5ISZD

Crystal structure of ls01-tcr/m1-hla-a*02 complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
200
structure length
200
Chain Sequence
LNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCAFDTNAGKSTFGDGTTLTVKPNIQNPDPAVYQLRDSASSAKSVCLFTDFDSQTNVSQSKDDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Broad TCR repertoire and diverse structural solutions for recognition of an immunodominant CD8(+) T cell epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2016-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iszD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iszD02
2CDGA 3BH9A 1FNGA 5IB3A 4W6WB 2CLRA 2DBJA 1V7NL 4X98B 1P5UA 2WLYA 5FHAL 4DN4H 1JGVH 3ELAT 1HHJB 2V2XA 3AB0C 4XP9L 5E5MB 1MUJB 3JUYA 3QEQD 3QR2A 2VR5A 5KVFL 4DGIH 5E6ZA 1ZS8A 3GBMH 2AV7A 1VFUA 1GOGA 1JPGA 3CH8A 1UQSA 3C6LD 4XC1H 4Y5YC 1A2YB 5D5MF 5AUMA 5B38G 2X40A 1CU4L 5SX5K 3TYFB 4OUUB 1EEZB 1T89A 4PGCB 3TT3L 2F5AH 1DUZB 2HT4D 3QNYB 5IFHL 1NCWH 1GOHA 1JPST 3CUPB 4R8WL 1DSFL 4DN3L 4NKDA 1L9NA 5FECA 3F58H 4XCYA 1FFPB 3PP3K 4OFKA 3KPSE 3MJGX 1OTSD 2HKHL 2Y07H 4MXQC 4OLXL 1ZTXH 4J8RB 3DHMA 5H94A 3DMMB 1Q0XH 4P2QB 1XIWC 2Q8AH 3EYQC 1CLZL 1TVBB 3GSXA 3BPCA 3QXUA 3L95B 5E2VH 5ISZA 1IAMA 1NEUA 5DD0L 4K94C 5I8KH 1OGTA 2A6DA 1G9MH 3OPZL 4MGXA 5CEZH 1AO7A 5DZLA 3ARUA 2I07B 5C0AE 2R2EA 5DFVD 5T1LA 5GHWH 5IVXF 4ZNEA 4GKZB 4UT7H 1KEML 5IB4A 4XPGL 2A9NH 2YC1B 4ZPVB 3OZ9H 5HDOA 2ZCLL 4KMTH 1DQJA 4YFEA 1XR9B 1A6VH 3QUZD 4KI5D 2NX5D 1NGYA 4FG6C 4RFNC 1HEZB 3NACH 4NHCH 3EFFB 4U49A 4R4FL 1TPXC 1DL7H 2E8YA 5IMMA 4HBCL 5JO5B 5HDLA 3ZMRA 3BVNB 3T0EB 1BQHA 3TO4A 4YHNB 4L4TD 1I8KB 1BZ7A 3UTPE 4E5XA 5ETUB 4P49A 1AQDB 1GGCH 3MRIB 3O4LA 3ZLQC 4BH8B 2CRMA 1II4E 4GUPA 4NC1E 1JVKA 4TNWK 32C2B 1FVDB 2PTVA 1UB6B 1IL1A 3N0PB 4RGNE 4LPWA 4G9FD 3QZWG 1BOGA 5FYKE 5F9JB 3DVFA 5E1AA 1CDJA 1HHKA 4HV8B 4OV5A 1HYRC 1R3LB 4OFYD 2HWZH 4PV9A 5JHDE 1X9QA 2DDQL 4IRZH 1ZWIB 1UJTA 3F7PC 5D4QA 3IRPX 1FL6A 4G8GA 8FABA 2DIAA 4OLEA 3QUMB 5GGSA 5T33H 1NFDA 5E94B 2X2YA 3RZCD 2VERN 2Z31D 5CMAB 1UB5A 4JO4L 4NRYB 5TDNB 1E6JL 2DN7A 5DVKA 4D9RD 5E56A 2J4WH 3S8WA 5H2BB 2AK4A 1MIEL 1KB9K 1WJ3A 3FTGB 3G04B 3WNKA 5GRYA 4MNGB 3RL1B 2ITCB 4YE4H 5C0FB 5D1ZB 4G6JH 1R3HB 5I8OH 3RPKA 1NGWB 4AM0A 2CIKA 4QRTB 1R5WA 3FONA 5DMGC 1NCTA 3QXWA 2FH6A 3HC0B 3UJTL 3D2UA 1QBBA 2FEDD 2OZ4A 3QA3B 3ROOA 1FVEB 3B9VA 1CDYA 4U1JB 5BRZE 2V2TA 3QRGH 3U7YL 4ZXBD 2OTUA 4NM8L 4DUWA 4J3UA 2FBJH 1FE8L 4CDHA 2DKMA 4LSUL 3P11L 3VXNA 2P48B 2X4SA 3MRBB 1ZGLA 3WXWH 1SY6L 1JNNL 2AEWA 4X6DA 1OARH 2IANE 3PWLA 2APBA 2PXYD 3O2WH 3MODH 3MJ7B 1L6ZA 5FAAA 3FFDB 2NY5H 3QEHA 4NN6B 5FB8A 1TTUA 1KENL 5F3HA 4MDJA 4R7NA 3P9MB 1VKXA 4NGHL 2Y5TB 3WS3A 2C1OB 3MJ9L 4V1DE 3U9PL 1EA9C 4YXKH 1BVKA 2VDLL 4NT6A 4ODBD 3C60C 3ARTA 2XKSA 3FRUA 3C9NB 4QHMB 1GSMA 3PWUB 4R3SB 2QSCL 1RZFL 3HE6A 5HY9A 3EIFA 3B6SA 4LCYA 1EZVX 1YYMH 1VPOH 4RNRB 1QKZL 3QPXH 5FGBA 2LU4A 4KQ4H 1KB5H 3ES6B 3T1FA 4BELD 3MRJA 4LKCB 1DN2A 3BE1L 3CVHL 4OTXL 2VUYA 3FCTB 3NVQA 5EIIB 4K8RC 4PR5B 4I2XE 4S1QH 2FSEA 4OZGA 2DF3A 4HW6A 1M71A 2D7PA 4AZ8A 1I1AD 4PJAA 5DC9B 4K7PH 43CAA 3MLVL 3GO1H 5GGUB 5K9KA 5FYJD 2YMXH 4YGAB 3C8DA 5T1KA 2ADIB 1CTNA 3R8QA 4NOFA 4G7YL 4NQDD 4XPBH 3AAZA 1AR2A 4HJ0C 5H37G 1P1ZB 4YHPA 1MEXL 5KG9A 5EU6E 4X9GA 3DYOA 3U1SL 1DDHA 1N4XH 1NPUA 1P7QB 1UGNA 2XN9E 5BS0E 1XCTB 4Z76B 2B39A 1BGXL 3GNMH 5F7EL 5DUML 5TE4H 1CD8A 1V7ML 3BAEH 3FQWA 5HBBA 1JGUH 2VZTA 3QFJE 2NLJA 1MHPL 3EO1A 5IHZB 3LPFA 2P5WD 5EOCJ 3UPCA 5HYSG 3F7QA 2Q6WB 4PRNA 3RIAK 1RULL 3GMNB 4ZMAT 1HI6B 4FFYL 4IRJB 4YDJA 4LNVA 1K8DB 5F6IB 1BD2D 5FYKU 1CFQB 2ARWA 3K4DA 5SWSB 4QRPE 5C70A 3UTTA 4MXVE 4MA1C 1SM3H 4L3EA 4PV8B 5CSGA 3GB7A 2D03L 3HUJB 4M8VA 5GJSL 4JHBA 1I85A 3ZKQD 3PHQA 4FFWC 5EZIH 5KSBE 3BQUB 1GVIA 1D5XB 2I60L 1IKFL 3IDIA 1MHEB 1A64A 2WK2A 1I3UA 5FV2A 1FL3A 2PW1B 3QWRA 3TVMD 1KACB 4TTGA 2Q76A 1A6AA 3M17B 3RDTD 4NSKB 5M94B 2LTQB 3RQ3A 4CU8A 2JTDA 1FNSH 2GY5A 2W9DL 3QDGE 1Z5LA 1OW0C 2AW2A 2X4TB 5KJRH 5HYQB 5CP7B 3BPNB 4HFWB 3U48A 2XXCB 4M7JL 4ZTPH 3OKKA 3RKDD 3RUGB 4BQBA 2VQUA 5I18L 3MV11 5D96B 1AGDB 5CJQL 3HLAA 1C12B 3D3VB 4ORGB 2JJUA 4HLJA 5EFIA 1U95B 2GJ6E 1KYOJ 5C0CE 3VCLB 4CADB 3MGAA 1BLNB 3IT8D 1GGTA 4BZ1L 1Q72L 5J6GA 1I1FB 1SMAA 2NY6B 1KGCE 4GRMA 3GGWA 3MRMB 3NABH 3KLDA 2ED8A 3UTSE 3VXMD 5HDBE 4Y4HB 4J3XA 3GK8H 1J12A 3IXAB 3WDHA 4L8CB 5JLZB 2NXYC 4BFIB 4ERSL 1DE4A 4APQB 3EO0A 2UUDH 4XCNB 5EO0A 2C7UB 4ODUB 3MUHL 3F7RA 2XRAH 2EEDA 3V7AG 1PD6A 4HT1H 2IBZX 3G08B 1AXIB 1N0LA 5ISZD 4K9EC 4HG4J 1WITA 1AO7D 2UZYB 2HVKB 4PJEE 4JO1H 1N7ML 3PDOB 1ZMYA 5T1LD 3F6LA 2RR3A 1OSPH 5KBNC 3V6BR 4MCYA 1D5MA 4UT6H 5HHVH 4JFFD 1WVZA 4X7DC 4UIMA 5DUBA 5E6IC 4PRIB 3MACL 4MA8H 2D7OA 1A4JA 5T3ZH 4U6XB 5GS0L 4OCYH 1KEGH 3OKMA 4JFOB 1MFAH 2XY2A 3BKYL 4JR9H 5JORB 1OAZH 4Q9RH 3AXLB 5TDOB 3TO4D 2FWOB 3B8YA 1G7MA 4LQ1A 5L9DL 4I18C 5J89A 3MLRH 1RZJC 3HC3L 3HG1A 4C58B 3MV01 1I1YA 4LAQH 3MREB 5HSFA 1O5DT 4HK3J 5FOBB 5DYOB 2Y7QA 5KAQG 5HHQB 4KPHH 4H0HB 3QP3A 1FGVH 2VWEE 3RGVA 2PKDA 3QJFA 2J8UA 1JGLH 1Q0YL 2D9CA 4UV4H 4PRPB 1YJDC 4OD2A 1G7JB 5I1LA 4OGXL 1JF1B 4Y5XC 5GJTH 5ENWB 2BC4A 3N06B 4AH2A 4QY8A 5GS0D 1KLFA 2EKSA 1RMFL 1QBLH 2Z4QA 4K3HA 5DUPL 2CXGA 2AK4D 3MLUL 4RMSA 2M26A 3DECA 4BSVA 3FFCA 5D1XA 1ADQH 4M6MH 4N9GA 4DUXA 1FYTE 4ZD3H 1FQ9C 1GZQB 2WBJC 2XPGB 4JN1L 3X14A 1NCUA 4HIEB 2BVPA 3D2UD 5C0DA 1U3ZA 4Y16B 3NCFB 4M8QB 5AG8A 2FCBA 5FUOH 2EH8L 3EYUH 1QFWH 5D72H 4NWUH 1VADB 2DQFB 4MVBC 3KYNA 3WKML 4OD1H 5HGDA 4JDZB 2MQCA 1IQDA 4MB4A 1IRAY 2J8OA 3PNWB 4TVPD 2WLZA 2APFA 1BZQK 2BMKA 2FLRT 1J8HB 1DTUA 1AGBB 5HYJE 3SBWC 4FQLH 3NH7H 4RIRB 4IOFC 1XR8A 1G7HA 1JFQH 2P8PB 4M5ZL 4ZYKB 1RURH 4P23C 1NMAL 2OR7A 4R4BB 1YA5A 4JFDA 1I9RH 3TT3H 1YEGL 4KY1L 1OPGL 4ISVA 4WWID 4P0DA 4ELME 2EDXA 5F1SA 3MBXH 1C1EH 1IGFL 1LEGB 1MSPA 3TNMB 4TYUA 5C09E 2BHZA 4KK9D 1QFPA 1DSFH 5F21B 4LLDB 5ESVB 5CJ5A 3REVA 1BWMA 2Y23A 1MH5A 2D7NA 5IW3A 4LHUD 4HIXL 4TQEL 1P4BH 3UJJH 3STZB 3BH8A 1ZLVK 2PTUA 4U0RB 2ZUQC 5BVJB 1DBJH 4PLOB 3KPTA 2W60B 3OJ2C 2R0KH 3I02B 5J56B 3KYAA 3RVTD 2J8HA 3EFDL 3LS4H 3DUUA 3IETA 3ZDYE 4GRLC 4IBLT 1KEMH 2JE8A 3IJSB 4L9LB 1S8DB 4XPGH 3E8UH 3Q6GL 5J06A 2J88L 4JM4H 2XZCH 1PY4A 3O3BA 3BIKA 3V4PL 1E4WH 4P9ML 1NUFA 4ZFOB 5D2NC 2GTWA 1I9EA 3QXTA 1T0PB 1FFNA 5ANMB 4EUPH 1AXTL 4HUKB 4NFCA 1JZ4A 5FYLH 4FABH 1F00I 3VXSB 3S35X 4XPHH 2G2RB 4LSRH 3ZTJG 1U91B 3HZKA 1YEIH 4JN2B 2BSRA 2AI0L 4PJ5B 4LDEB 3W9DB 4I0PB 1OD9A 3SDDC 4MJIB 3WKNA 3AS1A 1ZAGA 4P5MA 5D7KD 3H3PL 4KAQL 3RRQA 3TA3C 1TVHA 3D69A 4ZPTB 1A7BA 3UTTD 2VLKD 3T3MF 3BO8B 2C3VB 2F74A 4JPWH 1N5YH 3FO9A 3FOMB 4ZQKB 1KG0A 5I76B 3B2UC 2DQJL 4OM1L 1M05A 5JQHC 3VWJA 3E0GA 2GSGB 2NXZC 3KWWA 4XMPH 5C0NC 3OKYA 1S7WB 1JPTL 1JNJA 2W1NA 4AENA 3BEVB 5IHBA 3OG4B 3IJYA 5HGGS 5EUOA 2UYLA 1I9IL 1BIIB 1UZ8A 1U8QB 1XGQB 1R3KB 5F7LB 4CN6A 3QWRD 2K1MA 2VL4A 4K94L 4OAWA 2XKUA 5FM5M 4XNZB 4RQQA 3L3DA 4XBPB 3ULUF 3DROB 2VITB 4EXKA 1QLEH 4OCLC 3W0WD 3MV9B 1HCFX 4Y89A 3O6FA 1JF5A 1KB9J 5HHNA 1JNHA 2AXJA 4LLWA 1KPVA 4HIHB 2P7TB 5SWZA 5F7NC 4TULH 4OCMC 3BOVA 3NCJH 3S3SA 2ICEA 3E6HA 4MAYC 1DQMH 2YPVH 3FQRA 3PL6C 3WD5L 1A3RL 2FL5B 5CD3A 3QEQB 4MD5A 4H0GA 3JV6B 3ARSA 4EXPX 5IVZA 1UVQB 1V5JA 4QWWD 3DGGA 2FZ3B 2EE6A 4LVNB 2OS7A 4ZUWB 3FO2A 4MXQD 5KW9L 3C6LB 3MA7B 1IGML 3VFRB 1XIWD 4NKQB 1MI5E 3ILPB 4YPGB 3OR7B 1HYSC 3AC0A 4FFZH 4K7FB 3T1WA 5E5RB 2WIIA 4PJHB 2QQKH 4G7VH 5CJBA 4JGUA 3IAQA 5HYEA 3PGDA 1X5FA 4XZUA 3PWPA 4LIQL 3VXRD 1SEBA 5EBMB 3P0VL 4BUGA 5I15L 2AJVL 3BD5A 5ICYB 4XI5C 4FQ1H 1N59A 3DYMA 3GSNH 4UILH 5GRWA 3RVXC 4E0RA 3O0RL 2MJWA 3B3IA 2A0LD 1MAJA 1IGJA 3R06A 4MNQA 4JVUA 4YR6A 3MFFA 5EWIH 3QUZB 5K9OB 1RUMH 4RWHA 4RISL 2IG2H 1EGJH 4C56A 4Z7UA 3VG0H 1CG9A 2NX5B 5LQBL 3GSUB 5F88A 4D0CA 4GBXC 1H3XA 4KKNA 2W65A 3PIQA 4JHWL 2RCSL 3TV3H 1D5IL 4NO0A 5SWQA 4BH7A 1JUFA 4TNWF 1RZGB 3DBXB 4HZLB 5A2IH 2P8MB 4L4TB 4NN7B 1GHFL 3TBSB 1ADQA 4HH9B 4AIZA 1CIUA 4Z8FL 4NUGH 5TPWH 4M6NH 4G9FB 5F7KC 4JFEE 4G9DA 4ALAH 4PJGB 4WW1A 3RGVD 3WIHL 3O2DL 5HI3C 4ETQA 1SYSB 1IBGH 1EK3A 4K07A 1GCFA 2AGJL 4HKXB 5HHOA 2YA2A 3IB4A 4NQSB 4KJYA 3QDME 4TSBH 3FQXB 4YHML 1QUNA 3BKCH 3BIAX 4KDTA 4ODVL 2YZ8A 3PWVB 2DOCA 1N64L 4JRWA 1T21A 3RZCB 3OWEA 3OG6B 2Z31B 3GSQA 1P2CB 2EIDA 3FFCD 5KVGH 5GGRA 5DK0B 3OGOE 3UYRL 5D1XD 5IF0B 5HVGB 3WJLC 4XVSH 4XBEH 4GJTB 3T0DA 3H9SA 3G5ZA 1MCSA 2HJLB 3W9EA 2OI9B 4CMMB 4O4YL 5C9JB 4K8RL 3V8CA 2ZZUT 4K3EL 3MRHB 4M61A 5EC1B 2EDWA 2HTKD 1PG7L 5DF0A 1HZHL 3WN5B 2VKXA 2WAHA 4JJHA 1M7IA 4R0LC 2JCCB 4P3DB 3WHE0 2EDTA 4P99A 3QO0B 4JGMA 5FM4A 2IPKA 3HUJF 3L7FB 1NGXB 5IKCA 1MRCH 2XKNA 4NNYB 3KYMB 3PDDA 4QHUB 1B6DA 4JKWA 5K59E 4OCWH 4YO0A 1A6UL 5LG1A 5F9AC 2FR4A 4OZIB 2PXYB 3TJEH 1MJJA 5HJ3A 4PP2A 4ZAKC 4K71C 4Z77A 4C83A 1GGIL 5IW1A 4JFDD 1U92B 3PGFH 5ADOL 4LCIH 4NO2B 1JZ3A 4KVNH 4ZOAA 5BQ7B 1EVTC 4K8RD 4DAGL 1OGAA 4Z78B 3WFEH 2AJYH 4S1SL 2V9TA 2KBGA 1FZMB 1U8HB 3IKCB 1B4JL 2CK0H 3TBVB 3RUGF 3RWJA 3MNVA 3MNZB 2LAAA 3CFDA 1I7RB 4XHJC 4JZJA 4OQ1A 4EN3A 5LBSH 3MX0A 4TSCH 4EUPA 3LPGA 3MRLB 5LAXA 3I75B 4Y8DC 1SJHA 2MKWA 3BDBA 3I6GA 3OKLB 3MLYH 2Z35B 1N7MH 3BZDA 4F33A 1X5AA 4PYGA 1L6XA 2DRUA 1I1AB 5I17B 4LCCC 3L3KB 2CKBL 4Z0XB 4G80A 1BQUA 4PTTA 3UTQA 1KIRA 3EYVA 2DWDA 2EZ0C 4JFXB 1D6VH 2EDJA 3CLEL 3S37X 2YHGA 2BZDA 1FL5A 3L6FA 3VWKC 5DRXA 2XA8L 1S7VB 3I6KA 3L5HA 3KAAA 3CFCH 5JMRA 1C5DB 4UQ3A 3BFOA 3QXAA 3BP7B 1IM9A 2CR3A 3GIZH 5HGBB 1WEJH 4EKXA 2VDRH 1R6VA 5FA4A 1LO3H 4PFEA 4NZTH 2WUBL 3HAEH 4CKVX 3MA9H 4BSJA 2P5WB 1TTGA 3CVHB 4HDIB 4MDIA 1BVLB 3S36L 4UBDD 3CSPA 1G7PB 1OWWA 3SDAC 4KKCC 4J3TA 3I85A 4FFWD 1IEAA 4EBQL 1FO0H 2W0PA 5IJVA 1J0ZA 3BD4A 3BX7C 5KANI 1CE6B 3L3IA 1NDMA 3INUL 5B4MC 1YDPB 4QT5A 4ZUVB 1EBPA 3L1OH 3VWJD 3BISA 2OCFD 1MWAL 2NY7L 5CUSH 5JPNB 4M3KB 1TZGH 4DGYL 4KTDL 2BY2A 3QFDA 4H26A 1QR1A 1NAML 2HP4A 5HGAB 5C0BB 3VMPA 2FDBP 4GS7C 2IBGA 5FO8A 2C1PA 4XNYH 4K9EL 4PJ7E 1CE1L 5TDPB 3TBYA 4MWFA 2W0FB 4AYFA 5E70A 3WDIA 2ZJSL 3CX5K 5MERA 2CUIA 3QDJE 2NY0D 3MC0A 1U8KB 3P4MA 3TVMB 1JWUB 1YNTB 1GPOH 1A7OL 2VAJA 3CFIC 3RDTB 1D6EA 3EOTL 2CDGB 4ZS7H 3BH9B 1FNGB 1J0HA 4P46C 4Q9QH 4PJCA 5IT2H 2CLRB 2FNBA 1HHHA 3IDGB 3BEWA 5L7XL 4JG0L 2GK0A 2V2XB 1NCBL 1FVCA 4Y0GA 5IB1A 3BN9D 1MCCA 3S4SA 4N8CH 3UDWC 2B0SH 3VFVA 4FZEL 4U1IB 1JPGB 1RVFH 3R8BB 4H8WC 4PB0H 2LU3A 2P5EA 5DWUL 4OUOA 3RVVC 5KS9E 1RZJL 1SJXA 1EZVY 4OGYH 4YEFA 2JK5A 4ODXA 1EO8H 1YEHH 3GSNA 3MLSH 5EORL 3VXMB 5L0QB 4ETYA 3ZZ1A 4YHYB 4U3XA 3LH2H 4NKDB 5GS2H 1N6UA 5F97E 4LEOA 1EGJA 1JPSL 3PWPD 2R1WA 5CINL 2IGFH 2EDKA 1YJDL 5E6ID 3KLHC 2AEQH 3KXFA 5KSAC 5BZWB 2ZOLA 3PP4H 1INEH 3BPCB 4TQEH 5ISZB 2A6DB 3DI2B 4FQ2L 1AO7B 2QQNH 4NDMA 5GRVL 5EOQH 3GDBA 2DLIA 1RIUL 4XP5H 1BAFH 4I3SL 4HHAA 5IB4B 3CMOL 3UJIL 2QR0B 3LOWA 4F7CB 4JFFB 1MAML 4X7SH 5HHXH 4M6OL 3V9FA 3WS6A 15C8H 3P77A 4C56D 5CGMA 5T1DL 4Z7OF 1VERA 2WANA 1KJVA 1XF3B 4JRYA 4ODHL 2H2PC 5TGBA 3UZVB 3MYJA 5EULV 4PJ8C 4MB5A 5IMMB 1B4RA 1G6RL 4G8EA 2VE6A 1KLGB 5JUEH 3BZ4A 3TO4B 1NBQA 1HN1A 3HZVA 1QFUL 1FRGH 2HLFC 3AREC 5E2JA 3OSKA 1IGIL 3WFDH 4GQ9L 1IGYA 3QPQD 4GUPB 5EUKA 5JQ6H 1H15A 3D87B 1QRNA 2AI0H 5IROA 1YECH 2R69L 2BVOA 2RAMA 2WINA 1TZHB 3BKMH 4M1CD 4DW2H 4WFHD 1NEZA 3LMJL 1HHKB 4OV5B 2ARJQ 4P2OA 4PV9B 4MJ5A 4F7MA 3LQZB 4FTVB 3G6JA 1M7XA 2GUOA 4ZNEE 1WAAA 4OLWH 1Q1JL 4DFHA 1K8IA 1ZT1B 4IDLA 5I1HH 5JA8B 2WBJD 5GGSB 1NFDB 3QQ4A 1R5VB 1HH9A 4PG9B 2DQIL 4IOIA 1UB5B 2BSSA 3T3PF 1DQLL 4X5LA 5TFSL 1T1ZB 1RY7B 3FQNB 2VTFA 1FIGL 1N2RB 2AK4B 2QQLH 2IALA 3VDBA 4LAJH 1NMBH 3WEXA 3FRPG 1K3ZA 1U3YA 4XPTL 3BP5B 2BNQE 1Z6JT 4Y7MA 3ZKXB 4HUXA 5IFJA 2WP3O 2IPTL 1NCDH 4ODWB 1QACA 4AM0B 3EOAA 1EFXD 1R5WB 4Y4FA 3VRLF 4XT1C 3RWGA 3O4LE 3ME0A 3UYOD 1FGNH 4JRXA 5H8DA 3WO3B 4QYOA 5C6TL 5BV7B 1BWWA 3ROOB 5GGQL 2NY2C 1D9KC 5TJWK 1ZHBA 1IQWL 2BY1A 4JVWA 2V2TB 1ZT4A 4LKXA 3VXUA 1CK0L 2FX8L 3LKOA 5CWSB 3GRWL 5HD8C 4IMLB 3VXNB 2X4SB 3PABB 1ZGLB 3GI8L 2JJWA 4X6DB 3PWLB 4G8GE 1HIMH 1CZ8L 4MHHG 2IAMB 4NQCE 2W9EH 2I9TA 3MMEA 4U05A 5F3HB 1ITCA 1S3KH 1J1XL 4R7NB 2JB5L 1VKXB 4OGAD 2GT9A 3U0PA 3ZT7A 4GOSA 1DBAL 4WW2B 2IBZY 3R1GL 2VSDA 1OGAD 1BVKB 4NT6B 4Q6IA 4X0KA 3CFEA 5T5NG 4DGVH 2XQBH 4OF0A 4XHQA 1ZOXA 1UWEL 4KHTL 1U41A 1RZ7H 1H5BC 4LCYB 4OZ4A 4PS4L 4EN3D 3RWFA 3IYLW 4RBPH 5BO1L 1MCPL 1QNZH 5FYLD 1QBAA 4X8JB 3QIBA 2F8OA 1FFOA 3MRJB 1CR9L 4LHUB 3AS3A 5E7FA 1OAYH 4WU5B 1HQ4B 3S34H 4LLVA 5I1KL 4X4YA 2X05A 5F89A 43C9A 3TNNB 43CAB 1ZSDA 1MELA 3UO1H 1I3GH 3QCTL 1WCBA 5D70L 3HAEA 1VGKA 4JM2A 1KF9B 3GSVA 1BM3L 5KVDH 3AAZB 1BBJA 1C16B 1JWSA 5ALCL 3ULUE 1FO0A 1M6OB 2YPKA 4U1HA 1DDHB 1QRKA 3BXNA 4Y8AA 2CMRL 1XF5A 4RGOH 3HR6A 4NJAH 4YDLC 2ZKHL 2BK8A 3E3QC 3L7EA 1WZ1H 1FV1A 4LVEA 4PREB 3TA3D 1T2QL 3IXTA 3EO1B 4KKLD 4X4XB 4JPKL 7FABL 1NJ9A 2LVCA 2Y36H 3ALWA 3GM0A 4BFEA 2NXZD 4PJXB 5EOTA 4PRNB 3HRZA 4UINH 4FN0A 3OGCB 5C0ND 5LGJB 4E42A 1NC2A 2QJDA 5GZOC 3ZKMD 4I3GA 4XWGL 4YDJB 2XTJD 1WIUA 4QTHA 1X6LA 2MQ0A 5AAMA 3GHBL 3VFNB 2BHYA 3UTTB 4P2RA 4R6UA 2VLKB 4JAMA 3D85A 1F4WH 4FQCH 2O5XL 2YPLB 5A2KH 3DI3B 5GPRA 3PQYA 3TO2A 4YBQC 2AEPH 3V5DB 2ZCKL 4S11A 3P0YL 3TIEB 3PHQB 4GMTL 2VC2H 3I6LD 2BNRA 4EOWL 3NCMA 1KV3A 1QBMH 1KCUH 1MVUB 3MRGB 1JNLL 1CF8L 2HH0H 1H3VA 4BM7A 4PJGF 3GKWH 25C8L 1A6AB 4J4PA 4J3OC 1ETZA 3THML 3RAJL 4KVCL 3W0WB 4G3YH 4DQOH 4Y5YB 3QIUA 3QG6B 3FO1A 2CDEB 1CICA 4F37K 5J11C 4KXZI 4JKKA 5AZ2L 4W68A 2OYPA 4XBGA 3QXVA 2Z93B 1OB1A 4XNMA 5DJYA 2E3VA 2EH7L 4OZHB 5C7XH 4GG6F 1NGQL 4GAGH 1S5IL 2P5ED 3KPLB 3VFOA 2HFGL 4L3EE 1IC5L 3MLXL 4FXGB 1IKNC 3EYSH 5E8EA 5DD3H 3RZWA 3CXHJ 1TJIL 1NUNB 4L8BA 1JTOA 1XIWB 4YHIA 4YUEL 4FZ8H 4GRWH 2PTTB 2JCCF 4XI5D 1RUAL 2BVQB 2CR6A 3EO0B 3MLWL 1A22B 3X13B 3RVXD 2IQ9H 5EO0B 3NCYP 4KK5C 3V52H 4K23H 4Y1AA 1OP9A 3HR5B 4RMTA 1OP3H 5K9QI 3BPLB 5CZVH 3WHXA 2BSTA 4FMFA 1CS6A 2DB8A 1UEMA 3AY4C 3VXRB 3MUGA 3LN4B 4OZIF 3VRJA 3MUZ1 3P73B 4PJDB 4RFNB 4ODSL 2VLJA 4RGMC 1TPXB 4MCYB 5T5NF 1D5MB 3BKJH 2DM3A 3MV8A 1MCHA 2DJ4A 2F58H 1ND0B 1YMHB 4UIMB 5DUBB 5F44A 3DYPA 3H3BC 5C0RL 2WMPA 4JRYD 4OLZL 4X5WA 4RA0C 2IJ0C 5ITBH 5CEZE 5TE6L 3D9AL 1XEDA 2Q7YB 3VGBA 3DX9A 3V95A 2DBLL 3ARBA 1KXVC 4MQ7B 5EBWA 2OXHA 3AMLA 1G7MB 1A14H 4LK4A 1KIPB 4AIOA 3L3OB 1EEYB 1ZE3C 1GOFA 2G9HB 1UH4A 1LNUB 2JJTA 4WI4A 3EYFB 4M43H 1BQHG 1QRND 3M45A 1I1YB 2XZZA 4B7IA 5DMYA 4XNXH 3CPLB 5C6PB 2V7HB 1F58L 4XCEA 2YD3A 4P2OD 1NAKH 3PGCB 3QUXC 2Y7QB 4LSQL 4XH2A 5FA3A 1KT2B 3W2DL 2P46B 4GMSH 3CMGA 3MR9A 4WUUA 3WFHA 1AGCA 5D6DA 2YOCA 4S1RL 5CHNB 1QSEA 4OD2B 4LMQI 5ALBH 1FCGA 4QOKB 1TETH 4WEBH 1SQ2N 3DX7A 1F90L 2BC4B 4AH2B 4KK6C 1KJMB 3GMQA 1K6QL 4JY5L 2O26U 3FB6B 5CGYC 2BJML 5CCKL 4KQ3H 4E9LA 5GGVY 1AGEA 1XGRA 1G1YA 1LMKA 3FFCB 2JIXA 5D1XB 2OJZL 5FV1L 4DVRL 4G5ZL 3VW3L 1FH5H 1HH6B 1CE1H 1U42A 1CDCA 4Y4FD 2EKJA 1IAIH 2BVPB 4M7LL 4OSUL 5C0DB 1T0NA 1YMME 3HG1E 4PJBA 1R0AL 4WRLA 3LB6C 2RB8A 5E9DA 1ZHLB 2DMKA 3P30H 1IC7H 1RZ8A 4ZAKD 5FYKH 4FNLH 3KYNB 1J1PH 3VI4E 1MQKH 4J6RH 4LSTL 4M1DH 5HGDB 4LSPL 1YQVL 1GRWA 2B2XH 2DAVA 3DRTA 4LLMB 1EVUA 1NCBH 1EEUA 2ERJC 3OAYH 2J8UE 5JOFA 5HDQL 2EO9A 4HUUA 5I66B 3C60B 1H0DA 3LQAC 1XR8B 3Q5OA 4XVJL 5CZXC 3ZT5A 2FB4L 4NIKB 3SE4A 3IJHA 2R56H 1CN4A 3TGXA 4N0UA 3EDDA 3IFLL 1NLBH 4JFDB 5MENA 4I48B 4D0DA 3HI1A 3O2VL 4CRPA 2L0DA 1MJUH 2E7HA 3RWDB 1QTYT 1HINL 2VDOL 5EORH 2I5YL 1IGCH 4RWYH 2ZP0T 5FGSA 2E7LC 4HQQL 2R2BA 3JV5A 3SKJH 3REVB 4MB3A 3O3AA 3X17A 1RV6X 4HWZA 3FQUA 1MH5B 4G6ML 3QIBD 3SPVB 3HCVA 1I8LA 5AD0B 2Q8BL 1R3IL 3NZ8A 3BH8B 5DFTA 3ARYA 1E28A 4HKJA 1VFMA 3WNPA 1SBBA 3U46A 3PXJA 3S3PA 1JHTB 4LHUG 4JFYA 4WGWB 3DUUB 5L6YH 1OAKH 4TUJA 2NW2B 4JM2D 4AJ0A 3H0TA 3CMOH 2CJUL 4GXVH 1A7RH 1UT9A 3O3BB 5D1ZC 1QQDB 4M93B 2R2HA 1V8HA 4I5BA 4F58H 5T3XE 1OQOA 3C09B 3HMXH 4GKNB 3GIVA 4PGZA 3VFUA 4L4VE 1F13A 2JKXA 3IVKA 1FFNB 4KRLB 2ZCHH 5F93C 3IDXL 3FB7A 5C08D 4O58H 3SDAD 4PRPE 1HOCA 3GBNL 3SDYH 4MZ3A 1KLUA 2QHRL 1JTPA 2DS4A 4KJQC 3HZKB 2R8SH 1WFNA 1PKQE 1HSAA 1N26A 1JHLH 2PW2A 1ES0B 1X5GA 4MA1B 3EHBC 4N0YL 4H8WL 3AFLA 5IBUB 1NC2D 3QNXA 5C0GB 3RX7A 3HPLA 5FKPB 3RWCA 4WU7B 3ZTNL 4RSVA 1UYWH 2NZ9D 2XTLA 4WO4A 3TF7C 3B2VL 4L3CA 1KJ2L 1RIVL 3D69B 4X8XA 3SDCA 2VQTA 4MA3B 4P2RD 2VL5A 2F74B 3D85D 2CKBB 3HC4H 2I27N 1KG0B 4NZUL 3HMWL 3DUSA 3PQYD 4RZCA 2MNUA 3VWJB 5CD5D 2ZG2A 4PY7B 4DFIA 3Q5TA 4UIKL 4DKEH 1IC4H 2EE2A 4JKPH 3KWWB 4DEPB 3WNMA 4HWEH 3VXTA 1OLZA 1OAQH 4FQQB 1WFTA 1QOKA 5J1AA 3HNTL 2G5BA 2BHUA 4X80H 1LD9A 3FT2A 4G42A 1UZ8B 2F54A 2X70B 5I8CA 4MJ6B 4OAWB 1NGZB 4JHAL 4RQQB 4DKFL 4J4PD 2H26A 4ZFFB 2E8ZA 1P69B 1H3PL 4TTDC 1UXSB 4WFGE 5HHNB 2Y06H 4LLWB 1KPVB 4QTIL 2C9AA 3QIUD 3U30B 1CICD 1NFDF 4RMRA 3CSYB 5T1MA 3DWTA 2DQUH 4R26H 3DVNA 5D7IA 2EC9T 4Z7OE 4LP5A 4XX1G 3LKRA 4MD5B 4YZFF 5DLMH 3J8F7 5DJ6B 1XF4A 2NXYB 1MWAB 1J0JA 3LEVH 3VXQB 3DGGB 4LARL 4OF8A 2ARJB 2YWZA 2CKNA 4U1NA 1F45A 3LKNA 4BQCA 2PNDA 2AEIT 3MTRA 5EUOE 2H8PA 5E95B 2YD4A 1AHWA 2FECI 3B43A 3I2CL 1WWWX 4YHLL 1C5CH 1E27A 4Y1AD 3GSRB 2G75A 3PGDB 4IRJC 2VR4A 4NQUA 5INDA 5D2LE 5F6IC 1BBDH 3PWPB 3WXVH 2WP3T 1QA9A 3C5ZA 2DLFH 3H9YA 5E6IB 3MGTB 2A77L 2L7UA 5SWZE 1E4XL 4P59L 2AKRA 3QJHB 2H2PD 2VLJD 4DZBB 3M8OL 3KPSA 4PIRF 1IFHH 3DV4A 3MV8D 1A8JH 4POZD 2K3TA 2XFXA 5M95B 2LABA 3B3IB 4KUCD 4WW2F 1KIUA 3A6BL 4XXCA 2GITB 3QCTH 4I18B 5E00A 1I8IB 4QXTA 2VXSL 1L7TH 2O93L 2VR9A 3MFFB 5JHLL 3ULVC 3MBEA 5FUZL 5IWLC 4ZODA 5C0AA 1NFIA 1S7UB 2AJUH 3ARBD 4FQPA 4D0CB 2H32H 3QI9A 1KN2H 3PIQB 3VRLE 5FGRA 5CZKA 3SDXA 1ZANH 4HUNB 5HPOA 5SWQB 3GI9H 3BPNC 1D7FA 3SN6N 5J12C 3P4OA 5ACZA 2DQTH 1LDPL 5T3ZE 4LASH 1JGEB 2ICWA 2KUTA 2P42B 2UZIL 4Y5XB 1ZEAL 3QAZC 2VDNH 1YEKH 2J5LB 4G9DB 1A7QH 2K9UA 4DTGH 4WUUD 3UEZA 4DK6A 4ZTOL 4F8TA 3V7MA 1L7IH 3JVGA 1DVFC 5EIVA 4ETQB 1QSED 3C8HA 4G8IB 5E1HB 3RY6A 2V17H 3ROLB 4CMHB 4F7PB 1QR4A 5K9JH 1IAOA 2E9IA 4HKZB 4U2YA 5HYFA 2GYSA 1IAKB 3G9AB 2WBJB 4JQXA 4M03A 4MNQE 4YNYB 4BZ2H 2BNUA 5L88H 4APQC 3V6ZA 2MSPA 1T21B 1PZUB 4R96A 5F8RC 4Z7UE 1KCKA 2QADC 5GGRB 2JIXD 3TT1H 5F96L 1AKJA 4G6FD 5F1NA 5I74B 2C3XA 1G6RB 4YPJA 3CH1B 3P0YH 3G5ZB 5JTWA 1XZ0B 5FO7A 4PJXF 1D5BB 1VFAA 4M61B 4YAQA 3SE8L 1FYHB 1A4KA 5E9DD 1RI8A 1EFXB 25C8H 5F3BB 3WO4B 1BZ9A 1M7IB 1HCVA 4U1MA 3T65B 5I1AB 1CFVH 5FGCB 1FJ1A 5CFHA 4ZNCD 3DRQA 1B0GA 2ZUXA 4AEIH 4F9PC 4P23B 4Z7QF 5EZOH 1N8ZA 2Z91B 3ARDA 3SQOH 3SJVA 5HHOE 2IQAB 2W0KA 2DD8L 4YO0B 2FR4B 5BJTA 4XNUL 4F80A 1RUQH 1MJJB 3TH4T 5HJ3B 5BRZA 3GUTB 5IW1B 1LO5A 5E99H 4WDIB 3MLXH 5DVLA 3W11C 1FFQA 2V9RA 2KQMA 1MREH 4JVPA 1I8MB 3H9SE 2EYSA 5D8JL 1OGAB 2DQHL 4PJFB 5F9DC 3W82A 5JW4Q 2BOCA 4UZGA 5D7LE 3ULSA 4XP6L 1QO3A 2R23A 2ZUYA 3MLTA 3MNVB 5HVHB 1FBIH 5D7JA 4AT6A 3CFDB 4V1DA 1T1WA 4EN3B 3RTQA 1B6UA 4EUPB 1EO7A 5IOPA 4GRLB 3T8XB 3EJYC 2MKLC 4OZHF 4LSVL 4XC3L 5ITFA 2VLME 3I6GB 2ZSVA 1UFUA 2E27H 2ATKA 4CW1A 2PCPA 4ODTH 4AL8L 5D2NB 5GRZA 3ETBF 5EOCL 3VFTA 4F33B 3JWDC 4WENB 3QUYC 1SYVA 3LDBC 5F7MC 4PTTB 3UTQB 4PLNC 3K2UL 1KIRB 3GMLA 5FDWA 4I2XA 1WBXB 3IKKA 3QCVL 4ONGH 5GZNC 3EO9L 2HLAA 3FB5A 5GS1C 4NBXB 3LZFL 1MCOL 3KPOB 4PJGE 1FL5B 5AYUL 3L6FB 4FFVC 1CLOH 2EDEA 2XWJB 2DQEH 4KJPD 4G43B 4P5KA 2CXKA 3Q6FA 4WEUD 2DL9A 1S9XA 4FXKB 5DR5L 1LO0L 3I6KB 1SJEA 4U3CA 3GMOA 3QXAB 5DSCA 12E8H 1U58A 3WIIH 5EU6A 4PJDF 4RFOL 3PV6A 2ADFL 3TA3B 3RA7L 4YXHH 5I1GH 4JFZL 4JCMA 5I1CH 2EEBA 1CDIA 3DX6A 4XMKL 2CD0A 2XN9A 3MXVL 5TE7H 2A6JB 2XYCA 4CNIA 5LWYH 1PG7X 2MTPA 4GG6E 3SGJA 5FKAA 4XAKD 2NXZB 4WO4D 4CBPA 3IDYB 1UCBL 2XICA 1ACYH 3QFJA 4OI8A 3SDCD 1IEAB 3MOAH 5IBUG 2VISB 5INCA 2OX5A 4D9QD 3P4NB 2FIKA 4NKOA 1NDMB 1A7PH 1FNFA 1AFVL 1EJOH 2XTJB 3WLBB 1YPZE 4R97C 2AS5M 3TCLA 1S7QA 1NL0L 4HZAA 4D9LH 2KL6A 4H26B 1K6QH 5CJOL 3GMMB 3JUZA 1MRDH 2X1PA 1TZIA 2F54D 4QRPA 2J6EL 5FO8B 2VAAB 3FMGH 1F4XL 4JPIA 5DURD 1ODAA 1YYLH 4MWFB 1MFCH 2AXGA 4PGDB 2R1YB 3X11A 1FNHA 3P4MB 5D1QA 5A40E 1EMTH 3NCCB 5A2FA 1D6EB 2B5IC 1KCRH 4TOYL 1FZOB 2FGWL 4NZJA 3H9ZA 4PJCB 4F37F 2C3HA 2DQCH 1P84K 3Q1SH 2X9WA 4L9LC 3VGEA 2X4OA 1HHHB 3BEWB 4FP8H 4L8SA 2GK0B 2VUOA 3GKZA 1FVCB 4N90E 5IB1B 2VDKL 3S4SB 4TUKH 2E5EA 1I75A 3SE9L 5DRWB 1T66D 1TJGH 1CLCA 4KK5D 4P3CL 2A73A 2YUWA 1SHMA 2NNAB 1CFNA 2Y1VA 4WJ5A 5ICXA 4Y88A 2C4XA 3NFPA 2A74B 2JK5B 1RQ5A 2BY3A 4NZRH 4XWOC 3L3JB 5TF1L 1QFWI 4UU9A 3WLWC 1MLCA 3B9EA 1CGVA 4GT7A 1MY7A 3WFZA 5IK3B 2VDOH 1JJUA 1DQDL 4JFHE 4LEOB 2V5RA 4NQVA 1X4ZA 3OQ3B 2VZ3A 2R1WB 4LVOC 4N0CD 3UTSA 2H32A 3C5ZD 1JRHH 3FHAA 3JWOH 2ZOLB 4PRAA 4X5XA 1FNLA 1RJYA 3KNBA 1R3IH 3KPSD 4MS8C 4NDMB 5DJZA 4DZ8B 1FDLL 1JHKH 3O6LH 2VZUA 4NJ9H 5DJXB 3QEGH 4GBXB 2VDQH 5I30L 1PX3A 2R4SL 4BKLA 4A6YH 3GHEH 3IDUA 3S36X 2F5BL 4PJEA 1MFDL 5C0AD 3SGDH 3UCRA 4ZUSA 2O5YH 1IM3A 2JB6B 4XNZC 4PJ9C 1KJVB 2ICCA 3UBXA 3QI9D 1F3JA 1FAKT 3D39A 4RRPG 3IDMB 5A1AA 5CILL 3LD8B 4OT1H 3MCLL 4G8EB 3T4AA 5DD5L 3QUXD 1DQQA 1A21A 3BZ4B 3F7YA 4IJ3B 3IDXH 1KBGL 3HZVB 4YWGL 1FNEA 4JZOB 3DXAA 2H41A 5BZDA 3CX2A 1WFUA 5KN5B 1W72H 1IGYB 1SBSH 5EUKB 1N0XL 3W39A 4HMCA 3QQ9C 2ZPKH 1BX2B 4HWBL 1QFHA 3RPIB 3OHXA 4K2UH 3A0OA 2DQGL 4O02H 1BFSA 3LQAL 3KXFE 3ESUF 2APTA 5CGYD 3UTPD 1S9KC 5F6HI 4U6VH 1AIFB 5DDHA 4AEHH 4PUBH 2FJGB 4P2OB 5ID0A 3C6LC 4F7MB 1BVZA 3G6JB 4JO3L 2XG5A 2GUOB 4RGND 5F71A 1J5OL 3NIGF 5FYKD 1K8IB 3HTLX 3KPNB 2HT4C 5JHDD 3QQ4B 2O5ZL 3WL9A 2HN7A 3G6AB 4WUKH 1YN6A 3KPMB 3TIDB 4N5EC 1FORL 4N0FA 3QIWC 4WWKC 4XCFL 1AKJD 1Z3GL 1LVEA 2DI9A 2UV3A 4N8PA 1OTSC 4XCCL 4H20L 3NTCH 1AQKH 1GIGH 3EGSA 4HGMA 4NHUA 4IOSD 5IFJB 3MRQA 1KCVH 4LLQA 5D9SA 3EOAB 4HWNA 1B0WA 2A1WL 2EDNA 3I3EA 4Y4FB 1W0YT 4QHLA 1U3HD 4YDIH 3RWGB 1F6LL 3CXDL 1AR1D 1TJHL 3CC5B 2ZG1A 3UXFA 1U9KA 4KZDL 1FYTA 5IQ9B 3AS2A 1TIUA 2VH5H 4OLVL 3VFPB 4KU1A 5KVMC 4ZAKB 4K71B 4CAGA 1RZKH 1ZT4B 2B1AL 4KI5C 4LKXB 4XXDA 5JXEA 2YKLL 3PWJA 3LKOB 4D3CH 3HNSL 5GSVA 3T0VA 2NY4C 3ZL4H 4R90H 1A9BB 3FN9A 2BVUA 5BRZD 3MRFB 3EAKA 1NUDA 1BEYL 3CD4A 4CVXA 3AGVA 1KCSH 2GT9B 3U0PB 2IAND 3AUVA 4FOMA 2NMSA 1X6NA 4JJ5A 4NN7C 5IMOB 4XPAL 4X0KB 5DT1L 5E08L 4Y2DA 1WC7A 3CVIL 3OKOB 5EC2A 1KC5L 4H25A 2NYYD 2Y5EA 1BP3B 1I3RA 1J8KA 1AD0A 3CFKB 4V1DD 3U9UA 3MGOA 3D0LA 3RTQD 3RWFB 5LXGL 3H42H 4YHZH 1FC2D 5CS7A 4LCCB 1B9ZA 1U8NA 5FUCC 4JRXE 4ELMA 3QIBB 1FFOB 1LP9A 4KHXH 1MJ7H 1PYWA 2IH3B 5C09A 3RIFK 4EUPG 4LLVB 4YK4B 1HNGA 3VXUE 5F89B 4FS0A 3RZCC 43C9B 5FO9B 2Z31C 3TBTA 3OXRB 1ZSDB 2EYRA 2P43B 1YY8B 4ONHB 1X7QA 4F7EB 1WCBB 3VD3A 1IVLA 4JM2B 5AWNL 2ATPA 4EEEA 4KJQD 4L3AA 5EU4A 3HZYA 4CGTA 2OTWA 3WNLA 2HAZA 2B4CC 4F2MA 1OCWH 2YEZA 1FO0B 4RAUB 3IU3A 4F3FB 1A6TB 3WN5C 1MCLA 1Q94B 3OXSB 3KPQA 4POUB 1XF5B 2A9ML 4FTVE 5IHUL 5LGHH 1YN7A 3L7EB 3NGBC 4N8VB 2R0LH 1VA9A 5C08B 3QRFM 1FV1B 5EU6D 1KFAL 3SDAB 4NPYB 2ADGA 5FOJA 1A9EB 2XN9D 5D7SL 5F6HJ 1IMHC 1JWMB 4ZXBC 1RJLB 2EICA 4LVHC 1NJ9B 2HT2C 3BHBA 3NN8B 2XZQL 2DMCA 5EOTB 2FO4A 4YZFE 3QQNA 3TJHC 2OMBA 5GGVL 2VXUL 3QFJD 4RA3A 2YA0A 4MAUL 2XXMB 1NC2B 4MSWB 5FCUL 4E42B 5A43C 4OM0L 4NWTH 4QTHB 2XIDA 9CGTA 4NKMA 1IEBA 5B39A 5JIPA 4GS7B 3BW9B 5DD6A 4NNXB 5BVPH 1EERB 4P2RB 1T04B 3G5YA 4JAMB 5FHBH 3D85B 1ZLUH 3BGMA 4Y19A 4Z7VB 4PRDB 4OCXL 1IT9H 1U8OA 3PQYB 4TTDD 5D5MA 1FAIH 2WSKA 4HJJL 1MJ8H 4QRPD 3SOBH 1UWGL 5JZ7D 3QISA 3RHWK 2V5SA 3RY5A 5C2UB 2L7JA 3KLAA 3V6FA 1CGTA 4GKSB 4WNQB 5EU7C 2EXWD 3AM8C 4J2XA 4UT9H 5JIHA 5C8JA 5SX4H 3P9WB 5D1QD 3ZYOA 4U6TA 3GMPA 4LSSL 3QDHA 3GSOA 4NBYB 2GSIA 3DHJA 3SE8H 2DLTA 4KTEL 1I1AC 4O5LH 5DJ2A 5KTEL 1X5LA 1MOEA 2IH1A 3FO1B 3ULVL 1OSZB 4P5TA 1CICB 2MFNA 5I0DA 2VMFA 4LOUC 4N9OB 2WQRA 2YK1L 1P9MC 3IFOB 3QDGD 4KUZL 5GGSY 4WFFE 4XB8A 4D8PA 3U36A 5EPMA 2ZWLT 1HXMA 1OB1B 2JF1A 4XNMB 5DJYB 5ILTH 5IVXA 1A1NB 5ESQA 1MFEH 2NR6D 1DBBH 1QLRA 5JOEA 3S4SG 2V2WB 1CI5A 5IMLB 2CUMA 2B1HL 5FM5O 3PXHA 4XNUH 5ERWA 4GW5B 5E8EB 4OJFL 4PLJD 3I50L 5LCVL 5I19H 5J1SC 1GYAA 5E4EC 4L8BB 5C0CD 3VD5A 4M48L 4JQVC 5DXWA 5H35B 1LO4L 4A6YA 2BNRE 3MXWL 2F53A 2EYTA 5TQ2L 3EKCA 1KGCD 2M2DA 2PR4H 3O3UN 1T3FB 1CGWA 3UTSD 2QLVB 3K8KA 1T83A 3DVGA 3OX8A 4Y1AB 2HVJA 5JXAH 4R4ND 5AYQA 4WTZA 5L8KB 4PY8I 2VLJB 2ZNWA 1W72A 4WHDA 4K3JL 1D5ZA 5JPMB 2YRZA 4Y5VC 5CBEA 3VFGL 5CIPH 4PJFF 4JQIH 4U4BA 4QXGH 4JFQA 1MCNA 1GAFH 3DX9B 3ARBB 2D0HA 3DTXA 3RDTC 5B38B 4L9DA 4LRNL 1CBVH 2Y9RT 1T7WA 4X6CB 1ZVSA 1I9JH 3T0WA 2YPLE 4P57A 4Z7QE 3LKQB 4HS8L 4PGEA 2HTLD 4UTBL 4XCEB 3S5LA 5HHPA 3U7WL 5AAWA 4HS6A 1NBYA 2AK1H 3U0WH 3K3QA 4ELKA 2QADD 5FA3B 4HD9A 4DUVA 1CL7H 2YD2A 3MR9B 1KIQA 1MNUL 4MA7H 2GEEA 3BSZL 3VI3E 1T89C 4FQXA 3BZFB 4KDVA 1QSEB 2R0ZL 2DI8A 2D31B 1T03H 1G9NC 1Y6NR 3UX9B 5L0QC 4NM4H 4JFEA 2D7TL 1UACH 2XZAH 3A67L 1VEOA 1SMOA 3OAUH 6FABL 4TUOA 3FOLA 5DO2D 1XGRB 1B2WH 3AU1B 1H8OA 2JIXB 2X5PA 1FNAA 4G6FB 4N5UA 1Q9WA 2NY2B 3QDMA 5EZLA 3KLSA 5I75C 3A6CL 4FQIL 2OR9L 4HS3A 3JWDL 3QXDA 5GRJH 3I9GL 1FYTD 1RZ8B 3L3GA 4LCWE 3SKMA 1INQB 2SEBA 5SV3A 4PRBA 4WTWA 3BMVA 5E0QA 4TRPH 5JXED 3SCMA 4EIGB 1EAJA 2H1PH 4M7KL 4ZDHA 5IHLB 3CAFA 4D94A 5I73C 2YS4A 1EAPA 1UXWA 1LHZA 5C0EA 5C2BL 1W0WA 3VGDA 4AEEA 2KKQA 5JDJA 3TO4C 5DJAA 1AD9B 1JZ5A 3IJHB 1BJ1H 1FPTH 5HYJD 4N0UB 3W5NA 1Q9LA 4D0DB 3HI1B 4BFGA 4Y2DD 1T6WA 2IFFH 3VD9A 4EI5A 4ZS6D 2CDFA 3QB7C 3LN5A 3QHZL 4EDWL 4EI6B 1AE6H 1PG7W 1XF1A 2R2BB 4JB9L 1PFCA 4UUJA 4AY0A 1FZJB 1ORQB 4HWZB 3QCUH 4PJBE 4ZUUA 4GW4B 5I71C 3HCVB 3TFKD 2X09A 4V2BA 5E9DE 1G7QA 4PY8J 1RJZA 5C09D 1QSVA 3CLFH 3CNKA 4HMEA 4GW1B 4HKJB 3LKPB 2JJSA 4F57L 3U46B 4PPTA 4YHKL 5GS0C 4JFYB 1S7SA 3FN0L 1UZ6E 2FX7L 4JPVH 1CGSH 5I8EA 5DZNA 3T2QA 4LF3A 5AZEH 4YDLB 1KYOK 2AJXH 4WI8A 2YN3A 4QRUA 3TN0A 4LIQE 3IF1A 1S7XA 4JY6A 4NO5B 4X6FA 2IADA 4I5BB 1AI1L 3NIFE 4KV5F 4JLRA 1CFSA 1CXKA 4J3VA 3S6CA 1X5HA 5E8OA 1LQSR 5MENE 3O3EA 3ZKND 3PG2A 2CGRH 4FQJL 4AG4L 1HKFA 3CFJA 5MEQA 3MCLH 1VFBA 4XMLL 5F7YC 1HOCB 5BV7C 4GAYA 3L3HA 4QOKE 1V3KA 2AJZA 1LE5A 1J0YA 1KLUB 4I77L 2HRPL 4Q7DA 4ZFOL 3UAJD 2EDYA 1ZK9A 2PW2B 2LVEA 4N8VG 3ISWA 3G6DL 3K2MC 1VHPA 2P8LA 5IEHA 4HWBH 5DHXB 3NMEA 3RWIB 1FFRA 3HPLB 1JIBA 3D18B 4CVWA 4P9HC 4I3RH 4WO4B 2A83A 5F7WC 1TCRA 3HFML 4LRIA 5CSZB 2VL5B 4L5FL 1TNMA 5DI8B 4POYA 4MMXC 1CDUA 5M7QA 4LQFH 3UC0H 4PJIF 1KPUA 4U6HA 1T7VA 3HE6C 2VLRE 2HMID 3FAXA 1XCQA 3VXTB 3ULUH 1QLFA 3C08H 4OF5A 4KK9C 5F9WB 2G5BB 3RKPA 1LD9B 3FT2B 5FGBC 1F4YH 4YDKH 1NDGB 1JGDB 2F54B 4HFUH 5DURB 3FZUD 1HK6A 3NFNA 3QUMH 3TH3T 1K85A 3K74B 4G6AD 1YNLH 1M7DA 3OJDB 4MNHA 3NPZB 1X5XA 2JJVA 5DZOA 5DRNB 4YX2L 3RVTC 1WAAF 2YSSA 1A5FH 4GRWB 1U93A 3QSKB 4LPTA 4P5TD 1DLFH 4M62H 4X6EA 3QH3A 3QDJA 3HB3D 4MD4A 4OCSH 5T1MB 1WT5A 4XWOD 1CD1A 1F5WA 3DVNB 5HYSB 3JV4A 3HN3A 1U8PB 3C5SB 2HKFL 1ZVHA 3LKRB 1URLA 2APVA 4HF5L 1Z2KA 4GAJH 4NKIH 2MCPL 2BX5A 3WFBL 2AJ3A 3C5JB 3PP3H 3L5XL 3V6OA 2AXFB 4H88L 3VFSB 1J05A 4U1NB 4Q2ZA 3LKNB 3ARRA 1T5WB 3O9WA 5KSUA 5EIQA 1EHLL 4EVNA 2H8PB 1NCAL 5C0JB 1U8MA 5CIPA 1MI5D 1I4FA 3E6FA 1ZHKB 1L0QA 1LE9A 1E4KA 1XH3A 5BMFH 1K4CA 5EBGA 3STLB 3S35H 1AY1L 3U6RA 1CTOA 1QA9B 1PGRB 1L0XA 1N3NB 8CGTA 4IDJH 1LK2A 5I1EL 1DLHB 4PJ9D 4O2EB 1X5JA 3RNQA 1KTLB 3KPSB 3V8OA 1EHAA 1XGUA 3DIFA 3FO0H 4HUWB 5GGTH 3VU2A 5F7FA 1I85C 2XFXB 4M9PA 3EZJB 5T5FL 5DEFB 5HI5D 3B9KA 3N9GH 4ONFL 3EDFA 3HNVL 4K7PY 4RFEA 4Z95L 5IFAH 4JKMA 2PYEA 4FMKA 5I6XC 2APXA 3WE6B 4OLUL 3UZQA 3QQ9D 1NFIB 1MHCA 4LU5H 4B5EA 1CLYH 1DN0B 2OP4H 5DTFA 3LRSA 4X9HA 1T1XA 2GJJA 3QI9B 5JW3L 1YY9D 3HPJA 3MQIA 4HPYL 3IGAA 5J6HA 3QUXB 4GFTB 2QSQA 4HXBL 5FF6A 1F8TL 3P4OB 4YXLL 5IM7A 1UENA 4Q0XL 3GSWA 4NO3A 1DBKL 3KYOA 1QEWA 1UH3A 3DARA 5D7SH 4UV7H 5JMOC 4WHYG 5I9QB 1W8OA 1Y0LA 3ZHKA 1QPXA 4N5ED 2XWTA 2VDPL 3QIWD 4WWKD 2BFVH 4M1GL 2OSLA 1FLRL 4QWWC 3NA9L 1G9MC 4FQXD 2R0WH 2AAVA 4HPOH 1NCCH 5DJDB 4OIIH 4JG1L 2B8OT 4TSAL 4RGNB 1YEDA 2ZG3A 2G60H 3MLPA 4JFED 5CKGA 3KYKH 2X1WL 2ICES 1J87A 3TWCL 1PSKL 2E9BA 4B0MM 2VXQH 4TPRH 3V6ZB 5HVFB 5JHDB 4OLYL 1DBMH 4OCRL 5I2IB 3O8XA 2F15A 3ARGA 1RUPL 2WIMA 4Z7WF 4NQEA 3VJ6A 1AKJB 2VIRA 2CLVA 3KPPA 5F1NB 1R5IB 3BPLC 3QDMD 3SDXE 3G5XA 4OQTH 3TLRA 1MCDA 5GSRA 3FT4B 2Z8RA 3K4AA 5DMIL 3DOSA 3DX8A 3O6KH 3RWHA 4J3SA 2NY4D 1X5YA 5EU5B 1NLDH 2ERJB 4HC1H 5E5MA 3T09A 1MUJA 1U3HB 2J2ZA 2BNQA 4X7CC 2A0LC 2CIIA 4DOHE 4MXWH 1B0GB 4X7TB 1G7LB 5DA0B 5C9KA 4I9WE 4Z7VF 5LVEA 3LRGA 1FG2A 2B4CL 3U83A 1OM3L 2AABH 3SKOA 3LV3A 4NQXA 3TYFA 4PGCA 2VXTL 4J7RA 3OF6A 4WHTB 2WUCL 5BRZB 4XVTH 5C1MB 5B3NA 3CUPA 1U36A 4NN5B 2BDNL 2F19L 2OL3L 1OAUL 2IANB 4EI5D 4OFPA 4J8RA 5GIRB 1A0QL 1FZKA 3DMMA 4NQCA 2X4NB 4P2QA 4XPFH 2BOCB 5IR1B 3ULSB 2UVFA 4IHOA 3NIDF 3SGEH 1QO3B 2EDRA 4OD3H 3L95A 2ZUTA 3RI5K 2FD6L 4OB5L 4AT6B 1MFBL 4HX1A 3RGVC 4V1DB 1T1WB 1YEJH 3HS0A 5IOPB 3RIFF 1JP5A 3LPWA 1NSNL 4BA8A 5ITFB 4ZPVA 4DKDC 2ZSVB 2YRPA 1QZ1A 2PCPB 4WVRA 5A3ID 3VFTB 2DM7A 1HEZA 5IB5B 3MROB 3EFFA 1SYVB 3HE7A 4F7TA 3ILQD 2IFGA 5D1XC 3SJVE 4QRRB 1A3QA 5FDWB 3GMLB 4NRXB 4I2XB 5JO5A 5L2JB 2NY5C 3NCEB 1DCLA 4LCUA 4O00A 3BVNA 4GSDL 3QO1B 2X4PA 1OT2A 35C8L 1ORSB 3T0EA 2HLAB 4JY4A 1OWRM 2HT2D 4LL9A 4UTAL 4YIQB 1GGBL 1I8KA 1VGEL 5ETUA 2HTKC 3LIZL 3TJHD 4YDVB 3L5WB 1AQDA 2R29H 3UTZB 4P5KB 32C2A 3Q6FB 1S9XB 5FYJL 1UB6A 5IW6A 1IGTB 3GMOB 1DFBH 5DSCB 1U58B 3CIQA 3IFNH 5F9JA 2HJKB 5EU6B 3MOBH 1T22A 3WJJA 4CJ0A 1BFVH 3VFMA 2XN9B 5BS0B 1ZWIA 4WI3A 5DQDH 4KUCF 4X99A 5FKAB 3EDEA 3QUMA 1A1MB 1P7KA 5J7CC 1INDH 5GRUH 4IRSA 3WSQL 4NKOB 1PLGL 1E6OH 4NRYA 5TDNA 4LBEA 2W07A 1CGUA 5H2BA 4LNRA 1S7QB 3RL1A 5DD1L 3RHWF 5T3XH 3GFUA 2ITCA 4X6CF 5C0FA 3P4LA 3V4VL 3N85L 5D1ZA 1R3HA 3MYZA 3KS0H 1NGWA 1TZIB 1KELL 4QRPB 1CWVA 4PB9L 2WBKA 1A7NH 2AV1A 3I3BA 4O9HH 5EA0H 4PBWD 2HFEB 4LOUD 5MP6L 3X11B 2QSVA 1FVEA 3CK0H 1QVOA 3X3GH 3A6CH 5I1JL 5KSBB 1CXLA 1Y6KR 1MQ8A 4ZFZA 2Y25A 5JR1L 4UI2A 4H1LH 4RX4A 1MLBB 1LK3L 3MRBA 3QDJD 5E2TH 3VDAA 5I1IL 4M93C 1YC7A 3C09C 3P9MA 1UG9A 2ICWI 3QDGB 3NAAH 2CH8A 1R24B 4X6BB 4Z6AT 3ZDXF 4W4OA 1U6AL 4UDUA 2LAGB 5C07E 5GGRY 1S7TB 4LSDA 4WJ5B 1CFNB 5F8QC 3PHOA 1IAII 3V4UH 1QSFE 4QHMA 4XP4H 4Z7NE 4I0CC 5GGTA 3O11B 1Y6MR 2GJ6B 4X83A 4HLZG 4YQXH 2VZSA 5C0CB 1MCFA 4RNRA 4U1LA 4Z0BL 2X6MA 2M1KA 2H2SD 4YGVB 3S37H 2DQDL 1T1YA 4NQVB 3FCTA 4PR5A 4UBDC 3UTSB 5E2UH 4UB0L 2H32B 1G9NL 2VSCA 1G6VK 1FSKC 4PRAB 4YHOH 5GGUA 1RJYB 3KNBB 1VACA 2DYPA 1U2CA 1QG3A 3QHFL 3UPRB 2ADIA 1B0RA 3QEUA 3VWJC 3B5HA 4DEPC 2AJSH 5BOZG 3BUYA 3TYGL 2ORBH 3B9KD 4M5YL 1P1ZA 2KQNA 4QHNB 3MRRA 4BKLB 2OK0L 4TNVK 4PJEB 5J12B 1XCTA 4Z76A 5I1DB 3UBXB 5ACLA 1AI1H 3NFSH 5ADPL 2J1KA 2NY0C 2ENYA 3BT2H 3N1GC 1YEFL 3BP6B 3O6FC 1KN4H 5FFLA 1FIEA 3QAZB 5DRZA 1DQQB 5CEYB 5IGXL 3U30C 1FNEB 2MWCA 4GLRH 1DVFB 2Q6WA 3TPKA 1DR9A 3W39B 3GMNA 3BGFB 1HI6A 2BRRL 3N50A 1BQLH 3BN9C 4D0BB 3GJFK 2NY3D 2N7AA 2RQ8A 2X4UB 3TBWB 1YEEL 1CFQA 1JK8A 4OQTA 2FLBT 5DDHB 1WK0A 1UM4H 4OZFB 5ID0B 3EOYG 2FIRT 2QADB 5GISL 3HUJA 4HC1A 1S9VB 1RU9L 3C2AL 1J7VR 3WL9B 3CZFA 4UAOC 3BQUA 1NBVL 2HN7B 4HJGB 4KZEL 3O8XD 1MCWM 4LP4A 1YN6B 1T4KB 1J10A 3O3DA 1MHEA 5KVEH 4G6KL 1MF2L 5IBTL 2ED9A 2PW1A 2X89A 3D39E 3TCXA 4NNPH 1HKLH 1U8JA 4FA8A 3HI6H 3KJ6L 4CJ1A 1S9WA 3RU8L 4NHUB 3UPAA 5IEKA 3MRQB 1KOAA 1OD7A 4LLQB 4WCYL 5HYQA 5CP7A 1OTTD 3DXAE 3LEYL 3V0WL 5TQ0H 4JDTL 4QF1A 1DEEB 1OAXL 2VXVL 3RUGA 2BNQD 1YNKH 1WICA 5CEXA 3WFCH 1MAKA 4DCQB 1G84A 1AGDA 3S96B 1N6QL 4QHKI 3EBAA 3D3VA 5ESAA 2ICWJ 1U95A 4NP4L 1BJ8A 1XGYL 3VCLA 4CADA 3O4LD 1BLNA 3QG7H 4ZSOE 1MIMH 1YMMA 3BDYL 2VDMH 4QRQB 4W81A 5GSVB 1P53A 1WBYA 2NY1C 3OF6D 2X1QA 3MRMA 4M4PA 2OZ4L 1ONQB 4HCRH 3GMRA 4LPVA 5IBLC 5BV7L 4OIBA 4Y4HA 1WV7T 1ZLSL 5EO9A 3IXAA 1AGFB 3VGGA 4CVXB 5B3JF 4F15C 3X3FH 1DUYA 3RBSA 4U1SB 4G8GD 5DHVB 4TVPL 1OQXA 4XCNA 4JJ5B 5HYJB 2C7UA 4ODUA 1ZLVH 5DMKB 1A6WH 3B4NA 4NQCD 3QPQC 1CQYA 4Y2DB 1I7UA 5EC2B 1EJ6A 2J5LC 4QCIB 4M1CC 4P9HL 1AD0B 1MPAH 5DEGB 3MGOB 1NKOA 3NZHL 2HVKA 3D0LB 4HGWB 5F72S 3U9UB 1A3LH 3QUYB 1RUKH 4KTYA 4CMHC 4WI5A 1U8NB 3LDBB 4ELMB 2DTML 3MJ6A 2NTFB 1H3GA 4WFEE 4ENED 1PYWB 2FHBA 4RMVA 5DVNA 5C09B 4PRHE 4PTUB 4KDTC 1TXKA 5EN2B 3G5VB 3GJFB 4PJIE 5F9OL 5TH2A 2APWA 5GS1B 3IAPA 4LEXH 3O6ML 2BXZA 3OKNB 2EYRB 3HE7D 4XRCB 5IQ7L 5I16B 4U6XA 5I74C 2R4RH 4JFOA 4QXUH 1RIHL 5C71A 4O51B 1K5NA 5D71H 1X4XA 4Z5RA 3HZYB 1F3RB 1V7NH 1K2DA 5FHAH 4F2MB 4YEEA 5E8NB 4HEPG 4JO2L 1UM6L 4XP9H 4QNPE 4JFPA 3KPQB 2B20A 3WO4C 1KB5A 2JELL 5KVFH 1C5BL 1F6FB 1UM5L 4WI9A 3LAFA 5IB2A 3ULUD 2ADGB 1AJ7L 1FN4A 4L4VA 1JF6A 1V3MA 1CU4H 4RAHA 5E2WL 5HHQA 4Q0XH 1WUNT 5E8DL 4S2SA 2FO4B 4R97B 2XY1A 1LP9E 1K4DA 4PRPA 3T2NL 5IFHH 3HE6D 4AMKL 4ZG1A 1KJ3L 1UJ3A 2IEPA 3CDFA 4IRSD 5ENWA 3U4BL 4R8WH 4DN3H 1PKQA 1HILA 4NKMB 3VFWA 5B39B 4OGAC 4OLXH 2HKHH 5DD6B 1VESA 5MEOA 4H1LA 3G5YB 1XF2A 3DSFL 1LO2L 2A6KB 1CLZH 3KR3L 1OP5H 2R2CA 3PV7A 5DD0H 3HHRB 1QYGL 3OPZH 5HVHC 5T1KD 4M7ZB 2B5IB 4JZJC 4EN3C 3ARFA 3KLAB 3C8KB 3V6FB 4K3DL 4Y16A 4U6YB 2HRLA 4JDVB 3JTSB 3S7GA 2ZCLH 3OKDB 2VZOA 3NPSB 5DHYA 4IS6A 2I25N 4DN4L 1JGVL 2V5TA 3UBXI 4QHKJ 4JDZA 5E03A 3TPUB 4WI7A 3PNWA 4WY7L 3JTTB 4R4FH 5DJ2B 4DGIL 3GBML 1CVSC 2WWMD 2WBWB 4HBCH 1QHPA 2IH1B 4XC1L 2J3SA 2EDQA 4P5TB 2V5YA 3PDGA 5DK2A 2P8PA 4KDWA 4ZYKA 5EPMB 4L8DA 5ELIA 1HXMB 2F5AL 1OM3H 2C26A 4R4BA 3N1PC 5ESQB 1NCWL 1QLRB 5L2KE 4OKVB 1FC1A 4Y19E 3VD4A 3F58L 1LEGA 2Q1EA 5D5ME 2P44B 4LVOB 3D6GA 3TNMA 1TQCB 2Y07L 1ZTXL 4HIIA 1UKTA 4LLDA 2DDQH 5ESVA 1Q0XL 4A6YB 2Q8AL 2ZUVA 4L3ED 4KKLC 4LPCA 1PJ9A 3GJEA 2UWEB 5E2VL 5I8KL 5IUSA 5DMJB 3STZA 2CRYA 3IDYC 1G9ML 4GAFB 1MI5B 5DJCB 4IM8A 3ZKMC 4JO4H 5GHWL 2W60A 4UT7L 4CVUA 1E6JH 3WHE1 2XTJC 5KZCD 2DYPD 2A9NL 3OZ9L 4KMTL 5IV2A 1MIEH 3LKSA 5KAQF 1A6VL 4N1CA 4QGYA 1S8DA 4PJ9B 3RJQB 3P9LA 1T2XA 2DWEA 3NACL 4NHCL 5K93A 1SVZA 5D2LA 2C4FU 3CZJA 2OTPA 4Z7WE 2H3NA 3UJTH 5IVXE 5CSBA 5ANMA 2QEJA 3DETC 1TFHA 3ECBA 4JFQB 4J1UB 3VXSA 1GGCL 3U7YH 2G2RA 4NM8H 1X5IA 1U91A 4MJ2A 1I7TB 1FE8H 4LSUH 3P11H 3UBXG 5DS8B 2MHAB 1JZ7A 1SY6H 1JNNH 4PJ5A 3ALXA 3W9DA 3K1DA 1EIBA 1JL8A 4I0PA 2F53E 5CEZD 1AP2B 1XFPA 2VYRE 4LHJB 5A16B 2HWZL 1KENH 4Z7VE 4JZNA 4IRZL 3CDGA 1RZIA 4PGEB 2E6PA 4NGHH 5HHME 2EDHA 3MJ9H 3S5LB 1BIHA 5HHPB 3U9PH 1I7ZA 5T33L 3BO8A 2C3VA 2VDLH 1NBYB 4HS6B 3SE3A 3FOMA 4ZQKA 4ELKB 2GJZA 5I76A 2EDFA 4PGBB 3QIWB 4WWKB 4PP1D 1KIQB 2QSCH 3D48R 1RZFH 2GSGA 4FQXB 2J4WL 1WFOA 4GG8A 4OZFG 4A2MA 4JGJA 1UA6L 1QKZH 4W6YB 4JFEB 4YE4L 5J9PB 4G6JL 1U8QA 5BXFA 3BE1H 3CVHH 4OTXH 5I8OL 4XVUC 2EDDA 4TUOB 3FJTA 3NIDE 3FOLB 3V4VH 3DROA 5HI4C 4X4ZA 1KXTB 3ZKSD 3ZO0A 1JMXA 3MLVH 1HHIA 1HSBA 1Q9WB 3QDMB 2FECL 1H3TA 1CQKA 3QRGL 4G7YH 1X5KA 2CO6B 2E7CA 2FBJL 1WQVT 4RCAA 2NY4B 1MEXH 3L3GB 3SKMB 3WXWL 2SEBB 3U1SH 2GKIA 5ABDE 1H3UA 4PRBB 3O2WL 2FL5A 3MODL 3LHPL 3QEQA 3WS6C 2NY5L 3JV6A 3U0TB 1YMMD 1BGXH 3HG1D 4MLIA 5DUMH 5F7EH 2ESVE 1UVQA 2XT1B 4WTXA 1V7MH 3OBAA 1EAPB 1UXWB 4ZUWA 2ZUWA 5C0EB 3FB8A 3MA7A 1KNOB 1W0WB 4NOBA 3VFRA 1MHPH 3LD8C 3ILPA 5F7UA 3OR7A 4YXKL 4CVZB 5HPMA 3F7VB 4MXVF 5F7DB 4K7FA 5DJAB 4IJ3C 2ILLA 2PO6A 1RULH 1NBZA 4KWUA 4FFYH 1YYML 1VPOL 1CGYA 5C6WH 3KG5A 3QPXL 4OBRA 5KSBF 1O7SA 2YXFA 4KQ4L 4U1KA 5IROC 3VG9B 3RI5F 2CDFB 2NW3B 3H7LA 3DURA 6CGTA 3LN5B 1TTFA 4S1QL 1WWAX 4P2OC 1D3CA 2D03H 5ICYA 4ZUUB 3IDNA 4K7PL 3GO1L 5GJSH 4UB0H 2YMXL 1RJZB 3K8MA 4HUVB 1RJCA 3EZ8A 5D7LA 2Y72A 2I60H 3C6SA 4XPBL 1IKFH 1F6AA 4H0IA 1S7SB 4Q6YA 3QUZA 5K9OA 1CYGA 2NQCA 3MUY1 1N4XL 3TYGH 4LF3B 5TF0A 2VZVA 1PKOA 3GSUA 5GS3A 2W9DH 4W6XB 3BIBX 1SJVA 3GNML 3NGBB 5TE4L 4QRUB 2YWYA 2DI7A 3BAEL 1JGUL 4M7JH 4Y4FC 4ZXBB 2OL3B 3CXHK 4LVHB 5I18H 4HZLA 3O3EB 4RAVB 1JRHI 4L4TA 5CJQH 3MRCB 5EH1A 5MEQB 5T3XD 4GAYB 1TLKA 3L3HB 3OR6A 3F62A 3TBSA 4L4VD 3ULVF 4BZ1H 1Q72H 4G9FA 1XGPA 3QNZB 2YUXA 4PJGA 4M00A 3T0AA 4RMWA 1CFTB 4U7SA 4PRPD 5IEHB 2YBRA 3PJSB 2QBWA 4AIXA 2GK2A 1SM3L 3ZDXE 1JYNA 3SGDI 4F9LA 4OBSA 4ERSH 3HI5L 3FQXA 4UNTA 1TCRB 3DO7A 3LQMA 3PWVA 4KXZH 1A1OB 1WIOA 2HG5B 2ZOKB 4HIJB 5EZIL 2H9GB 5DK0A 4Q6IC 3WUZA 4GG6A 1DJSA 1WZLA 1KPUB 4U6HB 5B39G 4S1DD 4CMMA 1XCQB 4JREB 3V5KA 1QLFB 5C9JA 3ARFD 4P48A 3MRHA 1F2XK 1FNSL 4KRPC 1T5XB 4TVSa 1YPZA 5KJRL 3QIBC 1JPFA 3H9HB 2JCCA 1UKSA 4ZTPL 4P2CG 5E5UB 1UWXH 4YK4C 1M7DB 4NQDB 3MACH 3QO0A 5GS0H 5CJXA 4JDTH 4EDXA 1G7IA 4PJ7B 4DVBB 4XAWL 3BKYH 1NGXA 1U93B 4JM2C 1EH9A 4X6EB 4X9IA 5HGHB 3QDJB 4MD4B 5L9DH 1WIPA 4WFGD 2MPAL 5BW7A 2PXYA 4UOW0 5E4EB 4J12A 2N7BA 1EHXA 1S9YB 3NABL 3HC3H 3RIAF 1AC0A 1GXEA 3GK8L 4NO2A 4BQ9A 2EXYC 3EJJX 2AJ3B 1A6ZA 1P6FA 5BQ7A 5K33A 4U2ZA 4Z78A 4Q2ZB 2Q86B 1WLHA 4Q97A 4U3HA 1FZMA 2Z8VC 2XRAL 2Z8WC 5MEPB 4HT1L 3TBVA 3FQTA 4C59B 1BD2B 4EVNB 1Q0YH 1HHGA 4OGXH 3ZYZA 1U8MB 5CIPB 5KS9B 5CKAA 3EOBA 3E3QE 5DVMA 3SQBA 1OSPL 1RMFH 1XH3B 3IDJA 5DUPH 1H8SA 2NZ9C 4UT6L 3MLUH 4Y5VB 5HHVL 5E4IA 1OY3B 2UVEA 3CDYA 4BSWA 1J88A 1SY6A 3L3KA 3U4EA 1BMGA 5CLTA 2FGZA 4MA8L 3P3YA 3VA2C 5BOPA 5CD5C 4JN1H 4X7FC 3DIFB 3O6FD 4HGKC 5T3ZL 4OCYL 1KEGL 1LDSA 4TNVF 1MFAL 1ZGLM 4JFXA 5SWZD 4JR9L 1OAZL 4J3WA 3RWEB 4Q9RL 3B9KB 1KTRL 3SGKA 5IB3B 3MJ9A 3MZGB 2EH8H 4RFEB 4N1HB 3VXSD 3MLRL 3V6OE 3QQ3A 3WKMH 1MHCB 1S7VA 5DTFB 4J4PC 3BP7A 1ZS8B 4LAQL 4JO2H 2AV7B 3HPJB 2P24A 1UQSB 4ELMF 5J6HB 1UADC 3VE0A 1MY5A 5FF6B 5AUMB 2JLLA 3QIUC 1BHGA 2P5WA 3CVHA 3ARVA 1CICC 5IM7B 3LRHA 4M5ZH 4KPHL 3GSWB 4C57C 4JKLA 4HDIA 4NO3B 1BVLA 1FGVL 1G7PA 1NMAH 2W9LA 1JGLL 4UV4L 1Y0LB 5GJTL 1YEGH 1YDPA 2NY3B 4ZUVA 4KY1H 1OPGH 2XWTB 5J1TC 5FECB 5T3ZD 2OSLB 4XCYB 1IGFH 1QBLL 3KPRE 3S5LG 3U4BH 5H94B 3ZDYF 1YEDB 4WEMB 4XNQA 1ADQL 1E0OB 4E41E 5C0BA 3GSXB 4HIXH 4M6ML 5I75B 5ECJE 4ZD3L 4ZO7A 1OGTB 5KANG 5TDPA 2PYEE 2W0FA 1C08A 2R1XA 3O8XB 1B88A 3LS5L 2R2EB 5T1LB 3VJ6B 2CLVB 1UC6A 5EBLA 3EFDH 3VGHA 3TVMA 5FUOL 4MNQD 1DQJB 3EYUL 1QFWL 5D72L 4NWUL 5GSRB 2F9BT 3DX8B 4L1HA 4OD1L 3Q6GH 1NGYB 3RWHB 2BCKA 2J88H 3MV7E 4I13B 3V4PH 5I73B 1CXIA 4P9MH 1SEQL 3IDGA 1S78D 2NY1D 5A2LH 2VN7A 5IBLD 4POZC 2BNQB 4NO0D 2DICA 4WY7H 1MHHA 4FQLL 3NH7L 3H7BA 3B83A 5F7HA 2CIIB 1BQHB 1AXTH 4U1IA 1JFQL 1BZ7B 1RURL 4E5XB 1FG2B 3O4LB 3SKOB 3LV3B 4NQXB 4NUJA 3KHQA 1I9RL 1IL1B 2OBGA 3ARBC 2GTZA 1BFTA 4O2FA 3BUTA 1BOGB 3MBXL 1C1EL 1PDKA 3FN3A 2KZ1B 5E1AB 2PO6D 5SX4I 3VXMA 4KJWD 3CGTA 2V5MA 3OJMB 1AH1A 5HHOD 2JJTC 2X42A 3H3PH 5I71B 4NQEE 4KAQH 4IIQA 1FL6B 4G8GB 8FABB 1FZKB 1P4BL 4NQCB 3UJJL 4YJZL 4IHOB 4PG2A 5BZWA 2DQJH 1DBJL 4OM1H 2R0KL 4HX1B 2X10A 5D6DC 3LS4L 3H9SD 3HS0B 1JPTH 4OFVA 2BY0A 3RVWD 5D7LD 5EZJA 1I9IH 3E8UL 2QR0A 4JM4L 3CFBA 2XZCL 4F7CA 4JFFA 1E4WL 2CIKB 1JV5A 4K94H 4KKAD 3FONB 3ZE0F 2VQ1A 1VB9A 3D2UB 1XF3A 3HE7B 3FL7A 4F7TB 2VLMD 5FYLL 4LCUB 4FABL 4IMKA 1NQBA 2UWEF 1KLGA 2X4PB 4XPHL 4LSRL 2OTUB 2RHEA 3V7AE 4JY4B 4Q9CA 3H8NA 3U79A 3MJ8A 1YEIL 3WD5H 1N6VA 1A3RH 5J3HD 5J8OA 5C86A 2Y6SD 5IW6B 3QEHB 4P2QE 5FB8B 1T20A 5LJYH 4MDJB 1TZHA 1J0KA 1F02I 3HZMA 4BFBD 5KW9H 1T22B 1CVRA 1CT8A 4NFDA 3WS3B 4Y4KA 1IGMH 3VFMB 3LQZA 4RDQG 4FTVA 4JPWL 1N5YL 5IIEA 3FRUB 4X99B 1ZT1A 2FH8A 2Z9TA 3HE6B 5HY9B 3SE4C 1P7KB 3B6SB 1R5VA 2VB5A 4XMPL 3VA6A 4IRSB 4P4KA 4PG9A 1T1ZA 2DKUA 3FQNA 4LBEB 3T1FB 1PVHA 2E6JA 1N2RA 3DUHA 1A47A 4LNRB 1MCJA 3T3ME 4LIQH 1UA6H 3P0VH 1MRFL 2DL2A 3BP5A 1F3DH 5I15H 2FSEB 2AJVH 4OZGB 3T0EE 1M71B 4PJAB 4ODWA 1QLEL 2EDBA 3EJZD 5K9KB 1V3LA 1I8LC 5T1KB 3O0RH 5B21A 2AV1B 1GC1C 4CUCA 4PJHF 4TULL 2QKIA 5EU3A 3NCJL 3RP1A 4YHPB 1CL7I 1DQML 2YPVL 1QVOB 5KG9B 4RISH 3ZE1F 4ZFZB 1NGPL 5LQBH 5CWSA 4IMLA 4ZUTA 3PABA 4X9FA 4JHWH 2RCSH 1IM9D 3FQWB 1D5IH 3LHPH 2IAMA 1Q9OA 2NLJB 2Z92A 3ESVF 2AVGA 3NCBB 4FFZL 1H9VA 2AQ2A 2A6IA 4UDUB 4WW2A 5B8CA 1RK0A 1GHFH 1O0VA 4KJPC 4N90D 2QQKL 4G7VL 4Z8FH 4MQXD 4MNGE 3PHOB 5DGRA 1QP1A 4KI5F 4WV1A 1LEIA 4LPYA 3WIHH 3O2DH 1X44A 3WBDA 2V6HA 1K9TA 3SO3C 3OB0H 3TZVA 1C8PA 4U1LB 2AGJH 1RHFA 1MCKA 4L3EB 1HQRA 3GB7B 3UROR 4X8JA 1Q38A 1T1YB 4LHUA 4YHMH 4QRRE 4FQ1L 4WU5A 4ODVH 4WO4C 1HQ4A 1N64H 3GSNL 3FAWA 3K81A 4UILL 3SDCC 3TNNA 3UYRH 3DETD 2E7MA 5KZCB 3MRPA 1KUMA 1VACB 2DYPB 2LFGA 3IDIB 4JFHD 4MLSA 2XQYK 3RJDA 1B0RB 3QEUB 1FL3B 5I6XB 3O41A 5EWIL 1RUML 4O4YH 3RBGA 4K8RH 2Q76B 2IG2L 1EGJL 3VG0L 3BUYB 4K3EH 5F9WC 1BOYA 2C3GA 1PG7H 3MRRB 1HZHH 1C16A 1Z5LB 2DMBA 1M6OA 5K59F 2CLZA 3TV3L 1BREA 1Z0MA 3OKKB 4LFHD 1QD0A 4R2GD 4PREA 3HLAB 3SEPA 2E6QA 4ORZC 5EFIB 3IS0X 4LLAA 5C0IA 2M8XA 5DRZB 4X4XA 4NUGL 5TPWL 4M6NL 4ALAL 1A6UH 5J6GB 4PJXA 4GRMB 3GGWB 3OGCA 5LGJA 1GGIH 1IBGL 4YH6A 3ARQA 5ADOH 2J7LA 2D0GA 2P49B 3BRFA 4WI6A 1JK8B 4DWHA 1DE4B 2GCYA 4XVUD 3QWQB 1T66C 4TSBL 3VFNA 3BKCL 4DAGH 4FQHA 2VLKA 4S1SH 2YPLA 1G0XA 5HI4D 1B4JH 1JYVA 3HI5H 3SKNA 5KVGL 5EB9A 3KXFD 5C0BD 3V5DA 4XVSL 3OL2A 4XBEL 3T4YA 3TIEA 3DJ9A 3CZFB 1AHWC 1L4IA 1EPFA 2QTEA 3O3DB 1MVUA 3MRGA 4RDQF 5DC4B 1U8JB 1AXSA 1L9MA 4N0CC 1KXQE 1GGUA 1S9WB 3C5ZC 2EE3A 5IEKB 3W0WA 2CKBH 1P4IL 2VABA 1A4JB 2X41A 4Y5YA 3WYRA 4QF1B 1ZA6A 4OI7A 3OKMB 3QG6A 2CDEA 1MRCL 5CEXB 1WTLA 3CLEH 1REIA 4XXCC 4KGLA 2Z93A 1H3WM 5ESAB 4OCWL 4XAWH 1VCAA 5ID1A 4OZHA 3TJEL 3CCHA 5SWSE 2XA8H 4OFDA 3KPLA 3MBEC 1YMMB 3HG1B 1HWGB 2C4FT 4GO6B 1IC1A 3PGFL 4FXGA 4LCIL 3N1QC 2MPAH 4MX7A 3HUJE 4KVNL 1WBYB 3QI9C 4LCWA 3SY0A 2WUBH 2QQQA 3GMRB 4X7EC 1OTUD 1XIWA 3B8SA 3WFEL 2AJYL 5EO9B 2PTTA 1J1OL 2BVQA 2CK0L 3PWNA 1DUYB 3S36H 3RGVB 3X13A 3ULVE 3QJFB 2GI7A 2J8UB 4EBQH 5I1LB 5LBSL 4TSCL 3HR5A 4PJ7F 3INUH 5I9QC 4XGZA 4QY8B 1I7UB 1BECA 1TITA 1ROWA 1MWAH 2EKSB 1I3VA 2NY7H 3VXRA 2Z4QB 3MLYL 4D2NA 3JVGC 3LN4A 2GIYA 4NC1C 4DGYH 4KTDH 1NKRA 3P73A 1NAMH 3RY6C 4PJDA 3RUGE 4BSVB 4NQTA 4RGNC 2HJFA