5IT9A

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
206
structure length
206
Chain Sequence
b'SLPSTFDLTSEDAQLLLAARVHLGAKNVQVHQEPYVYKARPDGVNVINVGKTWEKIVLAARIIAAIPNPEDVVAISSRTYGQRAVLKYAAHTGATPIAGRFTPGSFTNYITRSFKEPRLVIVTDPRSDAQAIKESSYVNIPVIALTDLDSPSEYVDVAIPCNNRGKHSIGLIWYLLAREVLRLRGALPDRTQPWAIMPDLYFYRNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein uS2
molecule tags Ribosome
source organism Cricket paralysis virus
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
total genus 41
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00318 Ribosomal_S2 Ribosomal protein S2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 5it9A01
1TZCA 3FXAA 3HBAA 2HHHB 4LFBB 2I22A 4JYAB 4U6NA 4X64B 3T1YB 3QKIA 1XMQB 4B3TB 4JI7B 1N34B 1XNQB 2CXNA 3BCHA 3PR3A 2CXSA 4LF9B 2CXTA 1N8TA 2E5FA 4B3RB 4YHHB 5LL6P 4DUYB 4M0DA 4JI2B 3Q7IA 4JI6B 4IVNA 4JI4B 4LFAB 1U0FA 5LMNB 1VI5A 2DF8A 1M3SA 4LZJA 2CXOA 4GKJB 1X92A 3FF1A 2CB0A 2DECA 2ZM6B 4DV5B 1KOJA 4LF4B 1U0GA 1VI6A 2ZJ3A 4JI1B 4YY3B 1WIWA 2XBLA 1VIMA 1X94A 1FJGB 2A3NA 4JV5B 1Q50A 1HR0B 4DR4B 4LF6B 3Q88A 2CXPA 3UJHA 3JAMA 3LJKA 3G68A 5LMUB 2E5LB 1GZDA 1HOXA 2I2WA 3TRJA 3J7AC 3FKJA 2VQEB 4K0KB 4LF7B 1C7RA 4TOIA 1ZZGA 1J5XA 2UUBB 4OX9B 1JLHA 4DR6B 2X3YA 4JI5B 4AMVA 1XNRB 1HNXB 2UXDB 2YVAA 4JI0B 1U0EA 1JXAA 3JX9A 4S1WA 1T10A 1MOSA 1G98A 1HNWB 4GKKB 1J5EB 4S12A 3KNZA 1NRIA 3M5PA 3I0ZA 1IBKB 1GZVA 2CXUA 3OTOB 4DV3B 1XMOB 1HNZB 3J80A 3CVJA 1HM5A 1C7QA 2AMLA 2CXRA 1B0ZA 3SHOA 1I94B 4B3SB 1IRIA 3OOJA 3T1HB 4LF5B 4LF8B 4JI3B 5BR8B 1DQRA 3HJBA 4DUZB 4X62B 3TBFA 2V4MA 1TK9A 2WU8A 2PUVA 5IWAB 5FLXA 4DR2B 2UU9B 3ETNA 1JEOA 1X9HA 4DR7B 2F4VB 4DR5B 4DV2B 1VIVA 4DV1B 1MOQA 1MORA 2J6HA 2O2CA 3NBUA 4JI8B 2UXBB 4X65B 2XHZA 3FJ1A 2VF5X 4X66B 4DR3B 2POCA 3BJZA 2VF4X 2PGIA 3IFSA 3EUAA 3ODPA 1XTBA 5A2QA 1X9IA 4NXNB 2PUWA 1IBLB 2UUCB 2UUAB 1N33B 1IATA 5IT9A 1TZBA 5I01A 2PUTA 4DV7B 1IBMB 4DV4B 4B3MB 3J81A 4DV0B 4LFCB 4AQYB 4EM6A 2CXQA 2O2DA 2VQFB 2ZJ4A 4DR1B 4KHPB 1N36B 1N32B 2Q8NA 5BY2A 4DV6B 4NXMB 2UXCB 1JIQA 2CVPA 1NUHA 3C3JA
chains in the Genus database with same CATH superfamily
2SHKA 3Q6MA 3DOCA 4OFBA 2SKEA 1FFXA 1LD3A 4GICA 4AY2A 1U1EA 2W6ID 4I3GA 4RM3A 1H3NA 3PNLA 2JK1A 3HO1A 2EHDA 1WUYA 1GL6A 1RJWA 1ZOIA 2DR0A 1RZ3A 2MR5A 2QN6A 4B0PA 3ZOZA 3MS4A 1MQ9A 3IUBA 4R69A 2P41A 2AN5A 1PK9A 5ECYA 2P9HA 2VHUA 3FF4A 3PX2A 3Q7IA 1DX9A 2QQEA 4MICA 2IEBA 5CYPA 4BPRA 5IVPA 1E62A 2G06A 2WIJA 2OESA 2A5FA 2P77A 2QRNA 4KGDA 4IZOA 4N1AA 4UE6A 1F4PA 1Q57A 2DLNA 4MR8B 1TAGA 4A8JC 3CO0S 5GM1A 4BWFB 4UVEA 1G3QA 3DE7X 4JOQA 5HXAA 1W1WA 4GGOA 5FBKA 4OBEA 3SJBA 3PL1A 3UUGA 1VE1A 2CJWA 4HGNA 4PFQA 1H1TA 3OCZA 1CF2O 5IK2D 3U4IA 3AHCA 4MV9A 2ES4A 9ATCA 1B74A 5LB4A 3QX8A 3EQ2A 3H1EA 3I58A 4IIFA 3G2MA 4KIGA 5LA6F 1KWGA 3FMIA 1JSLA 2E0IA 4O2LA 5ALMA 1XAIA 1GV1A 1MF7A 1TQDA 4DL9A 3KZNA 4DEYA 2DXIA 1LZLA 5CLJA 4LUCA 4FCVA 2BTQA 4LJ9A 5JC8A 3KUCA 2IQ5A 3CBQA 4G1FA 4ZYUA 2HZ7A 2OHXA 2EZUA 3FNBA 1W5FA 2W70A 4BTEA 4URZR 1NZDA 2LRHA 3P0FA 3NT5A 4UNIA 4ZKDA 5K0GA 3PVZA 2ZT7A 4HO1X 3G3EA 3K8QA 4R6XA 2FXIA 4RCVA 4RS4A 2HXGA 2VK4A 4HC4A 3NKVA 5CNMA 5DBIA 3I62A 3VFDA 1FXWF 4IDEA 2JGJA 2VSYA 1GAQA 4K6HA 1SNYA 4PF1A 4PFJA 4U2GA 4O0LA 3VNAA 3I09A 1PWXA 4PG4A 4WESA 5K03A 2UZ4A 1W85A 1X8LA 2QUKA 3W4JA 1JHOA 5FI0B 4Z9BA 3TGLA 4L2IB 1G18A 5G41A 3FH0A 4BQSA 2BMJA 3L0ZA 1BS9A 4ZDWA 5CK4A 4CTMA 1JHUA 3Q7PA 5EY5B 4AG3A 4J0IA 1L5KA 4B3BA 4B4WA 1QBKC 5IM4F 2GPBA 4AICA 5JDIA 3KQKA 1NI3A 2G5CA 4FHDA 3K9QO 5DP1A 2IODA 2F4VB 1XA3A 2XGGA 4CV0A 1MVOA 2P69A 5H70A 5F76A 2GEVA 1YJQA 1PZFA 3YASA 2J87A 5TSDA 5FUQA 4RJ2A 2YYSA 5IEBA 3HI6A 2WSYB 3EVNA 5KHAA 3VR1A 3WYNA 4DWOA 4CMBA 3BX1A 2GO1A 3V1NA 2I1LA 2VP4A 4B47A 1PT8A 3VNQA 1DMRA 5DX8A 4LSMA 2FLWA 4WXEA 3GWGA 4I14A 2NTEA 3FRHA 1Z3IX 3UCEA 4E5SA 1TU0A 2WSMA 1AGPA 2I1VB 3EASA 4J1TA 3SYNA 4GBJA 2GJAA 5JNUA 1EXVA 1BXZA 3G49A 1KARA 4H7IA 5I48A 2B9EA 3T4PA 4XVCA 5DHSA 5D3KA 5FWXA 2FN9A 2Y0EA 4ENUA 2JFPA 2XSZA 1D2MA 3KG2A 1TUIA 2QM7A 2O6HA 2VH2A 3IVAA 4KWCA 1DOZA 4KHPB 3ZU4A 3C70A 1U8EA 1VZ2A 1Y7TA 3A4VA 1HO3A 1XRRA 4X8HA 4EYQA 3NONA 4CJXA 5J4HA 1JA0A 4B3HA 3TG8A 3GD5A 1PQWA 1ORHA 2H29A 3SVZA 1DKQA 1T8SA 1ZD5A 3PGVA 1H4SA 1EK0A 3Q3GE 1Z0FA 4NJMA 4DIFA 4DUYB 3DKKA 5HJ7A 3CTMA 2G88A 3DPSA 5AK3A 3ER8A 1SXHA 3A31A 4RKQA 2GBIA 4W7IA 4RJIA 1RIFA 3OT4A 4TKLA 3ZWKA 3G0HA 3BA6A 1T2CA 1P2DA 1EUQA 1I36A 3DEAA 2Q3MA 4LVUA 1N9GA 3EZ6A 2I4TA 1E20A 1BTOA 1DEKA 2C2HA 4GH5A 5BNTA 1YAJA 1RS0A 2PZKA 2HMVA 4Q4LA 5B1YA 3BMOA 2OXRA 1ZIPA 5F4ZA 4BLUA 6YASA 2NSHA 3SX0A 2OORC 3K1YA 3VNBA 4FDVA 5CNJA 2Y9PB 5G0TA 3TOXA 2FZ5A 2A3NA 2I3ZA 2O9JA 4LDZA 3BWVA 1V9SA 1B6SA 2GKOA 1BMQA 3G2JA 4KVAA 4YI5A 5CAEB 2FY8A 3HWWA 4CMKA 2VYND 3O7MA 1Z4OA 1G7CA 1PK8A 2ZBGA 3K0AB 4QPPA 1VPLA 2ILVA 1DRUA 2A0KA 4U63A 1BMFD 2DR3A 2LV8A 2WUDA 2OCLA 4AN1A 4OX9B 3CQ9A 1N9GB 3DSRA 4V2IA 4GYKA 5AWFC 1B8PA 3RRNA 1U0OC 1N9ZA 1ZSNA 3E9NA 4BMNA 4F3RA 2BUCA 1FXWA 1YMVA 5LMCA 1N8NA 4C4AA 1P6QA 3HJFA 1DBIA 5DNUA 1HYGA 3CB2A 2PHZA 2V5VA 3NTQA 5JE8A 3UN1A 4LTMA 2ZZMA 1A2QA 1V39A 5ERYA 5F5LA 3T9EA 2IUEA 2NQTA 2O0JA 3G9ZA 1G21E 1CSEE 2QK4A 1U7ZA 3GUCA 2GLUA 3NHJA 2C5EA 3BKWA 3PEFA 3R20A 4KDEA 4JU8A 1R4NA 1DAIA 1SZCA 3FWNA 4GG1A 4IGFA 2ZBUA 2FZVA 4WE3A 4DSNA 3CW9A 3L0PA 2N1BA 4JJFA 2FR0A 4OHYA 5BWNA 1IOLA 1OGJA 1ACLA 3I52A 2PGDA 3K5HA 4NCXA 3EXAA 1I2ZA 2YNMD 2AVNA 5ERGB 4OI4A 2PY6A 5JAHA 1N7IA 2QR2A 1ZGJA 3KJZA 4TRJA 4XCQA 5A6VA 2CDCA 1J0AA 3GXBA 1V1MA 1BVHA 4OQFA 4RJJA 4DV1B 5F7ZA 4M1OA 4D4MA 3QU9A 2JJQA 4HH1A 1P5RA 2HSEA 3R3JA 3RHFA 3IT3A 5C5DA 1X8KA 1PJCA 3PDJA 5DBGA 4DYVA 4U2KA 3HGQA 5MFZA 3ZJUA 2EFJA 2I7VA 1BXGB 2VF4X 4AF6A 4ZQFA 2D1FA 1WCWA 3I2GA 3U56A 2Z95A 2EAUA 1XU9A 3A9UA 4WDRA 1SVUA 5BRJA 3W04A 5LIPA 2PSSA 2CZCA 3HBJA 2YHSA 5FLYA 1ZQ9A 1SCNE 3BM5A 3WSVA 4KYUA 4BVAA 2Q2NA 5D7BA 3HHEA 1ENZA 4HWPA 3FPAA 1ELOA 2WIDA 2VFAA 3H16A 1Q0ZA 4CRWB 1O97D 3E9YA 4HKTA 1H2EA 4CIVA 2O2DA 3D7LA 5FI1B 4DXAA 4E2ZA 1EQ2A 3RARA 1NU8A 2ZU6A 2WYOA 4G5XA 4C7OA 2RGWA 5I7OA 4NBWA 3JYOA 3CZPA 3H9EO 2PZFA 4CQLA 4HH4A 4NOLA 5EFOA 1GQYA 3DKIA 4ENVA 4P22A 2AKEA 2EZ4A 4L2IA 5GJWC 3AP1A 2FZCA 2WJPA 2I54A 3MWEB 1IEXA 4M1SA 5EP1A 1UT6A 3Q1LA 4PNZA 1R0BA 4R51A 5E4YA 2DUNA 4FB5A 1JFLA 3O7WA 3N0XA 3TOCA 3MB8A 2QG6A 1FK8A 1Z7EA 5IJZA 3AHGA 1MUUA 4P5PA 3TJRA 1JT9A 4LJ4A 2JLQA 1YRLA 4V0NA 4BDTA 3DAOA 2GFIA 4LBWA 4LWZA 5FUBA 4DLYA 5BXYA 4FWBA 3VU8A 3JQAA 5DKFA 3WL8A 1I1OA 4D9EA 2J5RA 1EIWA 3HY6A 3GW8A 3IXQA 2EFEB 2JH9A 2OCGA 2NZXA 4K0RA 4QLOA 2GBLA 3QJ5A 4RK7A 4S1PA 2E6UX 3ET5A 1KOJA 2PLFA 1UJNA 3MF4A 3OQIB 3DL0A 4MCHA 4DLXA 3OSUA 5PGMA 1QQBA 3TW8B 4CTOA 3KT6A 4ALIA 1KY5A 4BUZA 4CF4A 4KR2A 3ND9A 4IOMA 3ONVA 5EWMA 2O2EA 5ADHA 1FIUA 5TPZA 1GQRA 5JXWA 1WBBA 1E89A 1V3UA 821PA 1T0PA 3JQFC 3E35A 2FMTA 3N6XA 2FP4B 2O0LA 5KSOA 2QVXX 2DR2A 5KSPA 4O4IA 4INOA 3FKJA 4F9EA 2CJWB 3L1JA 3K0BA 2YFYA 1ZZGA 2C5SA 1TUGA 1EX6A 3AG5A 2BMFA 3RAGA 4JJ8A 5JD6A 1HEIA 2WY2D 4GRAA 2FGKA 4YPVA 3A9VA 3B89A 4WLEA 4PVCA 1XBTA 3KE9A 4IMPA 5K51A 1XXHA 3LY9A 1I0LA 1E1KA 1N57A 1L6RA 4JNCA 1A76A 5JVDF 2BGGA 2H48A 3AJRA 2WUVA 4M0PA 3A06A 2BEWA 4UASA 3ROEA 3RUCA 4YJ2B 1BE6A 3I3SR 4JLWA 2CFCA 3VR6H 1RYDA 1LPNA 2J0UA 1PJBA 2GDZA 1AT1A 1OAOA 2Z5LA 3M3PA 4Q1DA 2ZIAA 5CVVA 5KVSA 1L7PA 3KUKA 3ZY5A 2IIPA 2G36A 4IDAA 4RZ3A 3EW7A 5F2KA 4JA0A 4NFSA 3JARA 2GASA 3FHLA 1QWSA 2A1UA 4EG0A 2JJ1A 4ETWA 3LQYA 4E4YA 3TMYA 3UMCA 1AKWA 1SUSA 2QVYX 3HYNA 3SMVA 1X7ZB 1TLFA 1T0UA 3D8RA 4IR7A 1JSRA 2PX4A 1ENYA 1Y7LA 1YR1A 3ORRA 2JGMA 1KKMA 5KHLB 2PRJA 3KU1A 1U0TA 4G5GA 4I2NA 2VTBB 2IXBA 3C3YA 7AT1A 1WZ2A 1WKBA 3L46A 4H31A 4K05A 4V0RA 3F6SA 5SZJA 2BELA 2DFLA 5L3QA 1I80A 5AUQA 2HU8A 4O5OA 5D5HA 2NZ2A 1JKJB 1M1YB 4WZZA 1SEVA 5IWCA 1SHUX 4KQ1A 1QH1B 2ABWA 5JD5A 2PANA 4MRAA 1E7YA 3P9KA 1QGUB 2NZYA 2ZAYA 4HQKA 2UZIR 4K6CA 4RW0A 3HN6A 1MPXA 4NJEB 4BMOB 2ZTLA 4CR6A 1H85A 2CHGA 3WLFA 5IJ9A 5IDQA 2F9LA 1X1SA 3L2OB 4MVYA 4UBOA 3CVVA 1IBSA 4Y2PA 1Z6YA 5B1SA 4BJ5A 4Z7NB 5IAGA 4BTVA 1L7DA 1GR1A 1FYFA 4Y3UA 2EF0A 3EPKA 4I1UA 5CLGA 2ZETA 3UWSA 1RYZA 3GDHA 1QIIA 2B8WA 4KXXA 5LM3A 2R5NA 3A1VA 1RRPA 1A5SB 2ZI9A 3G1WA 3H3FA 4UEJA 2D74A 3RI3A 4KYTA 4BP3A 1IQ0A 1PWEA 1SQFA 2HYDA 2YRXA 1KIMA 5FOVA 4I8DA 2Q6KA 2AD1A 5CLHA 3UMSA 1G59A 1DI0A 4PLPA 1MB9A 3WJ1A 2JCSA 2ZWPA 3D6FA 3M6IA 3WIOA 3WRYA 2GHTA 1R8XA 2E21A 4QVGA 4ZYXA 3ZCXA 1MQ8B 2Y1WA 3FPEA 2X13A 3B9BA 4L0DA 4NEQA 5ER6A 2VAMA 1QAQA 1TF7A 1EFRA 1XVVA 4R1UA 4XAQA 2NU9A 2X6QA 4EF6A 4YRZA 3ZEAA 3PC6A 3OQNA 3ZCUA 1QO0A 3TPFA 4F9GA 3AIOA 4HNVA 1ISRA 1E0JA 1IHDA 2GZSA 4QEZA 2GYWA 3QY0A 4LRTB 1FOEB 3EJ6A 3Q9NA 4EMBA 4CEHB 3CLVA 1U1FA 4CG1A 5K3FA 1XXLA 1OJLA 1P0IA 1U3UA 2JS7A 4KKXB 4O4IF 5HBGA 5HDQA 3R3WA 3AR6A 4HLUC 3HYRA 3JAMA 4HQ0A 2R11A 1NIPA 2J1LA 2H4WA 1SFRA 4KE7A 1GRCA 3UYKA 3WGZA 3JQQA 3WYGA 1Q3KA 4JKIA 4NQZA 2ZYDA 4N65A 1GTL1 1IEWA 1RVDA 5AVZA 1KR5A 2A9OA 3DE5X 4B7UA 5C1PA 1KFKB 3OAAA 2BPOA 4F60A 4DDUA 2F8TA 3PFHA 1D1PA 1EKXA 4OXYA 5AM3A 1MOSA 2ZPUA 4EPRA 1G2QA 3C8HA 4JX9A 3RF7A 1AS2A 1G291 1MABB 1QP8A 4KAXA 5EEHA 1LPBB 4H3KB 5T7BA 1ABBA 3FBTA 4JJGA 1G2PA 1W5AA 3DF7A 1Y3BE 3SHWA 3ZYZA 1ITZA 4LPSA 1WDWB 3HA3A 3CSDA 4GPEA 4DJJA 1YVRA 3H42B 3P5BA 3DD5A 3REGA 1DJPA 2JIZA 2Q99A 5GWXA 3UIEA 4F2PA 1OI3A 2BH9A 1T1IA 3FNIA 5TX7A 1OB2A 1R10A 1U7PA 2V97A 1TK9A 3ZJTA 4B71A 4ZVTA 2VYFA 4L6IA 3QA3E 1W34A 2I8LA 1SCIA 1XFDA 1X1CA 2GTIA 2YWRA 1CJVC 2Y93A 4K6KA 4ND2A 4D4LA 4L85A 1HRKA 4DREA 5IULC 1ZW1A 3HVRA 1MC5A 4EK9A 1XL0A 1MJFA 2GPAA 2YJTD 4L16A 1CR0A 1VE5A 5TV2A 2PRSA 2XCOA 4XM2A 4KPYA 1I30A 3OE7A 4KTVE 5CFNA 1NULA 1ZD8A 4BCDA 1BGWA 1DU4A 4J2OA 1DC5A 2CJYA 1DMSA 1LW7A 2W0MA 2YXLA 3L40A 3IQXA 4MUIA 3OOYA 5AR1A 2AXPA 3QVOA 5AK0A 2QTLA 3IKVA 3DNMA 4X20A 3WADA 4CYMA 1LDEA 4UD2A 5A9RA 5AVKA 4QJ4A 1U9JA 3BH6A 2CMKA 4D0LB 2G71A 1QDUA 2MHCA 2E4YA 4M8KA 3WWOA 3DZKA 1UP4A 3KALA 3FGOA 2I62A 2TMYA 5A5FA 1EE2A 4W5HA 2GM5A 4KVFA 4OQXA 2R6R1 4XVQA 2ZROA 5G0WA 5L3SB 1DIRA 3V32A 4TXNA 1KYYA 3CRQA 1JNXX 2IOHA 4QU8A 3ZVNA 2ZPTX 2JIOA 3R4CA 2VT7A 3U09A 4I4TF 1WCYA 1YWGO 1NRXA 1HETA 2Z2ZA 3FLBA 1ISSA 5L6LB 4PNPA 1ONNA 1HDEA 1X13A 2OCYC 1YZFA 2XZLA 1Q1NA 3QKIA 4W9RA 4NU0A 3QW2A 1W4BA 1TEXA 3PS9A 2WYHA 4YQEA 5A4IS 1U5AA 4BFWA 4PRZA 3ZWAA 5KNBH 1ZESA 3E4CA 3L0YA 4TLMB 3D8SA 4QAJA 5MN4A 1J25A 1T8TA 2QSZA 1KVSA 5EJ9A 1Q0PA 3I9LA 3MMPA 4G8DA 3MG9A 4TTSA 4A73A 1GPNA 1WPQA 4WAUA 4QULA 1JDPA 4OB6A 3PQ7A 3RK0A 5EQFA 2DFDA 2ZRIA 1QF7A 1UZNA 3MWFA 2I33A 4O59O 2NUTB 3OSZA 3E9QA 2O57A 4F96A 3B1FA 4R98A 1R5NA 2QE6A 4G5OA 4DAEA 5K05A 2HA0A 4A26A 4EEZA 3FZQA 3FA2A 2CZGA 3ZI0A 2HQRA 4KH0A 2HA2A 3I61A 1U90A 4AUKA 3HVUA 3L0IB 3ZU5A 1JEQB 1UP7A 1DWOA 4Q9JA 4C6TA 2R8YA 2BI4A 4KMOA 5DEIA 1VG9B 1GPAA 4NJEA 5DRYA 3TLCA 2CL0X 4AZ0B 2SKCA 1LSJA 4J16A 4DF3A 5A4JA 3W5UA 1YB6A 1SU7A 1M1YA 5E7MA 2ZVJA 4L0QA 3DV0A 4XWKA 1RM3A 2NNWB 4I55A 4ZMRA 4AMVA 4FS8A 5H3HA 1MRNA 4ZPXA 5JNWA 1RRKA 1XAJA 1Z6TA 3UMJA 2QU8A 1RKUA 2DAPA 1OBFO 2Q6LA 2RHTA 3RVMA 2N0SA 4WKBA 3IHWA 4TYNA 2IBTA 3O8CA 4LYYA 3GLSA 5K0SA 3EBLA 3T1VA 1W36D 3FFAA 5KS2A 1JWLA 4MKXA 2YMLA 4Y6RA 4LYHA 3VR5A 2XD4A 1GJRA 3H0EA 5FNVB 1B16A 2BRUC 3VYVA 1QE0A 2N3ZA 1ISHA 3FPKA 5DYYA 4FS3A 5BMOA 5J2UA 2OHVA 1BE8A 4KXUA 2BFWA 5EVJA 5DDIP 4RELA 2A2ZA 2GB4A 4DG9A 2XNHA 1UXOA 1Q6ZA 2ZQZA 3QENA 3LYAA 1XPRA 4Y2RA 1M83A 3X43A 3TTTA 3Q7EA 3R5HA 4TZ6A 2C7BA 2YRWA 2CK3A 1W8DA 2E3JA 4F91B 3LX5A 4ZU3A 3HJNA 4NI5A 2VSXA 5LQUA 1NMXA 1YACA 1U6KA 2BR3A 4TX1A 1IHYA 2REOA 4WVFA 4OG2A 4J03A 2ZK7A 4KR7A 1KBOA 1N0UA 5BN4B 4D96A 4N3CA 4ASUA 4AXBA 3QNMA 2QY9A 4RXUA 3TMKA 4C7VA 1NC3A 3HWRA 3KSRA 1DTWA 3BQMB 3Q2OA 4GU5A 3WNDA 2UUAB 2O8CA 3BCUA 1JDBB 5EUBA 4YRGA 1N1GA 3RSCA 3O75A 4D46A 4GLBA 1ULZA 1QFYA 1JEYA 2BTQB 5D01A 1RKXA 4ZARA 3K2BA 3WMWA 4DLRA 3UJ6A 1NP7A 4K40A 3ICWA 3GN1A 4XOUA 1RM5A 1FZQA 3HCCA 4FGUA 3D4PA 3HKEB 4KDCA 2ZWMA 5FB3A 3VVLA 1I3CA 2CLCX 4M37A 3WWEA 3OKPA 3NVMB 2XWPA 2CNWA 1EGVB 1T6BY 2B83A 1SHJA 2AYYA 2Q8NA 2V8OA 1WO8A 4HWKA 1FUKA 2JC3A 1ZFNA 1E18A 4V24A 3IP9A 5KTPA 1UEXC 5L4SA 1NUUA 1V1RB 3JQPA 3Q15C 4OU4A 3SBOA 2JBAA 2XE4A 7REQB 3DKPA 1PIWA 2CXNA 1L3IA 1T91A 2HPAA 4HX9A 3JQ9A 1DRKA 2IYQA 4B3RB 4CLOB 2Y99A 3B3GA 1DDIA 4HHEA 4PC6A 1CUEA 5CRIA 4LFAB 1V8OA 2V96A 5DV9A 3T7JA 3RJMA 1IPFA 1K8YB 2TMGA 4PCAA 4EQZA 1W2HA 3GGGA 1TM1E 2YDYA 3MWDA 2BGLA 2P2YA 3L4KA 4GP6A 3QFFA 1UPCA 3UO8B 1JDUA 1ZXBA 2W6OA 3NC0C 3TW4A 1DQPA 3QBEA 2BFBB 2RHOA 3G9XA 1O0BA 1GUZA 2BISA 2XB6A 3QEMA 2GEFA 3KEGA 2PKWA 1Z0IA 5DMXA 2RHCA 1RPAA 4F4CA 4AS2A 4ZRNA 2X76A 1VSBA 5JSHA 3C3CA 4Y8VA 5KVQA 3MUNA 2Q3FA 3IQZA 1DC4A 2ASVA 1WSAA 5ALUA 3OX4A 5E6RB 2LGJA 1EFVA 1Y37A 3CLTC 3GNLA 2JBWA 1AURA 4QRDA 2QP9X 2XZTA 3NOQA 4TUYB 3EZ2A 3F73A 4QM7A 4GMGA 4PZ0A 1JLHA 3CR7A 4CCWA 2VRWA 3E2PA 1P3JA 1X19A 5DIZA 3RWOA 4RU1A 3CNBA 3JX9A 4J2HA 3GLHB 2COKA 5CDUA 1UBHS 3D7NA 1X7HA 1G6Q1 1U2DA 1CP2A 1IOZA 2APJA 4K86A 4ML3A 4IMIB 3C6QA 3NHZA 5EKUA 4FPXA 3RYFA 2BLNA 4DMLA 2IOFK 1H9BA 2X0RA 1SA0A 4GLFA 4ILKA 4JXJA 4LI3X 4L22A 4PX9A 4RK0A 1R6BX 2IE8A 3G2HA 3P71T 1IJKA 2W2TA 2YV1A 1C0LA 4MPRA 4NZMA 5JPIA 5BNZA 4CKWA 1COWD 1VKJA 1QR2A 1TX4B 1U31A 4NOKA 1MNQA 5AXDA 5K8JB 1JWBB 4F1WA 3C3EA 4CFYA 1U7WA 2G6TA 5B2FA 2G82A 2X2OA 2WVJA 4JC4A 2EFHB 3SJUA 3RFXA 4RNDB 3ORYA 5EJ7A 2VHZA 1G21B 4G4SP 1KI1A 1OV6A 4GLLA 4NECA 5F64A 4DLWA 3ZKWA 2F64A 1EK1A 1LU9A 1HBJA 3NNDA 3IKMB 4K26A 2J6CA 2NUTA 2QYHA 3RROA 1KKLA 3X1JA 3W8FA 5LP6A 4J7AA 2BTEA 4LZLA 1GU1A 4FBGA 4IIBA 4LTNA 3PFKA 4CMEC 3DMNA 1CY6A 4M6WA 1Z06A 3VAYA 2IS6A 1E3IA 2AS0A 3IQHX 2SNIE 3EG9B 2CNBA 3R41A 5DI3A 3A4LA 4EJSC 4G5QA 3C3PA 4ARZA 4Q9LA 2FMKA 4YCBA 1G42A 2P2NA 4TRMA 1NMYA 3I4LA 5CA0A 2VLBA 4XYGA 2WWFA 2C7RA 3JATB 4NAHA 2DERA 4N3NA 2X23A 4LNAA 4YA6A 1DLJA 3OZVA 1K75A 2Z5VA 4DZZA 1JFTA 3TKAA 5CAEA 1XROA 3ZHVA 1O87A 1EHCA 2ZJ4A 2JFYA 3FVRA 4RE6A 4TTAA 2I3GA 3HVIA 1L1RA 3KKQA 1GTMA 3DXYA 3CJRA 4IO0A 5JAQA 3VZDA 3WB1A 4C3ZA 1I7DA 2XEXA 4LYJA 4I3HA 3NM4A 2QF7A 3INNA 3UJ8A 4MDYA 3DFUA 1H0KA 3OIGA 5HPYB 2BBTA 2IYFA 4LFBB 2I22A 1L4HA 4NDZA 4E3WA 2VHTA 1XMQB 3TCNA 1JQDA 2LW7A 4G0XA 3KOWA 5CIYA 1K2VN 2X8WA 1I32A 3JYQA 3VPBA 2ZSKA 2QA5A 4PY2A 2E5FA 4Z9YA 4MUYA 3ZWVA 4R7TA 5B57C 1SOMA 3DWIA 4CNQA 3WRWA 2OHHA 2X9VA 1C9JA 5CXSA 4E5PA 4Y1RB 3U7QA 5IJWA 2II6A 2QR5A 3TTSA 4RVOA 2Z4TA 3U1BA 3GZNB 2OPBA 2O2SA 3M1AA 4NABA 4V0SA 3O21A 4DJEC 4Q1BA 3ABIA 2AC7A 3BHNA 1GNLA 2XMRA 2RGUA 1ADCA 4NFYA 3FRIA 2WNSA 1Y81A 5ESXA 3BE4A 1MNAA 2BI8A 3S2ZA 1TLLA 4Q7LA 2BSQA 4EZEA 1Y9DA 1C7ZA 4Q15A 1PT6A 5AKZA 5HQ3A 1Z39A 4DKXA 5F1OA 2Y3IA 1ZPDA 5DTQA 1K6EA 1M0TA 1NKVA 3PCXA 4RF4A 4D6YA 1QGOA 1BDIA 2WJHA 4FZRA 3EZLA 1A8UA 1X7DA 4KQCA 3NYRA 4YRCA 2RGGA 1YUMA 1X38A 5BN5B 2ZJ5A 3ZHXA 4BE4A 4DIUA 4DCSA 3PB3A 5AHKA 4XFJA 2QRUA 3N28A 1JLLA 4OL9A 1U7OA 2PLNA 4PXSA 2AJTA 2UZ0A 1PNVA 2ETXA 3OTWA 2VJBA 4F72A 4KYIB 4JB2A 4Z86A 4RPGA 3NJ4A 2C3UA 5J59A 3O84A 5C5IA 5D5QA 2G9QA 2P7IA 1DFHA 2YIJA 4IHQA 2W22A 4Y2YA 1H22A 3AR4A 5AJUA 3RFUA 5HM6A 1JJIA 1NRIA 2G25A 2VVTA 2X2FA 3RYIB 5JI2E 2R25B 2HLNA 5JUWA 1DFIA 2EKBA 2C61A 4KNYA 2GLXA 4GS5A 3U1TA 4QFBA 2AZ4A 2GHQA 3FWYA 5BSHA 5K9ZA 4LQDA 2QV0A 2GCIA 4Q4HB 3K1AA 3SP1A 5IYZA 4KO3S 4AW9A 3FZYA 5KNDH 2NUPB 5DNCA 5GP1A 4YWHA 3C4QA 3JQGB 1A04A 4IMJB 1M0WA 4TMFA 4UKDA 3WP0A 4D97A 2A78A 4AWBA 1DAPA 1VRCA 3CWQA 2GF2A 1JXQA 4OGFA 2NN3C 4ZPJA 2YZKA 4J91A 3UENA 3GOQA 4LMPA 1H42A 1PR2A 2MSLA 3U62A 4CIDA 5BN1A 1JV2B 2JL1A 2XWBF 1V16B 1VIVA 3EZYA 2QNIA 1JH9A 1D7AA 1A7AA 2DSTA 4W5OA 3EZNA 1I5EA 4UDXX 3WLLA 1GAXA 4CV1A 5DHRA 3PD7A 1G5HA 1V95A 3I73A 4U2DA 5JYEA 3EOAI 3ITKA 3ODPA 1E4EB 3P2OA 2H1WA 4PCVA 4V2UA 4ZZ2A 4OXNA 5IUKC 2ZRKA 4DHWA 4V0QA 5AVSA 2VDUE 3TGWA 4MVJF 3RYCA 1F2UB 4G4IA 2EJVA 3S4YA 1K7YA 5AI8A 3TDNA 2O2JA 5I01A 2LDXA 3LT5A 4BZXA 4CN8A 2O52A 4L4ZA 4NK4A 3F4BA 1PZMA 4HAWA 2TECE 1MN6A 2G3YA 1Y9ZA 5IJ9B 4FFOA 4QKQA 2CV0A 1V41E 2VCYA 4AWAA 1F60A 4WQMA 3RSLA 4G97A 1U2GA 2OTCA 3FE2A 3J7TA 2V7QD 1MXFA 3V1UA 1VJGA 3EDMA 5EC8A 3SQOA 4DMKA 4IIYA 2XTJA 3GBVA 4NAVA 1QO9A 1RBQA 2ZRHA 3I01M 3Q2KA 1NP3A 2UAGA 3EVGA 3EWAA 2PYZA 1UAYA 5E4TA 4AS3A 5B4TA 3KP1A 4HAIA 1W25A 2O1EA 1WVGA 4D9FA 4LV5B 4BNWA 2XKKA 2AFIA 1Y5IA 4GT1A 3G9UA 1LNSA 1VA5A 4WZBA 2HWUA 5I7AA 5IAKA 4KFRA 1T4DA 3LQ4A 4I50F 4PZLA 1WHTB 3RTDA 4ND6A 2XVAA 2IUFA 3DFFA 3KZXA 3H8SA 3HKCB 3R8CA 2DH6A 3A4IA 4MJLA 1S3SA 4BNZA 4M9SA 4M98A 4ZIRA 1GRQA 2NVOA 1RACA 3F6PA 5A6SA 2HRQA 3LNTA 3OICA 4BMSA 3ABRB 3V2GA 1XP8A 1ZVVA 2WM8A 3MT8A 1XZIA 1TYEB 2V4ZA 3O2NA 5A6SB 1NONA 4Q19A 1O5OA 5CDGA 3G8DA 2DPMA 5DLEA 4EW6A 1ZCBA 1M34A 4MS3B 2NADA 2QQFA 1PR9A 4OGGA 2BSXA 4TZKA 1KDVA 3TPZA 2HT1A 3RS5A 4K3UA 2ZWAA 1FP7A 2JFUA 4PRLA 4LF7B 3KSMA 2UVPA 1ZD2P 2FG7C 2DCUA 2Z3WA 4KBYA 1V26A 2C00A 1W44A 1G8SA 2W6MA 2W2LA 5F33A 4HFMA 1CNFA 1CYDA 5IX8A 2PXXA 1JXAA 2XR1A 3QK7A 3TOVA 1RWQA 1RWBA 3PQ2A 1KI6A 3KXPA 4EFKA 3WL6A 1NV8A 1C50A 1NURA 1R6VA 1ZUD1 4Q4CA 1D2GA 3SYTA 3KOZA 4BFXA 1I3OA 4TXMA 5JY6A 1TC1A 3AUYA 4RKWA 2H18A 4O4JA 4UCFA 5EQTA 1ABEA 1IUPA 3W1WA 5BVGA 2ID7A 1AUOA 1UMDB 2BR4A 3O38A 1MC4A 1Z2OX 1RLMA 3HBLA 3AY6A 4BEBA 2VNIA 1NNI1 1JG2A 1VPVA 3HHPA 3SCZA 4GZ6A 2CLDX 4JR2A 2AE2A 5IKEA 2O1WA 3LK6A 3S44A 2VR1A 1QNLA 1LLFA 2BFPA 4LZAA 5G4KB 5SYAA 3RYCB 1D2CA 2UZ1A 3L41A 4IJKA 3ZY3A 4HNGA 4R8SA 2UU9B 2Z2XA 4LOLA 3OZCA 3HXKA 1DOAA 1SVOA 3CX4A 4MEJA 3H1BA 1AQJA 1JPJA 5BSEA 4BFVA 3OM9A 1E8DA 5JWHA 2B7LA 1UM8A 3T41A 1GR0A 3UGJA 1TD9A 2IXAA 5EESA 1N2XA 4LJ6A 3L3BA 3B2QA 1TF5A 5JCXA 2RGNC 4WNIA 4Z4GA 5D7NA 2QYTA 4GR4A 3VU1A 5C1DA 2OKCA 4XGQA 2ZBQA 1CYEA 1SHLA 4ODIA 3QG5A 5K2MA 1A96A 1WB5A 1AQNA 1QO7A 6GPBA 4Q02A 3SQWA 1WNFA 3O4VA 5T67A 4G0ZA 4IGIA 3WJAA 4KLAA 2BMDA 3SHQA 4UFOA 1MX5A 1QFJA 3AR8A 1OYYA 1L5QA 3DHYA 2PCLA 3KIPA 4NS1A 2WOJA 1TO2E 1E5LA 2OE2A 1JAXA 2FMFA 3L5KA 4ZO9A 1WHSB 3T3DA 1XLVA 1NNEA 1HDGO 5JDCC 1XU7A 2B0CA 1TM3E 1IHUA 2XOKD 1SKAA 2O8EB 2P1DA 4W7SA 1QZTA 1BA3A 1SU4A 2DRIA 5H4HA 3R3XA 2G8LA 1CJMA 2YV5A 4B31A 5DASA 2ZYRA 3H6KA 3TI7A 3N0WA 1SUFA 4O0MA 1UAAA 3KWJA 2JKZA 4WH0A 5AXAA 3DGEC 1VMKA 3C5WP 3G8YA 5EEGA 3RVNA 4DDHA 5IZ4A 1Z4NA 3FTEA 2UYGA 3DV2A 5GONA 3IDFA 3ENKA 3EXIA 2VJYA 5DISB 4EA7A 3NPMA 4CT0A 2VT6A 3NTUA 2WTNA 2HHJA 3KXDA 3REQA 3OBBA 2EEZA 1JZQA 2AB0A 4XJSA 4DLAA 4AMBA 3BERA 3JYPA 4MITA 5DFAA 1U4NA 3WAJA 2JZNA 1M2HA 2WDPA 1OLXB 2ZIEA 1XDSA 1YZUA 1MLDA 3FZGA 3HSKA 4JITA 1ULBA 4KX3A 2PVCA 4DB2A 1GL9B 1QONA 4E1BA 2PKQP 5AI4A 5EJMA 1FUIA 4YGXB 4KGXA 5TQ0A 4HYEA 1X70A 4LG1A 4Q82A 4WA8A 4YRTA 1MT0A 1Q50A 2W58A 1G63A 1HMPA 5FAXA 5JRDS 3VPCA 2WICA 1EJ0A 3GJXC 2WVHA 1SBHA 1DWUA 3DHWC 4MWSA 3RJTA 1QRUA 2BBOA 1GG8A 1J07A 3NVAA 3TECE 2P3QA 2I55A 4DE5A 2FU5C 3WGMA 1ZG3A 1YB5A 1R37A 2J9FB 1KQFA 1HNXB 3LCRA 2VHVA 4C0HA 1KQOA 1UBJS 4JVMA 1GTZA 2GYUA 2HPZA 2YWFA 5TS2A 3LLCA 3VV3A 2P11A 1E3WB 3W05A 2F4NA 3F7MA 3MCVA 3NKLA 4FXOA 4JB0A 2OA0A 1CNEA 1JFFB 1Y3IA 3Q10A 4U8GA 1X7GA 1CRWG 1OXKB 2OFXA 5DPMA 3W79A 1PFGA 1B93A 5BUQA 1SRRA 3I0NA 1H2BA 3OZIA 2AMLA 2DBVO 3VR3A 4X6XA 1M1XB 2IPAB 4X8OA 4OXIA 5B3LA 3HXQA 4LF8B 1ECFA 3L7BA 5EOVA 4JI3B 3SQNA 3ZWWA 2XYRA 4LZPA 4MQUA 5LXTF 1VJDA 1FLAA 1EP9A 4FHZA 1AUPA 1UMDA 3CW2A 3D54D 3DUWA 4MWEA 2DT8A 1TMKA 4R2HA 4XJXA 4OYLA 5DGXA 3T15A 2J9ZB 1H6DA 4DZRA 1VP9A 1JW9B 1ZM2A 2Z04A 3A9RA 1HDYA 3FRJA 4H7KA 2QTTA 4ME6A 2DHDA 1KZ1A 4HVAA 721PA 1Z2NX 1KH3A 3FOFC 1A9TA 3COVA 2ZYTX 1YJXA 1ISIA 3DB2A 3T4EA 3VHLB 4D8TA 4CI0B 3HEAA 4KC0A 4R4JA 1EP3B 3CRW1 4NESA 4BHTA 3EF3A 1OBHA 2AQIA 2PKQO 4Q34A 3SICE 4A0FA 3L1VA 2G72A 3N8IA 4R9VA 2NT4A 3VJMA 3ZE9A 3H9BA 3LIIA 3UOWA 1BS1A 4CIBA 1KQ3A 1QTIA 4DA9A 3QWIA 5AW7A 3NR2A 5IF3A 4D44A 1QC5A 2CLMB 4PC1A 5CLQA 5A05A 4E88A 3MOSA 5P21A 3RHZA 4B3MB 1MZPA 1C1XA 4F3KA 2WYWA 2CWWA 4L8VA 1XOIA 3UV7A 4EM6A 3THWA 4YRFA 3U48A 5M3BA 1KVTA 1NNUA 2X9GA 3NMUF 2B1RA 4G4GA 3DVAA 3ZZUA 4DXDA 4Q7QA 5KMGB 3ANMA 1IXRC 4RX1A 1CUDA 1LXCA 2E1RA 2GD2A 2D1SA 2VA9A 2XWQA 2GVDC 3BREA 3LUKA 4LZNA 2D3WA 1JG4A 5COBA 1BQ3A 1EFCA 4H6XA 2VG8A 4ZMSA 2CK3D 5CG1A 3QUQA 4G1UC 4DSAA 3IULA 3ZXYA 1MAAA 3P9PA 1Q92A 4O08A 5JCOA 2J45A 1P75A 4BKUA 5BSKA 4H59A 5H8WA 5EJEA 2CFSA 3HB7A 4PHTA 5CXUA 2WMYA 3A1DA 3DTNA 4BQQA 5JRZA 4P0QB 2CLSA 3A70A 5LMNB 1L4BA 1W59A 2JD2A 5DHAA 1T3TA 3QNWA 3VA7A 1FC0A 3BGOS 5HUQA 4ZQEA 1XCLA 4N0PA 2CB0A 3TX6A 1Z88A 2HJGA 4B6JA 5FWNA 1P7ZA 3NC4A 4DSZA 1VI2A 5BNWA 1QTQA 4C89A 3MWLA 1AKUA 2XNDA 3H11B 2V7EA 4HAXA 1NLMA 1ZIYA 1T2FA 4QTTB 4RVGA 3SC2B 5CW2A 1LRKA 2Y0CA 4FKMA 3PDCA 3A1SA 1KNXA 4MP6A 3ZZ0A 1EH5A 2C2KA 2W93A 2W9XA 1R66A 5EJ2A 3VOAA 1NXVA 3IEXA 1LDBA 2C4WA 1PQYA 4KXVA 1WVMA 1LJLA 1NJFA 2D0IA 1IH8A 3Q7SA 3W2HA 1QG6A 5CCXA 1XQ9A 5HSGA 3IOCA 1JIVA 1E4EA 3TWOA 1I1HA 1TQ4A 2PLRA 2WAMA 4A5SA 5K0ZA 4D4HA 3NI2A 4Y0NA 3PHGA 2KBEA 4XW2A 4Q9NA 3VUEA 2C9CA 3D1VA 5K99A 2WWXA 8GPBA 2QLTA 2W2NA 3JD2A 1E2BA 2P2SA 4EECA 1ZH8A 4B3FX 1G98A 1RKBA 2BZGA 5B4VA 2EYUA 4YP9A 2CL7X 1N1EA 4MIYA 5SY6A 1X87A 1FW6A 2XW6A 4L8GA 3FSGD 4LS3A 3DEZA 1KERA 1X8XA 1U3DA 2DWCA 1NJSA 2LDBA 2ZXFA 3KSZO 3P45A 4HDRB 1P7WA 3NLLA 3V4VB 1QJ4A 4FQ5A 1OB5A 3MWEA 4ND8A 1VBNA 4P7FA 4DBZA 4JFRA 3NIDB 2O5EA 4BE7B 1KJ8A 3TSZA 5ITZA 1E1RD 1IRIA 1NYRA 5DNEA 4NARA 4FHFA 1OPXA 4H7JA 3C3WA 3QQPA 4OB7A 1NT2A 2C58A 3RVRA 2O3JA 2FQYA 1HE1C 3JRWA 4PRKA 3TR5A 3MYRA 1OFUA 1YVUA 5A9TA 2PO7A 4RENA 5HCNA 2A4KA 2RHRA 1PDVA 3VR6A 4FHCA 3ND6A 1XV5A 4MAMA 4LTDA 3VO8A 4DLKA 4R8MA 1RQXA 1WD5A 2R48A 3HU1A 4RCYA 5GJCA 2ZJZA 4MV3A 3F3YA 5AVYA 1OR8A 4WOKA 4BO2A 4D0NA 2NO0A 4HLUA 2WF9A 3B9QA 3UKJA 2BEJA 3AFNA 2GCEA 1BXGA 4Z49A 3UB4A 4BRWA 2FSFA 1BMTA 2D7JA 2B7CA 3CR8A 2Z2IA 1U8TA 1EVYA 3I64A 4A0RA 3D1LA 4RL4A 4HZGA 4JAVC 2X7XA 3ZW9A 2PS0A 2I66A 1PG5A 2Q8QA 6REQB 2NT3A 3KAPA 4CMEA 4RANA 1UIRA 2D7CA 1GVNB 3WFIA 4AZ0A 4B32A 1SQGA 2DWQA 4FCWA 3T0IA 4BBAA 1JEQA 4CTKA 2PJZA 1R18A 3JAKA 4G0MA 4BIMA 1YR9A 4D1YA 1UDWA 1ZK2A 2C42A 3OU6A 1SCAA 2ODAA 1GYQA 3I6QA 3TM5A 2FPRA 1CZOA 2ZRFA 4GO1A 1PR6A 4AJ9A 5GZ6A 1HLDA 2OB2A 4CUZA 1LTHR 3EGXA 1L4MA 4UAJA 1NW4A 2WUEA 1NQXA 1V45E 3S2GA 3SBEA 5KREA 1XNQB 2JHGA 2PKXA 2MU1A 5IFKA 1KXZA 3HCRA 2WFLA 3SXJA 1CUHA 2ZJ7A 1OZGA 2IYNA 3DCYA 3HY4A 3L6BA 4IKEA 4OJNA 2VJLA 2HRBA 1TJNA 4CLEA 4TZTA 5C4MA 3EVAA 3JWEA 1ZA2A 2Q4OA 3O4RA 3ZYCA 3EPHA 1GL7A 2Q0SA 4GE0A 4RACA 2Q1TA 4Q4AB 5CLIA 3RAFC 2BFNA 1FLDA 2C5BA 2QRMA 3LDUA 5T5QA 2OOSA 2FSHA 2G4LA 1D4ZA 4UBIA 5MN5A 4LBYA 2QRKA 5AKYA 1M2OB 3D4BA 2MYPA 2QW0X 2BMEA 4U7FA 3G2IA 5ER9A 1F2TB 1JSXA 3QOWA 1J8VA 4JJEA 1QU3A 2V03A 4FE4A 1A3CA 2B69A 1GCUA 3BUSA 4I5DA 1K3UB 2Y0BA 3RK4A 3H1GA 3IKLA 3U7FB 1W4ZA 2PAAA 3M4NA 3PZRA 3P1JA 1X15A 5C5CA 3IHTA 2CLEB 1JLKA 3RG2A 4JY7A 3MS2A 1D5CA 1HT0A 1OGYA 2Q1YA 5T4BA 4N8SA 5FL7A 3R8FA 1U65A 2YY6A 4U7TB 4ZYWA 4P4TA 3HR4A 3DZIA 1JR3E 5JFOA 3PDWA 3LY8A 4HX5A 1PQ4A 3VR2A 1MJ5A 3T5BA 4YJGB 5LSAA 4IH9A 4PZZA 3GUUA 1S96A 3HV0A 4I50A 1RPJA 3A9SA 3FKQA 3K3PA 1HX7A 1NJ5A 4MO2A 5K0FA 3QHPA 3OTOB 3U37A 2Q7XA 4ZANA 4A0SA 1EFRD 2OC9A 3D6HA 4R7GA 4US1R 2QX9A 1EX9A 3NOVA 2FW1A 1A2KC 2I8AA 3A6HA 1ISGA 2OQIA 2BGIA 4YP7A 2XUFA 3VSBA 1NQOA 3HMQA 3PF8A 2R97A 1DCTA 4IUBS 1T9AA 1BU8A 1SHZA 4Q4AA 3PDUA 3WXMA 1WXDA 1PR1A 1YOVA 4KDFA 4E32A 4LXXA 3CVYA 4MUAA 3P2JA 5DYGA 3LDAA 3SOPA 2G1JA 3UJ7A 1O8BA 2IPLA 1S89A 4C2UA 1OBVA 4R68A 1F6DA 2UXBB 3KCNA 4YQZA 5KJ6A 1Q0TA 3CIOA 5IU6A 3FJ1A 4JVOA 3LD9A 5REQA 3L8DA 2B61A 1CG6A 1VPWA 2HN9A 1XTBA 4MKZA 3O4JA 1XMPA 4RSGA 1T9ZA 3FB4A 1L7VC 1YAHA 2QL6A 3RCBA 1XLUA 4HF7A 1TYCA 2YICA 3Q4GA 2OD2A 3ISTA 4H4CA 1GPWB 1M66A 1JIKA 1CK4A 2VHEA 4F85A 1BVRA 5KTTA 1PV1A 1U1GA 4WUTA 5C7IO 3A3YA 1XRNA 4G0PA 2H9IA 5FUYA 5IZCA 3U7IA 4YIKA 2W6ZA 3K7EA 1G7TA 3FJOA 4I4TA 5DI9A 1WUHS 2RMKA 3CFYA 1S02A 5E38A 3W9YA 1MT3A 1WXGA 1Y9EA 2IYEA 4FFWA 3BULA 2P4QA 3X1ZA 2AFHA 2I4NA 5IXSA 1Y3HA 1H8EA 2Y77A 3QBVA 4LRWA 4NRDA 4P81A 2O19A 3O26A 1O6BA 2GNAA 5FF9A 4URFA 2UYOA 4MR9A 4ZCTA 5JLAA 4MV8A 4N12A 3UWKA 1HFJA 1NXXA 2BC9A 4HTFA 2BGJA 2YL2A 3BWEA 1I51A 1V35A 2GBGA 1IIBA 2OHJA 2R8OA 3G23A 3I5AA 4XD7D 3KYCB 4FTWA 3ZVLA 1N8TA 3K9FC 4M4SA 1FXUA 1TMYA 1LLUA 3S3TA 1EU1A 1M2GA 2H7YA 3EOZA 1TTTA 1OZFA 1PTJA 1O9HA 3USES 5AVRA 1MRSA 4WK4B 3B6ZA 3G2PA 3SJ7A 4ENPA 5ED0A 3JY6A 5J47A 3E7PA 2P0YA 3RIMA 4PZPA 1NMQA 4GM4A 3IMEA 4MYCA 3UB2A 2QAJA 1H2ZA 2H92A 1DPFA 2P9GA 3OQVA 4FQ7A 1JJAA 2ECFA 4MWCA 3A2MA 2Q6IA 1ZJYA 4EY7A 4LCBA 1ULTA 3L7NA 1QGZA 2DTEA 1BN6A 1POWA 4JI1B 4EZBA 1MO3A 1UKCA 4WLOA 1UOOA 2B8TA 4IIUA 2HQ1A 2X0JA 2VCHA 4U1RA 2NU9B 1PK7A 1SCBA 1T6YA 4TMVA 3LJKA 1W2WB 3EE6A 3SE7A 1RW4A 3O5AA 1O5IA 4FFPA 1QIHA 1WF3A 3LRXA 3K5IA 1JZTA 4YCSA 3JR3A 3DMTC 4D9JA 1GTRA 2ZRJA 4I8XA 3EZFA 1UPAA 2YZ2A 3IQWA 1BS2A 3LW8A 4X24A 3MJDA 3OLWA 1W9HA 4KAAA 2QMZA 2R7NA 4YJFA 1A88A 2C8JA 2A9JA 1NXSA 5DSTA 2VKTA 1S6YA 1T1EA 2UV8A 3HMKA 2FPPA 4LJ7A 3CN7A 3N8DA 4IDQA 4KE8A 5CITA 3AWIA 3PXDA 5DM0A 4YT8A 5FDFA 3KKZA 2P4EA 4UXIA 1F51E 1C7QA 1E9RA 4HNRA 1YU6A 1HV8A 1QX4A 1W4CA 2C1XA 2ODTX 2EBFX 1NQ5A 4K9KA 5LIRA 2G1AA 1BSVA 3IELA 4WFJA 1DC6A 5DTIA 2QZZA 2IELA 1OZAA 2PCJA 2XT6A 4Y2HA 4EY4A 4BC1A 2ZTHA 1L2TA 4NMXB 1FMTA 4PQEA 3QWBA 4QGAA 3L4JA 3P52A 4BP8A 5KOYA 1KETA 3IXLA 3L8HA 4KSBA 4U0KA 4O3FA 1LI7A 1A1SA 1KAHA 1R9NA 1WTCA 1ADGA 4H18A 1EVIA 2IW1A 2B94A 2PZEA 3L7AA 4JA2A 4RMJA 4FGZA 3O8RA 2PX8A 3C14C 4BN5A 1G60A 1KVQA 2PMWB 3BEDA 3AIMA 3K8ZA 3GMTA 1IMJA 3ND7A 4CODB 2EARA 1P18A 3KKMA 3PBKA 1P74A 5DYNA 5DNYB 3KQVA 1PJRA 2DLDA 4OLBA 1MB0A 3KXLA 3JD4A 1KHTA 3QPCA 1B2LA 3QYJA 4KK4A 5B6PA 1BD3A 2Y1XA 3C5HA 4JKOA 1CW2B 3CNEA 1QBGA 2AUNA 4K9PA 1RPNA 2YZMA 3VSCA 1R50A 3JR7A 3FWHA 5EWMB 3UJ3X 2IYSA 1XPOA 2ODNA 1M8FA 2BGMA 3OU2A 4ID3A 2BEKA 2ZRPA 4DUPA 3FPJA 1T2DA 4EI2A 3OCUA 1BVUA 3ENNA 3AUXA 3LUBA 4EUKA 1CEEA 3M6AA 3A2NA 3HFRA 4TMTA 5AI0A 3IEVA 4DV6B 5D84A 5GINE 1D4FA 5HIKA 1LGYA 3RB8A 3DE4X 1XL1A 1W0JD 1MQAA 3LBHA 3PGLA 2P4UA 3QVUA 3R9KA 3RS0A 4ID9A 1FSPA 5ESWA 4C2AA 2YJZA 4EATA 2QRVA 4MV5A 2B3DA 3QVTA 4BB6A 3T9FA 1TVKB 1SXJD 4TRRA 2YNMA 4G0WA 3OCXA 1IHPA 4BJHB 5FUMA 2W98A 3R6LA 4DLNA 1PW7A 2AUMA 1X3LA 4P0TA 2P8JA 2O7SA 4OK3A 1B00A 4ZZ0A 5LD2C 7MHTA 3GLUA 4N3GA 4LZJA 1Z4LA 3P2MA 5HZHA 1DDGA 3SS7X 1NBAA 3AV0B 3C3XA 1W0KD 2NUPA 1UT5A 2QXUA 5NULA 2XCIA 4GX5A 1AMOA 3DOJA 1N8SA 3DLAA 4HN2A 1Y7PA 1D8TA 4ZAZA 3K31A 2K5UA 3PUZA 4V02A 5DXFA 2JRCA 4Z4CA 4C2TA 5AUNB 4FIDA 3IA2A 3MBOA 2V4UA 3PTLA 2A7QA 5HUHA 3GFVA 2W2PA 4C29A 3HV2A 3ZGZA 2PFSA 3IXMA 1F5SA 1T36A 2E48A 1E9EA 3C98A 4RMHA 1WXWA 2Y4NA 4HNSA 1DUSA 1CZKA 1W30A 2IX9A 2SCUB 5G40A 5B55A 4C78A 1OA0A 2DQZA 4NYMR 1FYDA 3KKLA 1JU4A 2GK6A 3G5TA 5FFFA 2WQ7A 2UUBB 3C7AA 4XM0A 4OM8A 5U1PA 3IDOA 2F55A 1N75A 4QYIA 4LJ8A 4UREA 3FB1A 1UDAA 1ISMA 4W99A 1CY2A 4H4DA 3BTOA 3WLJA 5J1SB 3MAGA 3G2OA 5I4BA 1H9CA 4HAOA 4LQCA 1NYQA 2P79A 1C8KA 1ZNWA 2VJPA 3IP7A 4NPCA 3VH1A 2BZ1A 3D64A 1UQUA 4W8GA 4MV7A 4MGHA 3SX2A 1DINA 4NBUA 3RRZA 3GEEA 1Z37A 4H7EA 4I1YA 5I3ZA 2PGXA 5KCZA 2WT4A 1YOBA 3IL2A 2Z58A 3TX2A 2PPVA 1BRMA 3CB4A 3GJ3A 4A10A 3V7FA 3QVSA 4WEOA 1L8LA 3GFGA 3HVJA 4CKEA 1X7WA 1AD2A 3L6OO 5AVVA 3LRTA 1U5BB 1VA4A 1XZQA 3EWIA 4DRXA 4R5HA 2FETA 2YMPA 1Y8AA 2WJAA 3E9MA 1TEZA 1YFKA 2J6HA 2VRNA 5HMLA 4CKEB 2YX1A 4Y0VA 3BAZA 4EIWA 2P4HX 3LU1A 1LPMA 3F4KA 3NH9A 3W77A 1QWOA 3OFND 2HA3A 2A8YA 3ETJA 4WXMA 3O9VA 2H4XA 2HMTA 1G6OA 3K0AA 1L5RA 1MAWA 3A32A 2Z30A 5FTKA 2ZYSA 2BDEA 3G2LA 1AQ6A 1T3HA 4Q5IA 3DZHA 2BCJQ 5AXCA 3QPWA 4NG4A 4O2AB 2N1MA 3DHVA 1OGIA 1NOKA 3SQDA 2EXXA 3WQRA 2GJKA 3F78A 4J0QA 4LCJA 4O4HA 1E0DA 5BOSB 3CRZA 3ZI7A 1DSSG 1FTYA 2Z8XA 4W1RA 4D92A 2AJBA 3W5CA 1TADA 2ARKA 3RVKA 4I9GA 1QLHA 2CVPA 3AW9A 1PD1A 1GZ3A 2KS6A 3WKEA 4XTCS 1ZC3A 1R00A 2BONA 3AM4A 2N42A 4ZVVA 2OZPA 4AC9A 3K09A 1JG7A 1AZSC 4M8NE 4NFHA 3FCYA 2OMEA 4K9OA 3R3UA 4BAGA 3HN2A 4MA4A 1KSHA 5JTTA 3GRUA 5LC1A 2IY8A 1UFRA 3GZJA 5CGZA 5CR9A 2GK4A 4QNNA 3IAFA 1NFQA 5ITSA 1J70A 2PR7A 3EPRA 3KOUA 2NW6A 5EMNA 5G4KA 2FSUA 2ZIXA 3LGAA 4JXKA 1CEYA 1C2TA 5AJXA 5ALHA 1WAMA 2RGYA 1XTTA 2VF7A 3LTEA 1CJCA 3MB5A 5BYBA 3WLAA 1GFWA 4WWHA 2P1RA 4I19A 2DY1A 3GQBA 3HJHA 3PFIA 4MIKA 1ZR4A 2AYZA 3KB8A 1NVAA 1DAKA 2OAEA 4M0KA 2ZJ3A 3MK31 4CQMA 5CYGA 2OGWA 3LHDA 3BJEA 4QXOA 3F6YA 2EKDA 1JQ5A 4RV4A 3R7WA 2C2MA 1FS4A 2BGNA 5B3JA 2PXAA 4JJAA 3WBJA 1H5QA 3RIHA 1C1HA 4C4PA 5D00A 1UKZA 5DM70 1SKBA 4QARA 1BROA 2AKAB 2QRLA 4HEQA 3QV1A 4RKFA 4K0KB 2O06A 1P9RA 2YS7A 3WAKA 5AVUA 5J4LA 3LUCA 1JLSA 2IGBA 1ZIOA 2JIPA 2O05A 3NANA 1BXRA 1XN4A 3H4TA 4WZAE 1KDPA 5K20A 1PS0A 3DD1A 3OZDA 3W2FA 3L77A 1Q0RA 3RS9A 1UPTA 1EFVB 4LWQA 4FD2A 3HYTA 4YAKA 4BEVA 3LW7A 3PIIA 4HMOA 2CE2X 2JVKA 3AUSA 5BV0A 1TCAA 1FTNA 2CXUA 1Y5LA 4HEA6 2ZJ0A 3D3EA 4KPGA 4RDIA 3VR0A 4EKDA 3ISVA 1DJQA 3LCUA 4NY1A 3R7AA 4UTZA 1L7MA 3KZOA 3RRXA 3SHOA 3TQSA 3VYTB 4BQIA 4MPTA 2OO5A 3TVYA 1Q91A 2RBGA 3X2FA 1R6UA 2RI0A 2WNHA 4BASA 4YJ2A 4HGRA 2GD1O 3WLMA 1I3NA 1O4WA 3OPQA 1VHQA 3EULA 4HJRA 4U2CA 2D00A 3VR4D 3K1JA 3OO0A 2H4FA 5FOXA 2BMWA 2X9NA 4RKRA 1E1CB 3OE1A 2OHFA 1T3GA 3A1FA 3IEMA 3R3VA 1XKQA 1HYBA 1KE1A 3TQCA 3VR2D 4R9SA 3DFMA 2O2YA 2DE0X 4JLAA 5TVGA 2PUGA 5HVNA 4EDHA 4AZTA 2FUEA 2ZSDA 1NKSA 2QTVB 3LSTA 1A50B 3N6VA 3UZUA 2K2WA 4LY6A 1R8SA 4KIJA 3RC1A 3GCZA 4ZDKA 2GA8A 2ONKA 1BWRA 1L9XA 1F6BA 1Q19A 1QQ6A 4Z1MA 4KWIA 1V7PC 1OSNA 1XQ6A 2FP4A 1IZ9A 1CERA 2BTOA 3BN3A 1A8HA 1R5BA 1OX4B 2VBCA 3C8MA 3HLTA 3RS7A 1WNTA 1GKYA 3DMRA 4WERA 2H31A 3G89A 3VXKA 2H3HA 1IPHA 4EPYA 5HYVA 1GDDA 3JVEA 1KKUA 3UGQA 5J3JA 1Y1KE 2C0QA 4WNAA 3WZLA 1F2UA 3PQFA 5JD4A 2WWGA 2R8EA 1JE1A 4GECA 3ZK9A 2HUNA 5AHXA 3T38A 4QGBA 2QJTA 1JRLA 1QP4A 4WK6A 1N5OX 3A1WA 1OQAA 3LPCA 1G4AE 4YYZA 5EJ5A 2HF8A 1E6KA 1RI2A 2P1ZA 4GOJA 1E9BA 3E7WA 3DEJA 1WDKA 1KZHA 4U6NA 4ES6A 4N6GA 1HKUA 1RXIA 3IPCA 4LGVA 4R9UC 4EO4A 2H1LA 1GGHA 5EG5A 2REQA 3BGSA 1QHFA 2QRGA 3MVEA 3OCJA 1R0CA 2ZTMA 4EBFA 2HADA 4JT4A 2BI7A 3S8MA 1M1NA 2JAOA 4KZKA 1CBUA 5JADA 1ENOA 2Z2JA 4MUBA 2W6PA 4XDZA 3WYAA 2W8ZA 3MMNA 4GKJB 3DCJA 2WJ4A 3OESA 4XUEA 1JAYA 1ZC4A 5DB4A 4IV0A 3FDFA 1N6RA 2PG3A 2O5RA 2WJZB 4X63A 5CT8A 2AK3A 3UCXA 2XVZA 1P1BA 3C41J 4KPUB 3RDPA 6LDHA 3RBZA 2J41A 1E0KA 1FQWA 1Z45A 2ZW9A 3E3NA 3NWOA 4HN9A 4OSPA 5FNVA 4AZ3A 2ODWA 1C9KA 1S8OA 2PSDA 3BXFA 4M0FA 5FPPA 3OZXA 3LA8A 3CF4A 2EJUA 3LP6A 2Q4EA 4ZT2A 3U9LA 2FJUA 4JSTA 2QN1A 4IIHA 4MW4A 1US8B 2H5EA 3PJFA 2VSNA 1G1MA 1LA2A 4TM8A 4YR9A 5LNK1 1JLLB 3NGLA 5C46F 2VS1A 1R6XA 5C8YB 4ZCLA 3N2LA 4PYOA 3AL0C 2CNOA 2X2PA 1QIFA 2YHIA 4S1WA 3U3JA 4JSRA 3CY6A 3DBOB 5CA1F 1IVYA 2NU7B 1IUOA 3GLIE 2XKAA 4LVOA 4P3KA 4R9RA 5EPEA 5ES3A 4JYZA 4AN0A 2WTUA 1D5WA 2A5GA 5HS4A 3R4VA 1F0PA 2B8EA 2OM2A 1U7DA 3F96A 5AW3A 1CQZA 2QAGB 1CJSA 2AFIE 3CVJA 2R2AA 3OLZA 1VLLA 1NDQA 1U1DA 3FNQA 3LQ2A 1DKOA 3QVGA 4PPFA 1DAFA 3PNVA 3PA8A 4R1SA 2Y66A 1M2VB 1CRZA 3AHHA 4TTIA 5FWAA 3RPEA 5LBIA 3W2TA 4BB0A 5A9SA 3RFVA 1GLGA 4GX0A 4NICA 4S1OA 3C6XA 4BFZA 1UKVY 1DT5A 4EA6A 5KSZA 3V1LA 2AZMA 1K66A 3TB6A 1EI9A 1NW3A 1QX3A 5ECDA 3CUEF 4F1KA 4RD6A 3ZW7A 3F5DA 3ZNPA 1XRSB 5B7PA 3CVXA 1DIGA 1VJTA 4JX8A 1ANKA 3CF2A 4R2IA 4DMUB 4HD8A 3KOXA 2DWUA 1ODJA 3H2ZA 4IINA 3T5GA 3U4QB 2J0SA 3ZZNA 3AQIA 4Q9HA 5FFNA 1Q2UA 2NUAA 5JS6A 4XD7A 1YR6A 2XUZA 1I6LA 2Q3DA 2AKYA 2ZB2A 4EVIA 4FSHA 4DY4A 3F9RA 3IAAA 5BR1A 3THXA 3U44B 4EJSB 2XMQA 3VI3B 2ZI6A 4ESVA 2X5NA 3RVDA 4QC2A 2R0QC 4E46A 3JAWB 5HBRA 1XAGA 3EWSA 3AZPA 5JRJA 4C3UA 1MAHA 1HSZA 2UUOA 3FLEA 1MCZA 3CF6R 3LXMA 3OOHA 2IHNA 2DY0A 4G07A 1SWWA 2YJ4A 3HU2A 4HK4A 4KO4S 3P4YA 1DKRA 2Q1UA 4JGBA 2NZWA 2YWCA 2PL5A 4WY5A 4QHTA 1GTVA 3L0DA 3GNTA 5D86A 2G70A 2QMOA 3DAPA 5AM1A 2J9YB 3P19A 1SULA 3AUFA 1QQ7A 4MMZB 4ZVQA 1K4KA 3FOZA 4K6FA 4JBGA 3ECCA 2V55B 5FD8A 2SICE 3GARA 1T1JA 3FPSA 1RXCA 3HE3A 4BBJA 5BOSA 1F7UA 1KYQA 1WE2A 2C98A 2GZAA 4DIKA 3QUSA 5DCUA 3DHEA 4ENTA 1IBRA 4Y0AA 4I1SA 5GMOA 4RGQA 2NO1A 2YN4A 1JQ3A 5G3ZA 2AFVA 2WJVA 3LPDA 3DKRA 2PVSA 3T54A 3B8EA 3HADA 4XOIA 1KOLA 2I65A 3N58A 3K9HA 4MWTA 1TGVA 1EFHA 3BXHA 4QQ8A 4FFMA 3CEJA 4P32A 2I3DA 3RUFA 3HI4A 3PWZA 1BO6A 3PRKE 4XGIA 4I4IA 4AMZA 4DV5B 4GRIA 1FRNA 3BCRA 3SZ3A 1KBZA 3QLJA 2GFQA 2XCTB 4BX0A 5HA5A 2O8FA 5FQOA 3TIVA 1HI9A 1P2UA 3UUFA 3DPUA 3ZKAA 2I03A 4ZRDA 4YIHA 1ZYUA 3LWNA 1T8YA 5JPCA 2R3SA 2ZR8A 1XYYA 3A9CA 1EEXB 5KKNB 1KP3A 1VKHA 3H5WA 3OT1B 3RKRA 3ZGXA 3G85A 1W0KA 2IZ1A 4QBTA 1YJ8A 2G7ZA 1LK0A 4LVNA 4WNCA 4MGYR 4MCIA 3UM9A 1JFSA 1G8GA 5A9SB 2IS2A 3KOYA 2Q6OA 3DBLA 1R4MA 1M6VA 1RKQA 1WUIS 3NHFA 3PE3A 3SC3A 4YBRA 5E3IA 4PLYA 4ZAVA 2YXDA 4PN7A 4ZGBA 2RK3A 1GUDA 1IL0A 3VO9A 5KTRA 3EEOA 4OB8A 4GD3Q 5ALNA 4FW9A 4PFSA 1DIOB 2HPVA 4J6FA 3B5JA 3MC1A 1E1QA 2FWIA 4DC9A 5JW6A 1FVFA 2VRCA 3SFVA 1E2JA 4P3XA 2OBYA 1TU3A 1NUQA 3D0KA 4LQ4A 1DELA 4HUQA 5CCEA 5JNRA 4XWTA 4OHUA 1NN5A 1DWPA 1U8XX 3DONA 1XKLA 2B20A 2BHNA 2YW2A 1CUBA 1DFGA 3KB2A 3ITDA 4JMLA 4NTZA 1NGSA 3IDZA 3HJCA 4N8EA 5L40A 2VWPA 1C3JA 1LZKA 2F67A 2FZEA 3GWZA 4EFMA 4V3CA 5IWAB 3N5CA 3RHSA 4YAIA 4RHEA 1PAUA 3D5QA 1WMBA 4WXHA 1WW2A 3I6MA 1JBEA 1EHYA 3KAKA 4QTXA 4LSZA 3QKSB 4K9RA 4C4RA 1O5TA 4TGLA 4L95C 5KJFA 1JJVA 3NEAA 4WIAA 2BKLA 2P62A 3KHSA 3RLFA 4GBED 3ZIAA 5B2EA 4X66B 4M0MA 1U6JA 1WPGA 1P9NA 3DUFA 1W93A 2Q62A 1FA9A 3PFFA 4H2DA 4B6PA 4NPAA 3Q3EA 4AI6A 1AKQA 1OOEA 3AVOA 1JXOA 2VPZA 3TXXA 4DLPA 5LYJB 3GLFA 3KBBA 1KJNA 3WL3A 2QMEA 3ANXA 4I1IA 3TIFA 4X7MA 4ZD6A 3UXHA 2ONJA 3DCIA 4O4JB 3BL6A 1LK7A 2C94A 4MUEA 4U7WA 3RG8A 221PA 3IGFA 1MJNA 2X86A 4M54A 4MHOA 1BU5A 4OV6B 4CF7A 4UW9A 3GAZA 3BGDA 3OQ6A 4WKNA 4HGOA 2WLSA 3SR0A 3H1TA 5F2NA 2CYBA 1V5EA 2ZB3A 1BVYF 5BOVA 1FFYA 4P7GA 1N5MA 2WSIA 4GI7A 3DXFA 3E23A 2AWNA 1KTVA 3L7MA 3E7DA 4Q1CA 5F73A 5CG2A 2G07A 2QEQA 4LW8A 1XKTA 5CIQA 1Z4QA 1WCIB 4CKYA 4EUHA 2WFAA 5TMEA 4HDSA 5G2OA 4E4RA 2E4XA 3E9ZA 2GSWA 4LHSA 3RRMA 5HOEA 1NQAO 4HV4A 4QLAA 2DUMA 2PGJA 3AFGA 2PFKA 2OK7A 4F4IA 2E4UA 2F9MA 1UWVA 3HUTA 4N6OA 1OX4A 3S28A 3JWGA 1Y1RA 3I5YA 1M6EX 1G3IA 2P2DA 3DZCA 1PZGA 5AW0A 4BVJA 1YR7A 3PC8A 1PJ8A 2OCAA 2VHYA 3H4IA 2FDCA 4Q1VA 1W19A 1FY2A 1GUYA 3GVXA 2F43A 3NOXA 3ZHCA 2BGWA 4BVLA 1MDBA 4OLHA 4DQ0A 3F3KA 3KZMA 3GP5A 4OJYA 3T3MB 3AV3A 5EYPB 5H16A 3UJHA 1BJRE 3IOMA 1MV8A 1AB5A 3ANTA 3ID6C 3E7FA 3HKBA 3NFYA 1TE2A 4TLEA 1A8QA 3RUIA 1H2XA 2HKIA 3ETHA 4B44A 4RTLA 1R5JA 1ZL0A 3FFWA 1H8HD 2V7WA 4G0QA 3AB8A 1SG6A 2YIMA 3AETB 3B9PA 2IDKA 3AI2A 5GVSA 5M5BA 2QU7A 2UXDB 4MGEA 1Z5GA 1T5IA 1T8RA 1PL0A 3AX6A 2R7LA 1P5HA 1U5CA 3EQ6A 3HNPA 4ADSG 4AG5A 4AVYA 3DLBA 3P5SA 3GQVA 5CPFA 3ESYA 4J0EA 2D0OB 3KNZA 3ZI4A 4E7OA 3DYIA 3L7KA 3NM6B 3QA9A 4H60A 2R751 4O2BF 3TZBA 1ZM4A 2PUBA 4INPA 1THMA 3J80A 1PG2A 2J08A 4PHHA 1REQA 3JQEA 1A5AB 1G8JA 2HCFA 1F8FA 4FDUA 1POXA 4F3YA 1YV9A 2ZUEA 2WB4A 1XHEA 5IEJA 1I24A 3HCBA 4MV0A 1TCUA 4QDUA 4R8VA 5FUXA 1V0JA 2VRCD 1B8UA 1I01A 1K08A 1RQ7A 4L5JA 1FRQA 3W8DA 5LKAA 3ETLA 3QXCA 2Z98A 3IIEA 3LY5A 1YS4A 3LBAA 4D3ZA 3ZE0B 3U61B 1RLJA 1ZDMA 4M9RA 1QGYA 3E5NA 3ETDA 1K7CA 3F6BX 1GD1O 1U2QA 4P4SA 2Z9DA 2OGZA 2ZU0C 1U2PA 1ZGZA 3SNKA 1T4CA 4DA7A 4RSRA 5MGNA 2FGJA 2VZEA 3PUXA 4PRYA 3TLBA 3UMFA 1L5LA 3U19A 3IV9A 4Q9AA 3RSQA 1JP7A 2Z3ZA 4P9NA 1FCJA 4FGJA 1P1JA 3D8TA 2YCLA 1R0RE 2XGSA 4WV3A 1XTRA 3K0SA 4M7OA 1KEZA 3ANYB 2OFOA 4KQ9A 4C7OB 2ZIXB 1GPYA 1BKSB 3I2FA 1XDGA 3OKCA 4O02B 1TTHA 1H1LA 2Y8EA 2VQ6A 1SIOA 4UVHA 3W9SA 4X1YA 3IAXA 5GIOE 3EEFA 4AQYB 2FEMA 4BLSA 1E3JA 2W6JA 3V8RA 3DHNA 4DCGA 1LK5A 3AU8A 3TRFA 5IDWA 5FNZA 2VDNB 1ZHFA 3JTEA 2Q6TA 4OHOA 3LIPA 2C88A 1F14A 1IJBA 1XWWA 5LZ5A 1XU4A 4G84A 3PGXA 1R6TA 3PHLA 3Q7QA 1Q0QA 2ZBPA 4L9WA 3EVTA 3PQ5A 3I2JA 3RR2A 1QRRA 4BNDA 3PWSA 5JMTA 1C8LA 4HDAA 2J3HA 3PA6A 5GJBA 4RY2A 2CFOA 1TFRA 3P2IA 3CEAA 3C48A 4L3WA 4MWGA 5ESRA 1A2BA 1V11A 4EG6A 3BKXA 3EXHA 4KYVA 4GHWA 4BUCA 1FMFA 5HIJA 4WLFA 4EG7A 3B6KA 4DA6A 2FPMA 4RABA 4OQMA 4Z3DA 4Q9DA 3ZY4A 1M6VB 4B79A 4XB6B 3ESCA 3HJAA 9LDTA 5BVHA 1QV7A 4NZ9A 2OVBA 3F8TA 4B83A 1BRTA 4JROA 1PDWA 4MVJP 5DLYA 2J9GA 3GP3A 5CCBA 1D04A 1Q11A 3FNFA 1AXRA 4TTTS 1N2CE 1D0IA 3WGYA 2PZMA 2B3TA 4TL9A 3I2YX 3JQDA 2FV8A 3CYFA 4C21A 1RR6A 3MM4A 1H3EA 1I6KA 5G53C 2PKEA 1XZKA 1N77A 1HOXA 3KQMA 2NU6A 1VPTA 2D8MA 4FYMA 5CB0A 3SZGA 1HPLA 1PGQA 1KY2A 1HE3A 1F8UA 1AG9A 2O2XA 3BXGA 2XITA 3UUWA 1QFSA 1WUTA 3TQTA 1OWLA 1U0EA 4FIZA 2GZ1A 4O2BA 1PT7A 5C18A 1YGPA 4ENQA 1X1AA 3ZQUA 2O2IA 3M6VA 5DLPA 1QJCA 2H59A 2Y67A 4J3NA 5CVCA 1SCQA 4GLJA 4YUAA 5DJ5A 1J21A 4W5QA 1Z22A 4WEQA 3VSDA 4PX5A 1NUAA 3DM5A 1YZGA 3KXKA 5AFSA 1KMQA 1EYZA 4YJGA 3LHSA 4X3PA 4ZCRA 1B23P 4ZAGA 1JJBA 2JCXA 1V3QE 2ZUSA 4IYJA 4HFNA 1Z6ZA 2M6RA 2NP7A 1BAPA 4W9NC 4EHHA 5D85A 4TMZA 1Z13A 1FDTA 1JPVA 1G20A 3DEHA 3GCXA 4H0NA 4JC8A 4F3CA 5JOQA 3N7UA 5KNDA 1GZ7A 1WM1A 2O0KA 4UE2A 3NHWA 4BRUA 3U4GA 3LV8A 3EAQA 1SUPA 1JMKC 4D98A 1PJ3A 5HS6A 1C9NA 2XAAA 4MP8A 4QPNA 1AQUA 3BFVA 4XQEA 2FKNA 1IVNA 3C74A 4HS4A 3BWDD 1U7TA 2C97A 4OJQA 2VF5X 3UJNA 2FSGA 4LX0A 1GNRA 2AGVA 5CW1A 2R5FA 4AUEA 1GPBA 3WWCA 1E92A 2EBWA 4WZAB 2I80A 5JH7A 1GAEO 1LQ2A 1Z8FA 2ZJBA 5E9AA 4DEVA 1JHQA 4XIIA 3PLNA 3MEQA 1W46A 2OWEA 3C3KA 3ZHQA 1UPBA 4FFNA 1L7EA 4LFCB 2YJ5A 5JARA 4F5EA 1E64A 1XR3A 4EBBA 3VU3A 5K8UA 3BZUA 2CCKA 4DSUA 6AT1A 5ULLA 2IF0A 3KR1A 1K7SN 1ZH2A 2QN3A 5KJ1A 3GLHA 4P1ZA 5I9BA 2JANA 3HCAA 4QOHA 2Z1MA 3WMRA 2UXCB 3FCSB 2V6IA 4TT3A 3HC7A 3HABA 2CUZA 5CYFA 3AY7A 2FW6A 1I9GA 1SOVA 1ML4A 1USIA 2YVLA 1GA4A 2YXBA 5I7FA 5DU2A 5K09A 1LFAA 5KNLA 3C4JA 3KWFA 3FWZA 1CF4A 1REQB 2WF6A 5ENDA 2FZGA 1UJ6A 3TRDA 2FQXA 4QJBA 5P8WA 3AFIA 3L8MA 5FRDA 2BGTA 4G5FA 4KXNA 3ZDDA 4JI2B 1BGXT 5KTNA 1M5UA 2FPWA 3V1MA 2UDPA 1TAQA 4BVEA 1B6RA 1Y5MA 1SUEA 4M0EA 4P86A 1E3LA 5JSZA 1CUXA 4IFBA 4YMTA 1O9GA 2XUOA 1XC7A 3ENQA 3GLKA 5FBVB 2ID9A 3K1ZA 1U7UA 5K0EA 2HV8A 2P9BA 3MWDB 1KL7A 2M6LA 2X8LA 2NPOA 1ZIXA 2VYQA 3AF0A 1I7QB 4NNJA 1IRXA 2ZYIA 3DYVA 4JLJA 1FJGB 1Z4MA 4OHRA 1RXWA 3SM9A 5T4HA 3SYLA 2N46A 2VJQA 3A04A 3RYHB 2JHFA 1GAWA 4OJTA 4KR3A 4MHSA 5AIBA 4U7DA 3TO5A 2ZUVA 2YN2A 3ZWXA 4U6QA 2IUTA 1ZW6A 2J85A 3BXEA 1WZIA 3EEIA 3FTPA 3GRYA 1KSJA 2NYUA 1FW8A 3QELB 4ZEOA 2LZ0A 1R1DA 1VBFA 2H08A 3OHMA 1W29A 5HF8A 2W71A 3TTYA 4YASA 5EE3A 4CZ2A 2GWRA 2ISSD 3DQQA 3PC3A 4MVJG 4N47A 4B0OA 4C0XA 1XMXA 421PA 1DKLA 3WRXC 4J0KA 1XRMA 2VHWA 6Q21A 1K3FA 3E7XA 3ILHA 2JGFA 4KBGA 2F48A 4KBFA 1QXSA 4B2YA 1Z35A 2VNJA 3EBOA 1IZ8A 3CLUC 2NQ8A 2XLCA 1H69A 1D2RA 1P1FA 1WG8A 2ZUDA 3BK1A 4R05A 3E8MA 3HP7A 3QE3A 2HT6A 2VCEA 4R8KA 4MRVA 3L8EA 2VAXA 2Q9CA 3ZJYA 3JXEA 5B58C 3GAFA 5ALIA 3A4NA 2AMVA 3NBFA 1YR8A 2VZ0A 1EFUA 4AP9A 5LU8A 2IYOA 1TZMA 2VPWA 3TQIA 1UOPA 3NAZA 3CCFA 2RH9B 1NZFA 3Q2IA 5BQXA 4PW0A 2Z57A 3HVKA 5AI5A 3WLNA 3CZMA 1YZQA 3IAUA 2QTCA 5SYMA 1DIBA 1N3BA 3WSWA 2FF5A 1XZGA 3U80A 4UE3S 2RGAA 4ZVNA 2GRAA 4EO7A 3FPLA 3JSAA 1Y5RA 3O3NB 2P2GA 4WK0B 2Y05A 1ECCA 5LOVB 4Q1AA 2W83A 3CVWA 2QTGA 4Z0HO 1CIJA 1JVBA 2EJWA 3NASA 3TQFA 5AKGA 2IYWA 2AZXA 4DV7B 4RE5A 2ZIUB 1QGAA 5I9SA 4LY9A 3RYIA 4B35A 3AR2A 2QRQA 3OM8A 4PO3X 4G63A 4CQMD 3OLYA 3H5IA 4FVTA 3PNYA 4M1KA 2MIIA 3M0EA 3D2CA 1H0SA 1PVVA 2R47A 1B26A 2FPSA 3ZBTA 4KXFB 2WPNA 3TJMA 4FWTA 1SHTX 3LK7A 1BXKA 3IDQA 1TNDA 4BQFA 1RIIA 4JLOA 4REQA 5H68A 1QNFA 3M1YA 3SU8A 2WOOA 4DNOA 3FUVA 2FZWA 1E58A 3PFCA 3RSGA 5M29A 3TCKA 2C92A 2ZSBA 3N2GA 4GEGA 3AF2A 4UMDA 1GAJA 1C3XA 2Z5GA 3JYNA 3PKIA 4XB2A 3VQTA 3WBKA 1NN0A 2OHGA 2Z1NA 3ILVA 1V1MB 3CUYA 2ZSUA 4FWIB 1LSUA 2G17A 4YV1A 4ZYTA 4UEOA 3ECAA 3OQMA 1GZ6A 1IZ7A 2YIDA 3NOOA 5BV7A 1IN4A 1RWWA 2FMHA 2X3UA 2XVYA 3DDOA 7YASA 4IVRA 3N3BC 3SXUB 2CB9A 3FX2A 4S24A 1CQWA 3QSYA 1RPZA 1V8FA 5BR7A 1RWPA 4PFKA 3E61A 4ISBA 2VUSA 2FDXA 3G9TA 1BW9A 3MGCA 4XEHA 4D3DA 4L9RA 2V6MA 5F3WB 3CONA 1ZSYA 1OVMA 1HQCA 1K86A 1N4DA 4WKCA 5DYWA 5ERXA 1YQUA 4CMIA 1RC1A 2ZI4A 2IL1A 2CBGA 2ISCA 2V7TA 3EISA 3EOBI 4D82A 2C4VA 3FYCA 1L5GB 1G0OA 3SSMA 5KQMA 1VMIA 1H4VB 1YOVB 4HRXA 1I9CA 1L4EA 1QB7A 4CHTA 1ZU5A 3GJSA 3HDVA 4MR7A 2OZLA 1T4MA 1VBMA 3QKUA 3CUVA 3R8XA 4D9NA 1NF2A 1VLHA 4LI0A 2FW8A 3P2EA 3P0HA 3C3DA 2FWBA 4GUAA 4L5CA 2JGKA 4NVRA 3EDCA 3LP5A 3U9TA 2VJMA 4MIOA 2OYSA 3WWDA 2FUG6 3A37A 3L4BA 4I1VA 5A4KA 1U02A 3P9IA 3JQ8A 3I05A 4C30A 1RMTA 5A7FA 3GYGA 2PBRA 5F98A 4MYUA 4IJWA 1JU9A 2B82A 3A25A 1DP4A 1SKQA 4FUTA 1YD7A 3K0CC 1USVA 4RF3A 2DU8A 2Q3CA 2RK4A 1G20B 3MSCA 3OCCA 1Q7BA 3PNKA 4OH1A 4R31A 3G0OA 3N75A 3CX8A 4Q3LA 4JH0A 5J4KA 3DOOA 4QQNA 1IWBB 1D4OA 2QD4A 1EVEA 3QFSA 4UD6A 13PKA 2F1HA 4GGMX 2NO4A 3G1TA 4QHYA 4U2EA 2YJ3A 4G1EB 1C0PA 3DCNA 1E1YA 4L9SA 4YN3A 5I4KA 4G81A 4EKYA 3THXB 4HSGA 4QQRA 5A7HA 3V7UA 2QS9A 4Q3AA 4ZEWA 4D4IA 4PWZA 1Q44A 2YUTA 2J4DA 4P80A 1CZNA 1FU4A 1YBFA 2AYXA 2DKNA 1BMDA 2HZBA 3FTNA 2BE9A 3QUCA 3UJBA 1TA0A 1E6LA 4QBGB 5L51A 1NIJA 2C4UA 2GN6A 1I33A 2VYNA 3EA5A 5DW3A 3PICA 2HQSA 4E31A 1N7JA 2HX1A 3JQ7B 2GHIA 3A0UA 2VP9A 4N5HX 5JJIA 1MC8A 10MHA 2J67A 2WHPB 2HBYA 2QVGA 3I23A 3KB1A 4NCBA 3M6UA 3SNHA 5IBCA 4M8SA 4BVFA 3WMXA 2AR0A 3BMNB 4B3CA 3G7UA 3PNMA 4G25A 3F90A 5FWYA 3L06A 5CA1B 1ZN8A 1JQEA 3JASB 3OCVA 3OMWA 2ZYVX 3QVGB 4MLZA 1X2EA 4R8LA 4UQOA 4WJZA 2BHRA 1UZAA 5AKJA 3OE4A 4EI9A 5CEFA 3H5NA 1JT2A 2GMWA 2ZZNA 3R7FA 4AX8A 2JLAA 4YPOA 4XKJA 4YRKA 3A0RB 4KB5A 2DBQA 3RTGA 1UFQA 1GIAA 4XE5A 4CEHA 4NV1A 3A7EA 2AUTA 2XGMA 1H4QA 2EBHX 1RU3A 1YDMA 3E8SA 1QOQB 4OMUA 4DLZA 2QGNA 1U2GC 2I71A 1KJZA 2ZM6B 4RMIA 2CNKA 2H54A 3AMVA 1A4UA 1KRHA 1PLKA 2J09A 4KV9A 1V37A 3WLSA 4KN5A