5IT9A

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
206
structure length
206
Chain Sequence
SLPSTFDLTSEDAQLLLAARVHLGAKNVQVHQEPYVYKARPDGVNVINVGKTWEKIVLAARIIAAIPNPEDVVAISSRTYGQRAVLKYAAHTGATPIAGRFTPGSFTNYITRSFKEPRLVIVTDPRSDAQAIKESSYVNIPVIALTDLDSPSEYVDVAIPCNNRGKHSIGLIWYLLAREVLRLRGALPDRTQPWAIMPDLYFYRNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
molecule keywords Ribosomal protein uS2
total genus 41
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00318 Ribosomal_S2 Ribosomal protein S2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 5it9A01
2PGIA 3BCHA 1G98A 1J5EB 1IBLB 1HNXB 2ZJ3A 2VF5X 2UUCB 1N33B 4DUYB 3QKIA 4LF4B 1XMOB 4DR3B 1I94B 2CXTA 2PUTA 3J7AC 1J5XA 5LL6P 2VF4X 1B0ZA 3I0ZA 1VIMA 3LJKA 3FXAA 3J81A 4YHHB 2F4VB 4LF6B 4DR5B 3C3JA 2E5FA 4AQYB 1MORA 3HBAA 3Q88A 4JI3B 4JI4B 4DR6B 4JYAB 1VIVA 2XHZA 2UXBB 1X94A 1C7QA 2CXNA 4DR7B 4K0KB 4DV5B 5IT9A 2CXOA 4JI1B 2ZM6B 1Q50A 4GKJB 1XTBA 1X9IA 4X65B 2YVAA 4NXNB 4DV2B 1U0EA 2ZJ4A 4OX9B 1DQRA 2VQEB 4NXMB 2A3NA 4M0DA 1ZZGA 1X9HA 1HNWB 2CB0A 1IATA 4JI2B 1IRIA 3T1HB 4DV0B 1GZDA 3JX9A 2CXQA 4X64B 1IBMB 2CXSA 2Q8NA 2WU8A 3M5PA 3PR3A 1VI5A 1HR0B 5BY2A 1U0GA 4JI0B 4LF9B 4GKKB 1NRIA 2XBLA 4DR1B 2UUAB 4B3MB 1JXAA 4U6NA 1JEOA 5I01A 1KOJA 2HHHB 4TOIA 3HJBA 4IVNA 1MOQA 2CXRA 1C7RA 4LF8B 4X62B 1JIQA 3UJHA 2V4MA 4B3SB 2DF8A 3ETNA 4B3RB 3FKJA 1HNZB 4DV6B 1M3SA 5IWAB 2O2DA 4YY3B 5BR8B 4LF7B 2E5LB 4LF5B 5LMUB 4DV7B 1FJGB 2CXPA 1IBKB 3ODPA 1XNQB 3SHOA 3TRJA 3J80A 2UXCB 4X66B 1JLHA 5A2QA 3JAMA 1XNRB 5LMNB 4JI6B 4JI8B 1N8TA 4AMVA 4B3TB 3NBUA 1HOXA 3CVJA 2I22A 1X92A 1N36B 3Q7IA 2PUWA 1TZCA 1TK9A 2CXUA 4JI7B 1WIWA 1NUHA 1N32B 1T10A 4DV3B 3TBFA 2UUBB 4DR4B 2UXDB 3G68A 1XMQB 3EUAA 4LFBB 1VI6A 3FJ1A 3FF1A 2VQFB 4LFAB 2UU9B 4DR2B 3KNZA 1GZVA 3T1YB 4JV5B 2AMLA 3IFSA 4KHPB 2PUVA 2POCA 4S12A 4LFCB 1TZBA 3BJZA 1U0FA 2O2CA 2I2WA 2DECA 4JI5B 5FLXA 4DV1B 2J6HA 3OOJA 2CVPA 2X3YA 1N34B 4DV4B 1MOSA 4DUZB 3OTOB 4LZJA 4S1WA 4EM6A 1HM5A
chains in the Genus database with same CATH superfamily
2YRXA 4QUGA 1E9VA 3J7TA 2YNMC 4H7IA 4EFKA 1RLUA 2AK3A 1N2SA 5JEDA 4OOEA 1PDOA 3VBEA 4AJJA 3OQNA 2P9EA 3Q7EA 3VPFA 2AJTA 1XZCA 2H1RA 9LDTA 4Z7NB 1M6NA 2QT1A 3O4FA 1B0ZA 1X2BA 4HFNA 3N87A 3T06B 3T61A 3P8ZA 4J6FA 4LV5B 1CB7A 2MYNA 1RFLA 5AHRA 3JAWB 4LYGA 3VR2D 1YL5A 1VLMA 3C6KA 1JHPA 2WVHA 1MO4A 4OP1A 4EKGA 5C8DA 2MJLA 1V8OA 2I55A 1FF9A 1NJ6A 5EA2A 1US8B 4PTZA 1NVTA 2KX7A 1KQ3A 2RGNA 1EMDA 2WWXA 4G0VA 2QPAA 4HDKB 3TWOA 1MPXA 4QRDA 4Y6RA 1TMGE 3O4GA 1JEQA 6YASA 4YO7A 1H4TA 1QKIA 2GDZA 2QJOA 5AK0A 3N6RA 2XVYA 3F0TA 1T1IA 4K6GA 2ID7A 1K7YA 4GX2A 4FWBA 4EHKA 1LQUA 3WYGA 3B3AA 3KQHA 3EXIB 4RPGA 1MABA 3UZUA 1J0EA 1X39A 3G3EA 1CJUC 1P7YA 4IHQA 2AKAB 2PLFA 2RD2A 2PLRA 3X1MA 4KIJA 4QUIA 4D4LA 3OBBA 4FOSA 1B2RA 2OQRA 4YONB 4B09A 1RHRA 2NVWA 3FVTA 2KHZA 4KR2A 2CKDA 4ZALA 4JBWA 1JIIA 4GI2A 3BA6A 3NIGB 4U63A 5JY6A 4D02A 1P9NA 4MVJD 4GGMX 3K2IA 3MJTA 1UC9A 2DXIA 3HY3A 1TFUA 2BGRA 4CMKA 4LMPA 3H16A 3IEVA 4AU1A 3IPYA 4ZJYA 1E2DA 1M1YA 2QENA 1EJBA 2GWHA 3BGSA 4I1OA 2XR1A 1OH7A 1ZO8A 4QOJA 1JILA 4M0FA 1K08A 3F6EX 4MP8A 1TM1E 4PZLA 3TTXA 5LD2C 4F9EA 3OMXA 4GX5A 1Z6AA 1DEKA 2B2NA 1Q3HA 2VSOA 3O8CA 2ZSHA 5HMMA 1TEVA 3MGKA 4Z2YA 3T0GA 4KXXA 4URVR 5T67A 1BEZA 4JLNA 4ND8A 5KBYA 4S1OA 1XZGA 3UMGA 3EIOA 4TUYF 4ENRA 5CEFA 3UMBA 5JANA 5F1YA 5DGDA 2X9LA 1LV8A 3OJCA 3PPWA 4ZAXA 2HA3A 1ISSA 3P20A 1KPHA 2WG0A 1G38A 4RC9A 4UUBA 4EMBA 4FI3C 2RIPA 1EDBA 4Z1OA 1IY8A 1BWSA 1M8PA 1NXWA 3F5DA 3R5JA 5E95A 3V34A 1U2GC 1T10A 4N54A 3TD9A 2XF2A 1QOZA 1UBEA 1M67A 4IIVA 3WE7A 1HWYA 1KO1A 1EBBA 3RRXA 4P4GA 4O4HF 2PSFA 2VQSA 3IB3A 4OIFA 4Q4JA 4AZTA 4ISBA 5H9VA 2YY5A 3W2GA 1NI4A 3L4EA 1QCZA 2IUEA 4ZVQA 3OIFA 4EATA 4I4LA 1QP7A 3I2YX 1CP3A 1HT3A 4LHWA 2OCIA 3F71A 4RL4A 1NASA 1KHHA 1XDSA 3HJNA 5EY5B 1HRDA 1FMTA 4EM6A 4DUZB 2BFPA 3Q9SA 5SV2A 1ID8A 1UEIA 4HLQB 2F43A 4I5GA 3HK2A 3G7SA 1A04A 1YL6A 2VF5X 3JAKB 3P9NA 3BD6A 4L4SA 4XVUA 2C04A 1QCYA 4J7CA 3OHMA 3RSGA 4BAUA 4LF4B 3D2LA 1SC6A 3OT4A 4JD5A 5H16A 5IAOA 1G3RA 1BXRB 3C2QA 3DLAA 2X5JO 1PEAA 3EIWA 2UZ3A 2PFGA 1QQAA 3AVUA 4NP6A 4D74A 4AKIA 3BXZA 4BP1A 1IM5A 3E27A 2OYCA 1TRKA 5AO9A 4EECA 3R3XA 1WQ4A 3HVJA 4FYVA 1RJWA 1XLVA 4A0HA 4IXTA 5JI3E 1T2AA 2RHBA 3BKXA 4AXXA 2VWHA 4XRGA 5FUYA 2NP6A 2PYDA 1G1MA 1T9BA 1Z0JA 2R00A 4NLLA 3EIFA 3PR2B 1Z38A 4KO2S 1G0OA 2NUTA 3I5AA 2NU6A 3WO1A 2FH5B 1P3Y1 4FLEA 4IHJF 3S6JA 4X71A 2C00A 1H2WA 2I3ZA 5JH7A 3U5TA 4D26A 3I92A 3NETA 2ZB3A 2ZIZA 3H11A 1LY1A 1LDBA 1UBTS 4Y2PA 5HFNA 1B16A 1KA9H 1T0JB 1W4AA 2QPTA 3AB8A 4NRDA 4EW2A 2J3DA 3U1VA 1RWPA 2LCIA 3T7EA 4QPDA 1R8SA 4MIYA 2ZRIA 5BW5A 2VNSA 4BRUA 1IHXA 4NBRA 2BD0A 4EG4A 2C9DA 2F67A 2CHVA 4QHTA 1JE1A 1ORTA 4TWIA 3VVBA 4FDAA 2WYWA 1BDHA 3ES9A 2B7BA 3TSZA 1CY8A 4IG4A 1MV5A 1J2JA 1TU0A 1X7DA 3EWNA 3MS7A 4K46A 3IUBA 4XGQA 1W30A 2D2FA 1PR6A 1ISHA 4BLPA 3WGTA 2GK3A 2FW9A 2W6QA 3FDIA 3MD9A 5D3MB 1GKKA 3W7VA 1BHQ1 2VFAA 1DAOA 2VPPA 1DC8A 4N8SA 2XUDA 3AYXB 3NU1A 1M33A 1IFXA 1RJEA 1SXJA 3BG5A 3KBBA 2XAUA 1R4MA 3KOZA 4LHZA 3QF4B 3ENKA 2ZXEA 2VWQA 1ZPDA 2HEGA 2W70A 3LUAA 4A5SA 1TW2A 4DADA 4YEDA 1AMUA 2ENUA 2DH6A 3FRJA 3NM4A 2YMQA 5ITVA 1JR6A 2HIAA 4ZOLF 2WU0A 4N5LA 2Z57A 3K7EA 1L3CA 4RCYA 4YRJA 2W2OA 3AF0A 5DK6A 4RE5A 4JBXA 3LK7A 5F78A 4FFDA 4OBBA 3KJNA 4XXHA 1CZUA 1IK6A 1KJ9A 1Q1BA 1R6TA 2AIRA 2VT2A 1R5JA 3R0VA 5HE9A 4QLOA 2HMVA 1ZC4A 4OYRA 4YJFA 1NBME 4BNLA 4BVKA 1KL7A 2QUJA 3PNKA 5IVKA 3AHJA 5CAEA 2UUBB 5EXTA 2PAFA 2I33A 3AJAA 1GTG1 4RPHA 2DULA 2VAXA 2BKVA 1Y7PA 3FKSD 4MAMA 5AK5A 2POCA 4AG5A 1VJCA 4QT0A 4EYOA 2C1EA 4DNQA 5CW1A 5ABPA 2FLWA 1N5RA 1MOSA 2GPNA 2V0NA 2CEKA 2JHCA 2V7QD 3D4LA 3QPAA 1TJ5A 1XJ5A 5JYCA 2D00A 2FZ5A 2IKSA 3T3MB 2JGFA 4TMVA 4RA9B 1PEDA 2DPXA 3CLHA 3DZHA 3TW8A 2XOXA 3PF8A 4IQ8A 3ZGLA 2BF7A 4UEWA 5EE9A 1C9DB 3IAM6 1IXRC 1TE2A 2ZRJA 3FBGA 3R7WB 3OIWA 5M29A 2BLNA 4DLTA 3I9LA 1J0AA 1DL5A 1KZHA 1L4MA 2VUHB 4Z8YA 4HNSA 2OHXA 4M9CA 3SP1A 5G4LA 5ICCA 4Z1MA 1QP0A 1XZMA 3OCWA 1RC0A 1B1CA 1N25A 1TT7A 3WK6A 4MYRA 2CT8A 4IUBS 3COPA 3GAMA 4MO2A 4RENA 2E5FA 4AMBA 2R8BA 3LZCA 3K9FC 2PJDA 4X1OA 1I7LA 1G41A 1TZJA 4JODA 5HCUA 2K7FA 1FIUA 2O5RA 3I09A 2C3PA 1CIJA 3EVNA 2IYOA 1ZXLA 4KH0A 3RVSA 1EG7A 4Y2RA 2NADA 5FORA 2I6SA 1KKMA 3BSYA 1PLJA 4JUDX 5LXTF 4RHFA 1M1XB 3R3JA 3TJMA 3WICA 1C1HA 2YVQA 1WY5A 2GN2A 4DB2A 2NZVG 3BMNB 1CDEA 4WJZA 4EQZA 2TMDA 2WHPB 4WZAA 3E58A 3CVVA 1T2NA 1QQTA 3A1NA 1Q20A 3BVPA 4OJQA 1BCRA 3KZXA 5M34A 3HV0A 4PM4A 3CLTD 1VPTA 3ECAA 4WZBE 3X43A 5EJ9A 2PZEA 4AZ0B 2ZBQA 4ZT2A 4PIVA 1CY7A 4AUEA 1U3DA 1EP9A 1V9LA 4MVJA 3BORA 4JMLA 4XPIA 5EXDA 4CBVA 3PL1A 5A4IS 4FE7A 5JASA 1HDYA 3JQAB 2JRCA 3TVDA 1ZEJA 2D7CA 2FFQA 2G8LA 2IHNA 5LOVF 1Y8RA 1CJCA 1E62A 2ZCVA 3T9EA 2POQX 1E60A 3D0RA 1RP1A 2QV7A 4J76A 1L8AA 5JZMA 1RC1A 5TB5A 1KVQA 3UCXA 2W6CX 3ABIA 4EY7A 2CFRA 3ZOZA 1U8XX 1KE1A 2BEVA 2EERA 2O2HA 3TR0A 2LBPA 3OWHA 1RJGA 1GQQA 4C87A 2WUWE 5JVDF 1PQPA 2C77A 4JOSA 3ESDA 4F5DA 2FZCA 1TM2A 4RK7A 2ZBDA 1WHSB 3V2IA 2DPLA 1W9MA 1UOEA 1T13A 4M1QA 4QULA 4BLQA 1N2ZA 4A2WA 3WVNA 1P62B 6PFKA 4OGLA 3K16A 1YIOA 2YFHA 3NQ41 4F7WA 1ZQ1A 4WK4B 1OV4A 5JQGA 2WIDA 4KWIA 5A6VA 4GMGA 1D4ZA 5E6RB 2OCYC 4I9HA 4AMVA 4UHDA 3LHDA 4IVPA 5LOVB 3ZBUA 2I22A 3SG0A 2YHIB 3L0BA 4PC6A 1I7SB 3NT4A 1UEJA 2HGSA 4H6XA 3SQXA 2JZCA 3HEBA 1ISFA 2P9FA 2BMAA 2Z3ZA 3SYRA 3A9UA 3FUCA 1P4HA 5FTJA 4JJ8A 3ASUA 2ONYA 2Q46A 7REQA 2ZJAA 3EG9B 4HGZA 3I61A 1YDMA 3UHPA 1TT5B 5ICMA 1YR6A 1MB4A 4LGYA 1UH5A 2BGNA 1ZK1A 3IT0A 3OTGA 1IN4A 2IY7A 3LHKA 1GAXA 2ZTHA 3BQ9A 3QZUA 4N7MA 4FOLA 5ESWA 3WGZA 1UJBA 3PFHA 1Q0RA 4RH3A 2AOTA 1DQSA 2R6ZA 3DW1X 3WXMA 4Q3BA 3QWIA 2PGIA 2QYSA 4MQLA 3MWYW 5HQJA 5LPNA 1I33A 1R8JA 4RVSA 4JB3A 1J5EB 2VTKA 4M83A 4UDNA 3BK7A 2PRIA 4JL5A 3WYAA 1V3TA 2V55B 3HKCB 4II2A 3WWEA 4W5NA 5DJ5A 3L04A 1U0HC 3L8MA 3QPDA 3F3KA 5CFPA 1A5SB 3L7OA 1EBUA 1IG0A 3B85A 1I8TA 1T8UA 4DA6A 5C8YA 3UHOA 4TTPA 2I7VA 3RFCA 3ZDYB 1ADJA 3GV0A 2A9OA 5HE8A 4F9TA 4IUYA 1NNUA 3C6YA 1E1MA 4NJMA 4PYRA 1RQNA 1NY5A 5DTJA 4LHYA 2CL6X 4LJ9A 2HA6A 4MJLA 4MS4B 3DL4A 1FP1D 3PQDA 5UKDA 4CHGA 2Z8XA 5E6SA 2XA1A 1ZK2A 1E4EA 3ONWA 5JDIA 1ZCFA 3TRKA 4D25A 4P3YA 5FTNA 1LBEA 1XHEA 3Q6MA 5K09A 1DKRA 4AN4A 3ZDCA 4BB9A 3K73O 1A7KA 4D9KA 1B0UA 4ZGGA 3P9KA 5EPUA 1KWGA 2GJAA 4DQUA 3AFHA 4XWOA 3Q6IA 2FQQA 1ODJA 3ZV4A 2ISQA 4PGGA 1ZGZA 4Y0VA 2FN9A 2MYPA 4M8SA 2AOUA 1I3LA 1QTIA 2JLCA 4Y1RB 5BN5A 1MDBA 3ELWA 2Y99A 3EPKA 4BXOB 2EIXA 4KIGA 1DBPA 4BKUA 2PLNA 5AOAA 5EJEA 5FOWA 3O9VA 3DR3A 2XDYA 1EX7A 1X3SA 1BCSB 1KZ7B 3LHSA 3EH1A 4N01A 4PCAA 4TMYA 4X7BA 3QU2A 4P31A 1JE0A 3NBAA 3OA2A 4B3DA 1WZNA 4KPFC 4ITVA 2PR7A 4CKEB 3TVYA 1JKJA 1KKLA 3D6MA 3TW0A 4EG8A 5FBZA 3AFMA 4QTUB 3FKJA 1UDRA 3G5LA 4FSDA 3C39A 1QDLB 4MB0A 5LBIA 1ECJA 5CDUA 2OAP1 1DT3A 1E64A 1SVWA 4LI0A 5DULA 5LQKA 2QSYA 1JAYA 1NUUA 4Q1VA 5JEEA 3OZRA 1F4LA 2V6GA 2OV8A 2P2GA 2RAFA 3BF7A 2Y4NA 3VYVA 3ZQ4A 1OB5A 1P3JA 4GE0A 2UZ1A 1AK2A 4U00A 3ILHA 5F2KA 1SCKA 5K0LA 3EXG1 4ZXFA 2IF2A 2VDKB 4ED9A 3L46A 3QVGB 1I0IA 1CUIA 2GLXA 4WEOA 5C1IA 2J59A 1O2DA 2JIQA 2ZULA 4I3HA 3ZNPA 3ZQUA 5I7WA 2HXYA 4I1YA 4Z9FA 1JPNA 4ZANA 3TH5A 1YZ3A 3CEAA 3B6MA 3D6JA 4J4HA 2F3RA 5EXXA 2HLDA 3ZVKA 3K8ZA 4NMLA 4PPFA 5KNCH 5BSHA 3EJ6A 1EFDN 2BFEB 1NJ8A 4Z8XA 1HX7A 3RAFC 4HYEA 3IELA 3OZ7A 4KQ2A 2KYRA 4UFNA 1OLUB 1W0KA 3CNQS 3CRMA 521PA 3EVEA 3RCBA 1Z62A 4GX0A 5FBKA 3AM1A 1LS6A 1P5JA 3DWFA 2OO7A 4I4IA 1DO8A 1MR3F 3FCOA 3KNZA 4M6WB 4E70A 2WQ6A 1DIGA 4XASA 5L4LA 2GM9A 5DN6A 2L19A 3V46A 1W5EA 2FSHA 2QLJA 1GADO 2ZT8A 3OX2A 1WBBA 5LQCA 2E4WA 3OU7A 2EDAA 4HDSB 2KW5A 3DW3X 1QYVA 4MROA 2QMEA 4G0MA 5AUQA 4ENUA 3HRKA 3I72A 1YGYA 3O2NA 3O4HA 5TS3A 5KHLB 1FS6A 3F2IA 1KH3A 1UAAA 1XMOB 4LX8A 4Y6OA 1H9BA 4PWZA 2YY7A 3VH3A 2PGOA 1II8B 1DJLA 5DLQC 5AESA 1IM8A 1FA9A 1MO5A 1J4AA 2BKUA 3EPRA 4V0MA 1VI2A 2Y1XA 1HDGO 3PLRA 1RXUA 3EDCA 4OATA 4IUCS 1CSEE 3CURA 2H4JA 1THGA 2LE0A 2PX4A 1UL1X 3D5TA 2F9FA 3MOGA 3EEFA 4CIDA 5K3OA 2DT8A 2Q27A 4IGFA 3HM9A 1O08A 2R8EA 3INTA 4JMPA 3OFSA 1D0IA 2ABWA 1HZZC 4G0QA 4CE6A 1RM4A 3E23A 1K92A 2WABA 1U90A 3I39X 2Q6LA 3TOSA 3UMRA 1Y9EA 3SYTA 2A8YA 3FWNA 4YACA 3SHFA 3HGMA 4HYQA 2PSSA 4Z7OB 1L7QA 4C01A 5IJZA 5L9AA 1XD8A 5JJLA 1DIRA 4DS3A 1YI1A 3CH7A 3NTLA 5TS2A 4AJ2A 2QR2A 3VPXA 1DMSA 3BGWA 4O8CA 2XNHA 3FZNA 5FR1A 3HGQA 3WRXA 3M5CA 2FPMA 2O3TA 1AGXA 4M1KA 2P2YA 1XF1A 3OZCA 4PSKA 4Q0MA 5FLEX 3CJQA 4BB0A 3F49S 1TRHA 3T8YA 4ODIA 1WMFA 2H5IA 1QLJA 2HYDA 2ZJ1A 3BWVA 3GAFA 3LBHA 4RCVA 1QFZA 3RWMB 1X1EA 4B7UA 1HR0B 1P0FA 5FLYA 3DD1A 4C29A 1FYEA 3W2EA 1P18A 4KFTA 2QVLA 1L8QA 4XR9A 5IKPA 4M49A 4JVNA 4HN9A 1ZBQA 5FHQA 2VQ3A 1MUUA 3A58B 1RW4A 4GXNA 2NT4A 4O2BB 4OK5A 1M2KA 2R6GA 4TT3D 2DF8A 2ZYIA 1NBMA 1Y4UA 4AJ1A 5DW3A 3W6OA 2B3TA 3OVMA 1IL0A 4RV5A 3VO8A 1V1MA 2ZZKA 2BH2A 5DVZA 1E8MA 2BPOA 4BE7B 4QEKA 4JQSA 2W4IA 3MGBA 4OBWA 1GYPA 1Y1KE 4X66B 1KMQA 2B4AA 2A5LA 2XXAA 2Q0SA 3ENVA 3EMVA 3ZX4A 2B21A 3LLCA 3QIAA 2EW2A 1EIZA 5DMXA 5GMOA 2IUUA 3W4IA 4WKOA 4F5ZA 5JY1A 1VA5A 2CF6A 3E9YA 4X7RA 3X1WA 2FG5A 1C9MA 4PYKA 2AZXA 1IG3A 3EARA 1RXEA 4IOLA 4KQFA 1RLMA 1J7KA 1J39A 1EH5A 4CCAA 5C18A 3UFXA 5H8WA 3UUGA 3Q3IA 4PICA 2IQIA 1KH2A 4JXJA 1UXGA 3KVVA 5HW0A 2D2IA 2G0TA 2JAWA 2F6RA 3OE1A 1PZMA 5DCUA 4EQ6B 4KITB 5K7SA 1XMQB 1RBYA 3DEIA 3D6AA 3M0EA 4G26A 5J2TF 4BV9A 1PQUA 2EFYA 5G53C 4KRYA 4FP9A 1KTIA 4PXSA 5A4JA 1WOYA 2XUQA 1XB2A 1PJ4A 4LJRA 4H7JA 5BOSA 1EWVA 3VJRA 2AN5A 2TECE 1VL2A 3FBWA 3DP9A 1NPYA 3F2VA 1RYHA 2IY9A 4GG1A 3P32A 1BJRE 2ZS7A 4INZA 3FF4A 4B0PA 3GFVA 1E3WB 1I2BA 4XLTA 2CV0A 1QNFA 1UXIA 2QGFA 2B5OA 4LISA 4WESA 3CUKA 3CW9A 1OCEA 4V0SA 1MVOA 3FWYA 3G5TA 4MAAA 4MINA 4EAQA 5F1OA 1VECA 3EMKA 2QKYA 3CUTA 4K2AA 3ZWNA 2H08A 3PPIA 3CZAA 3VTZA 5ALWA 1RXWA 5FWNA 1DVRA 1GAQA 4N5IX 1OFUA 5JD3A 1ZJ5A 1Z26A 2JI6A 4LJAA 1JNYA 5AVQA 1L9XA 4NYIQ 2AG1A 2JI4A 1Y81A 3ZHYA 2NW6A 3HB9A 3QLEA 4RAQA 5ECDA 4DDMA 1J90A 1D2RA 1U1FA 1YCGA 1RWQA 4DR6B 2P9JA 4M1YA 4E5NA 4EB0A 2QTHA 1C3VA 2J3KA 1ZCBA 1DAFA 4YHBA 2KBFA 1SO8A 4S0ZA 2W8ZA 2WV7A 1UAYA 2G88A 2X58A 3KHKA 4H4DA 2FRXA 5A03A 1J9ZA 3BB4A 1JWAB 4GMXA 2V96A 1H1LA 3EVCA 1MJ5A 1WWKA 4DT1B 1DQNA 2PD6A 2G5PA 2VAMA 4EKDA 4UNRA 5LJLA 2A86A 3FYSA 3ZXYA 1JLRA 5B36A 4K9OA 1O96B 4NXMB 4FC7A 4KL8S 2YWBA 1ZL0A 3PA8A 1XE3A 3MCZA 3L7NA 2P5UA 3VX4A 4ZI7A 1FY2A 1VKZA 1XAIA 4ZREA 1KMHB 4MDEA 4QDXA 2AMJA 3P94A 3REFA 1KEEB 2IIBA 4FFWA 1TXGA 3X3HA 4IEEA 5LCXA 4TVSA 1HGXA 4B6PA 1L4KA 1SMKA 1UBMS 2HM7A 4C89A 4HD8A 4F86A 1W2HA 3G2LA 1WZCA 1YQUA 1VCOA 4BNTA 1G6Q1 2UUAB 1SVSA 4UU7A 3K8YA 2OCDA 2Q1TA 4HB2A 5GADl 4CPDA 1FMLA 1CK4A 2O3RA 2HMSA 3VO9A 5AWFC 2V8BA 3ISTA 2XEDA 3UAYA 3MUNA 5B1HA 4GC5A 2HF7A 3AR7A 9ATCA 1QQBA 4UM9D 1DKPA 2OZKA 1KPGA 2NTYC 3PRJA 4X6UA 3H18A 1KEUA 5KYWB 1DWQA 1F12A 4QBTA 4DMKA 3GP5A 3N05A 4LF5B 2ZAGA 3WS7A 2GLUA 4MYDA 1DC5A 4GHWA 4ZAZA 4PSUA 4HNRA 1UQTA 3ZDFA 2JCVA 1RMQA 1SUEA 3ME5A 2LCFA 5AW7A 3RUDA 5EIXA 3ZH9B 2W6JD 1I6KA 2PGNA 2J9FA 2QN6A 4UFOA 2WPDA 5KTPA 4ZQHA 3JASB 4UPVA 1GT6A 3HMQA 3BHIA 5GQSA 1C7EA 2IEZA 5HQ3B 1NKTA 2HJVA 3VU9A 3V1YA 3FLBA 4GH5A 3ZGVA 1XMVA 1LFAA 3CC8A 2P0YA 1VGVA 3NRJA 4FCCA 4OFBA 1M8GA 4WUTA 1OKKA 3CW8X 3ZZTA 1U7WA 4A0FA 3FPKA 4MVJH 4QVGA 4F2DA 1BTOA 1IH8A 4H1VA 1E98A 3OP1A 4R5HA 3SKXA 3SVLA 3JATA 4L1KA 4FYKA 3HY6A 4Y9TA 1B0PA 4PWYA 3H1TA 3PQ2A 5EIFA 1DRJA 1XHFA 1Z73A 1J6UA 3DO8A 5C3MA 4ML3A 4BWGA 4ZCQA 3ZE2B 3M1LA 4AY5A 4F4IA 4IKOA 3KJXA 5IC5A 1U0OC 2G9UA 4NBUA 4E32A 4LNAA 3PNVA 1ODSA 3MEQA 5DP2A 4BO8A 2WWHA 4ZZ1A 3FPJA 2XQFA 3KXLA 2WP0A 2C9BA 1N2OA 1ADCA 4DZRA 3UPTA 1GGVA 4U2DA 4HZGA 2DR0A 2FR8C 4REQA 4NV0A 1S2MA 3JWIA 3D6FA 1IPFA 2QNBA 2N3ZA 4N0EA 3OZTA 1I94B 1Y3DE 2YV5A 3JRWA 1OBVA 3T6KA 4BJ6A 1YB2A 3BD9A 1NVEA 3MHTA 1AUPA 3QUBA 2Q6OA 4HAVA 1J99A 1KQPA 5C1BA 2DUWA 3LXUX 2CJYA 1DOAA 3QFTA 3AETA 4MRMA 3SDZA 3DVLA 2XYPA 4IDCA 4M9RA 2DQKA 3ANSA 1DTWB 2YVUA 3E84A 4KXVA 5AJXA 5EWLA 2MIIA 4JI3B 4CKCB 5KOHA 2WEKA 1GNQA 2QRPA 4HWPA 2P75A 4LK2A 5IAJA 3IEPA 1GSAA 3WRXC 1E8DA 3FHOA 1A69A 3NUGA 4GOJA 1AKMA 4M86A 4EYEA 4KV9A 1Y42X 2C0CA 4MUMA 4PONA 4OCZA 1Z0DA 2QMZA 1R18A 2WA2A 2Z1NA 3PUYA 1VKHA 5JAMA 1BVYF 3HP1A 3PHGA 3TPFA 1V6AA 5D3QA 1R3UA 2HZBA 3QKSB 4V0OA 3V9AA 4B6GA 4BFVA 2H8GA 3HJRA 2QL5A 4CW7A 4LCBA 1T4DA 4AICA 3IEMA 1G7CA 3NEPX 2VYNA 2BCEA 4KCGA 5JDCC 3KEFA 3TUZC 2D2EA 2HWXA 1RWNA 1W4LA 2JFFA 1CTQA 5ALHA 4G0XA 1YQQA 2I66A 4U9IS 4WOBA 2QSZA 3JWEA 1WEHA 3PC7A 3KLPX 2QLTA 2YWEA 2XT6A 4MPPA 1UF9A 1GL7A 2XKAA 5E1BA 3HUFA 1PR2A 5BT9A 4J8PA 5A4AA 2BT4A 3KYJB 4GPTA 4QO7A 5HA5A 4UPDA 1O97D 3SEAA 2BLLA 5LKRA 1NVVQ 4NU8X 2ZIUB 3VDMA 3V5NA 1GUYA 2JGEA 3BRWA 2WHRA 4BUCA 4NG4A 1UM8A 4OFXA 1T4GA 4AJKA 3LGXA 1Z2DA 1IQPA 1W2GA 2GF9A 3QU4A 5TR9A 1XHLA 1X70A 3BJRA 1SK9A 1DAIA 3JQ7B 4M37A 4F96A 5JLJA 5LU8A 2Z2IA 1JR3A 4P4LA 3TNLA 4P7JA 4B4KA 3PR1A 5C4GB 3MILA 5JFGA 4RY8A 2BHSA 1A72A 4FDVA 4LE0A 1DWOA 3H3JA 2NU8A 1YR2A 1Z5UA 2C4KA 2H63A 3W2FA 1FJXA 3H2BA 3VR6H 4OJYA 3VSCA 4BN4A 2HJRA 2OVFA 5KQSA 1WB9A 2E85A 4XTRA 1SCIA 3R5FA 1NUHA 1WM1A 2OLEA 1PNQA 2R6FA 3IKLA 2UAGA 2IXFA 2Z2XA 3CNBA 3GLUA 3LF2A 3OO0A 3UC9A 1RWOA 3HLKA 4JQZA 4PTLA 1UQUA 4PYQA 5FIUA 1TZBA 4Y2JA 4B71A 4QU9A 5I48A 2XCOA 5A7HA 4UTNA 3O4VA 4YCDA 1U5BA 4I5FA 2PS9A 1HTWA 2CUKA 4QOFA 1GRCA 5BMOA 1UKYA 4ZU1X 1Q1GA 3ESZA 1AA9A 2H0RA 2PSHA 1HL3A 5KYKA 3K6SB 2GNOA 1P8JA 2BEWB 2GPWA 2BFDB 2XWQA 3NP9A 1M2VA 5KHAA 3MUFA 3K9HA 3LUKA 2AG6A 2WQZA 4CQMB 1Y80A 3L0YA 3SIXA 4KFCA 4LOHA 2PXHA 1MHPA 4XFKA 1UR5A 4DABA 2YVKA 2B1JA 2DKNA 1R0KA 1UKAA 3AHHA 4JSYA 4IJMA 3ZDBA 4DA7A 1PW5A 3ZWAA 1XQ6A 2ZIGA 2O14A 5B6IA 2H2IA 1IOWA 3NALA 5ALXA 3HBAA 3LP8A 3ZG6A 4DDUA 3G2IA 4M1EA 4M3NA 3JQFA 1UWLA 2C2HA 2W48A 3CLSC 8GPBA 2Q07A 3LLUA 1G66A 3HVKA 4NV1A 1DLJA 1N7IA 1S1CA 5EIOA 5IM5A 3LWZA 5IC6A 2FK8A 2AQIA 1E0AA 1MG0A 2GVZC 1P7ZA 3QFCA 4Q1CA 3NHAA 3OUZA 4NVRA 4PC3A 4K88A 3HCNA 1SHJA 4L95C 3UMJA 3WWPA 3L4KA 1Q44A 1UDAA 2XRMA 3KR9A 5CLLA 4OX9B 4ZJZA 2JIZA 2P9BA 4YRLA 4M0MA 3O8QB 1LBIA 3DF9A 5K45A 3W90A 4FGJA 1XZAA 5FPQA 2VT6A 4EZEA 3HABA 4IDAA 5CVJA 5EHGA 1W5TA 2ODQA 3WLSA 2W2KB 5EIBC 1SVNA 4MEAA 3DE1X 4XSHA 5CDSA 1QMPA 1VI5A 2XLBA 2YX1A 1N0VC 3D0KA 3QA9A 1UT8A 1IB6A 3FPCA 2IV3A 3I6BA 5GOTA 1UBUS 2BE7A 1QJ4A 1N5IA 3UWOA 3AP2A 5I01A 5AM0A 2AG5A 1UBFA 2WWYA 3EA5A 3TX2A 3OECA 3PYMA 2O5VA 1JA1A 1ADGA 3JALA 3LY7A 1KJNA 1BE8A 3QE3A 4ROTA 2CY0A 4G81A 1NM5C 1RI1A 3KPVA 4JELA 3SFTA 3EEIA 1GXSB 5K0JA 4QAJA 1I2ZA 1K7EB 2ADOA 2Q5CA 4RVDA 2X1HA 5GVRA 3UC5A 1Y4AE 3AUFA 3PFIA 2BC9A 4OG2A 3UAZA 5B6JA 3EWSA 1P4GA 1TKBA 2YJZA 4JXKA 3MGGA 4ZCTA 2B20A 1YHNA 5DTEA 2ZB2A 1USKA 1YOVB 3KJHA 4KQIA 3G2PA 5F2EA 1RXIA 1YAJA 2EW8A 3GEDA 4MRSA 3A4IA 3KCQA 1X7XA 2BI8A 3QVVA 4QBIA 4MTLA 1UP4A 4YJHB 5G41A 4ZHQA 1JYFA 3KD2A 1ULSA 3O8OB 4J1NA 2UYHA 3RVBA 1RCTE 3T3PB 1Q0HA 4LOAA 1CUYA 1QORA 5IUNC 2E49A 2JGIA 1XD2B 2P11A 421PA 3ZX5A 2J07A 4GRIA 3A14A 4KXYA 3UENA 3IGFA 3K31A 3NO4A 5KKAA 3JZMA 3GLHE 2WSIA 5CA1F 2MYTA 4LDZA 4EMSA 2YZ2A 1QAOA 3O84A 3FOBA 5MN5A 3KTDA 1ODCA 4PAGA 2JLQA 3TECE 1E32A 1ECCA 1LDMA 1T0UA 1WZIA 3HPQA 5EEHA 2FP3A 3KR0A 2VJAA 2DFVA 3VSDA 4O02B 3BHJA 1EFUA 4OMCA 3SQLA 2Q3FA 3SXUA 3AEZA 3PJRA 3ZDXB 2R1VA 1HDEA 4E09A 1G8MA 5FB3A 3D3NA 2OMEA 3DGFC 1YC2A 3H5NA 2WAAA 4RM2A 3NH6A 5ALIA 1U65A 1QSGA 4LOLA 3DMGA 2FSVA 4U0KA 3MFYA 1E4YA 3QUQA 4IIJB 4QUDA 3R6DA 4DM4A 1CUXA 3A9WA 4TWRA 2QM3A 5ENZA 4G5HA 3TX6A 2VLBA 5CT6A 3C16C 3DEKA 1TJ3A 4IQ4A 4E88A 1BS9A 5DX1A 2PUFA 4Q03A 4MKGA 3GDOA 1SOMA 1B43A 4DR5B 1HMYA 2QJFA 1V7CA 3M6UA 1EFPB 1Z4QA 3M49A 2DFNA 1IY9A 4DGQA 2VOJA 4PGFA 5DSZA 1VM6A 2BEJA 4R8VA 2OYSA 3Q8WA 1I1HA 1H2ZA 1K5DA 2B37A 4H0NA 3FH0A 1CY4A 4BCBA 4POAA 2YR0A 3CLKA 3H86A 3EGXB 3IP5A 4C7OB 3W3ZB 2JKYA 4M1SA 4UXJA 4C14A 1QH1B 4EPTA 3GLFB 3ADKA 3L0PA 1JAIA 1GIAA 3LQ4A 5ITZA 5HVNA 2QS9A 2OORA 3DZFA 1NT4A 5LZ7A 2O5EA 1R74A 4G0NA 4ZMBA 2UUOA 4WMLA 2JFOA 3SYKA 4L9RA 4RDHA 2Q4DA 2HDNB 3PV0A 2NU7A 2DYKA 1LS1A 2H0AA 2AC4A 2VYND 3NBMA 3QVKA 4F04A 5AW2A 1U3GA 5PNTA 4BFLA 1ZWKA 3KKQA 2PKYX 2FHPA 5KO2A 4P82A 1MC8A 1L5ZA 3Q8XB 4WY5A 4K3UA 4FGSA 3DDZX 5DTMA 2C8KA 3E7XA 3BUSA 2E4XA 3BDAA 4O5AA 5AW5A 3UJ3X 1R8YA 2SECE 1BDMA 1P39A 1Y8QB 4M0LA 1GQ2A 1KSHA 4NARA 4C2BA 5MFPA 1JMYA 3IIJA 4G86A 4PHGA 5DGIA 1FQJA 1OXSC 1NIJA 2M9MA 4EJ2A 2G9QA 3QK7A 1TLLA 1ZUD1 2L42A 4GM1A 3PFWO 2YNMD 1KMIY 2X4IA 3T5CA 4FXPA 3RBAA 1XT6A 1B8PA 1CD5A 3OQJA 5JFOA 5ISMA 1AGYA 1U4OA 1M2JA 2PCJA 3CINA 1HURA 1VRVA 3U4QB 2Z5VA 1T9CA 2FKNA 5FO0A 2Y1DA 1M6VA 3OM8A 1LSUA 3AOEA 2VT7A 1CRLA 4HCJA 3TEJA 1A76A 2G04A 1IEXA 4E46A 5A2QA 1E3JA 3ABQB 4DMCA 4NDZA 5DI3B 3DDOA 3H1BA 1D6NA 1BO6A 4O4LA 3ESBA 2ZRBA 1O6BA 1FFXA 1OB2A 1OLXB 4LDRA 2OD9A 4IHAA 1HC7A 2AWOA 2OAGA 3K9NA 1N32B 5IF9A 1DO2A 1V96A 1N5KA 2RHHA 3OLVA 1SEVA 2BBOA 3R3YA 2Q3BA 1VI6A 5BV8A 1V8ZA 1GZVA 4HNQA 2Q8QA 5JOQA 1H22A 3CUWA 1UOOA 3GO4A 4ZVUA 3BJZA 2ZYUX 4K0KB 4NE2A 3RYHA 1PVDA 5LQAA 5GONA 4BB6A 2C4UA 4WJLA 1JIVA 1RZUA 2PGXA 5DKFA 3WMGA 1QVZA 3I52A 2HO5A 3RYIB 3KTOA 3PPXA 1LI4A 2ZZNA 1NW6A 1X1DA 3OI7A 2V5VA 4L7VA 1TUGA 3BFVA 3HPRA 5EKUA 3G9TA 3CW2A 5B1SA 1R4NA 4GOLD 5AKIA 3I8SA 1RRFA 4CMJA 1X42A 1QO7A 5I7SA 1K5GA 5L4SA 2C78A 2BFAA 4TN5A 1QOPB 4YRMA 5K4AA 1QB8A 3R09A 1J7JA 3QXSA 3MB8A 3NPMA 2OFWA 2ZSKA 3EXEA 3MWLA 5K3AA 4DBVO 3M82A 3Q87B 1EUCA 1N1EA 3QUTA 4NU6A 1VGRA 4JJ6A 2OCLA 3HCAA 3RUFA 1QRUA 4BLTA 1NSTA 1NONA 4KFRA 1PQ4A 2NZXA 2CXNA 1YDHA 5LU9A 3BX1A 3PFNA 2PYIA 1N3IA 1K2WA 3PXXA 4FE4A 4EK9A 1QS0A 4Q1DA 2O8CB 1HYEA 5ALYA 2CNOA 2X0IA 1K6XA 1Q50A 1RR6A 1M8KA 2ID9A 1QYCA 3B2QA 3CLUC 3KZOA 5G0SA 1MA0A 1LNSA 1CUJA 1Z8FA 3V6LA 4ZJPA 5EJ8A 2XKJE 4PPGA 3STUA 3X1KA 3UH1A 2JIZD 1HETA 1HDIA 5IEBA 4G63A 5H4GA 2HXGA 4B3JA 4JJ4A 4TV8B 4MNTA 1X1QA 4NEGA 5J59A 4A16A 1L7MA 1PZGA 1DKUA 2VO1A 4UBIA 5T6MA 3WIOA 1ND6A 4R1MA 4D99A 2X15A 3OPMA 2FEOA 5JPIA 1DDOA 2QAGB 1U3VA 2VDJA 3TI7A 1QX4A 2C83A 4K9NA 4OXNA 1LBQA 4PG4A 5K3FA 2BGMA 2Q6TA 2O05A 5E6UB 3A32A 4RVUA 1OYWA 1DHRA 5BSVA 3W3AH 3OPNA 5A6SB 2LNDA 1S8AA 4H3KB 3ROEA 4Q5IA 1K98A 4CM9A 2PD3A 1NBEA 1IMJA 1NRIA 4KZPA 5EESA 1LLCA 2NLOA 3P1JA 3IPXA 3UY4A 3I4CA 1NLMA 4CI0B 2EP7A 4MVJP 1D4FA 3U9LA 4JXXA 2EZUA 1VE3A 3IQXA 4P3NA 1C7RA 3B6JA 3MN1A 1WXIA 4MHSA 3PBKA 1LZKA 1IZ9A 2PFSA 5DNUA 2ZBGA 3C87A 3ETNA 2FF5A 1BW9A 2IZZA 3Q8MA 1HNZB 1SPXA 4OAQA 1TA0A 4YV0A 4ESVA 3Q72A 1I0ZA 3EAFA 5EEGA 4HWKA 4WFQA 1C1DB 1MH1A 1SXJE 3BSFA 3SR4A 4D97A 2RK4A 1RTTA 4DLSA 3RADC 4BGIA 3IVXA 5JRJA 5TGZA 2CXPA 1BAPA 1U8CB 5DI9A 1GPYA 5KDDA 3HJTA 3Q10A 4TKUB 4CLOB 4Y2GA 3VU0A 4IVRA 5DX0A 4R1LA 4ES6A 2D0IA 3G1WA 4S1TA 4ZYLA 4PLGA 4CG1A 2UYCA 1MC5A 4NPCA 1ZN9A 3T3DA 1OI4A 2BGJA 1L8XA 1MTOA 3DO5A 1C2TA 2BKAA 4LXXA 3NTXA 2YV4A 3L92A 1N36B 1KYXA 2QVGA 3CE9A 2VH1A 2YW2A 3EEQA 3W7AA 1YZFA 4O33A 3H9JA 4EA6A 1NWHA 3S1LA 1JXQA 3FPAA 3G68A 1GPUA 4Y9SA 4Z4GA 1V95A 3CY6A 4YYZA 5JQGF 2GILA 4HGYA 3P0HA 2UYOA 2Q9UA 5K0NA 4PSDA 4AKTA 4N3CA 5ITWA 3QVUA 3T34A 4W4TA 3T3EA 3C85A 4JEHA 4KR3A 2OR3A 4MGYR 3ZWXA 2O54A 5A9RA 4JITA 3FYTA 4BMCA 1FTQA 3I9OA 2FFHA 5I4BA 4QXPA 2I0FA 5G0TA 3A6FA 3PUHA 1PHPA 5AIBA 5FR2A 3PWZA 4IJKA 5IULC 4QQ8A 3TM5A 4OB8A 3RIYA 3U3XA 1FP4A 2VF4X 4H6PA 4NE7A 3LJKA 3RW9A 2YOFA 1QV6A 2FMUA 2UVQA 3A36A 3I3SR 3WWOA 1N3BA 3OLWA 1ZGJA 3VYTB 3IAS6 2C84A 1LC0A 3RDPA 3RIMA 1VP9A 3KKPA 1W8IA 3U60B 5DTIA 3RFVA 3N2KB 2HIHA 4FONA 2W2TA 6Q21A 5JQGB 4CGZA 1H9CA 2GD6A 1F14A 2D8AA 2Z3VA 2HH9A 4NBSA 2EV9A 4DR7B 3A6ZA 3MMZA 1LLQA 5JTTA 1TMOA 2BZ1A 3W8DA 1HFJA 1GJRA 1EXMA 2O06A 4FJ2A 4ZVLA 4QFCA 4AIRA 4R8MA 4REOA 1WMSA 3IP7A 2PX0A 3CCBA 8ABPA 4Q93A 5KNCA 3AVOA 4G01B 4JQYA 2DPHA 3CZCA 2JD0A 4FJ0A 4RNCA 1TYAE 5LA6F 5YASA 4JP5A 4R71A 1FXWF 1XXLA 1NY6A 4PVCA 1X9HA 1YDWA 2WJPA 1DPGA 3BIWA 2XOEA 1C7IA 1QHNA 4JB8A 3HCBA 5J1TB 2DR2A 2E2WA 2PUJA 3AUKA 4QM6A 4EVSA 1RM3A 2CXSA 2RGUA 3HN2A 3UW3A 2A0XA 3IJEB 2OE2A 4YQEA 4NMWA 3DBLB 1U99A 3VX3A 2VXYA 4XWYA 1Q6ZA 3VZRA 2X9NA 4GKKB 3BYZA 1NE7A 4DDTA 1A5ZA 2IYPA 3K96A 3CONA 3WGNA 4J07A 1RFGE 1YB4A 2KSQA 2OQ2A 3ANTA 4IX1A 4UZFA 4L57A 4O59O 2CC2A 3TBKA 3HJBA 3ZI7A 1ODIA 4I1PA 5L7WA 1UZUA 4O4JA 4WLNA 3TF5A 3ZDEA 4E5KA 2HPZA 4PFQA 2GVDC 3I12A 4Y1FA 2V4MA 5DN6D 3QMMA 4BQPA 3PGJA 2VTDA 4H60A 3U81A 4EJSB 2NO7A 1HG0A 3N0WA 4UMVA 5IWAB 1A2KC 2COUA 1B42A 3ZY6A 4CTOA 2H1FA 4GP6A 5LMUB 1OH5A 3B52X 3VZDA 2WG1A 1IAQA 3OCYA 3OFKA 2VATA 5BN4A 1FBTA 1ORIA 1UWCA 2CUTA 3GNLA 3MWEA 1H3NA 2A94A 2RHMA 3IAUA 1ZLXA 5BWOA 1JJ7A 1L7XA 2FZ4A 3M6AA 2ZJ5A 3HYCA 3R20A 1BMDA 4JJZA 4HLNA 4KX3A 4XLZA 2EF0A 3C1OA 4OLFA 4DMGA 4R69A 4BNDB 4HGRA 3C8UA 3HU5A 1PR3A 3VNQA 4BMXA 5HM8A 3A4MA 5TY0A 4LE2A 5E2IA 4DG5A 4RY0A 4ZJUA 2EZ9A 1RE1A 1B73A 3ZUGA 4QX6A 3JU3A 1CY1A 3IV9A 2AZMA 4DQVA 1I24A 1WUTA 2P6NA 3EIHA 3NHFA 2NNWB 3H1EA 2DM6A 4PZEA 3UEOA 1GN8A 3CSSA 4QYWA 4UBNA 1U9YA 1LCIA 4J0HA 4L8FA 4NCKA 5IAKA 2Z6VA 3WQBA 2G72A 1JIXA 1C4OA 1F1JA 1X6VA 2V45A 1OUMA 3CEJA 4OHUA 4I36A 3ZJ5A 3U0VA 5JC1A 2FEMA 4ARAA 1R3DA 2FWIA 4EG6A 1M5RA 4YJ3F 5DM1A 2HF2A 7YASA 1AHIA 4WLFA 1HXHA 4WKNA 2A9PA 2HAEA 1RPTA 4X7MA 2PMDA 3C7AA 3CHYA 2AFVA 3ZTWA 1NJFA 3DZIA 4P35A 1SD1A 2P2DA 3PNQA 2JLAA 3EGOA 3FSGD 4XCQA 2IOQA 5LLSA 1GTSA 2IXGA 2IOFK 3RS4A 2ZQYA 4U2FA 1PFKA 2FW6A 3W6NA 3ND9A 1HI9A 2Q99A 5HKBA 3LBYA 1ZGBA 2PA0A 1E6WA 3LFHA 2GA8A 3D9QX 4P7BA 4I8DA 1BE1A 3CMMA 4ZVNA 2RJ3A 2FZVA 1M5TA 1A2QA 2ZYGA 2F3SA 3PK0A 1KMNA 3QV1A 3N6VA 4G2NA 4JLWA 1QV9A 4XQ0A 2F8LA 1RCUA 4C4OA 4KR0A 5A04A 4YIHA 5IT9A 1BGXT 3U44A 1BOFA 4HJRA 1WZUA 2CLLB 4WSOA 3LC7O 3ZVLA 4QNMA 4R54A 4NNPA 1BWRA 4ZCMA 3RARA 4MUIA 3LCUA 1R50A 1I4TD 2IYZA 3A6PC 1F2TB 3RE1A 3JQFC 3FCCA 3YASA 1YU9A 4QDKA 5DM60 2HEIA 4YPVA 1X13A 4ZO7A 4EMUA 5SYNA 5TQ2A 5E0KB 2Z3WA 1C80A 4M8NE 1PD0A 3TAUA 3D0OA 2XSZA 2PKWA 4PIPA 3TQHA 3UK2A 4AUKA 1E6UA 3RVOA 3ZBPA 1ZAYA 1FNDA 4H59A 1EUYA 3E0QA 2BGGA 2O9JA 4WK6A 3KKNA 5LBUA 3ADBA 3HWX1 1YZGA 5D86A 2XB8A 2IP2A 2H57A 2NACA 1V16A 3IMFA 1ABEA 1FFCA 1QFYA 1W4RA 4LBZA 2IF0A 4NCHA 1KDYA 4B9EA 1X86B 2NP7A 3CTMA 3HKEB 3NWBA 1D2NA 1EAYA 4HUTA 1UMBB 3I42A 2L17A 1G16A 4KXMA 3F5MA 4CM4B 1IVSA 4FEEA 5F5NA 4H6VA 4HSEA 3VR5H 1MRZA 5BSMA 1WXWA 1NVXQ 3DM5A 1CLEA 2ZRDA 5C46F 4CEJA 5DMHA 2BL4A 4JLDA 4CRWB 4LE1A 5I4CA 2ZG6A 1O3YA 2FPPA 3NM6B 1X0VA 3D6TB 3BXHA 1XXHE 1YFZA 3DZCA 2PCLA 2PO7A 2RBGA 3NWOA 1KZ4A 2JGJA 2HREA 4W82A 3UYKA 1EZ4A 1AT1A 4HI0E 4X9XA 4B4UA 3HSKA 1R64A 4X95A 4S05A 4BOYA 5HEKA 1E66A 1NF9A 4B3TB 4AIIA 2O8EB 1GPLA 1MIOB 3RJZA 1DSSG 1WY7A 4WN3A 5KVSA 2NZ2A 3Q3CA 4PBRA 5KJ6A 3MG9A 4ND1A 3A1UA 3GA0A 4BECA 1XI2A 3BWEA 3P0EA 4WECA 3AF5A 4ZCIA 1QFJA 4BUZA 1XAJA 3DL7A 1IB0A 2X8JB 3ETHA 5CCEA 1CRQA 4BIIA 1A2OA 1N9KA 4FBLA 1M6YA 5HTOA 3T94A 3DWIA 1C4WA 3P27A 4C7BA 1T0BA 1IUPA 2CHQA 2H7XA 3G2NA 4AP5A 3Q2OA 1Y6ZA 5C5CA 4XGKA 2Z6AA 3SFZA 3VPCA 3L77A 2ZWAA 3AI2A 1F9EA 3MIZA 1AGNA 1BRTA 1OW3B 2I7CA 4RS4A 4DAEA 4XRRA 1PFGA 3IDQA 1G3QA 4P80A 3RIEA 3OP4A 4F5EA 3D5EA 3JPWA 3HFRA 4UZEA 1O03A 2HJHA 3KK0A 5J4HA 1WNTA 3TQSA 3G8YA 4BDTA 5EGSA 2QY6A 2XCSB 2VEOA 3U16A 2E21A 3IYLW 2FK7A 3MT9A 1Z16A 3JVDA 5ESRA 3UJ7A 1KO4A 3I2KA 2I76A 3N53A 4CG3A 3B7PA 4RPLA 4XQ9A 2NYUA 4RZHA 5IDWA 5ALEA 1IXYA 3WNDA 3JAWA 3WK4A 3ZQKA 4X1IA 3L8GA 5CA1A 4HH3C 2ZCJA 2FP4B 3FLAA 1V5WA 2XPCA 2HJWA 3JQ8B 2HU2A 2I7XA 1XYYA 5CB0A 3QEOA 5HKLA 5KS2A 3DC2A 1D07A 3CKKA 3DVRX 1OZGA 1E6KA 4J29A 1BDIA 5G4KB 2QMHA 1HDXA 2B69A 3SI7A 4U6QA 4WLEA 1GFIA 4M0DA 3U3RA 1GVHA 4D4HA 3Q9NA 2IBMA 3H87A 4OQXA 4DLXA 3EN0A 3GCZA 5AI0A 2PT9A 3ESYA 5EHIA 4DSAA 3HH8A 1MA3A 4LJ8A 3DBIA 3USZA 3EXIA 1XPRA 3H4VA 1Q84A 2FSUA 3BMQA 3MC1A 4KI7A 2VYVD 1PL8A 4REMA 2JFWA 2WM8A 5FOUA 3BE8A 3AR6A 3KQNA 1Y5LA 4MA4A 1ZISA 4JI0B 2W90A 4MOWA 4EI7A 3HDJA 2QE7D 3W3AA 3U40A 1TYZA 3IXQA 3MGCA 3TO5A 3ADCA 2HU5A 4F11A 3GN1A 2B83A 2HMWA 2YUIA 3DBOB 5IJ9A 1PS9A 4J94A 3QEMA 4O2LA 2ZE6A 4Q9KA 2ZU6A 1T4CB 5GTDA 4ILKA 1DKMA 2Z83A 2I2CA 4L28A 4MQMA 1I36A 5FWAA 4XEUA 1Z0ZA 3OU6A 2FG6C 4JWKA 3WC4A 4BVFA 2A9JA 3O73A 4JYCA 4Y6GB 4Q7MB 1FRZA 2A2ZA 3UGTA 4EW1A 4KNWA 1LDGA 3EW7A 5B3JA 4MR8A 3FDJA 4CLRB 5L8VA 2R4QA 1QC5B 2VSFA 3TVTA 3QKUA 1JKFA 2Z04A 1WQ3A 1CRWG 4LMAA 1RNLA 3E1SA 4H77A 4R3NA 5EZQA 3KKMA 4BB5A 3BS4A 4DCUA 3KYCB 2XMZA 2PMWB 1L4EA 4JLJA 4JAVC 2P1ZA 4YDHB 3NR2A 4JEUA 1A96A 1M66A 1AIPA 5HMLA 4C7MA 3K9GA 3LNCA 2O0KA 3RWOA 2CE2X 4J2HA 1V11B 2WTNA 2X22A 3BMXA 4FSHA 3STTA 1CUAA 2Y2VA 3HB0A 1Y6JA 1HK7A 2P9CA 1XU4A 5A71A 5H02A 1J2UA 4QYIA 4NV3A 3GRFA 3AVYA 2YY6A 1CDOA 1F0PA 1WQ1R 3IULA 4ZVKA 2BF4A 5G3ZA 4RACA 4CTNA 4Q24A 1ZKDA 4FR5A 2OZEA 4XQEA 5COBA 5ALNA 5H83A 4A5OA 4P9NA 5IG2A 5IJXA 4AMUA 3DEZA 3AR8A 2WVJA 1XYVA 3UXEA 4BVAA 4RDIA 5EWJB 3UHJA 4D9BA 3CX8A 3ENNA 2I2WA 2IYQA 3P52A 1JVBA 3SKVA 1UBJS 4ENVA 3H83A 1V35A 5DHAA 1ZGGA 3QBEA 5LUAA 4N65A 3FOFC 1XZQA 4CL0A 1YFJA 2GFQA 3ZWCA 2Z58A 1V8DA 3MJEA 1VL6A 4MS1B 3BFKA 1ZC3A 1G98A 4A6DA 1GUBA 3U6KA 5FT9A 2AN4A 3KQPA 1NKVA 4JL8A 4KE9A 2PKQP 5DU2A 2MWMA 5LWHA 1JG1A 2VNHA 2AOVA 3R7AA 3NEAA 3PUKA 3MNFA 3T1VA 3SJUA 4CHTA 4F3RA 1SZCA 3G9QA 1PNRA 3JAKA 2I3BA 3UK7A 2H2AA 1EWTA 3PI7A 1GCOA 1R4ZA 121PA 4LQ4A 4NMMA 3JSXA 2VHEA 1OSNA 5CFRA 3CSUA 3CVYA 4GXRA 4DGSA 2WM9B 5AKLA 3G5MA 4V0QA 2XCQA 1GHTA 3IPCA 1L5KA 1BD3A 1J22A 1F17A 2J9FB 4JJIA 3ZV7A 2GF0A 5IXJA 1PJ3A 2TMKA 2ZRCA 1LZLA 5SZKB 2IZ1A 4I9UA 4FN4A 1E2LA 1G5TA 5E9JA 5HKKA 4I4NA 4GKJB 3LUBA 2LCQA 2PZBA 2C82A 3LLSA 1G20B 1IAVA 1VLHA 4QPPA 4XQGA 5DRTA 3U4HA 4YLYA 2SKDA 1T2UA 3C8HA 3KJIA 4K6FA 3KZCA 3OZFA 1KFBB 4J2OA 2YN4A 1DADA 4QXOA 5E3IA 2NU6B 2WFZA 5H59A 3RREA 3S1AB 3TL6A 2R1TA 4ZAFA 1PV2A 3ZD9A 3ER8A 4BYMA 1QZ3A 3DULA 3DWEX 5EZ5A 1SHZA 5BNFA 1J42A 3DOIA 3FFWA 3N5KA 2GAIA 3DZGA 4KUGA 4D46A 2CL7X 3CLRD 4LOIA 4MGEA 4F60A 1XQXA 2HK8A 5AVWA 3UJCA 3P2YA 4MLCA 2QE6A 4S04A 2WUVA 1IN7A 1SUFA 3WP1B 1VKJA 3OCUA 1QUEA 4PLTA 5LZ9A 3VISA 1OPRA 1KFKB 3DL2A 3VQTA 4XJTA 3BXPA 3CYFA 2JBWA 2W6JA 4TTJA 4EEZA 2HMAA 4MIEA 4DKJA 5IKEA 1YDGA 4KJZA 2PVSA 3BGIA 2G67A 3QP9A 2FG7C 3MQ4A 2OHIA 5FPYA 2BR4A 4N0PA 5FWXA 4Q7QA 5FYDA 2RH4A 3MB5A 4V1CA 4XAQA 4MKRA 3HWRA 2X9GA 4JP2A 4ZV9A 3QFSA 2AF3C 2E4AA 2JGNA 2QN7A 3CWZA 4IKPA 4LKRA 4YJ3A 1V3VA 1Q12A 1P17A 2C0PA 5A06A 3JAMA 3CQ9A 4XIYA 3MPOA 3HVIA 1ZD3A 2CYBA 3IT2A 3PUIA 4FYWA 4KN8A 4IGEA 4KTTE 4PYLA 3C24A 2JLBA 2JPDA 4V02A 1KVSA 2WD7A 1J2TA 5I8ZA 1SBNE 1RI2A 1KFJB 3RJMA 1QV7A 2XUGA 3V1TC 1WCIA 4EHNA 1N8NA 2AXEA 3NASA 4IYJA 4N7BA 4X97A 4S2EA 1OD6A 1XVLA 2X1VA 1OXXK 3KQYA 1UFKA 2QGNA 4HEQA 4QXAA 4EGFA 5H1YA 3LQFA 2NPFA 4Q47A 1GOTA 3B5IA 1DC3A 1LTHR 1T2CA 2WWIA 2HNBA 1YFLA 1V41E 2PWZA 5CLGA 5K3BA 3B20A 3D1JA 1J97A 5I9LA 1R9JA 4P98A 3A4YA 2GA9A 3PC4A 1TQ4A 2FSPA 1W6RA 3QFHA 3G2OA 3GPCA 5BN3A 4W5OA 3SOZA 5KB3A 1XMXA 3AIKA 3ZHOA 1QGZA 2APJA 4RZQA 1E3EA 4WE3A 2PR2A 5F98A 3BL8A 1KKUA 2JAUA 3FPHA 3H5RA 1VFPA 2BKXA 4RBNA 5F64A 4B4WA 2GASA 3LQQA 2GZMA 3CRRA 4HAXA 2QL9A 1QP4A 4QL3A 1F8YA 2EVWX 1IZ7A 5LZ8A 1P4SA 1VSQA 4KMRA 2QRJA 4M1WA 1TX4B 3FHLA 1EX1A 2DX7A 3WBBA 3LZ6A 3IODA 3PDHA 1VPEA 3UV3A 3A9RA 2H8KA 3R9XA 1C7JA 3VUFA 3ZBQA 1U5AA 1YC5A 2ISCA 3TOZA 1SCAA 4IH9A 4MGKR 3TL3A 1MX9A 5JAUA 4RH1A 1HQDA 1PI3A 2QV0A 1JH9A 1DUIA 2NSDA 1WTCA 5KTRA 3AB7A 2JJMA 5EKXA 3TW6A 3K5IA 5LFAA 1BA2A 4LC1A 3ZXXA 3CNOA 4BBZA 3ONVA 1GGEA 4ZOEA 5I47A 2BCGY 2ONCA 4OB7A 2QI9F 3UUWA 1MMFB 3C5CA 4MEJA 1ACLA 2PU5A 1AZLA 1XZBA 3OIDA 3R6GA 4EHFA 4FDTA 1PJQA 2XUJA 4HB0A 3ODGA 5LC1A 1ZK3A 2ZWPA 5CURA 5MHTA 4TZ6A 3KAJA 2OSVA 5FF9A 4BVGA 3KQVA 3LY8A 4R2IA 4NCAA 3O90A 3PEFA 1VLJA 2YW9A 4NCBA 1G1AA 3G02A 1FFYA 1ZH8A 3HI6A 3DDNA 1LEHA 3EWIA 3PD1A 1J5PA 4BKPA 1I2CA 2I8CA 2ECOA 3SLRA 2FZEA 2LXNA 3MHPA 2F3QA 4YRQA 1XVIA 4YQFA 3TGPA 2P90A 2JGRA 5JATA 2E0IA 3VGPA 2H00A 5F2NA 5FYQA 2EWMA 5B4UA 3K2EA 8ATCA 1Y3CE 5G0VA 4W1RA 3SKYA 3ADOA 3HCWA 1G9XA 4N9WA 2AG8A 2H9IA 4QYTA 4DY6A 3LUCA 3RR2A 4EHLA 2C29D 2WIGA 2QL7A 3HM2A 4MA0A 1WPXA 2C7GA 5MGBA 5EYPA 2VT3A 1Q0TA 3IA2A 1I0LA 3STHA 2WHYA 2PKEA 4BO4A 1PTJC 1T36A 4OI0A 1Y3AA 2YV2A 5HS6A 1DAKA 3IOMA 1TQDA 2I62A 3MM4A 2GTHA 3UV6A 4HV4A 5CEEA 1G6HA 1I4EB 1A8QA 3RGWS 1QTQA 4H16A 4MQEA 2QMYA 2OFFA 1JJBA 2VP9A 3DP7A 1GUZA 4R2LA 5IVPA 4EI8A 1E1RA 3TDKA 2PUBA 2W6NA 4WBXC 4FKBA 2YBDA 4B6RA 2ZE8A 2DHDA 3LSYA 4TSRA 3ZXUB 3GJXC 1L7EA 3L7JA 4F4CA 1K3UB 1G8PA 3FX2A 3EDQA 2ZU0C 2BFBA 3OFJA 4LTDA 3W0LB 2ILVA 1N2CE 1R0WA 3G9XA 3WG9A 4AROA 1W88A 1GNPA 2VSXA 3BPSA 1EB8A 1THTA 3AW9A 1F3LA 2W2QA 2ZJFA 4JVOA 4BKRA 1C3OB 2DY0A 2NUPB 1XX6A 4L4UA 3VSAA 4W5RA 4GM4A 3ON5A 4MJXA 3GFRA 4AN1A 4BNMA 4D5GA 2Y1FA 4YMGA 5H4HA 4RJIA 1AKUA 1MQ9A 3ETCA 1V1RB 3O26A 3VPSA 5IJAA 1UM9B 3ROFA 1IBLB 3I1FA 4HWSA 5CX1A 3GAZA 1TC2A 1FYXA 2ZBVA 4YC7A 3NIFB 1IQUA 3R5HA 1VL0A 1Y63A 2QI9C 3I6ZA 4H08A 3ZE6A 3D7NA 3MZ0A 3KJEA 4K6OA 4O4IA 2YXNA 4RMIA 2I03A 5JD6A 2C7VA 2HNAA 4FHFA 3T7TA 1M2EA 4JVMA 3FZGA 3T3IA 2X77A 1AV7A 4AP9A 1VPWA 3LDHA 5H7XA 2CN1A 3NORA 3VYWA 1IZ0A 1ST2A 1R8XA 1XP8A 2OAQ1 2QLNA 3DOFA 1RLTA 2JEOA 3KAPA 3WWCA 3E9NA 1E6MA 4U2CA 5FUVA 4UHKA 3QBJA 1HMPA 5BR1A 2QUHA 2W22A 2ZROA 1KZ9A 2IHUA 3NBYC 4RW0A 1X7XB 1S2IA 1U8FO 4UAJA 4ZHQB 4FFMA 2G07A 1H9AA 3EVTA 4RKWA 3IUEA 2C59A 1GNVA 4Y0AA 1XA0A 3AEUB 1XD2A 1WDMA 2OBNA 2PVCA 2XYVA 3GGGA 1ESNA 2W6PA 3MGAA 2DJIA 4PLHA 3IB6A 4JJGA 4MWTA 3COJA 4EWLA 3IDAA 2PZJA 2FQXA 2Q6VA 3WHPA 5CMLA 2SBTA 2RGEA 4AZSA 3DMYA 3HL0A 2O2ZA 3OE7A 4RIHA 5B5SA 3GFOA 4ER3A 4G6ZA 1H65A 1B2LA 4OKNA 3KUCA 4WN9B 4MRVA 1VL1A 3AW8A 3HYLA 5JU6A 3GAAA 1FJHA 3GJ4A 2EAUA 2YWCA 1P1BA 2W58A 2WR8A 3Q3HA 2AOUB 3GBVA 1YMVA 1NW4A 3D0QA 1HEUA 4G8BA 1R0LA 4IIJA 1S01A 4JT9A 3PGA1 4FZ5A 1XLUA 4FZJA 4P6VF 4IHKA 2ARKA 4QWWA 4D9CA 1MTZA 3FMVA 3LYUA 3OLCX 2R6DA 3R6WA 1GZHB 4HC4A 4Z9BA 3W5BA 3D7KA 4NK5A 2XNKA 2OV6A 4HT3B 1WX1A 2GQ0A 4J03A 2BELA 2N75A 4NENB 2A5JA 3P2KA 5DHSA 4EO9A 5I7AA 1G21B 4INAA 1PFYA 4FOTA 3C7KA 1C9NA 1MJHA 1O95A 2WIFA 4PBSA 4FFBA 3R9WA 1SBIA 3DFZA 1FQWA 3UWKA 3HRHA 4X20A 5ALGA 4D9FA 3P0JA 5AQ1A 3ER6A 2WHPA 3KV1A 3M2TA 3SJCA 2WNSA 1AGRA 2WJYA 4GYKA 4BFTA 4UHEA 1GDHA 1TVEA 1XXHA 3DOJA 2GETA 3E9MA 4WKPA 5ELLA 4BX8A 3N8DA 3FZYA 3IBTA 3U7QB 4DBLE 4E5SA 2OECA 4RTMA 3OZIA 5B3JC 5B58C 4P4SB 4QTTB 4GW3A 3GCXA 3PNPA 2PGLA 2CFIA 2P9HA 1N34B 3AUJB 3U7RA 4JU8A 1GPJA 1F3OA 1YUBA 3LGSA 2Z6QA 2BWJA 1F20A 3BK1A 1KY4A 1O6GA 4QOHA 3SPXA 1JAHA 4BGUA 2AB0A 3S4YA 3WA7A 5KDOA 2AL7A 3WB1A 1X1CA 1VFNA 2BFOA 4M7OA 4G1FA 2YZNA 1LVHA 4QUAA 4BKQA 4A91A 1F2UB 2J8ZA 2QTVB 4HXFB 2VCEA 4C1NA 1A4XA 2D1FA 1O5TA 3GUZA 1FDUA 1IHDA 4DNXA 1WETA 4P7GA 4ZV7A 2NU9B 3TDMA 1ZIOA 3MCWA 1N2BA 5BVHB 4Y7CA 4YLGA 2V5AA 5FRDA 1HA3A 3IALA 2A0KA 1A7UA 2JAXA 1L6IA 2CLOB 4W5HA 2BGUA 5ELXA 3WXBA 2C96A 3AUTA 3EXHB 3UJ6A 1R0YA 1V48A 4D0LB 4CEHA 2CNWD 4Y30A 3WQQA 2ZIVB 2YV3A 1R6UA 1UXOA 2PQMA 3L6UA 4TMTA 1BVRA 3TQCA 2YHAA 3PXCX 2EW1A 2HZ7A 5F52A 4ANFA 1W9HA 1X9IA 3UKJA 3EOBI 4IXWA 5I6DA 1XA4A 1RSZA 3GBPA 7REQB 1Z08A 4I4TA 2GRUA 1ADFA 3K4HA 3FPLA 5CW2A 2QD5A 2F7SA 1W4ZA 4TXMA 4YO8A 1IVNA 1K9SA 1NMEA 1JFVA 1ZRMA 2B1RA 1SRQA 2VJYA 2WJ3A 5FTMA 5IRCD 2PWBA 3ZWQA 1KQFA 1N6KA 3DEHA 1JHYA 3BFPA 1GGKA 4QREA 3P45A 1ULBA 1YR8A 3KQSA 5CNJA 1J09A 1SOVA 5A4MS 5KVVA 4PINA 2PT5A 3TXAA 1EM6A 3X1JA 1N8SA 1TM7E 3KT0A 4H3VA 5KQMA 1DS6A 1GKUB 3CLTC 1P1RA 4GZMA 3RAPR 4NABA 1GPH1 1J25A 1DC7A 1I3OA 5IXYA 3PNBA 5ALKA 1ONBA 2JRLA 3PQ4A 2DETA 3II6X 2FPGB 1R5NA 2A3RA 2EC5A 1PHRA 4PX2A 4BASA 1TF2A 1IIRA 1SXGA 1M7HA 5IH3A 1IEWA 1J24A 3FG9A 3TLKA 2JLUA 3UBTA 4GMFA 1DFIA 1QG0A 2AVNA 5ARBA 3TTSA 3I34X 2WWRA 1WHTA 3VC2A 2Y1LA 2AX3A 2G8NA 5EC8A 4LGVA 4PN7A 4OM7A 1E4EB 2CHUA 4LYHA 2IGTA 4P5EA 4MUJA 4JCCA 3UUEA 4Q4CA 4Z49A 4RGVA 1D8TA 3AR4A 1P2SA 2H52A 4BFZA 4TTTS 1H2XA 5MN6A 1E4VA 4LV8B 4CFSA 2BMEA 1CR0A 2G09A 4NZ9A 1VLLA 4L73A 1Y6QA 4B7ZA 4BL5A 1P33A 1N0IA 3TFQA 1W85A 1KHTA 2QBYA 1MBZA 4KLNA 1P7WA 3KHUA 4OI1A 4MWOA 4OHFA 4M7PA 4QHSA 3WLMA 4FBGA 4LVCA 1V6SA 2XNSA 3GEHA 2PAAA 4IH1A 2G3YA 2FPOA 1TU3A 4L07A 5KJCA 3SR3A 5KC8A 3I5XA 4DEYA 1G21E 1V0JA 3LD9A 3GVXA 3PC6A 2CKMA 3PYXA 2VQ6A 4NJOA 4Y18A 4HXYA 4MYUA 4R8LA 3KJGA 3ZDDA 3W5JA 5KNDH 1W36D 4NHOA 2ZUDA 3T7AA 2A9VA 5GIPE 1R5OA 5KNBH 1PN3A 1P2BA 1RIFA 2AJ8A 3FLMA 3WQSB 3E05A 4BGVA 1QKKA 2CXTA 2ZLBA 1VJDA 3NI2A 3FVWA 3BREA 2FQYA 1C1DA 4L8VA 5I7FA 3H1GA 2UUPA 4W1QA 1CDZA 3DL0A 3WOHA 3DAYA 3IMCA 4I7EA 2R6AA 3LX4A 4BAGA 3FDZB 1WW8A 3R5TA 1JR4A 3FCEA 1QGAA 1VHTA 1BXGA 2F1RA 3JQBA 3OJLA 1CX9B 2WU3A 4URWR 1IONA 1H0KA 2IHZA 4LZPA 3QVGA 1V5FA 3WFZA 2DT5A 3BDVA 3UMCA 3HBFA 3LS2A 3ZU3A 5HUHA 4Z0HO 3L8EA 3HV2A 3FHCB 5IMBA 5L4NA 1EFHA 2QN9A 1SPBS 1WL8A 4RFSB 2ZIXA 5CK5A 2ZUFA 3SYNA 1ORDA 3LYHA 4MQ6A 4RY9A 3I6IA 1TVCA 1DINA 1H93A 2J31A 2W2MA 3A2MA 4G23A 2NTNA 4A8JA 4OBXA 4UEQA 2P4UA 2JHGA 2QTFA 1KEPA 4B7XA 1XF9A 4IY1A 3VH1A 1R5BA 4IV8A 3MYRA 3QNUA 4AJOA 1PAUA 1FDIA 4YAKA 3QKRA 3ZW7A 3V4OA 1KS2A 5EJMA 1UXKA 1X9GA 3RASA 1T5SA 1B3BA 2GN6A 4YI5A 1O96A 2NXNA 4Z0TA 1A7AA 3CNEA 2CNLA 4OQLA 4B8YA 5JARA 3TLGA 4DAOA 4ZV4A 1CY0A 3JRNA 3FYUB 1KQNA 2GBCA 5I4KA 2VJMB 3LWDA 3FMFA 4YAJA 2P91A 1Z34A 2QDXA 5JSZA 3WYNA 4B32A 2VJNA 3I23A 7AT1A 2DJ5A 1AKNA 2VF2A 3W6ZA 4EKIA 5KWJA 2OV4A 1PR1A 2WJ4A 3EYWA 1JSLA 1G5IA 4C08A 13PKA 1W4BA 3HXPA 4EBBA 1OOEA 4RK4A 3TAXA 3AL0C 3JYHA 3MLBA 3PIDA 1QHFA 2JH3A 3Q6NA 5EP4A 2IYNA 4JU9A 7ADHA 2XZPA 1YQGA 5DX8A 3ZJYA 2HADA 1FRFS 2OM6A 3OOYA 4PFSA 4TLCA 4N47A 2AMVA 1YR7A 3PGLA 4GKAA 2QOEA 2A59A 4EABA 5JIBA 1RHMA 4B43A 2D1YA 3EX7C 4TM7A 2D62A 4FEYA 2GSDA 5IABA 1JFFA 3R9IA 2J9RA 5EPEA 4P7FA 4YI3A 2CLCX 2X41A 3C43A 3K1ZA 1SCDA 3LC2O 2DBQA 3W5UA 4DBLC 1IN1A 2NQTA 2M2IA 4P38A 2FRDA 3GDFA 1LPBB 1YULA 3KE8A 5JHGB 3K15A 4GEKA 4WV3A 4I50B 1Q7RA 3ZLTA 3S81A 1GFZA 3CGGA 1STOA 1RZRA 2RB5A 2O7SA 4ZIRB 4MX8A 4ZCSA 5CYPA 5TQVA 1I3KA 2B34A 2FZLA 5HF6A 4RHTA 1DXOA 3KQMA 4AJ9A 1NIPA 2QW0X 2QX7A 5DLPA 1HZJA 2OZPA 4JI7B 2ZJ7A 5BRAA 3AF6A 3ZJUA 3ZHRA 2AYXA 2PJZA 4ER7A 2LVBA 3AF2A 1D2CA 3M3HA 1VG1A 3A0RB 3HNPA 3JARB 1V7QA 2HV8A 5JZBA 3V4PB 4MGHA 2XQJA 3JQQA 4ZHQF 1JWBB 4IRUB 1FSZA 1UZNA 1QKJA 2GR9A 3WLLA 4AL4A 1BFKA 4BHTA 3GEPA 3MWDA 3CNHA 2FN3A 1YJCA 1MGPA 1W6UA 3KR1A 3KEGA 4XD7D 4E7OA 1EJ0A 2XQKA 1U3CA 3BFJA 4XIJA 1Y3HA 3RSSA 4IFTA 3IR5A 2AD5A 4RXTA 1KEKA 5SZHB 3H9QA 1BQ4A 4RSHA 5IN5A 2CLMB 1CJTC 1KO8A 1H94A 2J67A 2PUTA 3GN2A 4XB1A 1U8ZA 2ZJ6A 4L2IB 4YDSA 5AQEA 6CHYA 4RTOA 2R4UA 3LCRA 4D8YA 4KAJA 1V1MB 3BQNB 2AJLI 3DF7A 1CNFA 1U8UA 1RAIA 4ER6A 5K0GA 3ZBTA 5IYZA 5E9QA 5C3UA 1YV9A 1DWUA 4YMIA 5DIFA 3W7BA 5KNCD 1CVLA 1MB3A 4IS3A 1WLYA 5FNVA 3OJFA 3AVTA 4KQEA 4M55A 2E89A 1YE8A 4DMRA 5ALQA 4U7WA 5FADA 3ZV5A 5JZVA 2ZSDA 3TTUA 1UKBA 2EHJA 3B89A 2MHCA 4OP3A 2RG1A 3VNAA 1ISGA 5JAIA 3N76A 3DAFA 2XTJA 1HOTA 1E1QA 1Q7GA 5TQJA 2BR3A 1Z5ZA 3D6VA 4DQKA 3J81k 3HXOA 2ZR7A 3NV9A 1Z56C 3WL7A 1AQLA 3D6UA 3HL4A 4MB2A 1UBOS 5CFMA 5EN4A 2UZ4A 3FKSA 5BOSB 2KWIA 2ES4A 4LXQA 3T1HB 4Q3AA 5AUOB 2R86A 3O7WA 4XB6B 4X6LA 3FGNA 3G8CA 1AZSC 5D7BA 3L1JA 1JEAA 1IN8A 3I76A 4EJSC 2GK7A 2B61A 3B9QA 4FYYA 4MWGA 2PS0A 2V7QA 4TKVB 2X7HA 2XUOA 4NG5A 3RYFA 2GEJA 1F51E 3KPYA 3NYIA 1X7ZB 1C9JA 2GN1A 2IIPA 3E5HA 3HSYA 2FLVA 4Z9XA 3RT7A 4UEKA 4FMPA 1MT3A 4Y67A 3JW8A 3DTVB 4W9NC 1LQ2A 2NV0A 3PD0A 5KJEA 1KYWA 1ZUHA 3ITEA 4V0LA 5CRIA 3FHTA 1CUSA 2WE8A 3AJEA 5DO9A 1KXJA 1YSCA 4YB8A 4H18A 4RYDA 5EMJA 3RLFA 2EIHA 2B99A 3COZA 4L50A 2RMKA 1EVJA 4CKYA 4S1NA 3DDHA 3QWFA 3VR1A 2PH7A 3ZC3A 4ECEA 2XQIA 3P2EA 4DXDA 1ZSVA 2KS6A 3E7FA 2YZGA 2AUNA 4C21A 2WZQA 1YI8A 2CCKA 3H1FA 3ZWKA 3DYIA 5DN9A 5FTLA 3R0QA 5FOVA 5ALZA 1B41A 3A3OA 1JECA 4J75A 1K4KA 1RQRA 1ZEMA 2ZITA 3ELDA 1W1IA 5KVQA 4GEGA 3BULA 4DRYA 4XVCA 2JH9A 3R8CA 1CS0B 3AI1A 4ZCRA 2JIPA 4HGOA 3LUHA 3D3WA 3GD5A 1H2HA 1QDEA 2E3JA 3LOQA 2C1ZA 3LX6A 4HEHA 4EDFA 4DQ0A 4EYQA 1KEEA 4OHCA 4UU0A 2YN2A 4KYVA 2WF5A 3GGCA 4KC0A 1YZYA 3I62A 1UINA 2DWQA 5CB6A 1T6NA 3ZD6A 3X2FA 3NGLA 4UKDA 1PK8A 3T9DA 4D3YA 2XY4A 4FOOA 2OB1A 2B4RO 1UXJA 2PRSA 3I58A 4PGHA 4O3FA 4TWZA 4BNIA 1KC3A 3KXIA 2XX3A 3M33A 3I4LA 1YZUA 3VSEA 4DVJA 5KNDA 2ZUUA 3H9CA 4KN6A 4I9GA 1XJQA 1H1DA 1JTFA 4BLWA 4D6PA 1JFRA 3RYCB 1I7DA 5CVUA 5AM3A 3QKIA 1QIHA 3ROPA 2M6LA 4R4JA 3EGIA 3FNEA 2JKZA 4KI0A 1Q57A 4OIMA 1Y3BE 2ADMA 2MINB 2Y9MB 5DYIA 3U4AA 3J7AC 5EIAA 3HWSA 3WBFA 1ZCAA 2F59A 1ORHA 5AKGA 2EL9A 2JFVA 1V39A 3F6BX 2P5SA 3CZRA 2GZ2A 4BMYA 4R6XA 4H9GA 3AX6A 1FDTA 2FSFA 1P4JA 3HC7A 3SS9X 1LSSA 2XZOA 4X45A 5JNTA 1X7YB 5CR9A 1VIVA 2WNIA 5JO0A 2V6MA 1MVLA 2JBAA 2IEDA 1TQ6A 1BXZA 1GY8A 3C3WA 4LIPD 2XSZD 2ON6A 4Z4EA 2YNMA 2VUIB 9LDBA 1DBRA 1UPAA 1C50A 3T4UA 5T4EA 1EXWA 3AKDA 2DQSA 2WJIA 3GCWA 3M9XA 3K70D 3FPGA 3FYHA 2P9GA 3NCHA 4HZUA 1BG6A 3ZQ6A 4XWWA 1AS3A 2ZCUA 2JJ2A 4FR0A 3AG6A 3H3FA 2ZT7A 5ED0A 1JW9B 4YUVA 3UV7A 4L0MA 5SY6A 3MTGA 3EW9A 3AINA 4RZXA 4I8XA 4JGBA 1V43A 2ATXA 2ICAA 1FW8A 3HFGA 4LWZA 3RIXA 3ETGA 5JLAA 4DSNA 2X5KO 1FCJA 1ZKMA 2JIRA 4I6EA 5BY2A 1U0GA 4Y6QA 3UMYA 1TK2A 5B1IA 5THQA 4P84A 4F3YA 2PX8A 2I4TA 2GZSA 4EG3A 1HORA 2R7MA 4HBZA 5A5VA 5KYUB 2GYWA 5EERA 4U7DA 2NVOA 3QY9A 4EX7A 3P0RA 1Z37A 5GOZA 3C3EA 4KAFA 1MOQA 4DYDA 4RJ2A 4P54A 1OROA 3JD1A 2BHLA 3ID6C 5JAQA 4YT8A 2JFZA 4DQXA 1JDVA 4ILEA 1VL5A 3CB4A 4N8DA 2OKGA 2AFHA 2I80A 1LBTA 2HDHA 3AHCA 1IJKA 3DCYA 2LWIA 3AC0A 3JALB 4L4YA 4N3GA 4ABYA 4QM7A 1N9GA 4QDJA 1Q3TA 4PRLA 1P0MA 2AOWA 4M0UA 3SZ3A 1UC8A 1XJ0A 4RXMA 1OGIA 4M7RA 2HRDA 5TT1A 1T3ZA 1XEAA 2H5EA 4XWGA 1XQ1A 4TMKA 5HIJA 2XZDA 3OUTA 5LMNB 2YS6A 1CJVC 2D1QA 3K0CA 4DIDA 1HEIA 2RKOA 3PFCA 4L85A 1YOVA 2BAGA 1UMCA 1Z13A 4C4AA 1RAGA 1E1LA 3IDFA 4OJTA 2Y0PA 1RAAA 2VEDA 1KP3A 4D0RA 4BEVA 2YUTA 1LDNA 4BGDA 2FPIA 4DR4B 3NIDB 5D5PA 9MHTA 2FPRA 3ZS8A 3F90A 1NP7A 4MRAA 2R751 4WINA 4ZTZB 2I54A 2EGUA 4IEIA 5IANA 1LDEA 4S1VA 1DX6A 3GRYA 3L06A 3RS3A 1BE6A 3V9PA 1M1YE 3EF0A 4EHHA 1YASA 3A3YA 4H6WA 4KQMA 4QDOA 1ZU5A 3B1KA 3PRYA 4GBMA 4LZJA 4RPJA 3F46A 3R74A 2ZYRA 3M4ZA 4QQKA 1JTVA 1DG3A 1GNSA 5KNLA 2GLTA 1HNXB 3IIIA 2CV2A 1NOIA 2FFAA 4EKNB 3WGIA 2GM3A 3BZBA 2R1VB 4PX9A 2ECFA 3HN7A 1ZIPA 1NG1A 1V26A 1SUCA 5KU7A 3MTJA 1CUDA 3E61A 4KPUA 3JQGA 3SAJA 3TW8B 2YZKA 3JQ7A 1EI9A 2XDWA 4MK4A 5TARA 5IZCC 4D2IA 5F9MA 2DFLA 1D6JA 1RPJA 2FWBA 1JEDA 4Q4HA 3UXYA 1XV5A 2CJWA 4ZA2A 2PS1A 4EPYA 1EDEA 3R7BA 5BVGB 4MVJI 4LJ4A 3KYDA 2J09A 2RHTA 4TRRA 1R6DA 4KDEA 4R7GA 3R23A 4J1TC 2WOOA 2HA7A 4GRDA 1K2VN 2M6KA 1PSWA 1MO3A 3N2NA 3STXA 3AH8A 5EWMA 2JFQA 4RWEA 2I4OA 1EM8B 1XTKA 3A4LA 3CG4A 2OC9A 3CJTA 4I1VA 1E6LA 2OPBA 2P9TA 1G5RA 2GFHA 1OLOA 2B92A 1WP4A 2UKDA 2WJAA 3INNA 1KP2A 2WMNB 1E0JA 2Z8YA 4JZYA 2IHBA 3U48A 3ZZMA 3PEVA 3FMOB 3T9BA 4R31A 2XNDD 4F4JA 3ZQJA 3RVQA 3CPSA 1EX9A 3CX6A 1LI7A 3JR3A 5HDQA 2EJVA 1PK9A 1Z4JA 3GR6A 5EWJA 4MW2A 3IPAA 4NQRA 2B0JA 2ETXA 1GKYA 2EX4A 3C7CB 4QEZA 1U5BB 1YS7A 3EZFA 1LWNA 3GJ0A 2RH5A 3IOEA 2M6RA 2Q0XA 3OWOA 3QMWA 4W7IA 4C43A 2VPWA 1CHNA 3EE6A 4A1FA 4JKOA 5JS8A 3GRZA 1FDRA 5FBRB 5FNZA 1U2TA 4N41A 5EQJB 2RSLA 2XDQA 1P5RA 2C5BA 2BSXA 2FFRA 3S2SA 3E03A 4ETIA 4R68A 5C35A 1E5XA 2IXEA 4AM8A 4OAPA 4G8DA 4DR1B 3GIDA 4AO8A 2AMFA 3H8WA 3NPAA 2X0EA 3O31A 4M1TA 3AIOA 4C30A 1NI3A 2GS9A 1FQOA 1TVKB 3BGOS 4MYSA 2IEBA 1INLA 3JR7A 5TRTA 4AZ3A 4RF5A 3OEHA 5KWVA 1EAMA 2OCGA 3K32A 1AN0A 3R41A 2HLNA 1AQUA 3F78A 3QELB 4B80A 2O0HA 1POXA 3OOEA 4OQQA 4TTSA