUL 3MPCA 5LCVL 4IHOB 4MLIA 5DZNA 1FYTE 1RZ8A 1HWGB 4N5UA 4WW2B 4LGSB 3UTPD 3VXOA 3S8WA 2LU7A 2NMSA 3MFFA 3V0VA 5DQ9A 3IDGB 4HWZA 5CZKA 5M95B 4ODUB 3VXMA 4YHYB 3QQNA 3MRRA 5HYSB 4L4JA 5HVHC 4QY8A 4YBQD 3QA3A 2B4CC 1S9YB 1T7ZA 3S36L 1I3VA 4PRBA 4MSWB 3BJ91 1OL0A 2AQ2A 1CIUA 1MFAL 3NFPB 3VXRE 3VFUA 3T8XB 2Y07H 5GGTL 3Q6GH 3X14B 3DX6B 4HS3B 5AAMA 1YNTA 1B6UA 5KVDL 2RR3A 3F7RA 4P2OB 4BFEA 4P57A 5FB8A 2V5YA 3STZA 4Z77B 1BAFL 2E8YA 2XN9D 3IF1A 2FHFA 2NLJA 2JTDA 3FO1A 5KVFL 5J06A 3O3BA 4QRRA 4JFDB 1DL7H 3H9ZA 1M71B 4GUPA 4KGJA 1A7NH 1CD0A 5CJ8A 5L0QB 4XC1L 5D70L 1UWEL 3O6FC 3MV8A 3MOAL 4LVNC 4Z0XA 3VXUB 1XIWC 5I19H 1W72A 4M1DH 3E6FB 4QGYA 3QWRA 4PJ5E 4PGEB 2NY5C 2R0KL 5CHNA 1X6LA 1NAML 4KROB 4R6UA 4F8TA 4MXWH 3RIAF 4HUXB 1G84A 3VWJA 4WUKH 3QUZD 4YE4H 5T3ZD 3FB7B 3WUWB 3MA7B 1FVEA 3TNMB 2HG5A 1N5AB 2F53E 4MHHI 3EYOB 3ALWA 2J6EH 2VLKD 4Y5YA 3MO1A 4WNQA 1T20B 3B43A 1BD2D 5HBBA 1B2WL 1OGAD 1JK8A 4WO4A 4DK3A 3A0OA 3UJIH 3MV7E 3VFOA 1P5VA 3L7FA 3ZZ1A 5KS9F 5EU6E 5MI0C 3O2WL 2JJTC 4G42A 3TBYA 4BZ1H 3K8LA 2ZSWB 1HHIB 3VH8A 3S35H 5C0BE 3BMWA 3CAFA 2FR4B 4PB9H 2N7AA 4XAKD 1RUQL 2W65A 5I30L 4RAVA 1JFQL 3QNYB 3RP1A 1BOGA 2NTFA 2K7PA 2CGRL 1P1ZB 4EIGB 3MJ6A 2X4UA 3P0YH 3CMGA 1T04B 4FFZL 4AEFA 3VI4E 3SE9H 4OAWB 4QWWD 5C0AD 4JM4L 2A1WL 2FSEB 1HH9A 3ZDZE 3VGEA 3AMLA 1XAUA 3CDFA 5CBAA 1BZ7A 2MCPH 1YA5A 4Y88A 3DBXB 3V9FA 4TSBH 4JHWH 3QIBD 2LTQB 3B2VL 1FL3A 4GMTL 3BD4A 2CKNA 4G6AC 4ZYKB 1UKQA 4JDTH 3CSYA 3VXSE 5KZCB 3FRPA 4O2EA 3V6OE 5GJSL 4QXGH 2QR0A 2WINA 1GSMA 5DRXA 2A6KA 4UV4H 4XZUA 1E4XL 2QKIA 3DUUA 2P8MB 3NIDE 3HRPA 3C6SB 3UTTD 4O51A 4HFWB 2DQEL 1MJ8H 2EDHA 2YSSA 4U6YB 4OCWH 4YDLC 1TETH 3O41A 3MMEB 3WO3B 3RIFK 2P8LB 1YEFL 3GSUA 3FCTB 1DR9A 1YZZA 2Z31D 3S4SG 2JB6A 4PJHE 3OAZK 4J4PD 5KTEH 4XPAL 1U92B 1ZS8A 4K9EL 4JFHE 1WV7T 5DWUH 4PGDA 5IFHL 5HGHB 1TTFA 3V5DA 3QDMB 4M6AA 4NZRL 3B5HA 4PJAE 1T1WA 1UB5B 4U4BA 4U31A 4Z7VA 5JIIA 1N5YH 2EC8A 4HWNA 2Y72A 4X9IA 3PABB 4H25B 3S97C 5I6XC 4YZFF 5EZJA 3KPRE 2F58L 4MWFA 4HUVA 2Q6WA 3X17A 3QQ9D 4XC3H 1EEQA 3MRIA 4P4KA 3BXNB 1G7HA 4M1GH 4KZEL 4KTEH 2YRPA 5FIEA 3QIUA 4PG9B 3WHXB 5DJDB 2HH0H 3DI2B 32C2A 2M26A 3MYZA 4GG6F 3IJSA 2ESVE 3GEWB 1T03H 5C9KA 4PV8B 1T66C 2M8XA 4A6YL 2R4RL 1TPXC 4WI2A 3S3SA 3FFCE 2FB4L 5CEZD 3O11A 1WICA 3ZKNC 5E8DL 5AZEL 3EDJA 5KVMC 2OTUA 1NCAL 3H3KA 5F1SA 3SJVE 4E41D 2E6JA 2DLTA 3OGCA 3Q5TA 4PJ7F 3UAJC 3X11B 1N7ML 1QYGL 5GJTH 3QEQD 2QHRL 2V5SA 3FQNA 4QHMA 4DZ8B 3C60C 3V2AR 4B0MM 1YUHB 4NKOB 4UZGA 3UDWA 4NQCA 3GSWB 3L7EB 4HH8A 3NZ8B 1DQMH 3S37L 1JPTH 3TPUB 5DC4B 4OF3A 5HYQB 2OK0L 4OZHA 2I9TB 4U1HB 2W9DH 3KLAB 2PR4H 2AJSH 3ARED 4M03A 1UZ6F 3OXSA 2YUXA 4N90D 4KY1H 3T1FB 1MHEB 2X10A 4K2UH 1MFDL 4QTIH 5EB9A 5HI3D 3H42H 3QNXA 4X6EB 2VXTL 5HVWA 4Y16D 4MA8L 3WKMH 2B1HL 1AR2A 4JR9L 4M7KL 1C12B 4K3EL 5C6PB 4L3EA 4J23A 4NOFA 3BUYB 1G7PB 1DVFA 3RL1A 1T2JA 4R26H 1GHFH 4NKIH 3WFZA 1U2HA 4FQHB 3MRKB 3KYOA 1EX0A 2CR3A 4HV8B 3DVGB 2VITA 3VXME 1R3JB 4TVPD 2A9NH 1OLLA 3MA9L 2EYTB 3CLFL 1F45A 1R3HA 4XPFH 3DVNA 3PWLB 2PW2A 3HZKA 1AE6H 4CJ1A 3IXAA 1P5UA 1F3JB 4S1DC 2P43B 4M02A 2V2TB 3C6LA 3RDTD 3HC4L 3Q5YA 1UA6H 3MOBL 5SWZD 2Y5EA 1KCUH 1JZ8A 5E9DB 1KB9K 5IFJA 4JDVB 1QLRB 2YD8A 4PJGA 2KPNA 3ARDB 3OKOB 1KTDA 4J3VA 5GRJH 4C83A 4WHTB 3L3IA 4J3TA 4UILH 2BNRD 5KW9L 4EI6A 1Q1JL 1XH3B 4PJBA 5FYLH 3VRIA 2Q76A 2XWTB 2CIIA 5J12B 4LRIC 2IALA 4X7CC 5EBLA 3QWOB 3TBWA 2BRRH 1JZ3A 2QSTA 2ADJB 1VFBB 2VRAA 3O81A 4CBPA 3ULUH 1QFUH 4MD4B 4NM4L 3QEUA 3PL6A 1U8KB 3MLYH 5IHZA 1U93B 5D2NA 1IGCL 3VI3E 5J8OA 4D3CL 5F21B 4UAOB 3NACH 1A2YA 3CXDL 4GXVL 4PD4K 3MJ9A 4NQDA 1K4CA 1J5OL 3SY0A 1MREL 3RRQA 4JG1H 3GJFB 4RBPH 5EUOA 1AD0A 4HX1A 4LLDA 2X4QA 4ODXA 1YECL 1ZHBA 3K80A 4UUJB 3FTGA 2FRGP 1QKZL 2DQIL 2HFTA 3JTTA 2R8SL 1QSZA 1U58B 1KELL 1WAAE 2P8PA 1J8HE 5F9JA 4WWKD 1P7QB 2XXMB 4GRWB 5D1ZD 5D71L 1I9RH 3L3HB 1JPGB 4M8VA 4ZPTA 4G9DB 5DUML 5EU3A 1BFVL 1CICB 3WCYA 5EO1B 3WS3A 4BUGA 5FO7A 4NN6C 2IC2A 4LAQL 2KQNA 1I1AB 4ORZC 3JXAA 3BPCB 3VRJA 1IT9L 1WWAX 1GOFA 4P3WA 1VPOL 1KIRB 3VXRD 4UDUA 2GJZB 4TUKH 5H94A 4WY7L 5I1EL 5KSVA 3S96A 3WDIA 1W72H 1NUGA 2EDNA 3QULA 4E0RB 3EFDH 3T0DA 2DS4A 2VWEE 3LKRA 1OAQL 1AIFA 5F8QC 3RX5A 4P5TC 2Q8AL 5DF0A 4LVOB 5DMGD 3WV0A 4DVBB 3ABZA 4F15C 2VL5B 1NBYB 3HPLB 3O6KL 3T04D 3CCHB 1IQDB 1QOKA 5E99H 1KG0B 3F5WB 4K7FA 1YEGH 4B50A 4HKZB 5HHXH 4NC1C 3BZEB 43CAA 3GM0A 4KK9C 4P5TD 1UACL 1L0YA 2WANA 3MODL 3HNSL 5C0IB 3T2QA 4NJAH 2Y9RT 3OKMA 2E7HA 3ARBD 4PJ5D 4MVBD 3CC5A 2YWZA 4ODHL 4KK9D 4U1NA 4WU5A 2FATL 3QQ4B 5JW5A 1LP9B 4MJ5B 2VDOH 4PV9A 1U8JB 3GB7A 3IKKA 1L7TH 4P23C 3I6KA 3CFJB 5CKAA 4LIQH 2X44D 3RHWK 4RWYH 4NO0D 4IRJA 5FK9A 3HMWL 2VLKB 3DUSB 4M48L 4OLZL 2EEBA 1BD2B 5L8JB 3VFGH 3N0PB 1LDPL 1OGAB 2F53D 5F1KC 1V3LA 5D7SH 4N8VG 4QF1B 5I16A 2DI8A 5DHYA 5LQBH 1ZGLB 1H15A 1RVFH 3OR7B 4MJIB 4CVWA 1EHNA 4P99A 3MV7D 3E3QE 3BP4B 2Z8VC 2NR6C 1C1EL 2Q8BH 3T65A 5IVXB 3U4AA 3GMOB 1AGCA 4X6BB 4GH7B 1PFCA 5C0BD 5A2JH 4IIQC 4UIMB 2D0HA 1P4IH 5MERB 3RX8A 4KK6D 4X6FB 3OBAA 4Z7VE 2FJGB 5IJVA 4HH9B 4TVSa 1FC1A 4LASH 5IEKB 2AK4B 1KNOB 5DRZB 3UPRB 1ZVSA 1DUYB 4EXPX 5C0GA 3HC0B 5IMMA 1EERB 2XV6B 3AMKA 3HZMB 2FH8A 2Z93A 4ZODA 2Y07L 4LCUB 3CDGB 3Q6GL 4FQXA 3H9HA 3IAQA 5BVPH 3ZDYE 4Z95H 4KKLC 3PIQA 4HK3N 3QIBB 1IM9A 3QUMA 1ULVA 5FM5O 1KN4L 3PF2A 4GKSA 1DL7L 4NJ9L 1A7NL 5D6DA 3INUH 2HFEA 4Q9QL 5D7JC 1UEMA 3FQUB 4MJ2A 4GKNB 3ULUF 4M1DL 4V1DD 4LLYA 3VXSD 3GMPB 1L7IL 3RJDA 3IFNL 4OFDA 4L4VE 4MXWL 2R56H 5JHDA 3UTTB 4L4TA 4X5WB 4YE4L 4HIXL 1EEUA 1IEBA 3ZTJG 3MR9B 1I9JH 1F02I 1M05B 3H9SD 2YUZA 5DFVD 2EXWC 1Y6KR 1UWXK 2NY4C 3JZ7A 3C2SA 5C09A 2J6EL 3BP6A 1YY9D 2FZ3B 1CZ8H 1I8KA 3NCYS 3OWEA 3KJ4C 2X4NA 4M6OH 5EOTB 3KPNB 5F9WC 5C86A 3UJIL 4JFHD 3F6IA 4MZ2A 1W0YT 1EK3A 4D0DB 4BZ1L 3DVIA 1JHKH 3EFFB 5DUBB 5T1MB 4PB9L 5DUPL 5IMKB 2IGFH 5B8CA 4YAQB 4ZO7A 3KPOB 1F4YH 1UM5L 3O3EA 3KVQA 4XMPL 5JOFB 1XR8A 1N8ZA 3GKZA 4PJCE 5BXFA 4X7EC 3QI9C 1EA9C 2DQHH 3EGSA 4Y1AE 1SQ2N 1IAIM 4G8FB 3SE9L 1MPAH 5FM5M 3VFTB 1VADB 1NCCH 3AVEA 1JZ7A 4ZFZB 5C8JB 3BDBA 4PRAA 4L1DA 3A67H 2ESVD 3F12B 5DQDH 5BRZA 3O9WC 2MCPL 5FAAA 2H32B 3WFHB 4TSBL 3MJ7B 4I2XA 2NY0D 1NGPH 4OD3H 5K9KA 4E41B 3FFCD 1RAMA 3EBAA 5D96B 1BPVA 2OSLA 4Y4KC 4AY0A 3KDMA 3CSBA 7CGTA 5F6IC 4XB7A 3WLBB 1QQDA 5ACLA 3SJVD 1GGTA 4HD9A 2GTWA 2Q3ZA 4IOIB 4X9HA 3RGVA 1FV1A 5KSAC 2PO6B 5EULV 4I13B 1AR1D 5ALCH 1Q0XH 1QFWH 1I7TB 4QXGL 4BSWB 1FFOA 3W2DH 2XTJC 4DN3H 5IK3B 4LKCA 3MQIA 1NEUA 3LV3A 5I8OH 5I1KL 1OQXA 4PJFB 1DZBA 4XBEL 1OARL 3X13B 1D3CA 3UC0H 2ADGB 1AGDA 3AREB 1MJ8L 3AXLA 3U4BH 5HGAB 4OCWL 1TETL 1CG9B 3PWPA 3B9KC 3CFBA 4ETQB 5D6CA 1T0MB 4X6DA 2WM0A 4AJ0A 4RGMB 4Y8DC 3VRLE 3HI1B 4F7CB 5KTEL 3BIKB 3L6FA 3MJ8B 4Y16B 2Y6SC 3GMLA 5D2NE 3T3MF 5IOPA 3D85D 3RIAK 4UU9A 3VG9C 3H2WA 2D31A 3UJJH 3ULUC 3IDYC 2ZSVA 4HIJB 1MLBB 4HMEA 2BHZA 3O4OB 3GI9H 4NUJA 4UBDC 5IB4B 5EUOE 5BQ7B 3DURB 4NSKA 4G7YL 2R2EA 1LHZA 4G6MH 5IBUB 1B0RA 35C8H 4PRDA 4PB0L 4XC3L 3L3DB 3SDAA 1A3RL 1XZ0A 2VDLH 4M1GL 4ODWB 3WNKA 4HF5L 4YHIB 3PG2A 4NZUL 5IW1A 5GGVY 4HPYH 5F1NA 4JN1H 1IKFH 3GUTB 3RDTB 3O4LA 1J1OL 1TCRA 2QADD 4BSJA 2BNUA 4NBXB 5GSVB 3ZHKA 2EDRA 3ARFD 1T03L 4LL9A 3MUY1 1RJCA 1DEDA 1P4LB 3RL2A 3U48A 1MCJA 2AV1A 3FRUB 3JWOC 5EUKA 4FTVA 3WMSA 4XCYA 2BNRB 2FEEI 5FCUH 5F3HA 1S7SA 5D5MB 5KVGH 4H20H 3RAJL 4LF3B 1X7QA 1J1XH 1LEKA 4YNYA 1D9KD 4Y2DB 2C1PA 4M93B 4F7PA 4HWEL 5GJTL 2UZIH 4KK8C 5JLZB 3DIFA 5GS0D 4RIRA 3LQZB 5E56A 3ZSTA 3VFNB 3QG6A 2Z35B 1PSKH 2N4IA 1WUNT 3VWJC 1T80A 2EO9A 5F7DB 1LEGA 2LVEA 1YN7B 4UNVA 3QIWD 1DQML 1JPTL 3BUTA 4ZS7H 1DN0B 2OR9H 1J05B 1YPZB 4XH2A 4NNXA 4Y5YC 1G6RA 4D0CA 3EOBA 4E42A 4KY1L 3U1SH 2D7TH 4Z7UA 5DO2D 3ZT6A 4QTIL 4WO4C 3H42L 4MQTB 4JM2A 1I1FB 1NFDF 1DQQB 1CFVL 2GW5A 4GQ9H 5F6HJ 3U36B 1JI1A 3KHOA 4WWKB 1BFTA 2B20A 5D1ZB 4X4MA 1KXTB 3I84A 3H0TA 4PJ9D 2O26U 3MLTB 3LRGA 5T1LA 4GS7B 2DDQL 3T0EA 4R26L 1J8HD 3LDBC 4MAYB 5DJ8B 1GHFL 3GMNA 4NKIL 1QO3A 4JPKL 3G5ZB 4R7NB 3QJHA 1ZT4A 1QR1B 3P40A 2JJWA 2H2PC 5DMJB 4WV1B 1UVQA 2A9NL 3MGTA 1OTSD 3TA3B 5DMYA 3F7VB 3VXRB 3CLEH 3LIZH 3MZGB 4XPFL 1J10A 5H8DA 4KTYA 2WLZA 3IETA 1AE6L 1WZKA 4O2CA 5DJ6B 4PGBB 5CJXA 5E7BA 1FORL 1UG9A 4U3HA 2OQJB 4K8RL 3IFPA 2JELH 4EI5D 2JIXB 1UA6L 4OZHF 5DMKA 3QNZB 1KCUL 1H8SA 4EUPB 1PBYA 1JN6B 4D0BB 3K81A 1AXSA 2D7PA 2Y7QA 1EDQA 1BF8A 1L9NA 2C7UA 4UILL 2AKRA 2Q1EA 3GGWB 4FP8H 1JYVA 2BC4A 4P46A 4ZAKD 4ONOA 2WW8A 2WMPA 3B9AA 1NMCC 4Z6AT 2BRRL 4NO0B 2HTLD 4PRHA 3RVWD 2GQHA 1VB9A 1XF1A 5J9PB 4AQ1B 4XMKL 2F53B 2NY1D 3GSXB 3JUYA 3HAEG 2WLYA 2EDWA 4PR5B 4KJWC 3NACL 1PY4A 5DJ2B 5E6ID 1CCZA 3MLUL 4MXVF 4TSCH 2D03H 1I8MA 3MV7B 2JLLA 1IC4L 4JG1L 4I0PA 4MQ7B 4HCRA 2PKDA 1NCTA 1HHJA 1NFIB 3PUCA 4WVRA 1A1MA 2DIAA 4JG0H 4KDWA 3SGJA 1P4BH 5IW6A 5DK3A 1F58H 5C0BB 2J12B 5DTFB 5TDPB 3OG4B 4JB9H 4PJGF 1Z0NA 4OIBA 1I9RL 5GS2H 1OAYH 3WFCL 4JO2H 5IHUH 2FX7H 3GZKA 3WDJA 2X9YA 5I1IH 3T2NH 2AXGB 1RU9L 4LDEB 1GGBL 4P4KC 1XF3A 3KPTA 5E8PB 5LG1A 3BPNB 3QO0B 1F6AB 3B9VA 3WIHA 3T0XA 4OD2A 1BQHA 3ECBB 1QEWB 4CADB 3QIUC 5KOMC 4PTUB 1MHHB 3C8HA 5DGQA 4PUBH 5DC0A 3EYUH 1GVIA 3EFDL 4MB3A 1U8IB 4M6NH 4UT6L 3FO9B 3NCYP 5L8KB 4X4ZA 4OF5A 2R1YA 4G8GE 4L3CB 4H88L 1KJVA 3MRQA 5LBSH 5E99L 5IIEB 1U3HD 5K9QG 2VISB 4F8QA 1FPTH 5HHXL 4Q97A 1I7RB 4V1DB 3VFWA 5KSBE 3LKSA 3QEGH 5JDJA 3VXNA 3D2UD 4IMLA 1ETZA 3KPLB 1T1YA 4NPYB 2JKXA 5FA4A 4XXCA 3G6DL 2AK1H 3P0GB 3CX5J 4IOSD 3VGAC 1CDUA 5CJOH 4L4VD 3CH1A 1CVSC 4FFWC 3H9SB 3QBTB 1K3ZA 3HAEA 3UDWC 4D8PB 2OL3A 3KAAA 4LIQL 4RWYL 3MV01 4GAYB 1U95A 4HKBA 1D6EA 2CDFB 2DMCA 1PG7X 1UC6A 4PJHB 3QUXA 4YZFE 3VFGL 1V7ML 1PKQA 3RWJA 5D7SL 1KJMA 2FIRT 4U6XA 3EO1A 4H26A 5DURD 4U1LB 5LQBL 4WHYH 1OPGL 2VOTA 3EYVA 1RVFL 4KFZC 5L7XL 2Q7YA 4NWTH 1FE8L 3C8KA 4MNHA 4PJAB 4KVNL 5ENWA 4XAWH 1QPPA 2YD4A 1GJIA 3O6LH 5IP4A 4HKXA 2Q8BL 4NRXA 1S3KL 1B0GB 3CZJA 5LGHH 1DVFC 3GSOA 4I48A 2DQCH 5CCKL 4BQ9A 3WFEH 2BOBB 1WGOA 3WFBH 5EOCL 3U7WL 2X1PA 5ICYA 3C08H 4WW1A 4RMSA 5JNYB 5F1IA 3BKYH 5FA3A 3JV6B 2FO1A 1U8PB 3CDCA 5EU5A 4LCWA 4RX4A 1UT9A 4EN3B 4LASL 4ISVB 5T3XH 2HTKD 3P4NA 4L8SA 3EOAB 1O0VA 2PYEE 2RCSH 3JTSA 3OAYH 5DD3H 3HA0A 4Y1AD 4RFEB 1KIPA 5TH2B 5KANI 2ESVB 2Z92B 4PJXE 2BCKB 3BI9X 5CILH 5BVPL 5SWSE 2E9WA 2O93L 3C6LC 3QFDB 4PJDA 2NY0B 1YMMD 4NKDA 2H2SD 2RBLA 1G7MB 3VXTA 4LSSH 2EIZA 5EU7C 3REVB 5JXAH 5F7EH 4OBRA 3UTOA 3EHBD 2F5AH 3NFNB 2EH8H 1OQOA 3DNKA 4QEGA 4X0KB 4KI1A 3RI5F 5I1DA 4JPVH 3ULVH 3BDYL 2A74B 2EIDA 3SDYH 2B0SH 4YBLC 4FFYH 4D9LL 3BO8B 1I9JL 4R0LA 2PTTB 5TDNB 3W9EB 3WXVH 4EIZC 3PL6C 4IDLA 1YEDB 2HRLA 5IVZA 2EDYA 2WV3A 3I2CL 1JGEB 1WT5A 5D2NC 4ETYA 4ONGH 2IH3B 1Y18A 4WCYH 4JHAL 1H8NA 4JFZL 1CZ8L 1KENH 1XF2A 3D87B 2KUTA 4LCCA 4C56A 5GGVL 4ELMA 5DEFB 1BX2B 4M6OL 5C0CA 4G8IB 2AQ1A 1CFNB 2PXYA 5I8KL 2GFBA 1FZKA 1NGXB 2IMMA 2X7LB 2DLEA 1NC2A 1MCLA 2NW3A 1BJ8A 5JHLH 1WBYB 1JHKL 4HWBA 5IKCB 1M1SA 5EN2B 3WUZA 4JGUA 3BAEH 2IGFL 5JPMB 1FN4A 3U79A 2C26A 4ZXBB 1XEDA 1F4YL 5C07B 3CD4A 5DR5H 1I7ZA 1OAXH 4OZ4A 2ZCKH 4XPHH 1BIIB 3CU1A 2VABB 1YMHB 4TRPL 3LZFH 4Z7WA 5F88A 1RJZB 2DQHL 3SGKA 2QADB 4UINL 3CU7A 5E5MA 2XFXB 5IF0A 3QPXH 1G9MH 4GKZB 2YPLE 4PRPA 4BZ2L 1NCCL 1KPUB 2ITDB 3MRHA 4KV5F 4NP4H 4HFUH 1JZ4A 3A67L 2FBJL 2EE2A 5DQDL 1Q94B 1PDKA 3JV4B 2ZG1A 3NPSC 5L2KA 4FFVD 5E4EC 4NCC1 3TIDB 1K85A 2CRZA 1NGPL 4RAUA 4URTB 1BVKB 1M7XA 4NQVA 1ONQA 2FYYA 5GGSB 4K23H 4X98A 4RFOL 3TZVB 1D9KB 4NHUA 3K2UL 4AQOA 4ZUTA 4I18B 3RUGF 3HR6A 2KDGA 5ALCL 1Q0XL 5IJKA 4UOW0 1G6RH 3IU3A 3SKJH 2JCCA 2F5BL 4Z7QF 2FGZA 4DN3L 3AB0B 4JZOB 2R0WL 1DQLH 2BK8A 4Z78B 2VDPL 5I8OL 4RDQF 3FT2A 4IRJC 3U4BL 4PGCA 5DVNA 3B9DA 3U9UA 2WUCL 3BN3B 1YEEH 3UPCA 1XCQB 1QRNA 4N8PA 4KK5D 3OKDB 5FYJE 2UWEA 1JWMA 5D1QD 1KB5A 4WU7B 1YNLH 4PRID 3HG1E 3MZTA 5IQ9B 1NGYB 3FB5A 4LNRA 4PJ9B 2ADIA 5T1KA 3ZTNL 3I3DA 4N9GA 1J8HB 4KRPB 3NGBB 4NO3B 3GI9L 1TJGH 2EYRB 4RBPK 3TP4A 3P77B 3WNMA 1BOYA 4ERSH 1XGQB 1A8JH 4OLYH 4G6ML 1WIPA 1WIOA 3MBEA 3PWVA 5CLTA 2IPKB 35C8L 1B3JA 3NCFB 4GSDH 3QHZH 2VDLL 3I3EA