5IT2H

Structure of a transglutaminase 2-specific autoantibody 693-10-b06 fab fragment
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
224
structure length
218
Chain Sequence
EVQLVQSGAEVKKPGESLKISCRGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPADSDTRYSPSFQGQVTISADKSINTAYLQWSSLKASDTAMYYCARLRMIGFDKNAPLDYWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High abundance of plasma cells secreting transglutaminase 2-specific IgA autoantibodies with limited somatic hypermutation in celiac disease intestinal lesions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords heavy chain
total genus 38
structure length 218
sequence length 224
ec nomenclature
pdb deposition date 2016-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5it2H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5it2H01
4Y4HD 4ODWB 1MCPL 3QUZD 3G5YA 2HLFD 1DQDL 3EJJX 1NAKL 2HA1A 3MJGX 5KAQG 3B8SA 1YEJL 3R1GL 2R1WB 4P2OA 1CGWA 5D7KE 4LLYA 1MREL 4MSWB 5BS0B 3GSUB 5EBMA 4NWUL 4POUB 4ZSOB 2MPAH 4J6RH 4HMCA 3HPJB 4P2OD 4ZUVA 2C4FT 4OLWH 3H3KA 1CBVL 3RWHA 4PRHD 5LGJB 4KKBC 4UOW0 1GGCL 5FO8A 4H26B 4P9HC 4YBQD 1UZ8B 1TENA 1FL6A 2VIRB 5DRXB 3SJVD 5F7FA 3IKCA 2XZQL 5DLML 1T6VN 3WNOA 5DD3L 3A67H 3EYSH 1FNHA 2H45A 3HI5H 1QVOA 4I77H 2F19L 5GGQH 4DUVA 1VEPA 4JRYE 3GHBL 2WWKT 3D3VA 4OLXL 5J56B 1A9EA 4KWUA 2XA8H 1KNOA 1ZA6B 3QIUA 4JHWH 4DWHA 1VHPA 3O6LL 1UJ3C 1FNAA 1ZT4A 2VERN 5I74B 4P5TD 4L8CA 1NKRA 2VKWA 1I9IL 3PP3H 4KUZL 3H6JA 3P73B 4QY8A 2FDBP 4KZDL 3LQAL 3DSNA 1G0YR 5HGAB 3AY4A 5IP4A 4DN3L 3CIQA 3VFSA 4H1LH 4HSQA 4LCYB 1QHOA 4ZODA 4ODHH 2R29H 4XCCH 5EUOB 3MV7E 3VA6A 3MREB 2X42A 3TH3T 4YHZL 4NQCD 3SCMC 4L4VE 3EO9L 2IBGA 4Z7VE 3QEQE 2VDML 4J3XA 1JPFB 3QP3A 2WBJA 4G9FE 3IFOB 3GSUA 3NFNA 3JVGA 2QQLH 1KUMA 3C2AL 1GJIA 5IMOA 3IU4H 4JY6A 5EO1A 4X7SL 1BVKB 2E6PA 2DLGA 3CSYA 1GZPB 4K94L 4O2CA 5MEQB 5HDQH 5DHVB 5F6IC 1N6QL 1T89A 3VRLE 1AGEB 1NLDL 1HQ4B 5KVMC 2H9GB 2JJVA 3UTTB 4JO1H 3CC5A 2R15A 1EEUA 4K7PL 3W81A 1QBAA 1A9BA 1OB1B 4J3TA 5KSBF 1A6UL 2OXHA 4IDJH 3O3DB 1S7VB 2LAAA 3HNSH 2EDXA 1KJMB 2HFFB 3VGFA 4AM0B 5JW4N 1BMGA 3CVHB 3MLUL 4HD9A 3SJVA 3HCVB 4FZEH 5E5MA 4NM4H 3GJFB 2QQKL 4RRPG 4I3RL 1PZ5A 1MFBL 4ORGA 3QULA 3BVNA 4L3EB 5GGTA 5J3HD 1JRHH 1UM4L 4NDMA 2BZDA 1VSCA 4HJGB 2ED8A 1T0MA 2MKWA 2P48B 4APQC 2NW3B 1TPXC 4JO3H 5F6HJ 1S7UB 5ID0A 3RVUD 1CR9L 3VXPA 2IMNA 4GMSH 5E6YA 2ADJA 1BJMA 4HPOL 2V9QA 2H1PH 3V0VB 4P9MH 4ALAL 5H94A 1V5JA 4ELKB 2CDGA 3GJFH 4TUKH 3B5TA 3KXFA 4OF7A 7FABH 4H8WL 2Q76B 3QUXA 5GS0L 5H35A 5EOQH 3SOBH 3E2HC 2WQRA 1FE8L 1QA9B 4FQ2L 4NQXB 4JVUA 1F4YL 3BKYL 2UZYB 5KZCB 3TT1L 1MAML 3MJ7A 5MENB 3WBDA 3B9KB 1IMHC 2X4OA 4AH2A 1EK3A 4O9HL 3ZT7A 2VUYA 1NJ9B 3STZB 3TP4A 3WNPA 3ULUD 3KLHC 2HFTA 1ZSDA 2HTKD 2EC9T 5E5UB 5HJ3A 1OP3K 3PWPB 1XF2A 2BJMH 3F7YB 4QTIL 1HWHB 5E5RB 3KDMB 4HS3A 4HJJH 2C9AA 1HINH 2X4PA 2GQHA 3G5ZA 2VE6B 3HI5L 1KOAA 1T7VA 3S35L 1RUAH 4MD4A 3P77B 4XI5C 4LQFH 3CK0H 3B9EA 1UKQA 1HNGA 4F9LA 3TN0B 3N50A 5EWIL 5IVXF 1CLOH 5K33A 3LDBC 1JPGA 4B5EA 1JRHI 2IWGA 2GT9A 2VUOA 1WGOA 2DD8H 2QEJA 3MA7A 3FRPG 1NC4D 1YN7A 2OL3H 3VXOA 2W9EH 5GS2H 2ZSWA 1PLGH 1WVZA 3ZKND 4P3DA 4ONFH 4QT5B 1GGBL 4CVWA 1C5DB 4LLDA 4OIIH 1U8LA 4LARH 1MCNA 4LCUA 5F1NA 4M9PA 3L3KA 5D7JD 3BHBA 3DYMA 4QXGL 1PLGL 4WFGD 1UJ3B 4KRLB 5L9DL 1CDBA 3OF6A 1XCTA 5I1IL 3L5XL 3FAWA 1P4LB 2BX5A 3B9DA 3MLYL 4LVNB 5I1JL 3HMXH 3VGAB 5J6HA 5BV7C 3CSBA 2H32H 4HKBB 4X83A 3GI9H 1CI5A 1U8KB 5F89A 3TPKA 4XCEA 3HE7B 1JUFB 3P73A 4EN3D 3U36A 1X5LA 1CFNA 1XGYL 5JOFB 3VRJA 3OKLA 4K23L 3TO4B 4HWEL 4OCSL 4WWKB 1HQRA 3VW3L 2ATKB 1RI8A 4UIMA 1A6PA 2EE2A 4NO3B 3EJYC 2R2HA 1Q0XL 4L3CA 3JVGC 3QDMB 3MLXL 3WDHA 4N0FB 5FKPB 3WXWH 2PTTA 4PRID 5JUEH 3WUWG 1Q1JH 2NY5C 1J88A 3L9RB 4L8DB 3KDMA 3O3UN 1GHFH 4HS3B 1ZOXA 2NY7H 2X40A 3V6FB 1ZXQA 3O6FA 3O8XD 3BAEL 3R1GH 1F02I 5MEQA 4JVWA 3DV4A 5IM7B 3QIUD 4PLNC 3WXVH 25C8L 4F7EA 4NKDA 3X11A 4OZGB 2V2TB 3AROA 1BBJB 1U2HA 3VFNA 2HLAA 1NMCC 5BRZE 4CN6A 1JHLL 3PGDB 1U8JA 4ISVA 2LU7A 5DHVH 1TNMA 4QHMB 2Y6SC 1J05A 3CLEL 2E5EA 1NCUA 3K2UH 5DUPL 3V6BR 3EFDH 4PJGE 1T1YA 2CXKA 2B1HH 4LCUB 5F1NB 1GGCH 4OT1H 2F53A 5IMMB 3ZZ1A 4PRIA 5SWZE 3VD3A 5DEFB 5EOTB 1Q0YH 3BKML 2NYYD 1JZ2A 2AK1H 3JTTB 1TPXB 1PX4A 4X99A 5IFHH 1LNUA 1YYML 2FJHA 3IJYB 4LSRL 4JFEE 4MWFB 4LPVA 4KMQA 5MERB 4AENA 5ID0B 4O58L 4YLQT 1IM9D 5IIEA 1EO8L 5C6WH 4FQIL 2DTML 4PJAE 5JOPD 4ZDHA 3RUGB 2OM5A 1R5VA 4WU5A 2P8PB 5GZOC 2L0DA 2CPCA 5HHOE 5IR1B 5JOFA 4AMKH 2CIIB 4OLYL 1RSFA 4KJQD 2ZOKA 4G43A 1BF8A 4WWKA 3Q5YA 3O2VL 4JE4B 3R8QA 4HK3J 5CGYC 3VXTB 5ITBL 5BS0E 5IHZA 5D7SL 4M5YH 3HE6A 3SDDD 3U7YH 3SGDH 4DW2H 5DDHB 3MLSL 2H2PC 3B9KD 3BOVA 4Z5RA 4NBYB 4YDIL 3HUJE 2UVFA 4PJFE 4PS4H 1D5XA 1UM6H 2O61A 5DFWH 3OB0K 3QSKB 5AD0A 1A7QL 5IROC 1AO7D 2VE6A 5DFVC 2GJ6B 2DRUA 35C8L 2FYYB 1BBJA 4KHTL 4YDIH 1NGQL 2SEBB 4NQSA 3QWOA 5ICZB 2NX5E 1MUJA 1CGVA 3I50L 2X4QB 1KN4H 3DX8B 2W9DH 4EI5D 4OJFL 1OL0A 5DJAB 3THMH 3OWEA 3IJHA 2NY6D 3MJ8A 3G6JE 5KSUA 3DRTA 3GSRA 3TA3C 2EKSA 2F54E 3CFCL 3OSKA 5JXAH 3LEYH 1NFDB 4PR5A 3QG7H 1X4ZA 3S37X 4WCYH 4ZUSB 4RNRB 3VFWB 1CZ8H 1AO7E 5F9OH 3BP7A 5IWLC 5BVPL 4UBDD 4M1DH 4LLQA 3F6LA 4M6AA 4Z7WF 1LDSA 2KZ1B 4JDZB 3U46B 2ZNWA 5J11C 5LAXA 4P2RE 5GRUH 3CFKA 4ZO9A 4F7PA 32C2B 4PUBL 5HYQA 2YD9A 1AQDB 1HEZA 1NCCH 3IDIB 2P44B 4LLWA 3LKQA 4U7MA 5BVPH 4PJDA 4HKBA 1WV7T 1JZ4A 1YYLH 2ENYA 3QCUL 1NFDF 1X5HA 4ODTL 5JUEL 2VZ1A 2X4SA 4XCEB 5FA4B 4LGRB 4PUBH 1QSFA 2FEDD 4XVTL 5CCKH 5C0JA 9CGTA 4YBLC 5E0QA 3OGCB 5E95B 2DJUA 4OSUL 4ZOBA 4GG6F 4FQQB 3BKJH 5I1KL 1I9JH 1CGYA 2ARJQ 1UM5L 2NNAB 3FT2B 5HD8D 4ENED 1VCAA 3CDCA 4BFBD 1NGWB 3D2UB 2DQFB 1RUKH 2EDQA 1KTLA 2WP3T 1NCTA 1CDIA 3DX7B 3PG2A 2XXCB 2FJGA 4Y89A 1LEIA 4IRJA 4X6DE 1EX0A 1NQBA 3L3GB 1QACA 2P8MA 3TJHD 1WWCA 2GJ6A 3FN0L 5LJYH 3BPNC 5JO5A 2B2XL 5CUSL 5AYQA 5IESL 4HBCH 1WLHA 2AK4A 1ZA3A 3GIZH 3MODH 3ESUF 3K81A 4KAQL 5MENE 3H3PL 5TQ0L 2NX5B 2GTZA 2XQYG 4OZGA 1UKSA 2V2TA 3EYQC 4H5SA 4PJ5E 4U1LB 2DLFH 4D8PA 4R4NC 1ZAGA 2UWEB 5DMYA 2NY4C 2P5WD 3VCLA 3STLA 4HH9B 3FB7A 4RNRA 4X0KB 4QNPF 1LO5B 2I5YH 2AKRA 4D2NA 1NDMA 3QFJD 1TZHB 4S1QL 5HYEA 4Z8FL 1F6AA 1N5YL 1FFNA 1AGCB 2GTWB 4JPVH 5EO0A 5HI3D 2XQBL 3FOLA 4IJ3C 2VLRE 2AJUH 4JKPH 4M7ZC 4ZOEA 1TFHA 5FUZL 4Z0BL 2XZCL 3OAYH 4I5BB 1D5ZB 3WEXA 5HVWA 4BQCA 2O26U 1R0AL 2YMXH 4M6OH 5CZKA 3VG0H 3MACH 5F70A 4U6HB 1IGIH 1DQQA 3QEHB 1Z9LA 2Y6SD 4PRHB 4LARL 3BEWB 2CUMA 1KNOB 1ZA6A 3EJZD 1QSED 3O9WD 1JV5A 1LQSR 4KY1H 5D1QA 5CINL 1ZVSB 3TC9A 2IAND 3BRFA 3MJ9H 1YY9D 2J5LB 2YK1H 4W4OC 1SY6L 3OZ9L 4YR6B 3D2UA 5SWSE 3ZHDA 5FM4A 2HRPL 4C83A 3O2WL 1INQB 4KPHH 1CS6A 3H9HA 5MI0B 3VFSB 1E4WL 1YJDC 5FB8A 3QG6A 3VFMA 2A6JA 3I02A 3L1OH 5TH2B 5KVFL 4ZXBB 1HIML 3MNWA 1ORSA 1BPVA 5EH1A 5IMKB 1UACH 4N68A 3WV0A 5JO5B 3WFHA 2V7NA 2GSIA 3KAAA 4KZEL 3TNMA 2YD7A 4F8QA 1FP5A 1Q0XH 3FHQA 4PY8J 1AO7B 2NX5A 3LRHA 2IFGA 3FB8A 4YC2B 1RZ8B 3ZDXF 5CP7A 1IC1A 2PNDA 3O3EA 4P46A 1Q1JL 3MV7B 4CJ1A 3V6OA 3UMTA 5T3ZL 5FHBH 1BVLA 5SV4A 1JTPA 4LSUH 5IFAH 5JHDD 5DT1H 1FRGH 1ZLUH 4AJ0A 5ALBH 5JPMB 1MHPL 1YQVH 1FFNB 1MJ7H 1I8IB 5D8JL 4FMKA 5IBLC 3MRRA 3UYOD 4RFNB 1MCCA 3DUUB 5FGSA 4AM0A 4QHUB 4XB8A 5J89A 5KS9F 4P2QD 3L5JA 1MLCB 4KJPC 5EU7C 5E5MB 1E4KC 2NY4D 3F7PC 5FV1L 4GRMB 3WNKA 1R5IA 4OV5B 5TF0A 3BZEA 1SQ2N 4JDVB 2DQGH 1E28B 3KPRA 3MRQB 4LLWB 3VWJC 5DUPH 4XCFL 4YE4L 1LEGB 1DQQB 1G9NL 3KPOA 5D5MF 4P48A 1GOGA 4HK0A 1T5XB 2ERJB 2BJML 1EGJH 1MNUH 2EO1A 2IH3B 5E4EC 4XNQA 3LB6C 5DQ9A 1CTOA 4N0RA 3MRGB 2R2EB 4NO0D 4QOKA 4E41B 3O9WA 3UTZA 5EORH 4NBZB 1RJLA 1G0XA 2ADJB 5JHDA 4MD0B 5F9JA 2P42B 4TULL 3PDOB 3UTQB 2P5EA 4XX1G 3WNMA 4NQDA 4OFYD 4PJAB 1H5BA 4JQXC 2WIIA 1X5FA 1JNJA 1QLEH 2IH1A 4ZXBA 1HZHL 1P69B 4LEXL 3NN8B 3D69B 3MLVH 2EDYA 1FLTX 5AZ2H 5DI8B 1JHKH 1HILA 4M8VA 3TNMB 3NA4A 3DGCR 2VDQH 3SGEH 4ZD3H 2DM4A 2NR6D 1ZSDB 1LO3L 1FGNH 5T33L 1BZ7A 4OCWL 2HG5A 2B7DT 4K3DL 2H3NB 1U3HC 4MX7A 4PJGB 1LO4L 3QIWD 4KKLC 1IQWL 3KPNB 5L9DH 5I16B 3GDBA 3SQOH 3OB0H 4WHYH 4DZ8A 5DZLA 5KSBE 3D0LA 3C9NA 1TJIL 3PHSA 4TSCL 1AI1H 1XR9B 4R4FL 1A02N 1NAML 5EZOH 3JBG7 5BVJB 1YNKH 4WI9A 4TTDD 2Q8BL 4IIQB 1ZLSH 1OAYH 1HKLH 4ZFZB 4AQOA 2ICWA 4OGYL 4QGTA 4JFFD 1I1CA 1FGVL 3QO0A 4TYUA 5DJ2B 1A1OA 2X1OA 3AM8A 2BVOB 3QEQA 4HFWB 4G8GA 1IM3A 1L6XA 1NL0L 4KVCL 1I1FA 4N90D 3O3BB 1E28A 1FZJB 3KPRB 3BT2L 4MA7H 5KTEH 3DUSA 3QEQD 1FVEA 2VDNH 1N3NA 1H3GA 5FO7A 4KJWC 4LEOB 5HGHA 4XH2B 1SM3L 4KROC 3CVHH 4TNVK 2Q8AH 1OVZA 1U92B 5IQ9B 1NL0H 1Y6KR 2HWZH 3U7WH 1AR2A 4PRPA 2VQ1B 4E41A 3I75B 2D4DA 3U4EA 5D9SB 4MHHG 2VSCA 3K80A 4GKZA 3DHMA 1I7ZA 3NZ8B 1RJYA 2LVCA 1DR9A 4FS0A 4NZUL 4OM1L 1I8KA 1G7IA 3BN9D 1JGVH 1TVHB 2BK8A 1ULVA 2E3VA 1E4KA 2Y06H 1J11A 4BZYA 3N9GH 1WFNA 3DJ9A 1IZJA 3O6KL 4E42A 4P59L 3RBSA 3VFOB 2HJKA 2YBRB 3P0YL 1YMME 1PKQA 1S9YB 4AEIH 2MSPA 4UU9B 2OBGA 5CHNA 4L3CB 3TVMD 3VGGA 2H3NA 2PETA 4XMPH 4NWUH 4IRZH 5JIKA 3E8UH 3D48R 4L8DA 5JW3L 3PQYB 5E8OB 2IBZX 4HHAA 3UTTE 1MIML 4HIIB 5GJTL 3MV7A 3HZYB 4PJEB 3FB6A 1EIBA 2WBWB 3KPQA 2RJMA 3OPZL 4NN7B 4LLVA 3QH3B 4IIQA 3ARUA 1CFSB 4ZAKA 1A7OL 5HDQL 5HGGS 2ICWB 3BGFC 2VABA 2IQAA 2O5YH 4PRBA 2ADIB 1J1XH 4FQPA 4K9EH 5DJ8A 2OI9B 4YPGA 1IM3B 1B88A 4UILL 4M93B 3OXRB 3TBYA 2Y1VA 2Z0BA 1WWBX 4U6XB 2DLIA 4P23A 1QYGH 1CU4H 1RD6A 2LTQB 4JPVL 4P4KC 4KMLB 3TLRA 5GGUB 4XHJC 3O2DA 3S8WA 2BVPA 2Q7YB 5BOPA 4NJAL 5EG6C 4ZS6C 5DJ0B 3QIUB 2VQ1A 1DQDH 2QSCL 3RFZC 3GRWH 4BKLB 3VXRD 5CD3A 5HHXL 4GRLD 1BQHB 2QTEA 1C16A 2YC1A 4HUVA 2CKBB 1EMTL 2W9LA 1AKJB 4HXBH 4P9ML 3K4DA 1JGDB 4LPTA 1WZKA 5DQDH 1M7XA 2DL9A 1X9QA 4G6JH 1BWWA 3NCEB 4KVNH 1BM3L 3O3DA 2QBWA 3DWTA 1PKQB 4GXUN 4Y8AA 4HUXA 5CHNB 1DFBL 3V5HB 3AS1A 4WTXA 4GT7A 4LPYA 1QO3B 3EYSL 3SDXF 3ULUF 5C0CD 3R06A 4L3EE 3DVGB 4G9DA 4KPHL 3W9DA 4WJ5A 1KULA 1BWMA 3BUTA 2NTFB 4YHOL 3Q1SH 4MLSA 2FO4A 1NUGA 3M8OH 4JZOB 1Q9OB 1X5GA 4H88H 1RZKH 4FZ8L 4LF3B 3RGVC 4RMVA 2AERT 3B3IB 5CWSB 1TQBC 4OD2B 1EUUA 2VMFA 1A6UH 2W0PA 2ADIA 1WT5A 2A6KA 1A1MA 4XVTH 1L6ZA 1RZKL 2BY1A 3QUXB 1VACA 4JFEB 5ICXA 1REIA 4YUEL 4IS6B 4WUUD 4ONGL 5CFHA 4POZC 4MNQD 5ILTH 3CMGA 4HT1L 4PJCF 1UM5H 3AUVA 5D71H 3GMNB 4BK4A 5CEZD 5CJQH 4FQLL 5CLTA 1DVFC 2AK4E 1Z0NA 2CDFA 4TUJA 3VD7A 4N0UA 3RVTD 3T3ME 3QEGL 1N5AA 2Y7QB 1WZ1L 1AE6H 1S7XA 1Z0MA 4MXWL 3HFMH 1OGAE 3A0OA 1YNTB 4M00A 4JM2C 1XEDA 3FCTB 3H3BC 4P2QA 2XFXB 5TF1H 4JHAL 1QHPA 4PJIB 1BQHA 4M5ZH 4Y5XB 2LV4A 1WAAA 5GHWH 1F90L 1DN2A 4MJ2A 2XWJB 2UV3A 4QGYA 2ZOLB 2I60H 3QUMA 3MXWH 5J06A 3QZWG 2GY7B 3NMEA 4NYLB 3BP6A 1SBSL 4HWNA 5SX5H 4J3OC 3VFVA 2ADFL 1YEDA 3AM8C 1WCQA 4OQTA 4LKXB 3MA7B 3IYLW 3Q5OA 3IAGC 3MOBH 1VDGA 4X4XB 3BZFA 5KAQF 3VXMD 1A7OH 5HI3C 2X4OB 1FORH 2ZSWB 3MOQA 2YPLA 3KPSA 4M7LH 4QHLB 3H42L 1L0YA 1MCPH 1DBKL 2EICA 1IQDB 3G6DL 1C5DA 2R4RL 3DV6A 4EUPH 3C8HA 5BCAA 5C1MB 3EYFA 3D85A 2NTFA 4O00A 5I73B 1UJTA 1WTGT 2WW8A 4HG4K 3PUCA 3HRZB 3OHXA 4S0TD 5FEBA 1GHFL 5F96H 4WV1C 1X6NA 2XTJB 4JQXA 1TDQA 4M7LL 1LP9F 5K9OB 1CCZA 4D0BB 3BW9A 1BD2E 3RQ3A 2J2ZA 2ICCA 1ZA3B 3G6JF 2XN9E 1OTUD 4Y19B 1H0DB 4ELME 1CL7L 4IMKC 1X4XA 4PRPD 1OP3H 1OP5H 1D5IL 2FD6L 5E8DL 1DUYB 3EBAA 4KK9C 3LCYA 5BZWA 1KB5A 2F5AH 1JN6B 4NRXA 3U36B 5HHXH 4RISH 1YY8A 4NQCA 2QKIA 3ZSTA 2XZZA 1NC2D 3GMNA 3PIQA 1P1ZA 4W6WB 4X0KA 2DS4A 1K4DA 2VLJE 3REWB 3UTSB 4WFHE 3EGSA 4OZFA 1DVFA 1UQSB 3BO8A 2Y7QA 1OAYL 2LU4A 1F97A 1NEUA 2BVEA 2CH8A 4FG6D 1A6ZB 4NPYB 4R97B 3RZCB 4HF5H 4HZLA 4M3JA 4RAUA 1P5UA 1UJ3A 1Z9OA 3PWNA 4P2OB 2PTTB 3VU2A 4JM2A 3T0BA 3ZKSD 3VWJD 4JGJA 4WUKL 3ZYIA 4R26H 3GRWA 4L5FL 4YGVB 3SO3B 1TETH 4QTHB 5A1AA 2BFVH 5DD0H 4AK1A 3ARDA 5FDWB 4GH7B 4K3HA 5FO9B 3BEWA 1JWUA 1BD2D 2XA3A 4WFFD 5E6IA 5BV7L 1CFNB 2X9WA 1U8MA 5LQBH 1A7PH 4PRAB 3T0ED 1KC5H 2R1YB 1CIDA 5HPOA 1FO0A 5I6XB 4HX1A 1HN1A 3CFBA 4FQCH 3IKCB 3DXAD 3W5MA 4TVPH 3GJEA 2EDLA 3SKJL 2FBOJ 4UDUB 3JWOL 4MS8C 2YA0A 3VXMA 3R0MA 2G75B 1T1YB 3ARBB 1BFSA 1BLNA 3U7AA 3FFCB 3NZHH 4Z18A 4K94C 1ZANL 3R06B 1WBYB 3V6OC 2VRAA 3AFLA 3KYAA 2DI8A 5C3TA 1T21B 4R2GD 1BIIA 1JNLH 3T09A 1ZHLA 1RZ7L 3C08H 3FKUS 2DDQH 1X4YA 5DEGA 5KVDL 5C0IA 3LS4L 2JCCB 4X6BA 4XAWH 4XI5D 2BMKA 2DKSA 5EPMA 2NXZC 5GSRB 3NA9L 5IBUB 4P46B 5C0AA 3SDCC 1SMOA 1FNGA 3HUJA 3HAEH 3VJ6B 1OAUH 1OGAD 3LVEA 4HC1H 2EE6A 4RWYL 5C0ND 4EKXA 4HK3N 1MHCA 1JWSB 3X3GH 3ZL4L 5LKNA 3QDGB 4K23H 1CICD 1DVFB 1UQSA 3MRKA 3VW3H 3MV8E 2FH6A 4LP5A 4NWTL 3TO2A 3VI3E 4I9WE 3GHEL 1ZTXL 4JM2B 5I2IB 1S7SA 1VGKA 4MZ3A 3EO0B 3BZ4A 4Y2DC 1RZGA 5CEZL 3HR6A 2HT2D 4KQ3H 2OZ4A 3FCTA 1LO0L 4OD3H 5L2JB 4QTHA 43CAB 1JGUL 4M6MH 3QIBD 3GBLA 4LCWB 4PRNA 4QXTA 3E6FB 5TE7H 4I13B 5T33H 4NCDA 4HK0B 5E70A 1AGEA 3TBVB 3BPOB 4ETYA 4JKMA 1U8MB 2DYPA 4G6KH 3UX9B 3C8KA 3D25B 5HPMB 4E0RB 2OTUB 3ARFD 3U0WL 3WXVL 4Y4FB 4LAQL 5I8KH 3FB5B 4XMLH 5IJKC 3QWRD 3PWJA 2Q3AA 5DTFA 2CGRH 2DYPD 3F7VA 3L7EB 1F4YH 4GQPH 3KNBA 2I9TB 3D39D 2VDOL 2Z8RA 4Y88A 3VXSD 4LGSB 4PJHE 1KPUA 3PXHA 4OGYH 1IAMA 2W60B 2F53D 4RMWA 2ID5A 2K3TA 2HKFL 4FQXD 4LMQI 5EZJA 5D6DC 3SGDI 2E7CA 4HJGA 3KLSA 1MI5D 1SJEA 4K94H 1Q0YL 3BKMH 5HDOA 3ZDXE 4GS7C 2NW3A 5HVHB 1O7SA 3MJ6A 5E1HB 3B6SA 1EFQA 1I3UA 1XR8A 3RNQA 4NQSB 5FIEA 4OF8A 5C0CA 4NNYB 3QRFM 3ESVF 3KPNA 3RVXD 1I7UB 3IGAB 2ZKHL 1A1NB 1GC1L 4Z76B 3T2NL 4LAJH 4OGAD 1KELL 2D7MA 5JPNA 5HVFB 4L5FH 2J8UF 1WEJL 5KS9E 1WFUA 4XCCL 2Y5TA 3KJ4C 5DGQA 5C09D 1EHNA 4OM0L 5F1OB 5ALBL 4R0LB 4UI2A 2FJFB 5E6ZA 4WI3A 2WINB 1VGKB 4ZS6D 4P2OC 5J1TC 3TBTA 5DRWA 1FC2D 2VXVL 1MI5A 1WBZA 3DX7A 3EHBD 4HG4J 4UNUA 3I6GA 3RGVA 2BSTA 4IRJB 1MQKL 2KDGA 4J4PD 4OZHF 3C2AH 4L4TA 2YMXL 4HS6B 3VG0L 4WI7A 1AE6L 1H3PL 1UCBH 2R2BA 4HPYH 4P5TC 2ZUUA 5IQ9A 4FQ2H 3DYOA 1JWUB 3BQUD 2BSED 5EA0H 1XGQB 5I75C 3D6GA 5I19L 1FO0L 5I1DB 1VADA 1WICA 3MYJB 1E6OL 2COQA 4HX1B 1G6RL 3MZTA 1T66C 1KPUB 3LS4H 1SY6H 3MRPB 4B50A 1FLRL 3KYKL 2DQFA 1S9XB 4RA0C 5ACLA 5CZVH 2ZG3A 4ZPTB 3GMMB 5E99H 1EEYA 5DHYB 1A6WH 2HJKB 4IEFB 3WMSA 5KVFH 3N06B 4OZGF 1NLDH 1HH9B 2BXZA 5D1ZC 3MOBL 2F5BH 3BH8B 5DEZA 1Q38A 3RVVD 4MQTB 3HG1E 4MYWB 3O0RL 4IDJL 4P5MA 3DECA 4KK5C 4BH8B 3UC0H 5C0GA 5LWYL 4XPBL 4QHKI 1OAQH 2UWEA 2ARJA 4XBEH 1KTRL 1EERB 1ZVHA 5ITFA 2CXGA 5FHBL 2UWEF 5I9QB 1CE1H 1UWEL 2PCPA 5TPWL 1JPST 4H1LB 3ZDYF 1N5YH 4FABH 2DJSA 4JFXA 4HXBL 4GW1A 2VZVA 1S9VB 4IRSB 4GAGL 3AB0C 1RY7B 2E7LC 1QFWL 43C9A 4L1DA 3DVIA 3P30H 1A14L 1XAUA 3CNKA 1G7LB 1R3LA 5DJCB 4Y2DB 2Z31A 3H9HB 3PNWA 4MXQD 4PJBA 2E9IA 4ZAKC 4M6OL 1RURH 1KIQB 3GSOA 4K7PY 1NC2A 5EC1B 3HC4H 1QBLL 1S9KC 2VL4A 4G5ZL 1FAIL 3IDXL 3JV4A 1KGCD 43CAA 1K2DB 2P24A 3ARGD 4YWGL 2DBLH 1PJ9A 1KXQE 1WWWX 4OZIF 5I1DA 4Z7NF 4M1GL 1YN6A 3BESR 4DQOH 4CMHC 2DQIH 1WJ3A 1ZGLA 2VJXA 4X6EA 4NQEA 3KWWB 4Q0XH 1KG0B 4OAWA 4QHNA 1QRNE 4GXVH 5F44A 2ESVB 3ZYZA 4FQXB 3EYUH 1GRWA 5IK3B 3QCTL 1L7TH 3U7YL 1AP2A 1DLFH 2VIRA 4C59B 3GMRB 3MFGB 1OGAA 4UV4H 2AS5M 4NN5C 5EZJB 3LKNA 3ULUL 2C5DC 1EAPA 3T2QA 2XQBH 5CBAB 4G3YH 2A9MH 3IJYA 4Y16C 4GRMA 1DLHB 3W9EB 1RIHL 4EXKA 5A3ID 2MQ0A 1DLFL 2Q86A 3C5ZB 2A74A 4D0DA 4TVSa 4IOIA 2BXYA 3RTQA 3PV7A 3DVGA 1QFPA 2BC4B 8CGTA 2DJ4A 2MNUA 4Z77B 2ZSVA 3PV6B 4P9HH 3FN3A 4JHAH 1ZLWK 4AL8L 1MF2H 1BZ9A 5EOCL 5I76A 3ROLA 3V0WH 4RIRB 1G7MA 1RFDH 5BQ7B 3HPLB 5C2BH 2AJYL 2HTLD 1S9VA 4HWEH 3KPSE 4I1NB 2IBBA 4R0LC 3RJQB 2D3VA 1PKQE 5HGAA 1CICB 1IGTA 3PP4H 5T1KD 5FOBB 4NJ9L 4PG2C 3V0WL 2HT4D 1WBZB 3U48A 2PYEA 3VFRB 1JF6A 4FTVE 2EH7H 4WO4B 4YDLB 3ARRA 1KPVA 3IU3A 1T3FB 1A7BA 3PJSA 1NBYA 3KPOB 2IADB 3TZVB 3MRMB 1IM9B 2VDNL 5IVXA 3LS5L 4FFZH 4Y5VB 3G5YB 2VN4A 3NIDF 4OQ1A 1B4RA 2FSEB 1QRNB 1ZT7B 4NJAH 5DFTA 3C60D 1U8NA 5TDNA 4PJIA 5HYJB 5IMOB 4P46D 3OF6D 3L3HB 1RUPL 2LAGB 4X7FC 3DO3A 1CVSC 3ETBF 2WLYA 2OYPA 5DS8B 5INCA 1JHLH 3HS0B 5T1LD 4N0UE 4HLZH 2ZOLA 5FYLL 4NQED 2BVUA 4QRPE 3WXWL 3BIBX 1XIWB 4NZJA 1F6FB 2OTWB 3U1SH 4AEEA 1DEDA 1B90A 4CN1A 3MFFA 3ES6A 1S9XA 3MGTA 3IVKB 3SY0A 1A5FL 1DP0A 1KJMA 3EOBB 1WT5C 2CGRL 4LLQB 2VH5H 1EEYB 4NNXB 3FHAA 4GUPB 2AXHA 1CFVL 4QF1B 1LVEA 2NPLX 3D1MC 1FNEA 3OKOB 3N1PC 4GRLA 2BNRD 4P3CH 5F8QC 3AS0A 4KRPD 4OLVL 1LO4H 1Q94B 2YWYA 4OUOA 4XNZC 5DVMA 4LKCB 5GGVH 1IE5A 4NKMB 3C6LC 4ZTPL 3WE6B 4U31A 3AU1A 3ZKNC 2JTDA 5MHSE 4MVBC 4ZUWA 4RIRA 4R96A 1S5HA 4U6YA 4WNQA 4OQTH 1IAIL 3RWGB 2NY6B 3OGCA 3SGJA 2E7LA 3LV3B 3AB0B 1G9ML 4EIZC 2YXMA 2JIXD 4CVXA 2GJ6E 1HE7A 2WUCL 4EQ3A 8FABB 3IJSB 4JJ5B 2UZIL 2YUWA 2GFBB 3S4SB 2O5XH 2V17H 1GC1H 5FYJL 2DL2A 5A40E 1KELH 2LU3A 4PY7B 1WAAE 5MENA 3VFOA 4W70A 4GW4A 1X6LA 1D6EB 1MEXH 2BHUA 3JV4B 1V3LA 1MJJB 3TPUB 5D1XC 3U9UB 3MQIA 4B7LA 3IAPA 2PXYB 3V9FA 4AIZA 4MLIA 4K8RL 3X3FH 2G2RB 5C0AE 4MA1C 2W92A 5EN2A 3QQNA 1NEZG 3ULSA 1ACYL 5DZNA 3S34L 3RZWA 3S6CA 4A6YL 4LPUA 5BOZG 5BZDA 1WIPA 5I15L 1YJDL 5B4MD 3B2UC 3FB6B 4E5XB 2Z4QB 2DMBA 2Q7NA 1QPXA 5E6IB 3FO2A 2OP4H 4JZNB 3N9GL 1GPOL 3IAQA 2Q8BH 1IRAY 1JVKA 3GIVA 3W0WB 2Z91A 2IJ0C 1UXSB 4E41E 1A7QH 2GUOB 2FCBA 4Y16B 5JIPA 5F93C 4WRLA 3OG6B 3DURB 4JAMA 1T7XA 1U8LB 3C87A 3JV5A 5IHUL 2W0FB 3HE6C 4QRRD 3LRSB 1FL3B 2V2WA 4PJ7B 2XWBB 3FFDA 4WENB 3ILQD 2J8UA 2EDDA 2ZSVB 2YKLL 2HWZL 1W8NA 3ARWA 4HKJA 5C0RL 1KXVC 3HKFA 5JMOC 3BPCA 3I2CL 5IW1B 2KQMA 3LB6D 2VABB 4F37K 4JZJC 4NQVA 1HH6B 4ELKA 4HQQH 5IF0A 4HCRL 4WHYG 4DN4H 2Q76A 3P11L 4Q2ZA 1B0RB 4XMLL 4UIKH 3E6HA 4YHNA 1QNZL 3SDYH 3D2UD 3KLAB 2X1QA 5E00B 1F42A 4DGYL 5HGBA 5CZXD 3DIFB 4HGWB 1K85A 4Y4KB 1MJ8L 4NHUA 4JQIH 4TUKL 5I1HH 4PRPE 4KJPD 3D0VA 3SKOA 1HHGA 1W72A 3H0TA 1RVFH 5HHME 4JG0H 1DBJL 2HKFH 5JLZA 5IBLD 3LD8B 4NCC1 5BS0A 2Y25A 3DARA 1JZ5A 4YQXL 4TUOB 5C6TH 3PWLB 3PWPA 4WFGE 1O5DT 2G5RA 3GI8H 3OB8A 3DO7A 3WO4B 1KEGH 4CUCA 4JZOA 4LCWA 4Y4HC 2F19H 3K8MA 4KK8D 2L4OA 5L6YH 1CLZL 1RK1A 4GW5B 3VXME 4XXCA 5GGRY 3FQWB 2OTUA 1A3LH 2A6KB 3L6FB 4HKXA 2XWTA 4B53A 1HINL 2Z35B 4OB5H 3KS0J 5IMLA 1YEGL 4JFOB 5C92A 3BDBA 4XP4L 3DETC 1UH3A 2UVEA 3FT3A 1G9MH 4ZFOL 4L9LB 4QOKE 2VDQL 1U8PB 4LIQE 3IDGA 3MV8B 1WCBA 5DEFA 1Q94A 3ET9F 4TUJB 4NN6B 1CL7I 4N5ED 1NBZA 3F5WB 1U3JA 5IWLA 4X6CF 2R29L 4HEME 5DO2C 5FYJH 3KG5A 1M05A 4G42B 1A3QA 1M4KA 2GJ6D 5T5FH 3V52H 4Y1AD 3ULUE 5JQ6H 1MLBB 3HNVH 1NAMH 2AK4D 3RUGA 1R3HA 3X13A 4YHZH 5IEKB 2BVYA 1EEQA 5CEZE 5B39B 1ORQA 1CL7H 2PO6C 4HLJA 3HC3H 2OR8A 3MBXH 4RX4D 3Q6GH 2WBJC 2DQHL 1MCQA 4NUJA 5ILTL 4Q9QL 1NH6A 4WDIB 3IU4L 1UH2A 2F5AL 2GFBA 3MV9D 4ZUUA 5I8OL 3VRJB 4RISL 5FKAA 1GZQA 1HHGB 1W72B 5KG9B 1TCRB 4CU6A 4QRRB 5DDHA 1N2RA 2OP4L 3X12B 5D2LA 5DURD 15C8H 2PXYC 5IBTL 4TSBL 4NWTH 2HP4A 2E7BA 5T1KA 1NFIA 2J12B 1EPFA 3VG9B 3MLUH 3SKMB 5IKCB 2Q6WB 4BFIA 5DJYA 5DYOB 4D0CB 4XGZA 1FYTD 1KB9J 2HRPH 3UAJD 4PGEB 3GJFK 1RMFH 3CU7A 2GCYA 5IHUH 3BW9B 3KYOB 4EDXB 4QRPD 1T0PB 3CDGA 4ZS7L 5F7YC 5EC2B 2AXGA 4X4MA 4PPTA 3U9PH 2MJWA 3ELAT 4G6KL 1MCWW 1UZ8A 3MYJA 4AZ8A 1I1AC 4K71B 2Z91B 1R3KA 4WUUA 5FYLE 3U0WH 2XPGA 5GRJL 1CR9H 4X4ZA 4G8GB 1C1EH 5TPWH 2X41A 5FF6B 5L88L 1FGNL 1LO3H 2YPLB 3KPSB 4K3JH 1YEFL 4L9LA 5FYJU 4CGTA 4DTGL 4BUGA 2V5MA 4J8RA 1CBVH 3GSXB 4EUPA 2DQGL 5D7LB 3U4BL 4OCRH 4JFDB 3O45A 4BH7A 3LN9A 5D6DA 3CH1A 5CCKL 1T0MB 3ZHLA 2XWBA 3FFDB 3VXRA 3UPAA 1A21A 4FHBD 2VZSA 1E6JL 1HHIB 2C3GA 3RJDA 3ARQA 3QRGL 1I7TA 1RK0B 1MJ8H 5I1KH 4MQ7B 4M3KB 2M26A 1MLBA 4XTRD 1S78D 5BJTB 4JZJB 3NFPB 4OZIA 2L7UA 5B39A 3VXSA 3CSGA 3DPBA 3MRIB 4RAVB 2ZWLT 1DUYA 5IQ7L 1HH6A 4XX1E 1G7IB 1T1WB 4MNGE 3NA9H 3VMNA 2EYRA 2OSLB 5ESAA 1LP9E 4QY8B 2QHLA 5E8EB 2FL5B 3P4NA 1I3RA 4UILH 1F4WL 1T80A 3MLWH 1P1ZB 1HOCA 4OF5A 4JM2F 5E9DB 3KLHD 2HVJB 1HYSC 1BOGA 4JHBA 1S9YA 3T0XA 1OP5K 4PJ9D 3SPVA 4FQIH 1KTLB 3N1MC 3LD8C 4HZLB 4RAUB 1MJUL 1U8QB 3D85D 1BP3B 1F3JB 2NY2D 2YA2A 3IFOA 3TIDB 1ZTXH 1R24B 2CLRB 2R4RH 1FQ9C 4UTBH 4NT6A 3AREB 1DJSA 1H8NA 2Q1EA 3RWEA 3E3QC 3TZVD 1ZHLB 3PHQA 4JRYD 4KHXH 1NCWH 4J7RA 4M48L 4N9OB 3MC0A 3HE7C 5FYKH 3QYCA 3FAXA 4C4KT 4NZDA 3LMJL 4YXHH 2YPLD 2ZJSL 4U6VL 4X6EB 3EHBC 3TO4C 4I3SH 4H8WC 5FGBA 1BM3H 3S35X 5EDXA 4RZCA 5CILH 4YXKH 1BQSA 35C8H 3HCVA 3QISA 1B6UA 3A6OA 2VNCA 1FIEA 4PTTB 3L5IA 3RPKA 4H0HB 1NGXA 2F8VA 4ZFGL 3BP7B 4XPGH 4CVZA 1IEBA 1T21A 4KTDH 1E27B 4WO4D 4LBEA 1S7SB 3MMEB 4YFLF 32C2A 1FFOB 5D7KD 4F37F 4FZEL 4GAJH 3ZE0F 3RX5A 4GQ9H 4ERSL 4NOFA 4KJQC 3O2WH 4P57A 5ESQB 4C56E 2PO6B 2YZ8A 4OZ4A 5GRUL 4PJCB 2QADC 3ZDYE 4UQ2A 3RTQC 4KJYB 1C5CH 4NUGH 2X4UB 3HUJB 5LWYH 3MLXH 3GNML 3T0EA 3MRFA 3V5DA 3I3BA 3A6CL 2DOCA 4N1CA 4KDWA 4TNWF 1DDHA 4ZPVB 2FNBA 5C0NC 5I17B 1TCMA 3WO3B 3DMMD 5CEYB 1OWRM 4FQ1H 4HUXB 5IVZA 3BISA 3O4LA 3S36X 2NNAA 3T2PA 1N6UA 1ZVYA 1U8QA 3RY5A 3RKPA 4OLUH 3EO0A 1LMKA 2FGZA 3MRBA 1AC0A 5IB2B 4X7TB 4Y0GA 3ZE1F 3AREA 1YZZA 4Z7NE 4ZNCD 3IRPX 5DJYB 3IDYB 4P5KA 1X44A 2Y07H 2ATPA 3MRDB 1GH7A 3U4BH 3QQ4A 4Z7UB 4L8BB 5DUBB 1DTUA 1FFQA 4F2MB 1OAKH 3C8KB 5HVGB 1EHLH 5EC2A 4CU7A 1LP9B 2JELL 2APBA 4K71C 4Y4FA 2OMNA 2O5YL 1FDLL 4ZAKD 1FCCA 2ADFH 1J1XL 3ZTJG 4M7LT 3KNBB 3FO0L 2OTPA 1EJ6A 2J6EL 3QJHA 1LHZA 2AI0L 1LILA 4Z95L 2AV7A 5DRZB 3D39B 3S35H 1D9KD 3T4YB 4PRIB 4ELMA 5IQ7H 1NDMB 4RBPK 5JDSA 4JFDA 2PW2A 1RZIA 3MA9L 5HY9A 1M71B 4K2UH 4XRCA 4S1SL 4AMKL 4QF1A 1BQUA 1V7MH 3GSNB 4GSDL 4TSAL 4XP4H 4M5YL 4M1CC 5AAMA 2PUQT 3MNVA 1JZ3A 4WU5B 3FQUA 3VXUE 4HS6A 5A2JH 4I48A 3ZDZF 4XPAL 3ZSSA 3OKDA 4P23C 1U3HA 5DK0A 3OJ2C 2F8XC 4JR9H 4M7JL 3UJJH 3ARSA 4PGBB 4XBGA 1CT8B 3NCJH 5T5FL 3V52L 3C2SA 2R69L 1OAQL 4M9OA 1ES0B 2KUTA 2VR9A 5EOCH 3BDYH 4GKNB 4ONHB 3OKMA 1D6VH 2BCKB 1IC7L 3BPLB 4NQDB 4PP2A 1MHHB 5DC0A 1FZKB 5C9JA 1SEBA 5TDOB 2ZZUT 3CXHJ 2HFGL 2D7PA 2NCMA 4HFUL 1AFVH 1CDJA 3GMMA 1YEHL 3PGCB 2BSTB 1HKFA 2Y36H 5D2NE 3NGBB 2HKHL 4FRWA 4BSVB 1S3KL 5I74C 4H0IA 4OCYH 3ULVC 3LKRA 2EIEA 4QRRE 3BH8A 2XN9D 3S88L 4YFLI 3KS0H 4AG4L 3TCXA 2X4RB 1AFVL 4TRPH 3QIBA 4H25A 1YEIL 2HFEA 5IBTH 4WY7H 1MHEA 5A43C 2P7TA 2NY1D 4XP1H 3B8YA 3VFNB 3V4PL 2D7OA 2EIZA 2H2SD 3PWUB 4L8SA 3VXQB 3SCMB 3O3EB 2VXQL 5GS1A 5ANME 2ZKHH 1X5JA 2YPKB 1L0QA 5C07B 1NFDA 3QAZC 4WFED 1MCSA 1VFBB 3HZKA 1DBAH 3QWRA 3BAEH 3V5KB 2W07A 4OI7A 5JORA 1ACZA 1A1OB 1M71A 5HBBA 2NQCA 1I3GL 4JFYB 2UYLA 1G7HB 3EIFA 4CVUA 2F5BL 3O2DH 5ID1B 2VXVH 3TIEB 3WL9B 1PSKH 3DUSB 3BPNB 2KL6A 5L88H 1Q9WB 4JG0L 2CDEB 5TJWK 2PXYD 3TT1H 5EUKA 4MDJB 2QADB 4Y7MA 1U92A 3VGBA 1YQVL 1K4CB 3IF1A 5F7UA 5F7HA 1KPRA 1OW0C 1MFEL 5TGBB 4Z7OF 5C2UB 4PLKD 6FABH 4NM8L 1JMXA 4UAOB 4MNQB 1T7WA 1FIGL 3LKSB 1MHHA 1SEQL 4HJJL 4HWZB 1NANH 5CEYA 1WAAF 5GS0H 1J1OH 5IEHA 1XF3B 3ME0A 3ZYOA 5EIIA 3TH4T 4WWID 1I1RA 3GMRA 4PGZA 1C08A 1Q9LB 2YEZA 6FABL 1ZHKB 4PRDB 4JQVC 1L7IH 2IPUG 2BFVL 1FVCB 1WIUA 5DD0L 1ZLVK 4Q9BA 3HNTL 1ZHNA 5FYJE 3SKOB 2O61B 4G6ML 2VXUH 2FEEI 3T2OA 3UBXA 1P4BH 4X98B 2DIJA 2W9EL 3E2HB 2BNRE 5B38B 1JFQL 4OLXH 4LSPH 4MMXC 4MXVE 4L4VB 1HZHH 4YEEA 5HYSB 5CGYD 1X7QA 4F7CB 3QWOB 5IJVA 4P4KA 1U9KA 4ODXB 4Z0BH 4NQEB 5F72S 5L0QB 4LEXH 4OCLC 1FNGB 3VJ6A 1P7QB 1ACYH 1MY7A 4DZ8B 4Z6AT 5KSUB 1IT9L 1VFBA 4FOMA 5D2NB 1FAKT 2A9NH 1M1SA 4KMTL 4YO0B 5I1JH 1EHXA 3W11D 1MCIA 2CLZA 4ALAH 4LSSH 2PKDA 4POZD 3TT3H 4F7TA 5CINH 4ZXBC 3GMQB 1L4IA 4S10A 3SOBL 5KVDH 2D31A 2YUVA 5DJDA 1JPTL 2DIBA 4HUNB 2CDEA 4BUHA 2HTLC 1F3RB 3F62A 1IBGH 3C5SA 5ALCL 5IW6B 1K4CA 4TVPD 3MRMA 1MCJA 1AHWA 1BX2B 2V2XB 5DK0B 2DQJH 2FSEA 3D25A 2HKHH 3OXSB 1J0JA 4EI5A 4FFVC 1HHKB 1A7PL 1HSAA 1NEZA 4YR6A 2I9TA 2FGWH 1CK0H 2O5ZL 1CE6A 4ZFFA 1YEIH 1QFUH 1KJVB 4WY7L 4GG6B 1G7JA 3ES6B 1OHQA 2H32A 5EBWB 3WKNA 3GSQB 3QXDA 1X5AA 2FECL 3S9DB 5T3ZH 3TYFA 1FVDA 3B9AA 2FJGB 4M6ML 4U1SB 1CFTA 1IARB 1TCRA 5AWNL 4S1RH 4OLZH 3EZJB 3IFNH 4QWWC 3RIAK 1MEXL 4JO4H 2DDQL 5T1KB 1QRNA 4F7CA 4ONFL 4WJ5B 2CMRL 2WBJD 2WSKA 4FQCL 4JLRB 3GSWB 3GSNH 5F9WC 1R5WB 4HHAB 2IG2L 2CRZA 2PYEE 3QAZB 3W5NA 3CXDL 1OAUL 3RWFB 4HGKC 4YO0A 3CDFA 4U33A 3VCLB 2H8PB 3MRCA 2IPKB 4PJ9B 3QUXD 5E2WL 4UNVA 4RSVA 1JPGB 1YMMD 2DI9A 2H2PD 4KRMB 4PRBB 1X5YA 1AGCA 2Z93A 3K0WA 2IALA 4M5ZL 3CXDH 3T3PE 2D31B 1YN7B 2ZCKL 2DLFL 5DMKB 5FF6A 4I8DA 2OX5A 5ID1A 4U1NA 1EEZA 3WFEH 3BFOA 4KRPB 4UQ3B 4PD4K 2H6PA 1Y6MR 1V3JA 1ZWIB 2PYFB 3WLWD 5GGUA 5GRVL 3VXRB 3QEHA 1IC4L 4J4PA 5CIPB 1UH4A 2ZUQC 3KPTA 2E9WA 3UAJC 1RK0A 1S5HB 4U6YB 3WD5H 5KW9L 3TA3A 1ZVSA 3DVNB 2OR7A 2A77L 4QRPB 2MFNA 1OLLA 4LSVL 5D2LE 1L9MA 3ILPA 3MRPA 3OR6A 4JG1H 5IV2B 3QEUB 1AKJA 3AY4C 5EBWA 5JXED 4JFFB 4HKZA 3F12A 2NY3B 2H2SC 2ZJSH 5CJOH 5LBSH 3GIVB 1WK0A 3D69A 4UDTA 5MEPA 4UIMB 4W6XB 5JXEA 1WBXB 2HYMA 2QLVB 3BGMA 3UTOA 4DGVH 3HG1D 4KROB 5CJOL 5LBSL 1QO3A 1NGYA 2Y5EA 3CFJB 5DJXB 4X4ME 4CADB 2GW5A 2B4CL 2CR6A 5C0GB 5DQDL 5HI4C 3V6FA 3WSQL 4PREA 2WMPA 5BXFA 3ZTJH 1CVRA 5BVJA 2LE9A 1LD9A 3AS3A 4ODVH 3EOTL 1LEKB 3DV4B 5IM7A 3NABH 3B3IA 5JTWA 3LKPB 4JVPA 5C07E 5SV3A 3S5LB 5ANMB 4R90H 1UXSA 1YYLL 1ERNA 1I4FB 2GITA 4NSKA 3VXRE 3F58L 1WC7B 3JTSA 4U1IB 3H2WA 3G9VA 4U1NB 3QNYB 4G9FD 5DJDB 5DK2B 4FZ8H 1N3NB 4EUPG 1DSFH 1MCEA 5C0EB 1WWAX 3SDAD 2D0FA 1JGEB 3VWKA 3MRQA 3RL2A 1HHJA 4DK3A 2AQ1A 1B0GA 2IPUK 1UCBL 4LBEB 4HXAH 1LO2L 3NFNB 1NCCL 5F9DC 3TA3B 3FMGH 2NY7L 2Z31C 1BFVH 2XY1A 4FABL 1QKZL 3OKYA 4YGVA 5CD5D 4I4WA 4R7DA 3ARDB 3MLTA 4DKEH 5IB4A 3P0YH 2MQ3A 5FGCB 3QNZB 2VC2L 4F58H 4JFDE 1JPSH 3GBMH 3L5WB 4HBCL 1H8OA 2VL5B 3IDJB 4LCCB 1CG9B 4QRTB 1DDHB 1A8JH 2YPLE 4ZPVA 3H3PH 1QQDA 3WFBH 5IMLB 1MFEH 3CUPB 2EDKA 2YD3A 5D1QC 4LSTL 1KTKE 4J12A 1D9KC 1B2WH 1ZHBB 3V7AE 5C6TL 4X8JA 4PD4J 4NDMB 1KCSL 1DEEA 1XCQB 1J0HA 1KENL 1IAOB 4MQXD 4EVNA 4TQEH 3DO7B 2X7LB 4MAYA 4L29B 4MB3A 2NLJA 1P4BL 3MLVL 1OTTD 4O2CB 1QYGL 1S7UA 3D0LB 1UZ6F 2YXFA 1AXTH 2BNQB 1LE9A 4L8BA 1RK1B 3UTSD 5TE6H 5E99L 3TBSA 2SEBA 2BMKB 3G5VB 2E27L 3VDCA 1A6WL 1VEOA 2CDGB 2IPKA 5FK9B 1I4FA 4NSKB 5ABDE 1YEGH 3DYPA 5ADPH 1XF5B 4WWKD 4O2FB 1AH1A 3K4AA 2X09A 4YHIA 3CMOL 5GGTL 3GJFA 5ITBH 4ZUUB 4PJEF 3DOSA 1MWAL 3MV8A 1T3FA 4CAGA 1NCBL 3P9LA 5FO7B 1N2RB 4PB0H 2DM2A 1JI1A 5ENWA 2NY1B 2CR3A 5HYQB 1HCVA 5JHLH 4CU8A 1DCLA 3MGOA 4QYOA 3UJTL 4BZ2H 5AG8A 4GAGH 1K9TA 4NRZA 3BH9B 3ORJA 3DI3B 3OJVC 5F7EL 1TQBB 5C07D 4FQHB 4LK4A 4Q0XL 4Q6IB 3VH8A 1HDMB 2AEQL 4KI5C 3QNZA 1ORQB 4W4NA 3Q6GL 4APQD 7CGTA 4GXVL 3HTLX 1YC8A 3GMLB 1KACB 3SGJC 2M8XA 3NZ8A 1RUMH 3QZWA 5FCUL 1DQLL 5F1SA 5HPMA 2N1KA 1RUAL 3HNSL 3CX2A 3FT4B 4R3SA 5FDYA 4JFFA 3THML 1MFAH 1ES0A 3M8OL 2H26A 4MAUL 4BQ9A 1ONQB 5JW4Q 3IETB 4YHOH 2QR0B 5D70L 1AGDB 1WBXA 4LLUB 1H3XA 1TTUA 5I1GH 1PW3A 2R0LH 1NGWA 2VXTL 4ZTOH 1CTNA 1J5OL 1MCOL 4MJIE 4P4RA 3RI5K 3VXMB 1OT1A 1GGBH 4JB9L 1LDPL 1T20B 3FFCA 3W82A 3L3KB 2VZ3A 2X7LA 1YDPB 2V5RA 3IT8D 4XHQA 3OMZA 4PREB 1I7TB 3PP3K 1P4LA 3KPQB 4XWGL 5I1AB 5DWUH 2DN7A 1DUZA 1LDPH 5IW3A 3O6FC 3CLFH 1IC5L 5K9JL 1NSNH 4WW2A 3DXAE 5EPMB 5GSRA 4IBLT 4PGDB 3ZHKA 2G5BB 5BRZB 3BKYH 2MOVA 2IG2H 4YHKL 3S4SA 3BEVA 3L3DA 5IROA 1ND0B 4KK5D 4FXGA 3CFEA 2PW1A 4FNLL 2EC8A 1S78C 4Q9RL 4HUUA 5D7JB 4XPHL 1S7TB 3T4AB 4MA8H 1KCVH 4YC2C 1RZJC 5EO0B 1QBBA 5I73C 1KCLA 1RJZB 2VOTA 5D5MA 3MRJB 2WV3A 3VE0B 4QTIH 2DB8A 3PABB 2G9HA 5D6CB 1D5ZA 2DQTH 4XPHH 4ZO8A 5C6PB 3QDME 1AR1C 4MAYC 3ZE2F 3OJDA 4JEGB 1FLRH 3KYKH 3QUMB 1Z2KA 2NR6C 3VXSB 2VN7A 3QUZC 1B2WL 5DVNA 5IB4B 2JJUA 4U1HB 4F7MA 3LPGA 4Y1AA 1T7ZA 3WYRA 5CEZH 3HE7A 1AGFA 2ADGA 4UT6H 3TJHC 4DVRH 3FT4A 1UB6A 4HIHB 4J3WA 3W0WA 4LKXA 4LPXA 5FUOH 4DGYH 2R39A 1PGRB 1FC1A 3SQOL 5SWSB 3NCBB 5IGXL 5T3ZE 4UMGA 1U6AL 4HWZA 3P0VL 3U82B 3O0RH 1OGTB 4HCRA 2E27H 4XNYL 4ZQKA 2FD6H 3MUJA 2W0FA 2Q87A 1DBJH 1ZHBA 3B2VH 4HAGA 5D96B 3ROOA 1T2XA 2P49B 3FQTB 4PJDE 3MROB 5DO2D 1GIGH 5E08L 1QRKA 3V6ZA 1F13A 2JF1A 5DA0B 3SO3C 1XF4A 2I07B 4OCYL 4P2CG 4JANB 3X14A 1MCDA 3J8F7 1NFKA 1PZUB 5T3ZD 4RGMC 4XCFH 4OZ4B 5IJVB 3R8BB 3BN3B 5DSCA 4QHMA 1BVLB 2WUCH 1DANU 4DCQB 4RFEB 5T1DH 4S0SD 3WN5B 2JIXA 3FTGA 5K59F 1DBBL 5JZ7C 3TWCH 4X5XA 1BFTA 1TETL 2W1NA 5DMJB 2D0HA 4ZO6A 1UWXK 4ODUA 5LQBL 3PNWB 2PF6A 2NY1C 4X99B 5J8OA 3TBTB 1N7MH 1F00I 4JHWL 4PV9B 5KTEL 4N5EC 3IDMA 4G9FA 4LRNH 3RTQD 2YUZA 3JWOH 4Z7OE 4P5KB 5B8CC 2OCFD 1U0QA 2P8PA 4GRWB 1AGFB 2ADGB 1HQ4A 5J6GA 4X9FA 1CIUA 1GVIA 1CLOL 4Z0XB 1PEWA 2P5EE 4DUWA 1OB1A 3LQAH 1FJ1B 4L4JA 4AEHH 4K55A 2JLLA 4OAWB 5JW5B 2R69H 1UFUA 4MJ6B 4YDVA 1CXKA 3MJ8B 3PDOA 2C3WA 3SJVB 3FQXA 5F6HI 3TGXA 2WWMC 3GSRB 2VC2H 3QQ3A 3A6BH 4ZQKB 4K8RH 1U8OA 3INUL 2E8YA 5IB3B 4J3VA 2P45B 4Z5RB 2IQ9H 5I1CL 1L9NA 1TJGL 4OD1L 3V2AR 3NCMA 4JQVA 5HY9B 5JMRA 3V6OE 3VXNA 5AG9A 3OTTA 1TTFA 3C09C 4PLJC 4L3ED 3WFBL 1AXIB 3BP5A 3X14B 5DJ6B 3T3MF 4MA8L 3LKQB 5J57B 1JGLH 5DUBA 1X5KA 4X9IA 3UDWC 3ZL4H 4JFHE 2BNUA 5IEKA 3U0PB 4E9LA 2X70B 4HH8A 2XKSA 2GK0B 4NO0A 2IPTH 4XBPA 5CEXB 3BJLA 1AXTL 4G8EA 4CW1A 2FATH 4PRIE 2DF3A 5KJRL 1LE5A 1NLBH 1QEWB 2R0ZH 2GJZA 3H9SD 3OKMB 4UINL 2PW1B 3QNXB 4PJXA 3QPQC 3LS5H 4PJBE 1I3VA 3T4AA 1YEJH 4YIQB 3JXAA 1JRHL 4P23D 2EIDA 3LQAC 1SBBA 4I0PD 3DX9B 2AV1B 3LH2H 5D5MB 4M1CD 3O3BA 2GJJA 4PJBB 2P47B 4PJ8C 2N4IA 3PABA 3CMOH 4MCYA 5GGTH 3ZKMC 4PG9A 4Q74A 1BF2A 2R9HD 1NBYB 1IGIL 5D7IE 4D0CA 4DVBB 3CX5K 3OKEA 4KGJA 1GGTA 3C60B 4Z0XA 4PJFB 1RZJH 5TDNB 2HFEB 4OJFH 1KIRB 4JFPA 3QXVA 2EXWD 1Z9SA 1LK2A 3PDGA 2C3HA 5DD3H 2RFXA 2NX5D 3K2UL 4ODVL 3Q1SL 3ZDZE 2N7AA 4R26L 1XIWA 2DBLL 4OIAA 1CGUA 4GMTH 4H88L 2ESVA 3STLB 3UTSE 4P3DB 4FQJH 4EI6B 3GJEB 3IS1X 1CK0L 4XPFL 4X6CB 1U36A 3PGCA 4PBXA 1ODAA 3STBA 4F15B 3FQTA 2OK0L 1YNLH 3IDNA 3LEXB 5FYKD 5DD1L 1F8TH 1WQVT 3V6ZB 4UU9A 4XNMA 4YHML 2XN9B 2DAVA 1YMHB 2DMCA 2FHFA 1Y18A 1NMAH 1SYVA 2DWDB 4UV4L 5ETUA 2C4FU 1NGYB 4D9QD 3U0PA 2AP2A 3CPLB 5BS0D 4MDJA 3P9MA 1MAJA 5JXEC 2UZIH 4KUCD 5IJKA 4XPTH 1N7ML 4UUJA 4KUZH 1JUFA 4B41A 4HLZG 4S2SB 5GS1B 2VZUA 2KZWA 1EJOH 2OS7A 1QKZH 2MCG1 4DTGH 4I3SL 2YPKA 5E8EA 1CGTA 4HH9A 3FB7B 2Y5TB 4MB5A 3HZKB 3T3PF 4R6UA 4R4BA 3JUYA 4MA3B 3WN5A 2VLLB 1UVQA 3FOMB 4OLEA 1OTUC 4OM1H 4R0LA 1PY4A 3P0GB 3RHWK 3W0WD 4OGXL 2GTWA 4JFYA 3QDMA 4JFED 3ARZA 3OL2A 4NRYB 2AXJA 3RGVB 4HDIA 1E6OH 3H7BA 3E3QE 2D03L 3CFIC 3O8XB 4D9RE 3MNWB 5E2JA 4JM4H 1T66D 1A3RH 2R1WA 1S7WA 3E8UL 4U1GC 3JWDL 2VDLH 3QUYA 4ETQB 2E6JA 1I9RH 1JV5B 3PP4L 4LU5L 5D2LF 4TTGA 5CZVL 1KJ3L 4Z7UF 1AIFA 3HAEG 1OTTC 2IF7A 1T04A 2O93L 1T5WA 1FN4A 1H9VA 4PV8B 3O9WC 2WWKO 3GUTA 2VQUA 3G08B 1I9RL 4LU5H 1INQA 3VFGH 4X6CA 5F6IB 2FIKA 3S37L 1C08B 1Q9LA 2YEZB 2VL5A 2FHCA 4DVRL 2VZTA 1IAIM 4R8WH 1QQDB 1ORSB 1QR4A 3UC0L 2JB5H 3WLBA 5D93B 4XPBH 3EDFA 3CUPA 3GK8L 5IG7B 3DURA 4JAMB 1Y18B 3VI3F 1T1ZB 1OSPL 1HNFA 2CJUH 5CP3H 1FNEB 3OKOA 4X8JB 3B6SB 5B38G 4LVOC 5D71L 1FYTB 1F4XL 3QPXL 5I1LB 2HT4C 3LN4A 3QFDA 3OV6A 1H15B 1XZ0B 5CILL 2ICWI 4CRPA 2B20A 2ED7A 2IH3A 2ZOKB 3O4OB 4R2GC 2FR4A 4XHJD 5FECA 4OSUH 4YEFA 2PCPB 5ADOH 4U0RB 1V3MA 4APQB 4OCRL 3BJ91 5IHZB 2IFFH 3EFDL 3RA7H 3BQUB 4I2XA 4JPKH 4MS8D 3D5OF 1SEQH 4NN5B 4YIQA 1VACB 4Q2ZB 1UWGL 1H5BB 3DX9A 3O4LD 4JJ5A 2IC2A 3BT2H 5IB1B 3DLQR 4K3EL 3IB4A 3BZEB 4HIEA 5IFHL 1FVDB 1DFBH 4O51A 4DJMA 3OKNB 5LGKA 2G60H 1Z5LB 1JK8B 2OL3A 4FFYL 4ETQA 3ARFA 1N0LA 2DLTA 5FUCC 4B0MM 4XNQB 3PWLA 2PXYA 4AIZB 1XGQA 2Y4SA 1R3IH 2FGWL 3DX6B 4QRQB 3O2VH 2XWJA 2B0SL 4CNIA 2NY3D 1YEEL 2XKNB 2HJFB 4RWHA 2F15A 4GW5A 1EV2E 1T89C 5IVOA 3MRCB 3KJ6L 5EZOL 5CMAA 1EHAA 2A9NL 3O6KH 4V1DA 3V95A 2AGJL 1OCWL 3MSPA 2VQTA 3H9YA 4JZNA 1G6VK 4F15C 4NCC2 2F54A 4PJHB 4JN1L 2E7HA 5DRXA 2EC9U 3SJVE 4F80A 3BZFB 3ARGC 1PD6A 2HLFC 1UM6L 4P3WA 5JQ6L 2CO7B 1HXYA 4IMLB 4U7SA 1U2CA 3DV6B 3HMXL 3FO1B 3GI9L 1AD9B 5I6XC 3D3VB 4ZYKB 5FA4A 1AQKH 4OZHE 3VI4E 1SM3H 5I8OH 4YH6A 3GHEH 4OCSH 1G7QA 3SDDC 1ROWA 3GBNL 1BEYH 1U42A 5H8DA 2VXQH 4TULH 1INEL 4HKJB 4RBPH 3S7GA 1EBAA 3FT2A 5DMIL 4NQVB 3WLWC 3V79C 2KBGA 4RWYH 4HKZB 5C0RH 1XGRA 3T0DA 3RZCD 1EEZB 4LIQH 2ESVD 4Y19E 1J8HB 1PX3A 1RUPH 3CCHA 2MPAL 4J6RL 5E56A 2NXZB 3DROA 4XP5H 1NJ9A 3STZA 3ARFB 3D0VB 3C6LB 4S1RL 2VISB 3H9SE 1Y6NR 1TQCC 3VXUB 2XYCA 3VRLF 1JWMB 4NZTH 1FE8H 3M17A 4ZMAT 3MUHL 4DN4L 3NZHL 4G6FB 1DL7H 2CUHA 1TLKA 4KDTA 4NM8H 1BIHA 1MELA 3FONA 3GMPA 2EDFA 5KN5B 5F7EH 1CFVH 1LD9B 1V3KA 4KI5D 3RIFF 2I27N 4M62L 5CMAB 4GRLC 4XCNB 3G5XB 1NAMB 3MOAL 3F12B 1FYHB 3GKZA 2XG5A 1JPSL 2GT9B 2IMMA 1YPZE 3GBML 1RULL 3FQWA 4RMRA 1KEGL 2FB4H 2BERA 3M45A 5GGVY 1GGIL 2YD2A 3F7RA 1KN2H 3MR9B 2HFFA 4WHTA 1NMCB 4JPWL 3REVA 5ADOL 3JTSB 3H9ZA 1HI6A 5EU4B 3UO1H 4K2UL 3CVIL 3SDCD 3MLRL 4I5BA 4KKLD 5HD8C 3HG1B 3WEXB 1G9NH 5DK2A 3RAJH 3K8LA 1PG7H 4I0PB 1PZ5B 4M4RA 1EUTA 4ZTOL 1AD9A 2HN7A 4Y4FC 3WIFA 3BHBB 3GIZL 3MODL 1EXUB 1FH5H 4F9PA 3MROA 4G8IB 4R2GB 4YHMH 2EECA 2OK0H 3BWAA 4U0RC 1KPRB 4I77L 2I07A 1BQHG 4LLVB 3KXFE 4V1DE 3ROLB 1LEKA 2BP3A 1I7RA 1IGJB 4DFIA 4LRIC 2LQRA 1M7IA 4JJHA 3AXLB 1HXMA 1KFAH 3QA3A 1A2YA 1Z6JT 3PQYD 3SE3C 2CRMA 2GITB 3QDJA 2NXYC 3ARBD 1QBMH 4BFGA 1XGRB 2V9RA 1ZMYA 1P9MC 5E9DD 5HVHC 4TSAH 4X80H 4MQXC 1HQRB 4JRWA 1TMCB 4U6XA 4X9GA 4KKAC 3QDJD 3VMPA 1LK3H 2PR4L 1DE4A 4OZFG 3DROB 4JRXD 4XPAH 4NFBA 2E7MA 1H8SA 1RIVL 1P84J 2X1WL 4JR9L 2GK2A 3BYTA 3VFUB 5KVEH 2X4NA 1NCBH 4HAFA 3ZE2E 4Q9CA 1IM9A 1OARL 1JHTA 5J9PA 2FWOA 1XCQA 5FYKE 1ZT7A 1B3JA 1M7DB 3G04B 3HPJA 3RDTA 3ULUC 3I9GL 3PGFL 4ODXA 2J4WL 3RRQA 2DQCL 1D5BB 2Z4QA 3VMOA 4AYFA 2VWEC 4YDKH 2IAMB 4Y5YA 1NCDL 4F7EB 1DN0A 2QQQA 4OD2A 4M1DL 2FX7L 5JXAL 2AABL 4RAHA 3QO1B 1KJ2B 5DMGC 3WS3A 4X7SH 3ZYJA 4IRJC 5EU3A 1HI6B 2A6IB 4DGIL 4NNXA 4PJDF 2NXZD 4JRXA 4JO1L 4WFFE 3QXAA 2C1OA 1IAII 1OP9A 5F7LB 5I75B 1OPGH 1KLGB 2F53B 3F6IA 1ETZA 5IMMA 1FV1B 4M6NL 4CVZB 1IEBB 2UY6A 2VLRB 2JB5L 4EVNB 3JTTA 3GRWL 2UY7A 2FO4B 2APVA 3EJZC 3ZTNH 1MRFL 1P7KB 1CDCA 4LFHG 1I8MA 5E2VH 3FRUB 2RGSA 1J18A 4UTAH 5CS7A 1ZK9A 4PLKC 2WK2A 4ZO7A 3BD4A 4K3JL 5JIHA 1W0VB 5E8DH 4J1UA 1UA6L 4JZJA 1BFOA 4GAYA 5F88B 1IGFH 1RUKL 4OLUL 2APFA 3G6JA 5K59E 5ICXB 3QIBC 3MXWL 2PN5A 4PJ7F 2B1AH 4RGNC 4XC3L 2ZCLL 1UZ6E 5CGTA 1UWEH 3V4UH 5A2IH 2BRRL 3TYFB 3P4NB 3UZVB 1NC4A 4OLWL 2M2DA 3QNXA 3BXNB 4LLUA 3W39B 4WI5A 4N0UB 1J0ZA 4CL7A 2DTMH 4NN6C 3SPVB 2DQJL 4TOYL 4G7VL 2QL1A 3J7HA 3O6ML 4G6FD 5HYJE 4U1JB 3WUWB 4GG8B 3I6GB 2EE9A 3OR7B 1QLRA 4K3EH 5AD0B 1QZ1A 4IRSC 3H8NA 1BVZA 2IAMA 4Q6IA 3TN0D 2A0LC 1F4AA 4D3CL 1MVUB 3IXTA 4OFIA 3EOAB 4GKSB 1OTSC 4HWBH 4RFOL 4F2MA 2H8PA 5ICZA 1A9BB 1QP1A 4DW2L 3QCVH 2X4QA 3DX8A 4R3SB 4OIBA 5I30L 2J88H 4WU7B 4XT1C 2BOCA 1WZMA 1D5IH 1FL6B 2BVTA 4JFOA 2R4SL 2D9CA 3IETA 1MFDH 3LHPH 3FRPA 1OSZB 4FXKA 1MRCL 4KHXL 5TFSL 5GJSL 2B4CC 3HNVL 3EZ8A 1U8PA 2XZCH 4OFPA 2NY4B 3K1DA 2A6DB 4N5UA 2J88L 5JDSB 3QEGH 2CQVA 2NY2C 4LEOA 4BK5A 4M48H 4YFEA 3VFPA 2GAZB 4OKDA 1G1CA 2QSCH 1A9EB 3VG9C 2A9ML 4M43L 3LPFA 4X7EC 1AQDA 1HEZB 5FYKU 2OJZH 1BHGA 3I75A 5FM5M 5K9OA 4UOJA 4L4TD 3WFCL 3MMEA 3SBWA 2DWEA 4A2MA 5DVKA 4M7ZB 5I1AA 1W0VA 1ZLVH 1RIVH 4Q58C 1I7RB 3GEWB 4PJXE 3LEYL 15C8L 4U1KA 5FO9A 2YK1L 5C70A 4PGDA 1CDUA 4NC1E 1RQ5A 1HYSD 1D7FA 4HIJB 4WUUE 3JV6B 1OM3L 1B0RA 1ND0A 2DQCH 4M8QA 5EUOA 5CP3A 1K4DB 2OJEA 2DI7A 3PE9A 3HUJF 1NLBL 1P6FA 5F1KC 4AH2B 5F21B 43C9B 1SEBB 5C0FA 2ZPKH 1KYOJ 1C5BH 1RMFL 3AMKA 3IFNL 5BO1L 2VDRL 2FX9L 1RU9L 3F7YA 1LEIB 2DQTL 5DZOA 1P5VA 3EAKA 4V2CB 3O8XA 1NC2B 1S7QB 4IHOA 3DBXB 4F3FA 3TEUA 4JY6B 1U8HB 1YEFH 3GGWA 1PYWA 4DOHE 5SWQB 1VPOL 3P77A 1J9CT 3CLEH 4F7MB 5I1HL 4NQEE 4GFTB 3TN0A 3QQ4B 4YNYA 2H9GA 4X6BB 2Z8VC 1VENA 4N0YL 4L8SB 4U1LA 5GIRB 2R1YA 1A22B 1N64H 1A6TB 4GRWH 2HH0L 4QHNB 5C09A 3TCLB 5LGHL 3BKCH 1MFNA 2A6IA 1PBYA 3JV0A 5LVEA 4EI5C 1MHCB 3CGTA 1JWSA 25C8H 4LSRH 1K8IB 1AP2B 4ORGB 3RY6C 1BOYA 4O58H 4KKNA 1KLGA 2XG4A 3KYMA 1HHJB 4XMPL 3FOLB 4FTVD 2HJLA 4XXCC 3RWDA 1NBZB 1B0GB 3F5WA 2VLRA 4Z7VA 1RURL 3I84A 5AUMB 3B5GA 3BWUC 1P7KA 2EYTA 1XIWC 3MX0A 3P40A 3FRUA 1X5IA 1YPZB 3T0WA 3MXVH 1J8HE 3CH8A 3MLZH 1QSFD 1XIWD 4GG6E 4OTXH 2VZOA 4I48B 3WS6C 3AC0A 4RGNB 5DSCB 3U2SB 3I6KB 4LSVH 5K93A 4YK4B 1T22A 5TGBA 2EIBA 1DQMH 1D5MA 2RAMA 2ATKA 4WEBL 5E4EB 3IKKA 3GZKA 4QEGA 4D3CH 2X2YA 3MUZ1 4JY4B 3NCYS 2YN5A 2EZ0D 5HHNA 5TE4L 3UTPD 2BSRB 4PP2B 3X12A 5SWZA 3D18A 3D3VE 1N0XH 1MH5B 4NGHH 4IRJD 5A2FA 1LK3L 2EEBA 2PR4H 4PFEA 4OBSA 1GYAA 4CKVX 2OL3L 4DAGL 1JNLL 5D7SH 2VLKA 1IQWH 1FFPA 4L29A 1FG2B 2CLVA 4X7CC 3BP5B 5F3BB 4BJLA 5JQHC 1HKLL 2QHRH 3QJFB 4EOWL 2A73B 4LPCA 5J6GB 5CWSA 4X6CE 4QRUA 2VYRE 3KYOA 3TBSB 4MDIA 2AJSH 2D7TH 2JK5A 5T1LA 3UCRA 4TSBH 4AEHL 2Y72A 3MRLB 4K3GA 2IGFL 4WEUD 3UDWA 3ALXA 3PWJB 5DTFB 3HS0A 2BOCB 3PWUA 4WUUB 3RU8H 4HWUA 3GB7A 1G6RA 4EOWH 1CXFA 1IEAB 3QQ3B 2YKLH 3VFTA 1NCAH 3SDDA 1RHFA 5JA8B 5T1DL 2DKUA 1NUFA 5FXCH 4PJXB 3FL7A 1T1XB 2NY2B 3MRHA 5HGDB 2XIDA 3B83A 2BNRB 3V4VH 1ADQA 1ADQL 2VAAB 5GGRB 4Q7DA 3V4PH 3K46A 4WUKH 1MFBH 3QIWA 4X6DA 5E94A 1XCTB 2BOBA 5E6IC 5DUML 1QNZH 3ARGA 5C86A 3TVMC 4NZUH 1JYWA 4L4TB 3MBEB 1Z3GL 4NKMA 3SGKA 1I3GH 1BX2A 3X17A 3C60A 3MRIA 3BUYB 4JN2B 4N90E 4XBPB 1OWWA 1X3DA 4GMSL 1UG9A 1HHKA 4WNQB 3RL1B 2ZCHH 1QEWA 2H26B 2FL5A 5F7DB 4TVPL 2B8OT 5IVZB 3BN9C 3UTQA 3HE6B 1IEHA 4HQQL 2AJ3B 2HVJA 1AGDA 3QFJB 5EOQL 3GO1L 4Y1AE 3G6AB 4XVJL 3M1BA 3JWNC 2AV1A 1IQDA 5L6YL 2P8LB 4H8WH 1AKJD 3LIZH 1MNUL 4IRZL 2EXWC 4R7NB 5DRNB 1J8HA 3RNKA 1E4XH 4KAQH 1R24A 2CLRA 2C1PB 2BY2A 1YDPA 4HEPG 4PJBF 1D6EA 5BW7C 1WFTA 4O9HH 4D0BA 2R2BB 3TN0C 2VISA 5GGVL 3ZLQC 1PY9A 3SKNA 2JK5B 1SYVB 1G7PB 2R56L 3TNNB 3L3JB 4Y19A 4OCXH 4PJFF 4UT6L 1ZGLP 3FB8B 5E1AA 5D7IF 3DHJA 4HC1L 3MA9H 3K74B 5DD5H 2EKSB 4LNVA 4E5XA 5E8PB 1ITCA 2MHAA 3T8XA 3BPLC 4KGLA 4OBRA 4KH2A 1NGZB 4OTXL 4H26A 1HYRC 3C6SA 3U30B 2JJTA 1K8DA 3R0NA 2V5TA 5KSAC 3UJIH 4LSPL 5DHYA 4NHCL 3MNZA 3NGBC 1F11A 4PP1C 5FA3A 3VGAC 4R8WL 3IDIA 5EU4A 4J23A 2OI9C 3VI4F 4UIKL 3SDYL 5JHLL 4M93C 5EC1A 5EU5A 1YPZA 5DR5H 3B43A 1ZWIA 2I25N 2VSDA 4HIXL 4PJ7A 3OZ9H 4U1HA 2HVKA 3ULVD 1R5VB 4YK4C 5DFVD 2OJZL 1OW0A 3DXAB 4WWKC 1KIPB 3U4EB 4HS8H 3MV11 4LLAA 5ITFB 2FX8L 2GEEA 2HFGH 3T0EB 3QIUC 3T0VA 1TJHL 1MWAH 1FO0B 3GBNH 5HDLA 1YEHH 1NFDE 4QRSB 2W65B 2EDOA 3QT2A 4NO5B 1RJYB 1T04B 2C3VA 5IV2A 3GUTB 5C08A 4LASH 3RA7L 5HHNB 3H9SA 2P8LA 4JPKL 3L7FA 4L4TE 5KSVA 3O11A 3SE3A 1KB5L 3FO9B 1MCOH 3KLAA 5E00A 2WIIB 2YHGA 2C4XA 3WJJC 5FYLD 3MRBB 2YBRA 1H3VA 1CD8A 4LLMB 1ZLWH 3NN8A 1SHMA 4C55A 5A2KH 1AJ7L 1DLHA 3NIFE 2X4NB 1FG9C 1QUNA 2QQNH 3L3JA 1QFWM 1E4WH 2VWEE 2WBJB 4M61B 1CGSL 3V4VL 2FIRT 1FYTA 3D39E 4R90L 2WUBH 3G04A 3RGVD 1UACL 4Z77A 3MRLA 5D1QD 4J3SA 4JLRA 3ZE0E 4B7IA 4Z7QE 1KC5L 3HAEB 4XNXL 4XPTL 1YPZF 5CJXA 4DOHB 1MF2L 5CJQL 4WI8A 1G7MB 5J1SC 1IEAA 2X9XA 4APQA 3QCUH 3I3DA 2YS4A 1YUHA 4BYHA 2A1WL 5IOPA 3RKDD 3NIGF 3VRIB 3FN9A 4Z7UE 1SY6A 2HH0H 3MO1A 4ODUB 2EDRA 3O3AB 4JDZA 4WW2F 3U46A 4D94A 5HDBF 1WF5A 3CFKB 2XY2A 3QXAB 2Q86B 5SX4I 2R9HC 3FT3B 5TF1L 1GSMA 3A67L 4L3EA 3MBEC 3IDGB 4JKKA 2EH7L 1U58A 2BY3A 4JY5L 4Z78A 2AK1L 3TBVA 1U95A 1W0WA 4MNGB 3WNLA 2V7HA 3RVWC 5CJ5A 3SCMD 5K9KB 2X4SB 2DYPB 2RQ8A 1U41A 1MFCH 3SDAC 1MCHA 1BJ1J 3DMMA 1SBSH 4Y4FD 2YR3A 4YHPB 2W38A 3DTXA 2E9JA 5JW5A 3FQRA 2BNQE 4OKVA 4DEPC 4FFWD 3QDHA 3DVNA 3WFEL 4WVRA 4FQQA 1UWXH 4QOKD 1F58H 3RWJA 3WJJA 5I8EB 1XF1A 1I7ZB 4CMMA 2FLBT 1U8OB 1KFAL 5I30H 2QV2A 3QG6B 1F4WH 1EVTC 1ZHKA 1CG9A 1NGPL 1NBVL 3MV9B 4MXQC 4WO4A 1FVCA 5JA9A 5IMKA 2YN3A 4G3YL 4O51B 1INDL 3RNKB 5EULV 5MEND 1I8LC 3VXNB 3V5HA 5D72H 4QRRA 3MLSH 2EDNA 3EYVB 4O2EA 4F33B 4NC2B 4XCYB 4RMSA 5HYSA 4I3GA 4WFEE 1AHWC 4MJIB 1NAKH 1U8NB 4UTBL 4LDOB 4P5TA 1K5NA 1TZIB 2HMIC 4M43H 4JO2H 2WP3O 3SDXB 1Q9OA 3T0EE 2FH8A 5FGCE 2CKNA 1V7NH 3FFCD 2AEPH 2YRPA 3CX5J 3HR5A 3P2TA 4PGEA 4KTDL 5JPNB 5C2BL 3INUH 4JRYB 2X89D 1NGQH 3PWVA 5HHMD 4Y5YC 3CDGB 2XTJC 2APXA 3W2DH 1N6QH 1T6WA 3I50H 1G84A 4QXWA 4KHTH 1QD0A 1SJHB 3GMQA 1KN4L 4YHIB 4TSCH 3VWJA 1OQXA 3CZFA 3S4SG 5J3HC 4OZHB 2XNAB 4U1IA 2DQEH 1F8TL 2ZUVA 4PB9H 1KBGH 2VB5A 5HYFA 3IDXH 5BW7A 3QI9A 4QT5A 3C5SB 4GW4B 4UT7H 3TV3H 3ARDD 2X4TA 3S97C 2Q20A 4LRNL 1OPGL 2FX9H 4U05A 5K9KA 4MB4A 3BMWA 4ZUTA 5DQ9B 2DQUL 2XFXA 5E9DE 3T0EC 1KJ2H 2DMKA 5T5NF 3RZCC 1HSAB 4BKLA 4YZFF 1M6OB 4XNUH 4FQHA 5D5ME 5BJTA 2AJZB 2P5EB 3K1KC 4ODTH 3BGAA 2NW2A 4EIGB 4PJ9C 4ZS7H 2J8OA 2B5IC 4KDVA 3P11H 4GRWE 4V1DD 2Q3ZA 1G0DA 4LCWD 5CLWA 3F7QA 2W0KA 3OKLB 3O11B 3RX7A 4G8GD 5FB8B 4XC3H 3IDJA 4EN3B 1KEMH 3HI6L 1RIHH 3BE1H 1PAMA 2V7NB 5C7XH 1A4JB 1IFHL 4MJIA 1GL4B 4LVEA 4NFDA 2G2RA 2NY5L 5FYJD 3ZO0A 1T20A 2ZUQB 4LSQH 1XGUA 4AQ1B 5I16A 1DL7L 2J7LA 2BVQB 1E6JH 2NXYD 1DEEB 5I71C 1X7QB 1W8OA 2ZUTA 3QRGH 1N4XH 3C9NB 4WIQA 2IPTL 4ODSH 1EVUA 3NCFB 2Z9TA 5E03A 2Y9RT 4UB0H 3KR3H 1A64A 4MA3A 3G5XA 4ZNEA 1OD7A 4WW2B 4HWBL 3AXLA 1HXMB 3T65B 1MIMH 3SE4C 4GBXA 5FK9A 1GC1C 3MRRB 4LCIH 5DD5L 2MKLC 1IC4H 4RDQG 5F1IA 4HDIB 3SDCB 5CZXC 1R5IB 3DIFA 5K9QG 2F58L 3KPRE 3DUHA 1CXIA 2EDTA 1T2QH 3H0TB 1NGXB 5C3LD 4XVSL 5EOTA 5I1EH 1W72H 2RHEA 4G8IA 1U95B 1U3YA 1W0WB 4MNGA 4N8VB 3B9VA 4XXDB 4DAGH 2R0ZL 1OAZH 5MERA 1M7DA 4QOKB 4Y5XA 3QUYD 3PL6B 2J3SA 1JPTH 2EYSB 4L9DA 4C56D 4G8FB 3S3PA 4Y1AB 1A2YB 3TESA 4KJYA 4BELD 1S7RA 2W9DL 2FO1A 1TZGL 4LCYA 1XT5A 1CLZH 3BPOC 3WS3B 2H32B 4WTZG 3WKMH 5IVNA 1D6VL 3CFBB 4N9GB 4X7DC 3HZVB 1AC6A 1OGTA 1PG7X 5E7BA 1DQLH 3VFUA 3HZMA 3QULB 2WAHA 1BQLL 3VGEA 4IOIB 4TPRL 4IOFC 1ETZB 3RAJL 3WFDH 1JP5A 3BRGC 1VFAA 5EO1B 1P4IH 1QFWI 3WIIH 3V8OA 1BZ9B 2ZUWA 3ABZA 4KZEH 3LEVH 1HIMH 4XP6H 1J5OH 5F3BA 4I0CC 1BQLH 4Y5YB 4Z7UA 5T1MB 2P43B 4BQ6A 2QJDA 1FL5A 3UTTA 4GS7B 5IUSA 5I1GL 1T83C 2VLMD 5AYUH 3S5LA 3UYRL 2ED9A 3V0VA 5EUOE 3T65A 1YECL 3C5JB 5B39G 2ARWA 1NBQA 2XQYK 1P4IL 5C0AB 4G6AD 4K7FB 4LOUC 4LCCC 2BRQA 4PTUB 3OXRA 2GIYA 4EEEA 4NUJB 3GB7B 1AGBA 1N64L 4JKWA 2DD8L 1ZLUK 3VWJB 5GZOD 4W68A 2C1OB 3VFRA 4JFDD 1IC5H 1KLUA 5K9JH 1FV1A 4LHUD 4PIRF 3KPSD 5DWUL 3DRQB 3L3IA 1Z5LA 3EOYG 3KJ4B 1RZIB 3OG4B 2D4FA 3BO8B 3QUMH 4OIIL 3WIHL 2VAAA 4JGMA 5LAXB 2FZ3B 4N8VG 5CGMA 5KANI 1A6ZA 4NPYA 2XI9A 1GAFH 3ZKXB 1RJZA 3GI8L 3VXPB 2BOBB