5ISZD

Crystal structure of ls01-tcr/m1-hla-a*02 complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
200
structure length
200
Chain Sequence
b'LNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCAFDTNAGKSTFGDGTTLTVKPNIQNPDPAVYQLRDSASSAKSVCLFTDFDSQTNVSQSKDDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Broad TCR repertoire and diverse structural solutions for recognition of an immunodominant CD8(+) T cell epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2016-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iszD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iszD02
3RZCD 4OCSH 2C1PA 4MXQC 4KWUA 3X13B 5D5MB 1E27B 3EO9L 5HY9A 4OZ4B 3GI9H 5E1AB 4LGSB 5EBWA 5E8DL 1AC0A 3W0WD 1I3GL 3QUYA 2DLEA 5EUKA 4FQHB 5F6IC 2E7LC 3RX8A 3GJEA 5I0DA 3IRZA 4JQIH 4JKPL 4WHYH 4WFHE 5HGBA 5T1MA 1WK0A 2VIRB 4WWKC 3NFSL 1HOCB 5GGSA 2FH8A 2VDPL 4BZ2H 3AY4C 4HUUB 1H3XA 1GOHA 2XXCB 4RIRB 1RIVH 2P7TA 3C6SA 5BV7H 2OJZL 4JM2B 4YHKH 1TZHA 4OZFG 3QUXC 3VMPA 5BQ7B 1RZGB 3HRPA 1ODAA 3Q2CA 1II4E 4JFEB 1KT2A 1YN6B 3VFGH 4Y89A 4DUXA 2DKMA 3V4PH 1OLZA 5GS0D 1YEGL 1ZHKA 5CEXB 4Y19A 2C3HA 3S36L 1S7VB 5EU7E 3PWVA 2A0LD 3V0WL 5EZOH 5KBNC 4YHPA 5I15L 5CJXC 4LLUB 4M6NL 5D8JH 1SJHA 4HBQA 1DBJH 4L4TB 4KDTA 5I75B 5AYUL 1IBGL 5ADPH 3VW3L 1FBIH 4TRPH 3WXVL 4G6FB 5JO5B 1G1CA 2R1WA 4JPIB 2WIMA 4WUUD 5TF1H 4LSUL 1W0WB 3QEHA 2BXYA 3NH7L 5ERWB 4JO3H 3S35H 2P47B 4LSQL 2AJSL 4UT9L 4U33A 3ILQD 1CFQB 5DZOA 2A0LC 5MEPA 1WVZA 4XC1L 1DQQB 1R5WA 3QDGA 4WI7A 3BD5A 2X4OB 2MKWA 3AAZA 3NPSB 3SDCC 2EIZB 4UIKL 1NGZA 4MLSA 3PWJA 4NT6B 4ZUTB 3RNQB 4BK5A 4AT6B 2NY5L 5D96B 4X4ME 4Z76B 4CMHB 4QWWD 4JANB 4M1GH 3E8UH 4AEHH 3VXUA 2YSSA 3HRZB 1P9MA 5IT2H 1AHWC 1JTTA 2APTA 2VWEE 2XQYK 5DURD 1EEZA 1MY7A 1D6VH 4DFHA 2Z92B 3BPCA 3EZ8A 1Q9LA 4ISVA 2PO6D 8FABA 4OLUH 3CFEA 3MRPB 4JDVA 5C09E 4AEFA 4CU7A 1RZFL 3MRLA 3BWAB 3LQZA 5EN2B 2RR3A 5MI0B 3L3OA 4MNGE 1BOGB 1T2QH 1KBGH 2ZKHL 2BY1A 4EDXB 3RTQC 4F58L 1MAJA 4P23A 5FYKH 4OV5A 1BFVL 2NZIA 3QCTH 4U2YA 1JFQL 3VFNA 4LNRA 1D5IH 2ATKA 4U1GC 2ZUQC 2CKBH 5I1AB 1CXIA 2HJLA 3FHAA 5HD8D 3G6JA 3GSRB 4S10A 1G9EA 4NQUA 3OR6A 1AQDB 3RGHA 3RKDD 1F4XL 4DGVH 3FFDA 1TTFA 4ONHA 5H2BA 1DLHB 2EYTA 1AD0A 3DO7A 1H9VA 2CH8A 3C5SA 1ZA6A 2DTMH 3O6FD 1F42A 4P3DA 3K0WA 1RD6A 5FA3B 4GUPA 4O9HH 4TTGA 1ACZA 3UC0L 2IANB 2AK4A 2B0SH 1IGTB 1U8KB 1YNLL 4JN1L 3WFCL 4G9FE 1KNOB 1S9VA 3V52H 3ARFA 3B2UC 3P9MB 4NKMA 3F65A 2EH7H 1CFNA 3ULUF 4JFDB 3LZFH 3HHRB 4WEMB 4YBLB 4MVBD 4M7ZB 3AM8C 2GITB 3QUZD 4DVRH 2ADIB 1C5BH 1TVHB 4DAGL 1RSFA 2G75A 4HUVA 2J8OA 4PRNA 1RK1B 1UACL 4NFDA 3OXSB 1TPXC 3UO1H 4Y4FB 4ODSL 3B6SB 3DX6A 3VMNA 4U1LA 4DGYH 4U6TA 5IIEA 1MEXL 4XVJL 3FTGB 4H25A 2MPAH 4HJJL 4R97C 1ZSDB 2IG2H 4FP8H 5D7JD 3T0EA 1ZV5A 5DJZB 5ANMA 1T89C 1QP1A 2HVJA 4LLQA 1KCLA 1IGJB 2YPKB 2I9LB 1Q9WA 3FO9B 1QSFA 1WEJH 4ZS7H 2WANA 5FB8B 4NHUB 1HH6A 4CNIA 1E6OH 5H94B 4ALAL 1WWBX 3LDBC 4O2EB 1NCBL 4OFDA 4OLVH 4NO5A 2EXWC 2QSQA 3ARBC 1XGPB 2NY6B 4PJ8A 3ZYOA 2D03L 1BJ8A 3D18A 3Q6FA 4JFFB 3VWJC 4YIQA 5CEYA 4WI8A 2IF7A 5D7JC 4XCYA 1BEYH 4JO2L 5JW3L 2ZWLT 4FQLH 3WS6A 3S4SB 5L2JA 2FRGP 2RB8A 4KZEH 3GGWB 3D39B 5DHYB 1X3DA 2XWJA 3PWUB 5EIQA 4NYLB 4YGAB 2FB4L 1I3RB 5D7IA 5F70A 1IT9H 1UQSA 4D9QE 5KSBE 4UUJA 3LPWA 5EU6D 4RGND 1QPXA 3CSPA 1HDMB 4R90L 5MEND 1A6ZB 3I02B 3X12B 2XWBB 3OSKA 3C5ZD 1J0HA 4M5YH 4PBXA 3O11A 2DM7A 2JLLA 4S1QH 5MHSE 3ZDZE 1RUKL 4LFHG 3PXJA 3QDJB 3HZKA 3Q5TA 4PB0H 1AJ7H 5JUEH 4NQSB 3TT1H 4X9GA 1ZLWH 2K7QA 4D0BA 3HTLX 1XR8B 3X11B 1U91B 3VA6A 2JELL 4K2UH 3U48A 2J88L 4YXLL 3UPRB 1ZGLM 1MFDH 3CZFA 4D0DA 1BAFL 2Z8VC 4U1JA 2VC2H 5TJWK 3FO0H 1OT1A 4FFVD 4RGNC 3QSKB 2X42A 3N85L 2F19L 1I1RA 1MJJB 1RJYA 3C5ZC 3L3KA 1E0OB 5C9JA 3BH9B 3JTTA 4X6DE 3HAEH 4MJIA 2UY6A 2BDNH 1ACYL 2VQUA 3LHPL 1MHCB 3B9DA 3K4AA 3L9RA 4O5LH 3U9PL 3UTPE 3MV01 1ZS8A 4DTGH 1AGBB 4M7KL 4G6KH 2LTQB 4HPYL 2X4QA 3VFMB 5DRZB 5EZIL 1DVFD 4MCYA 3MGTA 3EOTH 1MVFA 1IZKA 1HEZA 5I17A 1A7OH 5F9JA 4FFVC 4WW2B 1KB5H 2X89A 3MJ6A 4Q58C 3PHQA 3HMXH 4X9IA 2R8SH 1S7SA 4PJGF 4GKNB 2WBJB 4QRSA 1AR1C 4LAQL 1Q9OA 4PREA 3KJ6L 1QBML 1YPZE 4HPOH 3UYOD 2CRMA 1KOAA 5EPMA 2FX9L 1E4XH 4K07A 3BN9C 1KYOJ 5ENWB 4O51A 2QLVB 5B8CC 4HT1L 1NGXB 1XF3A 4FG6C 5B39G 4OLEA 5IHZB 1KG0A 1NUGA 5IBUB 5IW1A 4G42B 1GC1C 3FB8B 5JQHC 4DUWA 1PD6A 4LSRL 5TE7H 4LFHD 3DTXA 4H0IA 12E8H 5ISZA 4R4FL 4GKSB 1J1PL 1ZWIA 2YD9A 3TO4B 4XNUL 4PR5A 1CGWA 3LRSB 1NEUA 4X6CF 1W72H 2ADGA 3EFFB 2J6EL 3REWB 4KH2A 1AE6H 2X4SB 4KUZH 3INUH 2AJZA 2BK8A 4PJEB 2F8XC 3VD7A 2FO4A 2CUMA 2G2RB 1NAML 5F6HJ 3UDWC 5GGTH 1FIEA 1F6FB 3P4LA 1C5DA 5CCKL 1G1YA 5JHDD 4J4PD 2EDDA 2VJXA 2CXGA 1DTUA 4YH6A 1GGIH 3DV4B 4RISL 5I8OL 3RWIB 4V2CB 1OD7A 1Q72H 3SGKA 3GM0A 3VXTA 2CK0L 4P48A 2OJEA 4HIEA 5D2LE 1ADQH 4R7DA 5CMAA 3RWJA 1OAKL 3VG9B 4KKBD 2C7UB 3E6FA 4EUPG 1X5ZA 5HDOA 4JO1L 1EK3A 2FJFA 3T2PA 4MCZA 4MDIA 3OL2A 2H9GA 1TNMA 1B0GA 3FB7B 3BIKB 2VXTL 3Q6GH 1I1AB 2EIBA 4LKCA 2XN9D 3K4ZA 3L5WB 4TVPL 3GSVB 3QIWC 4PP1C 3GMPB 3RWFA 3B9AA 1LEKB 1IGFL 2O26U 5C0AA 3VGDA 1NBYB 2HTKD 3O2VL 4OIIL 3HI1B 2FEEL 1CL7H 5LG1A 1E4KA 3MRJB 5C71A 4M1DL 1CD0A 2XQBL 3VGAB 2DYPB 4PV8B 4QLRA 1TZIB 3WN5B 4KI5D 2IFFL 4GAJL 4WO4C 3H7BB 1R24A 2JCCE 3OKNA 4O2FB 1ZVHA 1C12B 4I2XA 5DRWB 5F1IA 5KVDL 2A74A 2Q87A 4HH9A 5L7XL 1CIDA 3ILPA 4KK5D 5I8CA 2X6MA 5DI8B 3P9WB 3JTSB 4PJ9B 3OR7A 1I1CA 1J1OH 1HQ4B 1WBYA 4JKWA 5D7SH 3CK0H 2OXGA 1BJ1J 2BNRE 2Q20A 3BMVA 4Y2DA 3RGVA 1YNTB 2FJHA 1YMHA 2A6DA 4PJ5D 5DD6B 3HZMA 4K3GA 4PV9A 3TBTA 1JGUH 4I0PB 5T3ZE 3NGBC 4YO0A 1T1YA 3HNVL 4EN3D 3RY4A 3BKCH 5F9WB 5F3HA 5GZOC 2FBOJ 3MFGB 3ROOB 5L6YH 3V7AG 2R4SH 1T2JA 3OKMA 4L3EB 3VRLE 3MREB 4LQFH 4I9WE 4BQ8A 2V7HA 3S9DB 1JWSB 3SDXB 2QHRL 2W1NA 4X8XA 3GHBH 3O3EB 4F7MA 5DJXA 4JY4A 4BELD 1FVEA 1YEDA 4X4YB 4OLXH 5E00B 3QXAB 5DVKA 4N9GA 3IJHB 1UJ3C 3FT4B 5ACZB 4KQ4H 2EYSB 5HVHB 3UTSE 2NY0D 5E8NA 4LEOB 5GIRB 4C83A 2EC8A 4BYHA 5GGVH 1OAXL 4NCDA 1R0AL 4FQIH 4JQVA 2C1OA 1FL6B 5BS0D 2EICA 4JQXA 1NFIB 3TNMB 3IXAA 3VXMB 1GGBL 4HS8L 1DEEB 5DK0B 5ESVA 1YNKL 1EHLL 1NEZB 4W4NA 3KAAA 5C0CD 4YWGL 4LQ1A 4TNWK 1XMWA 3ABZA 3HZYA 3N1GC 3VH8G 5D1QC 4XWOC 2J4WL 2HLAB 4TSAL 2DL9A 4G8GE 1D5ZB 3QUKA 3TT3H 2XRAH 3BGFC 1LDSA 2CGRH 2NY0C 2D4FA 3ZKMD 3SDAD 1K8IB 4MQ7B 3L5XH 3UTTB 1BFOB 4HC1H 2I9TB 4KRPC 1L7TH 4YDLC 5DK2A 3KLHC 5I2IB 1S7XB 4HG4J 3G08A 4IRSA 4LGPB 1EO8H 3N1MC 4KU1A 3ARYA 2DQUH 2FATL 1BF8A 4G5ZL 4LPTA 3T4AA 3QRGL 3OWEA 5D6DA 5E03A 1YMMB 1F13A 1KJVB 2DLIA 4U6HB 1LDPH 5SX5K 1A4KA 1A7PL 2OL3B 4PGDB 2FJGA 4D0CA 3H9SA 4U1SB 4BFIB 3ZKMC 1A5FH 3OMZA 5ITFA 5HSFA 5IFAH 1N59A 2XOTA 1NAKL 5DZLA 4JM2D 3PL6B 3ZHLA 2OK0L 2W0KA 4PJ7A 3PWPB 4PJXE 2BJMH 4M48H 5D7KE 4LHUB 3QEQB 3I2CL 4JFED 2ICWB 2A38A 2R0LL 1IM9B 3V6BR 1XCQB 1T83C 1MCFA 4Q9BA 2KKQA 2XXMB 3QXVA 4FXKA 1NFKA 4P3CH 1T5WA 1TDQA 3JV6A 4U49A 3B43A 2WUBL 4KKCC 1J7VR 1PG7W 4KTDL 4XCEA 2FR4B 2JJVA 4ERSL 4NN6B 5HI3D 5C1MB 4AY0A 1JE6A 3LB6C 2ARJQ 4P2OB 4PFEA 1EAPB 5GGSY 2NX5E 1OCWH 3O8XB 1IGCL 2ZUSA 5T1LD 1GC1H 4G6FD 1UZ6F 5BJTA 1WCBB 2ZOKB 3KG5A 3MOBL 4P57B 1MFAL 3MV8B 2DQTH 2QQNH 5ESQA 4CW1A 3CU7A 5H35B 2M2DA 4XNZB 5CUSL 1L0YA 4XTRD 3CMOH 2XWTA 4ELKB 5JHLH 5EC1A 1B9ZA 4YAQB 4RCAA 4WU5B 5JOFA 4MJ5A 5HHPA 1FE8H 4AH2B 3TF7C 3G6AA 3HE6B 1UADC 3QEUB 3O6KL 4WEUD 3KS0H 4ZQKB 2AV1B 2GSGB 1MJ7L 1UJTA 2O5ZL 3MRMA 1JWUA 5MEOA 4N8VA 1NFDA 5I75C 2WBKA 3QXWA 4M00A 3VFRB 2ICEA 1Q94B 2KZ1B 2CR3A 3EZJB 1OP5K 5D7IF 4PTUA 3MJ8A 2EDTA 3K1DA 3V8CA 4M02A 3R06B 4YHIB 2BSTA 1ZHBB 5JW5A 1MFEL 4K3JL 4D9RE 1T22A 3DMMC 4OZGA 1K9TA 2HT4D 3QCVH 2R4RH 5E9DB 3CNKA 1KCVH 4OAWA 4C59B 5J06A 4LCWE 5K9JH 4F7EB 5IB1A 1RZ8A 3RWGA 4E41B 1DUYB 1ES0A 2HMID 1Q9KB 4MMXC 3OG4B 2ATPA 5TPWH 3ORJA 1ZT7B 3CDGA 3QXUA 3QXTA 4JRXE 3UZQA 2MCPL 2DQJL 2JB5L 3JZ7A 5C0ND 4MD0A 5C0GA 2Q8BH 4Z7VA 4YBQD 2H2SC 1CS6A 3S5LB 2F54A 3J7HA 3MRCA 1FIGH 4JZNB 2ADJB 2RIKA 3KPSA 1SM3H 2DQHL 4XRCB 5I1IL 4DQOL 2BNQA 2IQAA 1BMGA 5MP6H 2ZG2A 5EOTB 3D1MC 3ES6A 3IDGA 4L1HA 1ZLSH 3ZKXC 2BERA 5BVPH 1Y0LB 3SE3A 3B83A 5MI0C 5A2LH 5FO7B 2Y5EA 4KDVA 2IQ9H 3CH8A 3KYAA 1RIUL 1WICA 3L3HA 4OCLC 1ZGLP 5C0NC 4HIHA 4Y5YA 1QFWH 3VXSA 4YBQC 4NNXB 2OTWB 1IEAB 2IAND 2CLVA 3LKSA 3VXRA 3ARGB 3RWEA 2VL5A 1TVBB 4H0HB 4NM8H 5CP7A 2ORBL 1T04B 4JFDD 3TN0A 5HYEA 3BOVA 4XVTL 4KQ3L 5LGHL 2VLKE 3P77A 2IPTH 5F3BA 1GHFL 1RUQH 5E2VH 2VDNH 1F3DH 3VXQB 3NABL 5L88H 5EU7C 5DJAB 1R3HA 4IOIB 1I9RH 4PJIE 2XI9A 4JAMA 4CU6A 5MERB 4FXLA 2WQRA 4EOWH 4OBRA 5GS1B 3MRHB 1BGXH 5EDXA 3OKLA 4PRPD 2A2QT 3EOBA 4F8QA 1UEYA 4XWGH 1JGLH 4KZDL 3AREA 4OI9A 4JKKA 4HLZG 5C0BB 2V2WA 1VDGA 1I4FA 2B1HH 1FPTL 1OAZL 1M7IA 3EYFA 1P69B 4OCYL 1T21B 5KW9L 1RHHA 2GTWA 5ESAB 4HWZA 3GJFA 1FNGA 1HHKB 5HTSA 3SCMA 4X98B 5AZEL 4XPGL 1IAOA 4G80B 4DZ8A 1G9ML 3Q1SL 3V8OA 4FQQA 4YUEL 3IDNA 2Y25A 3DXAE 4Y4FC 4P9HL 5DJ0A 1KTLB 3OB0K 5IB5B 3NIGF 5J9PB 5GJTL 3T3PF 2D7PA 3SGEI 4K3HA 3TM6A 2NY6D 2XFXB 3LEXA 4K7PX 4UAOB 5D70H 4JFFD 4PRBB 2WSKA 5JLZA 3UTZB 5IGXH 2ZJSH 1I1YA 1U8PB 1ORQB 1LK2B 5IQ7L 2NLJA 4L4VB 25C8H 3S3JA 1GAFL 4IS6A 5KJRH 1DSFH 2NY4B 2XKSA 3MRFA 1BIIA 3FCTB 4R4BB 3BX7C 3WEXA 4HUWA 2P5EB 3D39D 3I6LD 4EVNB 4CKVX 2WK2A 5CBAA 1KN4L 4G7VL 2QJDA 3P30L 1OM3L 4UOW0 3REVA 4AEIH 5EORH 4H26B 4NFBA 3CX2A 7FABH 1RU9L 4F3FB 5HYJD 3NAAL 5E7FA 3TYGL 1MREL 2VQ1A 2ZCLL 1DQDL 3MXWH 1RK0A 4HJGA 4M8QA 2QKIB 1CDYA 3QO1B 4ONGL 4G6ML 3GSWA 3BGMB 4BQCA 5BRZD 2E27L 2R39A 3W2DL 1HWGB 3S6CA 1IKNA 3T8XA 2P48B 3IVKB 2Q7YA 3TYFB 5JXED 5FFLA 1DE4B 2EDHA 3BT2L 4TUKH 2R23A 4YXKH 5C0EB 1I8MA 5HHOB 4P49A 4LCYB 1WIOA 2AJYL 5F7YC 1N4XL 4XMKL 2QSCL 1T1XB 3BZFA 4IMKA 4I4WB 2UUDH 3U2SA 4JJHA 1GIGH 2Z8RA 4LMQE 4XVUD 4LRNL 2VXSL 4ZS6D 2H3NB 3BFOA 4PJGB 1PYWB 2NZ9D 1HSAA 2NR6D 3WLWC 1AIFA 4ZOBA 1YPZF 4GRLB 1ZANH 1HHJA 1XIWA 4D3CL 4HW6A 1S7TB 5JXEC 3ME0A 3EYOB 3HCVB 2BSSB 3PIQB 5C70A 1Q38A 4KJQD 1QHPA 4WEBH 3W82A 4OCSL 4H5SB 1TZGL 3KPOB 4RWYH 5E08H 3O3DA 4I77H 3HAEG 3ZE2E 1P84K 4AIXA 1BLNB 3GI9L 5LCVH 4XVUC 4KK8D 5FA4B 3HE7B 1QG3A 4JZOA 1LVEA 5ID0B 4TQEH 3SO3B 4HGWB 5KOVC 2IH1B 3HLAB 4MXVE 2LTQC 2FYYB 3B2VH 3QG7H 4X6CB 4LVHC 5IQ9A 4YHZH 3GSUB 4JQIL 4IRJD 1ONQB 4HK0B 4LKXB 4HBCH 1NMCC 1ZOXA 3S34L 2VE6B 4BZ2L 3BE1H 4R3SB 3IAGC 4UDTA 4FQ2H 1RIVL 4QOKA 3UYPA 4GW5A 2WBJC 3PGFH 4X4XA 1I85C 5DFTA 3L3JA 4PRDA 1WWAX 3QIBA 5HHNA 4F15B 3EFDH 4X5XB 3KYMA 3IGAB 1FO0A 4Y4KA 4N0CC 4KK8C 2K7PA 3T09A 3CVHB 3VFGL 1SY6A 3V4PL 1HCVA 1N26A 2WQ8A 4ENED 4U1KB 2MHAA 3VXUE 3LRHA 4UQ3A 1SJEA 3MC0A 4APQB 5C08A 5HY9B 1JYXA 4KJYA 4GOSA 4HFUH 4WFED 4RGMB 2F74A 2OXHA 1DBJL 3QUYB 1O5DT 1CGVA 1T6VN 3MO1A 3TO4C 2R2HA 1OF2B 3CC5A 5IJKA 2X1PA 5ADPL 3HG1E 4ZSOA 5LGJA 3GSNA 1P4BH 4M43H 4YK4B 4WJ5B 4JFQA 5DS8A 4NN5B 5I16A 5TF1L 2YD2A 3QXDA 3QJHA 4JO3L 3S35L 3SDYH 1CBVH 2Z31C 3GMNB 3T04D 1MFCL 4JZJA 4ENEC 1I1AD 4Y5XA 1A3QA 4P2RE 1B2WL 4Q9RH 2VN4A 3RZCA 3D0LA 4OM1H 1KT2B 1OAUH 4NGHH 2APXA 2BY0A 4Y19B 4RQQB 3PWVB 4WIQA 4DN3H 4M1GL 3W0WA 4AEHL 3GI8H 5IT2L 4YHPB 3BZ4A 3VG9C 2RQ8A 1D6VL 4EXKA 1I7TA 1QA9A 2I24N 1YEFH 1PQZA 1SJHB 4MX7A 2DYPD 3MLSH 4QO1A 5DMYA 4OLUL 2CRZA 2HFTA 4PJCE 4RMRA 4MJ2A 2JK5A 3FN0L 4YXHL 3P73A 1F4HA 3MTRA 3IDMB 2R1WB 2CQVA 1KBGL 1GPOH 1JZ6A 1BF2A 3ULVF 4HX1A 4OFYD 3QEHB 5FYKL 1AH1A 2BSRA 2PXYC 3TNNA 2X1WL 3FFCB 1MVUA 4PJ9D 2E9IA 3QCTL 2VZTA 5IBLC 2X4NA 2NNAA 5MEPB 4JKMA 3S37H 4B5EA 1QLFA 1MNUH 1J0ZA 2DKSA 3AAZB 2V5RA 3VGAC 1MCBA 1NGZB 4R4ND 1A3RH 3V6ZA 5D1ZD 4I0PD 3WN5C 4DVBA 1FGNL 5JR1H 3NIFE 1S9WA 4WI6A 4KDWA 4DGVL 2Y7QA 5EIIA 2XACC 2DTML 3ET9F 1EEZB 5ANME 2DQCH 1FYTA 3BPCB 4TVPE 4O9HL 1Q9LB 2XG4A 4ISVB 3GNMH 8FABB 4WUUA 4J3XA 1NFDF 2B0SL 1JPTH 3MRLB 1H5BA 1DQJA 1QVOA 2M8XA 2GHWB 3V52L 1MCQA 3L3OB 5DLMH 1FNEA 1U95A 2EH7L 1CDUA 2HKHH 4C56E 3LZFL 3MBEC 5DHVA 1S5IH 4P23B 4OV5B 1IGML 2EZ0C 4DVRL 1OGTA 1NCNA 1U3YA 3NFPA 5SV3A 2VDML 5CZVH 1GXEA 2ATKB 3M1BB 3UMTA 3UO1L 2G5BB 3VXMD 3WLBA 5JOPE 1SBSH 2NY2B 5GISL 3OR6B 1CXFA 1P2CB 2MPAL 4KVCH 4XGZB 3E3QE 1G0XA 2PO6A 4I3GA 3MJ9A 3S96A 4AIZA 3BUTA 4OQTA 3DO7B 2ICCA 2P5WD 1ZA6B 1R3KA 3EO1A 2IG2L 5HVHC 4P3DB 4UINH 3QRFM 3RVTD 2GKIA 3UTTD 4L5FH 2AK4B 4ZAKB 4OM0H 1S9VB 1WEJL 3ARFB 3WBDA 5IMKB 2EDOA 4ZS7L 4LLMA 2WWMD 4NKMB 3SGDI 1KIUA 4CJ0A 4HWEH 4OIAA 1E6OL 5B4MC 2OS7A 1KGCE 1BZ7A 4HMCA 1H3VA 2XTJE 4HUVB 1YMMD 2G75B 5BMFL 5I6XB 4PRNB 2APWA 2PNDA 1ZMYA 1ZXQA 3EAKA 3P4MA 2B20A 1Z9LA 1EA9C 2JIXB 2VSDA 5KSVA 1A6VH 3DX6B 4U1LB 1BEYL 3QPQC 1FDLH 5F8RC 4FQLL 5C6PB 3QG6A 2A6KA 3O6FA 5EC2A 4K9EL 1FZJA 3PL6D 1CDGA 2XKNA 3PE9A 3QZWA 4LEXH 2IBZX 2EC9U 3DRTA 2B7DT 3PWPD 4Z5RB 4M7JH 4S1SH 2YD5A 2JJTC 3QEQD 4UIMB 1K3IA 3TEUA 3WUWG 4LLQB 4MD4A 1IM9D 3ZKNC 4J3WA 1UB6B 1Q9WB 4XP9H 5A2IH 4AK1A 3AS2A 5J3HC 1QSFB 4OCXH 3LKQA 1KJMB 4XXCC 1D7FA 4OZHA 3QUZA 4IIQA 3RA7H 5SWQA 1HH6B 3TPKA 3PUCA 1PBYA 4Z0BH 4FQPA 4PB0L 3I6GA 5JUEL 3TT1L 4I3RL 1LE9A 3BRDA 5GJSH 4QNPE 5LJYH 1P5UA 4NO5B 5CZKA 2OI9B 2YRLA 3VI3F 4PJ8B 5JPNA 2D0HA 3CVIL 3D18B 3Q6FB 1OW0A 4YIQB 3D6GA 1RURL 4NQVB 1MFDL 3RWDA 2H2PD 3FO0L 4KMTL 4URTB 4XCYB 1QEWA 4P2CG 3ZMRA 3HI5L 3O6LH 4XCNB 5L2JB 2H32A 1RPQA 4GKZA 5F7EH 1F02I 2YBRA 2XWJB 4W70A 5CSGA 4JGMA 2D4DA 4NSKA 3B8SA 4YX2H 3AMLA 1JZ7A 3SE4C 5D7IB 2O93L 2BDNL 3MX0A 4Z78A 1DFBH 4ORZC 1U2HA 2NQCA 4MNGB 4O5LL 2UZXB 1MCNA 3HE6D 1KLGA 4JJ5A 4NN6C 4CN4A 3MBXH 2QADB 4DTGL 4P2OC 4G6KL 2PTVA 2R9HD 4ZOAA 5HJ3A 1QSZA 4XCCH 3O11B 3DURB 3O8XC 3EOTL 3C8DA 2RHEA 2PTTA 1MWAA 2AJUH 1KB5L 3L5HA 3FQUA 3HMXL 1A7RH 2R8SL 4HH8A 5FO9A 4EI5C 2E3VA 5E9DD 3U79A 3VG0H 4XNZC 2GJ6D 5CP3H 4HPOL 2QR0A 2YEZA 5GGUB 3GEWB 4E41D 1E4XL 3AU1B 2VYRE 1SVZA 3WFZA 3HE6C 4OF6A 5GS0L 3GK8L 4KTYA 1SEBB 2X41A 4JN2A 5FAAA 3JTTB 5C9JB 5F8QC 1T03H 5EU6A 3W9EA 1G6RB 5MENA 4MJIB 2GT9A 1F6AB 4G9FB 5TE7L 1UXSA 3C2AH 1YQVH 2DQEH 1A9EA 1WCQA 5I66A 4JR9H 2NYYC 1NCWH 1W72L 5CLWA 1W8NA 4P2YA 3IXTA 2X4QB 3MA9H 5E8PA 1ZLWK 1G7MA 1EO7A 1AE6L 4TTDD 4E5XA 1HEZB 5I17B 5IMMA 4KUZL 3INUL 1WWWX 5F9JB 1J86A 3PP4H 3PHQB 2I5YH 1S7SB 5FK9B 1MJUL 2FWOA 3ULUD 4K23H 5GGTL 3TH3T 5CHNA 4IM8A 5EZJA 2GK2A 4QTHA 1PW3A 1R6VA 2VLLB 5EPMB 2Q86B 2VB5A 1GGIL 1TJHH 2FX7H 1K2DA 4KVNH 2BY2A 4I48A 3C6LA 4IRZH 1KG0B 5L0QB 5IW1B 3UTQB 4GRWE 4NQDB 4AYFA 1ADQL 5SWZD 1BIHA 3VA2C 2Z93B 1QBBA 1XH3B 1JGEA 4WV1B 4ZNCD 1UM5H 5JDSB 1UCBH 5ISZB 3ULUC 1ZWIB 1DVFA 3KR3H 3MJ9L 4TNVF 1JHTA 2C4FU 2BSED 5KSUA 5DD5H 4CVWA 1CIUA 2ADGB 3CDCA 2YZ8A 4Z95L 5C0BD 5DRXA 2UYLA 4G8FA 3ARGC 2C4XA 1F4WH 3MA7A 1QQDA 1EDQA 1FC2D 3LS4H 3MLVH 4U05A 2AJZB 4F7CA 2Y36H 1RUPH 4PGCA 2FO4B 1GYAA 4RSVA 4XMLH 4L8SA 2VLJD 2L7UA 2ZP0T 4C58B 5EUOA 2D7QA 3QYCA 1CL7L 2BVEA 2D3VA 4HDIA 4F33A 4HEME 4PY8J 4F37K 2OP4H 4X5WA 3UBXI 3SQBA 1U36A 2VDOL 1UB5B 3D25A 3OX8A 5GS1C 1KCKA 2OJEB 4HIEB 3QDHA 3NIDE 4RFEA 1R5VB 4FRWA 1SQ2N 4R7DB 1L7IH 3RWJB 4O2CA 5E8EA 1H0DB 1G6VK 4PLKC 3E6FB 2FJFB 3P9LA 3DUUA 3OF6D 4MDIB 1B0GB 1J1OL 5D7SL 2NY4D 3CK0L 5ID1B 4LKCB 5IMLA 4GG8A 4U0QB 2OZ4H 2XT1B 3ARSA 2P5ED 5HYSB 4Q74A 3T0WA 3H7LA 2XZQH 4HCRA 4LCUA 4XVSH 5JHDA 1JGUL 4J4PA 2VNCA 3KPPA 4J3VA 1EGJA 1E4WH 1HYSD 1BD2E 1O7VA 4TSCH 5L6YL 1MHEA 1KJ3H 4XX1G 1NANH 4LQFL 1OGAE 4Q6IC 5ITBH 2GUOA 2WLYA 1NGYB 3L3IA 1JTPA 1CE6A 3GHBL 2J8UE 1G7PA 5IUSA 1GH7A 1RUAH 4KKNA 1MLBA 3OKNB 3CXHJ 4OLXL 2IMMA 5F1IB 2FSEA 1F97A 3D3VE 3BSZL 4I0CC 4KQ4L 4IMLA 1I7UA 2A74B 2XN9A 1OT2A 1Z6JT 1ZT4A 5I8CB 5GGVL 3FT2A 1WBYB 1OHQA 5HHOD 2ZCHL 4R2GB 4RBPK 4XNXL 2Z8WC 3C60C 3IJYA 4FQIL 5IOPA 2RFXA 2A77L 2GAZB 1YPZB 5K59F 3QDME 4S1RH 2IPUG 3MLUH 5IF0B 2HT2C 1JNJA 1MWAL 2I26N 5F3HB 3SKJH 1C16A 4PJ7E 4V1DE 4WTWA 2YR3A 4GRLD 2OL3H 2XRAL 4N8CH 2UVFA 3V6OA 2CGRL 2P8PA 3OKMB 2EDKA 4N5UA 3C08L 2V7NA 4MA7L 4IDJH 1DQTA 3ULSA 3QIUB 3V6FA 5IVZB 5I1GH 1JNHA 4F7MB 1V05A 1L7TL 2YXFA 2X9YA 3GIZH 1YEDB 3IF1A 4J7RA 4FNLH 4ZPTA 5IFJB 4OI8A 4N9GB 4P9MH 1MIMH 5GRUH 3QHTC 3PP3K 1EO8L 2HKFH 2NXYC 2XZCL 5EBLA 4W4OC 5E8NB 1EIBA 4C83B 3PABA 3VDAA 2FBJH 2COQA 3JUYA 5D71H 2OTUA 1MCDA 1LDPL 2CSPA 4PJ5A 2C1OB 5T5FH 1S5HB 1G7IA 3FMGH 4EN3A 1UYWH 3IXAB 2W9LA 3LH2H 4WI5A 5AAMA 3MRDA 2ZNWA 1UKQA 4LU5H 3OKDA 5I30H 3AS1A 5IFAL 4NWUH 3ARPA 5ICYA 4DWHA 3NCJL 4EUPA 5DJ2A 4M48L 1DP0A 3HE7C 2NW2A 2MJWA 3WYRA 4X7SH 1VEMA 4GG6A 3LKRA 1I8LA 2AJ3A 3SO3C 3RFZC 2R2BA 5HI5D 3C09B 4NZRH 5DK2B 3C87A 1SEQH 2Y72A 3GRWH 4P3CL 1NKOA 1BVKB 5IWLC 4APQD 4OZGE 5BS0A 2HRPH 4ZPVA 4QGYA 1ITBB 3MRBA 3QUYD 3A6OA 2XYCA 4I3SL 1A1OA 2XNAA 5EO1A 3WHXA 4MHHG 1RZ7H 1GC1L 2FJGB 4NRXA 4D0CB 2YPLD 5C0CA 3TH2T 5GGRB 3ROLB 3BPNC 2DQTL 1H8SA 3DX7B 1OLLA 1N59B 4Z7VE 5EU4A 1ZLUH 4NIKB 2Y6SD 3CMOL 4KV5F 3SDAA 5JHLL 4QXWA 1U9KA 1WSST 4APQC 1FE8L 1BPVA 1QLEH 4KRNA 2ZG3A 1QD0A 4RGMC 4FFYH 3X13A 4PRIB 3QUYC 5CIPB 5E6ID 1WLHA 1E27A 4PJCF 4Z7UE 3PWNA 2GCYB 4YK4C 4RFOL 3CLFH 2ZNXA 3O4LA 2BNRB 3QCVL 2R4RL 5ECJE 2B4CC 1MRCH 5EA0H 2EEAA 3FZUD 1VA9A 4YFDB 2Z35A 4OZHF 1HOCA 4RIRA 2VDKH 4JM2A 3MLXH 1KFAH 3GDBA 5BQ7A 3ULUH 3FFCD 2Q8BL 3JV0A 4HSQA 5TFSH 5I71B 1O7SA 1PX3A 2XWTB 5EC1B 1YN6A 2DWDB 5LBSH 1QBLH 4POUB 5JOFB 1SM3L 5HHPB 5CEXA 1XT5A 4YHOH 3G6AB 1S7VA 1C7TA 1A6UL 2WIIA 5MP6L 3BW9A 5MEOB 1JWUB 1UWGH 3EO0B 4KDTC 4N8VB 1NFDB 1ZLSL 4OKVB 4LLUA 4PJDA 5BVPL 1NCTA 4PTUB 3MJ8B 5E8DH 1I3GH 3LEYH 5JW5B 1HKLH 2CDGB 2IQ9L 1T22B 1GGTA 3VH8A 3F58H 5TE6H 5T1LA 4UNUA 1KELL 1T4KA 4JPIA 5F1KC 1QFWL 3AROA 3U82B 5IB1B 3NFSH 1ES0B 3FAWA 2ATPB 4F2MA 5FF6A 3TA3D 2MSPA 4G8GB 4NM8L 4YDVA 1CFQA 1LEGB 1EMTH 3KJ4B 4KKAC 1DQQA 1YC8A 1RUQL 5E2VL 3AB0B 4MD0B 1BBJA 4L8BA 5C0GB 2ZOLB 3T0VA 5L88L 5CJ8A 1KJ2B 4NCC1 2EIZA 5JXAL 2F54B 3MRCB 4YFEA 1P9MC 4NT6A 1I9RL 3KPSB 3OHXA 4AT6A 2A6JB 1YEGH 4CRPA 4Z76A 3S36H 2BNQB 2V17L 1N0LA 5FUZH 4EOWL 2UWEE 3WMSA 1BGXL 2F8VA 2NY2D 2EE2A 3V0WH 5BOZG 3NCCB 4XWGL 1JGLL 1VPOH 3F7PC 3IDGB 5FYKE 4TN9A 5T3XH 5SX4H 4M6NH 2B1HL 1WV7T 5D2NA 5AYUH 3BWAA 4P23C 2DS4A 4HIHB 1T66D 3H9HB 4HLJA 2AK4D 2CLVB 3LKSB 4ZAKD 4NC1C 4PGZA 1B0WA 3RWEB 4JDTH 4TYUA 2VL5B 4TVSa 4AM0B 2XTLA 4UT9H 5D93C 3TN0B 2BRQA 4XPHL 4K71C 3P77B 4XC3H 2E8ZA 4JRYE 5D70L 1P5VA 3ZE1F 4YQXH 3LEVH 3GSRA 1R3HB 5IGXL 2ZJSL 1AQDA 3VD3A 25C8L 2JIXD 1IL1B 5KJRL 3UX9B 1DLHA 2ARWA 4A6YH 3AREB 1AY1L 1MCWW 5FA3A 3ARFC 3GIVB 1I4FB 2N4IA 4OB5H 1M7IB 3G5XA 5EOQH 5LXGH 1BFTA 2IANA 4DKEH 5SV4A 1IGTA 1RZFH 1U8KA 2FL5B 2FECL 1KNOA 4HWZB 3GJFB 1FNGB 2E7HA 2ZKHH 3EYVA 1N0XL 4BZ1H 1IAOB 1RZKC 4PGJA 4DZ8B 3ZT6A 2GITA 4Y4HD 4M62L 2FEDD 1X5JA 1TVHA 4NZDA 4U3XA 3OXSA 4JDZB 2H8PA 5D7LB 3B6SA 1OVZA 4LK4A 5JLZB 3DI2B 5F7NC 4PRPA 2AVGA 3GMRA 1I1YB 2ZUXA 3R8BB 3OPZH 1N5YH 4TUKL 2NLJB 3T0EC 1F4XH 3F5WB 4YXKL 4LGRB 4IS6B 4NUJB 3KXFB 5JIHA 2HT3C 1ZSDA 1F5WA 5DJZA 5FYJU 4NZJA 2AQ1A 1GIGL 2FEDC 3RDTB 4HWBH 4OT1H 2X1OA 5DMGC 2QADD 3VFVA 2OI9C 3WIHH 4OZIF 4PJ8C 2VQ1B 1X5AA 5H94A 1HN1A 3HUJF 1ZANL 1FRGH 1RK0B 2HTLC 4HJGB 4MJ6A 2EE6A 3BD3A 1XGPA 4JFFA 3GSWB 1IJ9A 3WS6C 1IAMA 1UACH 5SWSA 3TJEH 4RWYL 4ODSH 4I77L 1YEHL 1C8PA 3T8XB 1J1XL 1MEXH 4KMQA 5JORA 5LCVL 3JBG7 3K80A 3MYJA 3GGWA 3D39A 1AGEA 1D5BB 2CDEA 4U1IB 3CVHH 1I8KB 3T1FB 3ALPA 4HJJH 2J3SA 2MQ0A 4OJFL 3QG7L 1CLYH 3BZFB 3U2SB 4MJID 5HYJA 4G9FD 3I02A 3ZT5A 2XWBA 2JJSA 3BE1L 2AI0H 3CJJA 2GI7A 1RVFH 4Z7WA 1CL7I 1HSAB 2C5DC 3MV9E 5H37H 1A9BA 43C9B 3EFDL 1AIFB 5HDQL 1PLGH 1HHJB 3FKUS 4LOUD 5BRZA 3KLAB 4EXPX 4QHLB 3X11A 1N5AA 1U91A 2EE9A 3B8YA 3VFUB 3UPRA 2B4CH 2OQJB 5GZND 4XZUA 1KPRA 3TFKC 4KI5F 2BHUA 4WGWB 2APBA 5JW3H 3V95A 2OX5A 2X2YA 2UUDK 2LVEA 4FQJH 3MMEA 1P4BL 3HKFA 4M43L 4NQDD 4PS4H 4X5LA 1YA5A 4CN1A 1X5KA 2Y5TB 5F1SA 3O2DA 5KVFH 1CXHA 4HS6A 4MAUL 1BJ1H 5FUCE 4UDTB 4QOKB 5DRZA 4GW5B 4X4XB 2H1PH 4M93B 5ILTH 1RUKH 2KQNA 3L3JB 3QIBB 4WW2A 5HHNB 1HKFA 1KXVC 4J23A 4QHKI 4C4KO 3KYMB 4GKNA 4Q9RL 4Y4KB 3QNZB 3GSQA 1Z0NA 3P3YA 1FZMA 5L2KE 1OAUL 4X9FA 4YEFA 4NGHL 1T7ZA 4XPFH 4FFWC 4NFCA 3HPJA 4YXLH 4OD2A 5L0QC 1BAFH 3B9VA 4DN3L 2MHAB 3GI8L 2E7BA 1SJEB 4FOMA 5CJBA 1NGXA 2A9NH 3STZB 4YDKH 2PYEA 4KROB 1K5NA 5C08B 5IHZA 2F19H 3VFTB 4ORGA 3DBXA 4KJYB 2O61A 4KJPD 4GG6F 2F74B 3MLSL 5DJCB 4WUUE 4IRJA 4ESKA 2R2HB 3CC5B 4LVNC 3LMJH 4ZSOB 3TIEB 3CFIC 3GSNB 5FUOL 3U9PH 4TOYL 4JFQB 1GPOL 5I1JL 5I16B 1M71B 1F4YH 3ELAT 3QXDB 3QJHB 5DDHA 5KS9A 4OGAD 3REWA 4S0TD 1JHLL 4BQBA 4JZJB 1N6UA 2X4SA 1YEEH 3NZ8B 4POYA 4Y5XB 3BWUC 1NDGB 2G2RA 4YHYB 4KK6C 3RZCB 1HHGA 4WRLA 4XT1C 1A3RL 1QBMH 1MCEA 4NP4L 3ZDXF 3IDYB 4UTBH 3RWIA 4OBSA 3R1GL 4MMZC 3WV0A 1JN6A 3BZ4B 2R2EB 1TFHA 1I7TB 4WI2A 4MX7B 4OGAC 3GNML 4PJFE 1HXYB 3UTPD 4RZCA 1JPTL 1QSEB 3WFBH 3JUZA 2JK5B 3P73B 5DLML 3V0AC 4DN4H 2HKHL 1QR4A 2PR4H 3BP7A 4HX1B 1I1AA 1FFPB 4L3CA 3TNNB 1MVUB 2EDQA 3MRNA 4R2GD 5CD5D 2X4NB 2NNAB 5CZVL 2VABA 4NKIH 4NZTH 5KG9A 1E4KC 1QLFB 3BEVB 1A3LH 1S9XA 1INQB 1NBYA 1SBSL 5MEQB 3V6ZB 3HI1A 2ILLA 3T0AA 2HA1A 3M8OH 1QUNA 2AEQL 1GOGA 1F45A 3N0PB 2Y7QB 2DYPA 5EIIB 1M4KA 2ESVA 5IVXE 1RZKH 2E9BA 1FYTB 5JOEA 3H7BA 4N1HB 4X7EC 1G9NL 2BOCA 1C12A 1HH9B 2EKJA 1J9CT 1QOKA 3QIUD 2OMNA 2J8HA 3GSXB 4L5FL 1OAKH 1XGRA 4PJDF 4BK4A 4OFYA 4MWFA 1QVOB 3B9KB 4JO1H 4RMUA 2DQGL 3FL7A 1KCUH 3RP1A 1FNEB 1U95B 3JTSA 4PJ9A 4Y2DC 3RGVC 4U1NA 1HQ4A 4N0UA 2EC9T 5DHVB 1S78C 5B38G 4JVUA 4PYHA 5IK3A 1HI6B 2R69H 3RVXD 4JFHE 1OGTB 1YNTA 3NFPB 4YNYA 4Q9CA 4S11A 5D1ZA 4I0PA 5L8KB 1DBMH 4ZUVA 1A6VL 5T33L 3WLBB 8CGTA 1TXKA 4OIIH 2CDFB 4AL8L 4KJWD 2EE3A 4P3WA 4M1DH 2XQBH 3MREA 4LEXL 3S96B 1LE5B 4AIZB 1JWSA 3SDXA 3HB3D 4M7JL 1R3KB 3U36B 3O3EA 3WNPA 4GAJH 2FX8H 3LV3A 5IB4B 4OZFB 4X4YA 1OP3H 3RVXC 3QXAA 3SQOH 4XP9L 5ACZA 4OCXL 4LEOA 4JQVC 1ZHNB 4L9LA 1I9EA 3RA7L 4JQXC 4HWNA 5GJSL 1BZ7B 4MNHB 3O2DL 1U8MB 4DKFH 4J1UB 3VXMA 1DEEA 4PJHA 1MQKH 3P2TA 3HB3C 3IU4H 1F2QA 2CKNA 3UJJH 5TDNB 2VAJA 4EBQH 2ITDA 5B3JE 1CG9A 3O6LL 3MLWH 4UT6H 3BPOB 3QG6B 2A6KB 2HLAA 3RWCB 2P5WA 1KCRH 1WBXB 3L7EA 4RGNE 2KL6A 5MENE 4PJCB 3C09C 4YX2L 3X14B 2VLRB 2XKNB 1CXLA 4MNQE 1K8IA 5GS2D 1NBZA 3UYRH 2P1YA 1DFBL 4IRSC 3UTTA 1BFOA 4G43A 3A0OA 3QUMA 1A14L 1QFWI 3MBXL 4BQ6A 1JZ2A 4PRID 4YR6A 1G9MC 2W65B 5D6DC 2X44D 4XCCL 3LKQB 1AC6A 3AS0A 4N5ED 3U6RB 4OZHB 4OGZA 2D9CA 5LVEA 1YMMA 1A7RL 1I1FB 2BNRD 1KJVA 4U6HA 1R0AH 1LE9B 3ULVD 3FB6A 4X9HA 2DAVA 4PGDA 1JF5A 1Z9SA 2FHBA 3IKKA 3RY6A 4BFIA 5T3ZD 3OJ2C 3LKOB 3EJZC 4R26L 4HV8B 4POZC 3NCBB 2A83B 1FC1A 1YNKH 3N06B 1J12A 5DO2D 1EHLH 5KAQG 4HZLB 1U41A 1QEWB 1UVQA 1JMXA 3PL6A 4H88H 1FNSH 3RIAK 2H32B 4TSAH 2BVTA 3PWPA 1CGTA 4GKZB 5DUPH 1F3RB 5F72S 4DKDC 2AABH 4ODHH 2ICWA 3HC3H 3VDBA 1VGKA 4PJBF 1SMOA 2I25N 4Z78B 1XCQA 2BRRH 2DQEL 2AEPH 4F9PA 2WBWB 3DJ9A 1KLGB 4JJ5B 4C56B 3KPMA 3UTSD 1NCWL 3L6FB 2VXQL 3JSSA 5HJ3B 4ZFGH 3MA9L 4PD4K 3HC4L 4KAQH 1XEDA 5DO2C 1OP5H 4ZO6A 3O9WB 3Q5OA 2PTTB 1LILA 4LARH 4WDIA 3PP4L 3O41A 1KTDA 3NFNB 3I3BA 4NQXB 4K23L 5FO9B 4LNVA 1A7PH 3DVGB 4PRHB 3QJFA 5EUOE 5KOMC 2P46B 1WCBA 5ALCH 1XGQB 2C4FT 2QQLL 4F9LA 1CZ8H 4Z18A 1MCRA 1TJHL 2P24B 3HFMH 2FX7L 3H8NA 4DZBB 4G8GD 1FH5H 2ERJB 2EIDA 4ELKA 5IEHA 4IRZL 3W11D 5JDJA 5FYLH 4YAQA 4JN2B 4WU5A 3HS0A 1OOAA 3MCG1 5EU6B 1VKXA 4Z0XB 3QEUA 2GT9B 2F54D 4ZQKA 4XCFH 2V5SA 2GSGA 2W0PA 2IBGA 1IC5L 3IAQA 4NO0D 1L0QA 2FECI 2XQYG 1OARH 4QT5B 1UCBL 1A9EB 3KR3L 2BNQD 3VFRA 5I66B 2NXZC 3PGDB 5ICXA 1PGRB 2VL4A 5DD5L 2EDRA 2WUBH 2H45A 2XTJB 4KTDH 3FQXB 1G7MB 2XV6B 4ERSH 4E5XB 3LS4L 3MLVL 2Y36L 4QKXB 1RUPL 2GJ6A 2DMKA 4LDEB 1MCOH 4DW2L 1MRDH 3KJ4C 4E41A 4XMLL 4Z7WF 5JZ7C 1DBBH 1MIEH 3SN6N 1EERB 3BXNA 5EZJB 4X80L 4QEGA 4QTHB 3QR2A 3MUY1 1IGIH 2VISA 3WUWA 5EH1A 2OP4L 3QNYB 1K2DB 3DPBA 4I48B 5D7KD 2HG5B 3C6LB 4JZNA 5CSZB 4XP6H 3T3MF 4JREB 4RRPG 3SE3C 1H15A 3LPFA 2XN9E 1JGEB 5C07E 5E7BA 2A73A 1DVFB 3IYLW 1VACA 3CUPB 3H3PL 1JHTB 4Y5YC 2OZ4L 3N9GL 3MNZA 2B5IB 1X5HA 4GRWH 4PY7B 1QQDB 2XZQL 4HKXA 4F7CB 4NNXA 5HDLA 4XVSL 1IEAA 1UFUA 3TN0C 1RMFL 5IG7A 5HPOA 5C6WH 1VENA 2R2CA 2HWZH 1E4WL 3OTTA 1X5LA 1FL5A 1WBZB 1RY7B 1EHXA 4GAYA 1AD9A 3KNBB 5E24E 4OD1H 4EZMA 4X5WB 3RHWK 5ITBL 5SWZA 5DJAA 3OX8B 1MI5E 3EJYD 5CINL 1T7WA 5ICZB 2DM2A 5D7LD 3VRIB 3AREC 3NMEA 4DQOH 5EO9B 3RPKA 5MERA 5D6CB 5HGHB 3MV7E 1MRFH 3MRHA 1KN2L 4LCIH 1CICB 1CQYA 3P9LB 5BZWA 5C6TH 3DUUB 4GBXA 5C0BA 3KXFD 5IMLB 4GG8B 3SCMC 1T21A 4OZIB 1ETZA 1T6WA 5ESAA 3HUJB 2VLJA 4Z7NE 1XF2A 5KS9F 1W0VA 4S1RL 3MLUL 1ZK9A 3CX5K 3WE6A 3RDTD 4X98A 3TBYA 1QR1A 3AVEA 4ODTH 2D7OA 3SKJL 1VCAA 2HJKB 2OL3L 4N8CL 5IB5A 4KQ3H 5GSVA 3AXLB 5J9PA 3W39A 4UNTA 5F89B 2GUOB 2BNUA 2XFXA 5CD3A 5I1GL 1G7PB 4PRBA 4MAYB 4NNYA 3LD8C 2HLFC 1EEQA 1MLBB 1XR9B 2R15A 3GIZL 1U8PA 3VI4F 3OF6A 4BKLA 2DD8L 2WUCH 4P9ML 5GRUL 2FSEB 1OTSD 4GRMB 5EO0B 3Q0HA 3FCTA 1HNGA 1P1ZB 2P5EA 4HXBH 4BUHA 4KZDH 3MROA 4EVNA 4QRRE 2FBJL 3CFBA 1V3MA 1Z5LA 1FPTH 3IJYB 4S1DD 4OCYH 2RFXB 5T5FL 3DOSA 4NQEA 1C08A 4PLJD 1UYWL 4L29B 5B39B 3WL9A 4F3FA 1HILB 5AD0B 4NWUL 1BZ9A 4HIJA 1NKRA 4YE4H 1C1EL 1TQCC 1G9MH 3O45B 2QKIA 3VD9A 5E0QA 4Y1AE 3VD4A 1C16B 4KY1H 1OTSC 1IKNC 2VUOA 2P8PB 2UZYB 1QRKA 2V7NB 2Q3AA 4LPUA 3ULSB 2W92A 5D5ME 3MCLH 1JNHB 4NO2A 4NZRL 3IF1B 5IQ7H 1SEQL 3GRWL 1GAFH 3K8KA 2D0FA 4IMKC 2YS4A 4F7TB 1E28A 4XP4H 5HHOA 1QNZH 3OKOB 2HRPL 2V5YA 2HH0H 4HIIA 5EWIL 3VGGA 2MFNA 2LAGB 2KH2B 2OTUB 1IE5A 1UH4A 1S7WA 3OKKB 4PJ5B 1RZ7L 1G7IB 2H3NA 1XIWC 4PJGA 1PYWA 3MRDB 3W9DB 4LDOB 1RU9H 3NAAH 4N68A 4KC3B 5IM7A 3V0VA 2VSCA 3WXWH 1BP3B 4GRLA 4HIXH 3V5HB 3QI9D 5DMKA 4JFEE 3MRKA 5ICYB 3MGOA 2P4AB 4EUPB 2GSIB 4ZTOL 4UBDD 4ZFZA 4ONGH 5DJ2B 3U0TA 1E4JA 1CLCA 1CTOA 1N6QH 4X4ZA 1J0KA 1WZLA 4H5SA 4Y4KD 2NW2B 3SE8L 3KPOA 2E27H 4FFYL 1GOFA 3V4VH 4GG6B 3OJDA 1PKQB 5E2WH 4WW1B 1EHNA 2AJ3B 4U1HA 3MNVA 4N0FA 1TCMA 3WS3A 3QEGH 3RVVD 3BT2H 3ZHKA 1SYVA 4L4TE 1KIRB 3CLFL 1TITA 5DJ8A 3HLAA 1JVKA 2FYYA 2AJYH 4AZ8A 2ADFH 3K2MC 4LP4A 4JLRA 4X6CA 1VEPA 1JNNH 1MRCL 5EA0L 3GSUA 3MRBB 5IV2B 4ZO7A 5DEGB 4HK0A 4ELME 1JJUA 1CDJA 1JNLH 4LKXA 3QIBC 5JW4Q 5EO1B 2VE6A 4NRXB 5C0CB 3BJLA 3D5OF 5DVNA 2VDKL 1BD2B 1A7NL 4Y4KC 3MLXL 4K9EC 1KFAL 2PYFB 3KHQA 1OGAB 1S9KC 3ULUL 5TQ2H 1CFVH 3E2HB 3S97C 1IEBA 3IGAA 5TFSL 4PJHF 5EU4B 5EFIB 1DEDA 3D0VA 5LBSL 1QBLL 1NDMA 4KROC 3UPAA 4YHOL 3TCXA 5K93A 1DJSA 1TZGH 4C57C 5C0DB 4U1KA 1EV2E 1LHZA 4DK3A 3QWOB 1UWGL 1ZA3A 4APQA 5IJKC 1I8IB 3JWOC 3PWNB 3PV7A 1EUTA 4N1CA 3LEYL 1HKLL 3KYOB 2FH6A 3O4LB 1OF2A 4ZFOA 1UT9A 3F58L 5TE6L 4MJ4A 1J88A 2YPLA 4WJ5A 5JW4N 3EHBC 1WFNA 4JZJC 5DGQA 1QSED 4Y5XC 2Z35B 3S34H 4XXDA 3IB4A 2IMNA 2F53B 4YHYC 3RZCC 2W38A 1ZLUK 3GMNA 3JXAA 5FHBH 4G3YH 3VXPB 1EMTL 4X99B 1L9MA 1T5XB 4HD9A 4JPWH 2GJZA 3IDYC 3A67L 2W0LA 1TTGA 5E94A 3C9NA 3WJLA 3VWKA 5HHQA 5E6IA 3IAPA 5J13B 4RQQA 4WI9A 5FUZL 5GRYA 2WIIB 1DCLA 4OQ1A 3BW9B 1G84A 4PLNC 4P4RA 1JI1A 1RIHL 3ARDB 5TDOB 1VPOL 4PJDB 4Y5VA 5T3XL 1MSPA 4JFPB 5EOCJ 4RAVA 5BZDA 1HK6A 1IVLA 2YUZA 1OL0A 2C3GA 2PCPA 1FYTD 3S35X 3VH8B 4MLIA 5T1LB 3CU1A 5J1SC 3BISA 1T4KB 3IDMA 4H1LG 5FUCC 4WU7A 1P6AB 3CSYB 2ID5A 4JFDE 3L1OH 2ICWJ 5BVJA 1I75A 1YJDC 4RX4D 1J0IA 1RULH 3B9KD 4UDUB 4JDTL 2Z91A 4F2MB 1SMAA 5CGYD 5FF6B 5GS0C 2AK1L 3FFCA 4YDVB 1MFCH 3FB5A 3QHFL 3D2UD 4XC3L 1B2WH 4UT7H 1BVZA 3GJFH 1JIBA 1BBJB 4L8BB 2Y06H 3VXNB 4YQXL 3LEVL 1A47A 4XPTH 3OHXB 1KLUB 1WIUA 4R7NA 4QTIH 2X70B 1LO0H 1BQHG 4A6YL 3D9AH 1H5BC 1QHOA 4OB5L 3PDDA 5EOQL 4B7LA 5LXGL 3ILQC 4DKEL 5D2NB 3FN0H 5DRNB 4YXHH 4ZFFA 3TA3A 5K9QI 4X7CC 4BZ1L 5KVGH 3LRGA 4JFFE 4QWWC 3KLSA 3EDKA 1VERA 3KPRE 3M1BA 2ZUWA 2G5BA 1FL3A 5FDWB 4FFZH 4Z7QE 2VZVA 2PO6C 2W07A 1U92A 2N7BA 4OIBA 5FGCB 1P2CA 3OPZL 5BV7B 1N5YL 3FQRB 3I6LE 1FGNH 4XI5D 1X44A 1K4DA 4XGZA 1A6TB 3K8MA 4JB9L 4MA1B 2VLRD 4B50A 2XKUA 4FQ1L 2QSTA 3G5XB 4LDLB 4P46B 4QHUB 4HWBL 4OT1L 1X5IA 2CLZB 4ZAKA 4NO3A 3G04A 5IMKA 1IFHH 4GO6B 1GGYA 3QDJE 3WIHL 3EYVB 1JYNA 4CADA 5HD8C 4ZXBA 1KUMA 1FRGL 4AMKL 4QRUA 1IGMH 3RKDC 4XI5C 3ALXA 2J1KA 4B41A 3BPOC 1MCHA 2VDMH 4PRAA 5J6GA 1P7KA 4R0LB 2WM0A 2H8PB 3O6FC 1TENA 4GS7B 3TJEL 2JIXA 3RJDA 5F7LB 1JMZA 5GISH 4PRPB 2VITA 3GMRB 3Q3GB 4PJBB 1FLRH 3SKNB 1JPGB 4FZEL 3CVHL 1O0VA 4TVPD 4Z5RA 1D9KB 3OXRA 1CLYL 4JFZH 4UIMA 3QWRD 1HSBB 3QFJB 2ED9A 2YN3A 4MVBC 5CBEB 3IS0X 1I7ZB 3QUZC 4IIQC 1UB6A 4M61A 3BP6B 2AI0L 3ALWA 4C56D 1KJMA 1RVFL 2GIYA 4NJAL 3VFVB 3LS5L 4Y4HA 3RUGE 5IHBA 1OW0C 1KYOK 1PLGL 4MD5A 4MJ6B 3O9WD 1GL4B 1MCIA 4FMKA 3U0WH 5BMFH 4X4MA 4JM4H 2VMFA 2B4CL 4NQVA 5SWSB 4PRHD 4U6XA 3KS0J 3ZTJH 5DD1L 4XCNA 2Q76A 5JORB 3MYJB 3F62A 1FO0H 1AGEB 2YD7A 2CDEB 4Y2OA 2VOTA 4K9EH 4FQJL 1SY6H 2E6QA 1EJ6A 1H3PH 2CKBB 3T0XA 1B4RA 2LU3A 2J5LB 5F7HA 4MNGA 4PS4L 3RX5A 4LPWA 4M1CD 3G9VA 5KVFL 5E6YA 5HYJB 3DURA 3UCRA 3F6LA 1PZUB 4PJAF 4P4KB 5A3ID 2DIJA 5DVMA 4Z7WB 2H1PL 4XP1H 5ILTL 4PJEE 5F21B 1A9BB 4JFOA 1NANI 2SEBA 3JWOH 2XTJD 3GSNH 1UG9A 4I3RH 4U4BA 1LO3H 1NC4A 3PHSA 5CEZD 5BRZB 3EDJA 1N5AB 4XPFL 2ERJC 2YD1A 3CVIH 5GGUA 1A1MB 1NUFA 1RURH 4W6YB 3AU1A 3PV6A 4XZUB 1KPRB 4KMTH 4QRPB 4YDKL 2A9NL 3HI5H 4FQCH 4OD3H 2W59A 1WQVT 1SEBA 4FHBD 3MLTB 3GMOA 1G6RA 2BMKB 3BYTA 1F6AA 3C6LD 2VAAB 4J8RB 5KTEH 4G9FA 3LMJL 4W81A 3MMEB 4ODUB 2J2ZA 2BVPA 4DCQB 5I1DB 5I8KH 4M5ZL 4HS6B 3GBLA 4LLWA 1F4YL 5CGMA 1QBAA 5DQDH 5F9AC 3VD5A 3TBVB 5K9OB 1YYML 5DEFB 1YEEL 5F1OB 1JZ5A 1CGSH 2FHCA 2YZ1A 4AENA 5FK9A 2FZ3A 3GSQB 1FZMB 1MHHA 1LP9E 1V7NH 2I07A 5FV2A 3HPJB 3BKYH 3C6LC 1I9IL 2VLLA 1OSZB 2Q86A 4OD2B 4UTBL 3KLDA 2BC4A 4JREC 4KHTH 1YJDH 2I27N 4ETYA 5IEKA 1CDIA 1FG2A 2IAMA 2PYEB 1K5NB 4ORGB 5GS0H 3NN8A 3DBXB 1NBQA 3GK8H 3VFSA 2O61B 2DBJA 3UTQA 5HYQA 4NQDA 4IRJB 1WITA 1DVFC 3LAFA 4KXZI 3RKPA 4ZDHA 4XPBH 2Z93A 3WFBL 1Z9MA 1XH3A 2YKLH 5IKCA 4WV1A 3W5MA 5JDSA 4D2NA 3P0YL 4DN4L 2B5IC 2DMCA 2MMXA 2DJ4A 2CLRB 2DDQH 2PR4L 1NBVH 1VFUA 5DDHB 5KS9B 1CICD 1X4YA 3OAYK 4L8SC 4ODBD 4MB3A 3E6HB 4NKIL 4NZTL 1WAAE 2HFEB 4WI3A 5HVFB 4HKJB 1MJUH 5TF0A 1A3LL 1OPGH 1HHGB 1HHHA 3PQYB 1ZT1A 4GQ9H 5DHVH 3T2NL 4C4KT 3M8OL 3TVMD 4L3EE 1OTTD 3JVGA 4EEEA 3BDXA 1DDHA 1D5MA 1RZKL 4UI2A 1WFUA 5KSBA 1KEGH 1JN6B 1UB5A 4OGXH 1EFQA 2VDRH 3EGSB 1J10A 5E56A 1TQBB 1R5VA 5A16B 1U3HD 4MAYD 1H0DA 2AQ2A 1FJ1A 4RZCB 3MV9B 4WWKB 1KCUL 1KB9K 5E4IA 3MJ9H 3UJIH 4OQTH 3KPNB 3BP7B 4ZMAT 5C0JA 5ID1A 1CLOH 2R69L 2VQTA 5HYSA 2EEBA 3HAEB 4J4PC 4Z95H 4L3CB 2JJWA 5J11C 3WKNA 15C8L 3VXME 5DT1H 4BH7A 3MRNB 1X5GA 4RAUA 3E1F1 4P5TD 4RBPH 2VABB 2PF6A 2W91A 4HFWB 5KG9B 5DR5H 1DBML 2LABA 4OLWH 1S9XB 3T4YB 1CDBA 1K4CA 5GPRA 5ACMA 5DTFA 1EO5A 4KKBC 4HUNB 4X6DA 4J3UA 4HG4K 1VFAB 4GXUM 2ESVB 4UU9B 1NGYA 3UTTE 2VDOH 1Y18A 2FX8L 5FGSA 2B1AH 2G9HA 3L7FB 1GJIA 3ETBF 2BOCB 1DANU 3KHOA 3SQOL 1XGRB 2VXVH 2CPCA 4MWFB 2HVKA 1NSNH 2EEDA 4U1NB 4N0UB 3SBWA 3PP3H 2HTKC 5IK3B 2A6IA 1URLA 5C3LD 1A6WH 2GAZA 1V7MH 1FVCA 1RHFA 1YPZA 4DKFL 3T65A 1FLTX 1MQKL 4YNYB 3IU4L 5D1ZB 4KI5C 4N0YH 4WFFE 4ZUVB 5IF0A 3UJJL 3V6OC 1NCAL 4XHJD 4EBQL 5HGDA 4U0RC 5FYJD 3MLWL 4UT6L 1AXSA 3PWPE 3CSBA 1KCRL 2YRPA 1J5OL 5FECA 2DI9A 3QEQE 1AHWB 3I3DA 3V2AR 4KK5C 3CMGA 1J11A 3UYRL 3QIUA 5IVZA 2NPLX 5JMRA 5E5MB 1R5IA 2AJXL 3FONA 1G7JB 3LV3B 5IFJA 2H32H 3BSZH 4PGEA 4ELMF 1ERNA 3RTQB 4QRQB 1G6RL 4L9LB 4EN3C 4XHJC 1YEKH 2ZCHH 5CZXD 4XNXH 1X7QB 1CR9H 2AXHA 4M9PA 5BW7A 1S5HA 2YXMA 2A77H 4H20H 2ZUQB 5F97E 3GBNH 3MV8E 3DNKA 4PJHB 1KB9J 1DQMH 2FDBP 2HYMA 1PSKH 2B39A 1BD2D 2ITDB 4H88L 4IOFD 1FNSL 1CG9B 1MWAH 3BKJH 1FNLA 4Q0XH 4GJTB 4NBZB 1OGAD 4A2MA 2P5WB 3QQ4A 3ZYIA 1GSMA 1I8LC 3L7EB 5DUPL 5SX4I 1T0PB 4E0RB 2AABL 1OP3K 4ODHL 3C08H 4JPVH 5D1XD 3HC3L 4MA7H 1NBZB 3UBXG 1WTGT 2BRRL 3MZGB 2AEPL 4G43B 5AEAA 1JP5A 1DN0A 4IDLA 3D3VD 3QUMB 5J4MA 2DM3A 4YR6B 1BVKA 4OCWL 3MR9A 5FGRA 2XZCH 4ZFGL 2NY3D 4KAQL 1WC7A 4X6FA 3FRPG 5E9DE 5C7XH 5DMJB 4MS8D 5EU5A 2ED7A 4LARL 3U9UB 4IOFC 3O4LD 1BREA 3QFDA 4E41E 2ZUVA 5KSAA 3FB6B 1GZPA 4K7PY 3QDMD 1MF2L 5GGRA 3ROLA 5ALCL 1IARB 4LPXA 3SDAC 3DX7A 1CZ8L 2ZZUT 3HFML 1U8NB 3RI5K 4BJLA 2F53D 4V1DD 5CEZH 1FH5L 1UVQB 5FV1L 4WUKH 4N90E 4UTAL 1QACA 3NCJH 1PAMA 5FYLL 2JCCA 1UM6L 4KTEH 5T1DL 4OV6F 5I18H 3QWQB 2W60B 4XCFL 1VGKB 4G9DB 4PRIA 1VHPA 5I1CH 5CIPA 1R3LA 1OTUD 1OARL 1UCTA 3HPLB 4QHNB 3CD4A 1GGUA 3KPMB 2GCYA 4YGVB 4N8PA 1QO3A 4WHYG 1CD9B 3P11H 3ARDD 2BNRA 3HNSH 4L4JA 4QHMA 3ULUE 5DUMH 1CF8H 1CYGA 1JZ4A 4U3HA 2V5TA 1XFPA 2DQFA 4WDIB 4JM2C 3O41B 1MCOL 3VE0A 3RVWD 3ARBB 4I3SH 1KTDB 1MRDL 5F7DB 4Y0GA 5JIIA 1DBBL 1MIEL 3QJFB 2Z9TA 3BKMH 2X40A 1NJ9A 1NQBA 1CGXA 1MCWM 1A64A 1IGIL 4R6UA 3ZDYE 5J13C 2CJUL 2WAHA 4DOHB 5IEHB 4QRTB 2DWDA 2BVQB 1BQLH 4XP6L 5DJ6B 3HS0B 3PJSA 4XAWH 1VKXB 2DLHA 5HGGS 1U2CA 3EKCA 3PHOA 5HI3C 1WZKA 2OR9H 3UTSA 2DRUA 3EO0A 3CFDA 4OKVA 5I76A 3H6JA 3PNWB 2H26A 5ICXB 1K3ZA 4RFOH 2CDGA 3BP4B 4XBGB 3LN9A 1PZ5A 2WWKT 4YHMH 2GJ6B 4XTRC 1MH5A 1ZHLA 1N3NB 2IWGA 4HQQH 3QCUH 4V2BA 3K3QA 2HWZL 1X6LA 4P5KB 4G8GA 3SPVA 3BXNB 5AUMB 3NPSC 1ED3A 1AGDA 1LEGA 1EEYA 2VISB 3WUWB 4FXGA 1M1SA 1QKZH 4OD1L 4ZO8A 5T3XE 2DL2A 4MNQB 5D96C 4CMHC 2ZOLA 1R3JA 1K6QL 4H8WL 4HCRH 4HJ0D 4GLRH 1KJ2A 4IJ3B 5L9DL 1N2RB 4NO0A 3T1WA 1WISA 2A6JA 4L4VE 1EGJH 4ZUSB 2HT4C 4MQSB 1A6UH 1H15B 1MRFL 1L6XA 4LCIL 5DQ9B 2P5EE 4YBHA 5C6TL 4K8RD 5D2NC 2A73B 3QO0A 1VACB 2HMIC 2WV3A 1S8DA 4K3DH 3SJVB 4UB0H 3OGCA 2AXFA 4MA8H 3D85D 1P7QD 3EJJX 3HMWL 4MSWA 3MNZB 1CT8B 4GAGL 4HKXB 5CJOH 1KELH 4LMQI 3H9HA 4P46D 1BECA 2D7TH 5IG7B 4P2QB 4ODTL 4G6JL 2DTSA 4PBWD 4AM0A 1Q0XH 1FL5B 4PJXA 4X7DC 3VGEA 4CVZB 4GAYB 1AD9B 3AS3A 5IBTH 4DKAA 3P4OA 1AO7E 3O4OB 4K8RC 3HNTH 2E8YA 1HCFX 5SWZB 3O81A 3I9GL 3TZVA 4F57H 5JXAH 1XF5B 2B8OT 3UXFA 1YECH 4LL9A 3L5JA 5IFHH 4WGVB 3FO1B 2WUCL 4MA1C 4O4YH 1IL1A 5HHOE 2V17H 1KC5H 5AZ2H 4ETQA 4QCIA 3MFFB 4HXBL 5BZWB 1KPVB 3OB8A 4JY6B 2GY7B 4GBXB 4XH2A 4FTVE 4UV7H 3FQNB 3GIVA 5BXFB 1D9KD 3RUGF 2VDLH 2BFVH 2LV4A 1ETZB 2FL5A 3NZHH 4PJGE 2VLJB 3QFJD 4YBLC 5IB2B 4M7ZC 1XF2B 1JPST 1W0VB 3LIZH 3WE6B 3TBYB 1JK8A 3F7VB 4U3CA 4YE4L 1QR1B 4GS7C 1WFTA 3BHBB 3H9YA 5M7QA 4KY1L 4NJ9H 5I9QB 4XPHH 5GSVB 3K81A 4JDZA 5D7LA 3W39B 5FYJH 3EOAB 2BNUB 3TBWA 1J8HE 5CD3B 1OY3B 3MCLL 3M07A 4WTZA 2EH8H 4NNYB 1FYHB 3X17A 2V6HA 5SWSD 4BKLB 5KSBF 3T77A 3F5WA 4NUJA 4EUPH 3KXFA 4U2ZA 3THMH 4XP4L 5K9KB 5FYKD 1QNZL 5B3NA 2WP3T 1AY1H 3MROB 4LCWA 2HH0L 3JV5A 1DQLH 3CFBB 5F7KC 2DLGA 4PJAB 1Z5LB 1DLFL 2EECA 3ZDZF 3SE9H 3ZTNL 3RDTA 1ZVSA 1JWMA 3DLQR 1C08B 4NQEB 2CXKA 2EDLA 1UM4H 3WL9B 2JB6A 4XP5H 2F5BH 2NY6C 3ZSTA 1N0XH 2AERT 3ULVL 3WXWL 1BZ9B 4HIXL 4HIJB 4RRPA 3NCYP 1QTYT 4P4KD 3RPIB 1ZTXH 4M62H 1G9NC 3U7AA 1N6QL 5C92A 2CUHA 4PUBL 4WO4B 3V4VL 5E8OA 5E2WL 1YY9D 35C8H 5C07B 4X6DF 1EJOH 1VFBA 4NO2B 3QEGL 2J5LC 1D5BA 4QRPD 3SHSA 4U1IA 1B4JH 5CFHA 2QBWA 3DETD 1E28B 2RBLA 1QLRB 2P8MA 1I8KA 4U1MA 3T1FA 4RGOH 4X0KB 4AIOA 2JJSC 2ADFL 4ODWB 2O5YH 1JNNL 4U6YA 4HIIB 5ABDE 1JNLL 1S7WB 5FOBA 4L3AA 1ULVA 5E2UH 3PDGA 5HYFA 1L0XA 3WSQL 2JKXA 3BIAX 3RHWF 4Z8FH 2VLKA 5IM7B 4TUOA 1LP9F 43C9A 3V0VB 1MCPH 1N64H 5TQ2L 1CFVL 3G9AB 3HZVA 5DMKB 3MRKB 2BX5A 3MGOB 3KLAA 4QHLA 5ELIA 4AG4H 3U4BH 4ZFZB 3BZEB 3DETC 4PJIA 3VFUA 3H42H 4Y19E 3U0TB 3FQWA 2OQJA 4IHOB 4I8DA 1AXTH 1CVRA 3OJDB 3M17B 1YEHH 1QRNB 4U1HB 3MNVB 1J1XH 2A1WH 4N0FB 3WS3B 1SYVB 4ZS6C 1KJ2L 3BGAA 2OSLA 2CMRL 1LO2H 3B5TA 3IJSA 2PYED 2NZ9C 2MTPA 5DJ8B 2NR6C 4OJFH 5F88B 4JLRB 3AUVA 4NQCB 1G7QB 1MLCB 2Y5TA 2PKDA 2XA8L 3RVUD 5EZLA 2UVEA 4WW2C 4KJQC 5JA9A 4Y7MA 3FFCE 3QI9A 3SDDD 2FEEI 4HGKC 1CVSC 5FHBL 4G3YL 1JHKH 3LVEA 5F1NA 4OUUB 3QDGE 2EO9A 1UXWB 3DYMA 5HDQH 2IBZY 2RJMA 1IEBB 3QNZA 4JPWL 3BGFB 1LO5B 3MXVL 3D69B 1WT5A 2A9ML 2Q6WA 3D0VB 4OKDA 1NDMB 1PEZA 3PQYD 4YDLB 1NLDL 1V3JA 4MXQD 4ODVH 4IRJC 5D2LF 3STZA 1ZA3B 1FCGA 3VFTA 4QRRB 4WHTB 5AWNL 1REIA 4XBEH 4QXUH 5DJCA 4Z9KB 1LD9B 1KV3A 4ZFOB 1I7RA 2OR8A 3TIEA 4R96A 1RQ5A 1OP9A 3NTCH 2YPLB 1WFOA 3L1OL 1M71A 4MAUH 4F80A 4XXDB 1RULL 4EJ1C 2FGWH 5C2BH 4Y1AB 3MV9D 4WWKD 3WFEH 3JWNC 3LKNA 3NZ8A 3KGRA 2VUYA 3NA4A 4NC1E 3RU8H 5IROA 2EDBA 1NDGA 3QUXD 4UT7L 5L8LB 4QXTA 1C5CL 2Y06L 2ZCKH 3G6JE 2GJZB 3EYUH 3MLZH 4OF3A 5EB9A 4XPTL 5E94B 3C9NB 3TP4A 3VWKB 5HHQB 5E6IB 4BFEA 1WUNT 2YA2A 1UC6A 4JPKH 1NCDH 4QTIL 2XY1A 1LO0L 3BEWB 5HDBE 1AR2A 2JCCF 1TQBC 1JZ8A 4P4RB 3DUSB 3V7MA 2R2EA 3D9AL 4Y5VB 4DFIA 2IJ0C 4NQTA 4BSVA 1NC2A 2ESVD 4RAVB 1UWEH 5BZDB 2CD0A 4GSDH 3R0NA 2AK4E 1HXYA 1I1AC 3R0MA 1QSEA 2PCPB 4K8RH 5TQ0H 2FIRT 4UOJA 4GW4B 1MHPL 1HHIA 5FUOH 4TOYH 1Q1JH 3DVNA 4WU7B 5JIKA 5I1JH 3S37X 3MRGB 5BVJB 3DYOA 3LN4A 3MUZ1 1FFPA 5KVGL 3MQIA 1IGYB 2Z91B 3FN9A 1JHLH 1PG7X 4N1EA 3PG2A 2VH5L 3FB5B 1TETH 2DJUA 4I18B 4LCCA 5L2KD 3BEVA 2ZUTA 1P4IH 4FFZL 3J8F7 3LN5A 2YA0A 1FG9C 1INQA 1DBAH 3VRLF 3OAZH 5MEQA 3SDCD 3OZ9L 4AQOA 3VFPB 2YWYA 1XGYH 5T5NG 4LSTL 4R7NB 4N0RA 1HINL 2DM4A 4NP4H 1FN4A 3WKMH 3T2OA 2ITCB 4GW1B 3R1GH 2CIIB 3T0EE 1J18A 2R0KH 3EW3B 3DMMB 4ELMB 4ZYKA 5KVEH 3QZWG 1HH9A 4PJ9C 3GSXA 1QSFE 1B6DA 2R1YB 4RX4A 3B9KA 1IFHL 4FZ8L 4ZFFB 3TA3B 1UZ6E 3MRQA 1IC1A 1FAIL 1G0YR 1KEMH 2B2XL 4R4NC 2GTZB 5DWUL 1HI6A 3D2UA 3RTQD 3HI6H 4HEPG 1EBAA 1EUUA 1EX0A 3GJFK 4I0PC 5D1ZC 2CO7B 5GS3A 2L7JA 5F9WC 5FO8A 2AV7B 4LASH 4MA3A 1XGTA 2HJFB 1I9JL 1ZKAA 1FL3B 3DYPA 3KWWB 1BVLB 1BBDH 2APFA 1U92B 3A6CH 5T1KB 4RDQG 1M05B 2CDFA 1FLRL 3P4NB 5JPMA 2KBGA 1K4DB 1F6LL 2AEQH 4NM4H 2IALA 4M6AA 3ZKXB 5J6HA 1MCCA 5D7IE 3HG1A 2HN7A 3VXOB 1LE5A 4CDHA 5KANI 3U36A 1WZ1L 2UZIH 4NCC2 3RL2B 2X4PA 4JFZL 1A7BA 5IB4A 2RCSH 4OZFA 1G9NH 4NUGL 4M6MH 4L9LC 3O3UN 3DIFA 2GEEA 1HWHB 3MUHL 4J6RH 4NO3B 3B4NA 3G04B 4JG0L 2DQGH 5KAQF 1ZHNA 3B2UD 4K7FB 3SY0B 4CADB 4P2RA 4W6WB 1S7RA 4ZXBB 3OV6A 3TH4T 4QRUB 4MNHA 2AXJA 2MNUA 2Y07H 1U8MA 4J1UA 1TMCB 3U0WL 5FGBA 4JM4L 4DGIH 4PRAB 4OF5A 4NKOA 5J6GB 1P7KB 4PJXF 2DQDH 5TDNA 3L95A 5T33H 1EEUA 2PW2B 2J6EA 2VITB 3RVTC 3RWCA 4H1LA 1WBXA 4AL8H 1FO0L 4ZOEA 3TV3L 1AI1H 4MJIE 4PJCA 3X14A 2VLRA 1SY6L 4HKBA 2HFFB 2WWMC 1H3PL 4HLZH 1BWWA 1CWVA 3OXRB 2DOCA 3MOAH 1NAMA 2YD3A 1S9YB 4CMMA 3ZKSD 1CK0H 3GMMB 4RNRB 2W65A 4M61B 1JGDA 3SKMB 3DUHA 4ZNEA 1OAYL 3F7QA 2DJSA 3U6RA 4JG1H 4XP1L 2YD4A 4Y4HB 1UWXH 3RY6C 1I1FA 1AFVL 4JFHD 3JWOL 3GSNL 1BQHA 3WNKA 3U4EA 5GGRY 1LO3L 4MD5B 1X4XA 3SGJA 3O2DH 5D4QA 3ZDYF 2EXWD 3PL6C 3ARBD 3LKOA 4HV8A 1LQSR 1CLZH 1T1ZB 3QQNA 2A83A 3VWJD 1T20B 2PN5A 4HZLA 4U6XB 1T7YA 5A43C 4FQCL 4OD3L 2Q76B 4NQDE 2WZPD 4Q2ZB 2W0FA 3VGFA 3V9FA 4F9PC 5C09B 1I3UA 1OB1B 2EXYD 3QWRA 3KPTA 5KTEL 5J89A 1MCJA 5M95B 4NWTH 5ISZE 1CDHA 4C56A 1A14H 5I8KL 3MSPA 4TNVK 3WCYA 3ZKQD 4X6EA 2XZZA 5DQDL 3L6FA 4MDJB 1MY5A 5D9SA 3NCMA 1XZ0A 2DI7A 4LVEA 3O9WA 2H2PC 3RWHA 5INCA 1CGSL 3KPRB 4CVXB 4K3EH 4JFOB 5FYLE 2SEBB 2YPVH 2ICES 3NFNA 3MACL 4NQXA 4BFGA 4F9LC 4L8CB 1NC4B 3NIGE 3DVGA 4H0GA 1HIMH 3FAXA 4FMFA 1V7NL 4PRHA 3T3PE 4J12A 4PG2A 3O6ML 1XGQA 2EXYC 5IB3A 3BKYL 4R26H 4B53A 2WW8A 3PV6B 2P24A 1YEJL 4DZBA 1J87A 4KHTL 1YJDL 5DD3H 2AXGB 4GMSH 1HNFA 2QEJA 2R9HC 3WNLA 3MLYH 1GGCH 4YHLH 4LF3B 3VCLB 4MNQD 1CU4H 1EXUB 3CFKB 4Z0XA 3GMOB 1T2XA 3KYNA 4M6OL 4P99A 5J1AA 4XPBL 1AGFA 1A7QH 2F8OA 2YKLL 5J0BA 5E2JA 4M03A 1DUZA 2C3XA 4QT5A 2BVPB 2E9WA 1BX2A 2DDQL 3STBA 3PGDA 3IFNH 4LLWB 1NBVL 2NCMA 2BOBB 5KZCB 2VXQH 4NOFA 1TVDA 1NGQL 3IKCB 3FQXA 3HC4H 3ARQA 3SJVD 3TPUA 4LPYA 4WENB 1P4LB 2N56A 3GFUA 4R9HA 4RMQA 4Y8DC 5D72L 4AENB 2FZ3B 5C0AE 5DC9B 1OPGL 1G7LB 1MHHB 4GQ9L 1AR1D 2IH3B 2I07B 3MUGA 3CXHK 4WFGD 4IJ3C 4YJZL 4P2QD 2QQLH 3RL1B 5AAWA 1G0DA 4GXVH 2BC4B 3O2WH 4PJIF 3QNYA 4OFKA 3DWTA 1KEGL 5IEKB 4BH8B 3BN9D 1FG2B 2IAMB 2HG5A 4OGXL 3NN8B 4FG6D 2VZSA 3VFSB 5CSZA 3VGHA 5J8OA 1PJ9A 4HWUA 3CDYA 5HYQB 4I2XE 2VDRL 3VFOB 4LVHB 4ZDHB 5F9OH 4TTDC 1MFBL 2QHLA 5IKCB 1IC5H 1NMCB 3IFLL 3RUGB 3UJIL 3CUPA 4OQTL 1EFXD 1QSVA 1C7SA 5ALBL 2OLDA 1CLOL 1JF1A 1T0MA 4TUJA 3SOBH 3RJQB 4GBXD 4PY7A 5DT1L 5LAXA 1MUJA 1DANT 3IDJB 5DJDA 4Z6AT 2DF3A 4DW2H 4IEFB 4XNQB 5DR5L 1X4ZA 3DARA 3RRQA 5F7MC 1Z0MA 4LSDA 4OLWL 2VDQH 4XPAH 4JEGB 1HHHB 2Y23A 3O4OC 1KIQB 1ZT1B 3U83A 4XB7A 4LRIA 1VEOA 1WBZA 5HGAA 3F6IA 4X80H 3QQ9D 3KNBA 3LSOA 3MOQA 4E42A 1B0RA 4X7TB 4KK9D 1DDHB 1D5MB 2W9DH 2D0GA 2P49B 5KSBB 3DX9B 4JKLA 2BHYA 4HZAA 2B1AL 2NY7H 3I6KA 5GSRA 5ICZA 3VRIA 5I8EB 4GBXC 5EO9A 2OM5A 5D6CA 5HGHA 5E5RB 2VXVL 1FJ1B 2BVOB 3JV4B 3G6DH 3RX7A 1CICA 1INEH 1NSNL 3H3PH 5I0ZA 1B90A 1U8IA 2Z31B 5C0JB 2P43B 1LMKA 3N9GH 4OZIA 3QQ9C 4Z77B 1A6WL 1V7ML 3T0DA 3AFLA 3HUJA 4BH7B 4RAUB 2C3VB 4KK9C 3QIWD 1RZJL 4LLDA 4PP1D 4HAGA 3L3DA 4LSPL 3F7RA 4N0YL 5E1HB 3TVMA 5I9QC 1RMFH 5J7CC 4NQED 2EDFA 1K4CB 3A6BH 1FZOA 1YEIH 1WTLA 2NTFA 2D9QB 5DTFB 1KLFA 2YWZA 2RAMA 4UAOC 3PDOA 4X6DB 2HJKA 4WHCA 2VZOA 3AXLA 2IPKB 5F89A 3QHZH 2GFBA 1U3HA 3VMOA 2NY4C 1Y18B 2D2OA 4MAYA 4Q9QL 2C26A 2GK0B 1XR9A 5CINH 2G9HB 4LIQL 4WO4D 5ETUB 5C07D 2CR6A 4GRMA 5EO0A 4D94A 1IM3B 3BPLB 1P1ZA 1KN2H 2DWEB 2EKSB 2HVKB 3LQAL 3OQ3B 2PXYB 1YEKL 1A2YA 3Q48A 1X9QA 3O3AB 5DQJA 1HYSC 1G7HB 2HP4A 4P5TA 4JY5L 2PW1B 2FO1A 2A6IB 1CR9L 3H9SE 3QUMH 1LP9B 1CGYA 4H20L 1FVCB 1YN7A 4L29A 3GBNL 2MCG1 1D6EA 5B39A 1LWRA 3T65B 1NUDA 1HILA 1S7UB 1DQML 2VKXA 5AD0A 3R4DA 3OKEB 1PSKL 5HGDB 1Y6KR 2MOVA 3O45A 1T3FA 3BKJL 4NDMA 1JPSH 3V5DB 3BAEH 2R56H 4Q0XL 5HHME 1AXSB 3BRFA 4EDWH 1WWCA 4OFPA 4K94C 5GZOD 3IFOB 3ZE2F 5FECB 1RFDH 4JPVL 1MI5D 4PRIE 4PYGA 1U8OA 2ZUYA 4GMTL 5M94B 1R5IB 3FONB 5EOCH 4MXVF 1NH6A 5EBMB 3MV7D 2DD8H 4D9LL 4FABL 4F7TA 1QRND 3H9ZA 4PGEB 2HFGH 1E6JH 3C2SA 3ULVE 3OKOA 2VO5A 3GKWH 3MBEB 4HK3J 5C7XL 5C9KA 3BUYB 3O0RH 4PP2B 4HKZB 1IC4H 3PWLA 3OKKA 4XAKE 3IRPX 4WCYH 3MRRA 4GRLC 5E6ZA 4NQCD 3U7YH 3FRUA 3W9DA 2YK1H 1BM3H 1U0QA 1JUFA 1A21A