5IT9L

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
155
structure length
155
Chain Sequence
STELTVQSERAFQKQPHIFTNPKAKANRKTKRWYKNVGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTRMHRTIVIRRDYLHYVPKYNRYEKRHKNVPAHVSPAFRVQVGDIVTVGQCRPISKTVRFNVLKVASATGKANKQFAKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
total genus 19
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00366 Ribosomal_S17 Ribosomal protein S17
L PF16205 Ribosomal_S17_N Ribosomal_S17 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1000 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5it9L00
3J7AV 5IT9L 5LL6X 3J80L 3JAML 5FLXL 3J81L 5A2QL
chains in the Genus database with same CATH superfamily
2QDLA 4ZUIA 1F9PA 3HKZE 4JI3L 2PW7A 2RHSB 2JYOA 5IYBG 3VA7A 4LUOA 4NXMQ 1X54A 3S17H 3G6JB 3GTPH 1Y1VG 4JV5Q 4NXML 3D31A 4JV5L 3TSSA 2AQ2B 2XWJB 1G2TA 2V1CC 4RMFA 3CCMA 3MFGA 4PG3A 1BUVT 3KBGA 1NTGA 3RZDH 2VUMH 3K7AH 1I4GA 4DAPA 2E74C 4L5RC 3ULPA 2R7ZH 5JPMC 1VQAA 2QA4A 5I6YA 2B2UA 2RHQB 1NUCA 1J5EQ 3QR8A 3UDFA 1TWGB 2HDLA 3MEHA 3GTOH 1QVGA 4C3HG 3S16B 2X69A 3AFPA 1J5EL 2I5HA 4DK3C 4OEMB 2AQ1B 3H94A 4DR5Q 2D5DA 1V8QA 2CQOA 3FPUB 1V1PA 1LLRD 4YHHQ 1GKHA 3AQQA 4DR5L 4YCVA 1U9RA 1R9TH 2K50A 1LT4D 4K6DA 4KKTA 4YHHL 5F2DA 5E4XA 1U5KA 2WIIB 2A69C 2Z6KC 4IUUA 4BWGB 2NVYH 1IZ6A 1CI3M 5H1SE 1AZQA 3KLRA 1X56A 1EIHA 2G9DA 4CGYB 5C44H 1Y1VH 2VNUD 2EYMA 1PRTB 3ZYYX 1PFNA 2O4XA 1ILPA 1E2WA 2WAQG 1SE8A 2EVBA 2RBMA 4BY7H 4J15A 3T4AC 2EJGC 5I2YA 1EWIA 4KHVA 1M4VA 2L5TA 2QCPX 1EY6A 3E0EA 4FXKC 2QKIC 2EYLA 3ERQA 3GO5A 2N78A 1SFOH 5CGKA 3R2TA 3NTIA 3S17B 1STBA 3I72A 2MUYA 2BDNA 1LYLA 5I2XA 3CCEA 4B3RQ 1EQQA 2F0GA 3D6CA 2R92H 4B3RL 3IKJA 3CF5A 4J8QA 1EEID 3IAYA 3CC2A 1A8VA 1VQBA 1AN8A 4MIUA 5FLMH 5M3FB 1BDOA 1K9MC 5C4XH 1TU2B 3FRPB 3K7AB 1ONLA 2K52A 1D1IA 3DWQA 3K57A 3CXCA 4IOCA 3BDLA 5CV4A 4A93G 2A8VA 2NTTA 1II3A 1K28A 4K5WA 2EPBA 3BZCA 2FXQA 4P72A 2BH8A 3PIPA 2R93B 3CHBD 3M85A 1B3AA 1EWCA 1JB3A 2PMZB 2DN8A 3NBHB 4GN3B 4IJHA 4OO1G 2WB1G 4K14A 5COYA 5JJZA 1KC8C 4KY5A 2LS01 4DN4M 1K73C 2NYZD 4JVZA 4P74A 1VQIA 4DNRB 3OPOA 3QB3A 3TP8A 1Q8IA 4LFCQ 2JEAI 1FL0A 4ZYSA 1Y1VB 5C4ZA 1JE5A 4ILWA 5CMDA 1FNWA 4LFCL 2F0EA 3CRKC 1CT1D 5EQ0A 4KKUA 2JA5G 3ND9A 2TMPA 1X32A 1K8AC 2IT1A 1C9OA 2KVMA 4KI0A 2FINB 3Q8DA 2Z6KA 3DWAA 2JEBI 1UNSA 3TN2A 2WKCA 4XIGS 2HD3A 2EY5A 2EYFA 3S2HH 4XYOA 3KDFA 5C3XA 1FNUA 1SFOB 3PO2G 3F1ZA 2EYPA 4JI0Q 4F88A 4IOAA 4C3HB 1HQRD 4JI0L 2EE1A 2Z1CA 3N52A 3SEBA 1DD2A 1PTOH 2QGQA 1S3OA 1RD9D 3UE1A 1TY2A 2J4XA 5J39A 2DY7A 4A3MG 2NUCA 4CJ2C 1BCPC 1Q1EA 4LJZC 3HZXA 4ULLA 4UAIA 5C4XB 4LWCA 2MP1A 1E7ZA 5CV5A 4JW0A 2A68D 1JQYD 2EYJA 2HIVA 1W2BA 1LACA 2KBNA 2RA4A 1GM5A 1KLGD 3BJUA 4WJWA 1JICA 3KJPA 2SNMA 5IP9G 3FEWX 1YNJC 2WAQB 2Z0SA 3BDOA 3H91A 2K03A 4U68A 4CBVA 3F2DA 5G3LD 1ZYRD 5IYCH 1U4MA 3A8KE 4CKEA 1BQQT 3HOVH 1EY8A 1OXSC 1P16A 1PFMA 2CH4A 1UE6A 3JAME 1R4PB 3PO2H 5IIFA 4DAYA 1KQSA 2IX1A 4UY8C 1HTPA 2DUDA 5AFWA 3U9SA 5IT9L 3K5LA 1QCBD 2RSNA 3G4SA 1ENAA 1D5MC 4FXGC 1V1PB 1Y1WG 4BY1G 4LF4Q 4X3SA 5IT9c 2F0VA 1SYDA 5KYLA 4Y52H 3CW2C 3A0JA 1JJGA 4LF4L 4K8JA 5M5YH 3K5OA 3LWEA 3CCSA 4HCEA 1U4PA 4JOIC 4FP5D 3S2HB 3T53B 1ASZA 2XVSA 4A93B 3STBD 3MC0B 4KJOA 1MSGA 1TS3A 4IPDA 4P71A 1GUSA 2PZTA 3BVMA 4LFAQ 3UDXA 5CBAE 1JOKA 4DV6Q 1GXDC 1B50A 3A56A 4LFAL 5GROA 3FVQA 4DV6L 2WB1B 4A3IH 4OL7A 1VMPA 4B9XA 4XQQA 3I2ZA 3I4MG 4I65A 1I6HB 1QB5D 2B3GA 4A3JH 1YI2A 1F77A 4FF1A 2UXBQ 2L1BA 2RQXA 3ONAB 3NEMA 3PF5A 2UXBL 5IP7G 5KNCA 2H5XA 2TSSA 3EROA 2PPBC 2AHOB 4ZK9B 1H9MA 4R8IA 1VQCA 1X9NA 1RTOA 5KNDA 3HOVB 3MVVA 2XN9C 5I4DA 2EY2A 3E9IA 1L1OC 1K3RA 2KCNA 1F2MA 3TRZA 3DM1A 2Q2TA 1E0BA 2E2JB 1WCMH 1L0WA 4X3TA 3PO2B 2F0HA 3CC7A 1X3FA 4HMJA 4Y7NB 4GNXA 5FOBB 4X66Q 2J0TD 3CCJA 3HOYH 3RZOB 4X66L 5J1ZA 2JQOA 3A5UA 2B2YA 4A3MB 1JE4A 1IYUA 4HIKA 1EOVA 2K5HA 3JAMi 5LL6S 4GKKQ 1ENCA 1SAPA 2IHFA 1CHQD 4C2MH 4GKKL 5EJWA 3M4YA 1EZ6A 2M2LA 1O80A 3O13A 3S1RH 4ZKBB 1QZHA 5IP7H 2B63H 2DY8A 5DLQE 2OT2A 1YNXA 1KXLA 1X3EA 2JN4A 4IFDH 2FJ2A 5CV6A 3VR6A 4KHPQ 1LT5D 1UUPA 1R4QB 3TP7A 3Q0AA 1U0LA 2ZJPA 1VQJA 1EYGA 2D2CC 1QVCA 3NHHA 4PV1C 4KHPL 4LF5Q 4GLAC 1CKOA 5C4JB 1ZXTA 1ET9A 2RSOA 3PUYA 4R4QA 4LF5L 1YVCA 4DR4Q 1V9PA 3A55A 2F0WA 1PYBA 3KJOA 4DR4L 3OYYA 1HZBA 4KHZA 4XXEA 4LAAA 1HJPA 1VQFA 3HOWH 1EU4A 2A73B 1Y1WB 4BY1B 1HR0Q 1BOSA 3Q22A 4AIMA 1B44D 2YTVA 2PCFB 4XT3B 1S4ZA 1HR0L 2PQAA 4FVMA 3A8JE 2RKSA 4O2DA 4A3CG 4C56C 5E1FA 1O7LA 2RDGA 4JC0A 3PUXA 2PI2E 3M4PA 4C3IH 3G48A 1FNVA 4HJ7A 1WFQA 1JORA 4O42A 1PH1A 2VS1A 1VQ5A 1EY5A 4ALPA 4AQYL 5JEAJ 4BBSH 3L9AX 2FFKB 2WKDA 5FO8B 4C3JG 3S1QB 4C1NK 1DGSA 3TREA 4WRDA 1TWAB 2ASBA 3G7LA 3I4MB 1SNQA 2WFWA 3Q24A 1E1TA 3DEPA 1HHVA 2NZ1D 2SDFA 4X64L 4DAYB 1X55A 4RGMA 5DAUA 3TS0A 1PVOA 4R4OA 4ABNA 1I50H 4FF4A 3Q6SA 1IBMQ 3GV3A 4IUQA 4B08A 3W2DA 1WJJA 1Q86C 1O7ZA 1G6ZA 5ELDA 1IBML 3TBIB 2F0JA 5M5WH 2L4NA 3GTGH 3MEFA 1I94Q 3R2IA 1D7QA 4FNFA 1D5XC 2AWOA 4XQNA 4MTKA 2DNCA 2JA8G 4O1NA 1BBWA 1VQ8A 4LUZA 3BVGA 1E2VA 1GOZA 2E75C 1DOLA 4E6IA 1JC7A 2BOSA 2E2IH 3T1HQ 2B2VC 4RCNA 3H3VC 3NP8A 3E0JA 3T1HL 4A4IA 3N6RA 4NB3A 4OIKA 4WORA 3M7NA 2ZJRA 3NXWA 3S2DH 5D65A 1B9NA 4HSVA 4RGOS 1WOCA 4WJ3M 2HHHQ 2A5HA 3AFQA 4JI4Q 1EFWA 4OX9Q 2UXDQ 1UEAB 2IX0A 2OTLA 2HHHL 3SK4A 4JI4L 4OX9L 1JOQA 1FGUA 2UXDL 2XTIA 1NR4A 2F3VA 3MXPA 5IGBA 1HCZA 2BE5D 1VF7A 5IGFA 2NB0A 2UUAQ 1K8MA 1BKBA 1XTCD 1SMYC 5C3EG 2F0IA 4IPHA 5IYDG 2UUAL 1CHPD 1BCPB 1Y8PB 3M9BA 3OHXC 2IW3A 1N34Q 2BCOA 1IYJB 1KDAA 1LV9A 4ZKCB 1HZAA 3SE0A 3MHBA 3SK6A 3I3CA 2UUBQ 4BXXG 3TQYA 2K5NA 3EIVA 4DV1Q 1RF2D 1W6JA 1WTOA 2UUBL 2I46A 2OWOA 4DV1L 2HCCA 4H7BA 2F4VQ 1I50B 3NQIA 2CW0C 3RN5A 2CVRA 4GLXA 1QNUA 4BA2I 1K3BC 1A2TA 3E5SA 4DR7Q 4UPAA 2L55A 2F4VL 3A74A 3I7FA 5LMNQ 3GTMH 2KCTA 1QE6A 5ELBA 4DR7L 3PGZA 2CQAA 3CRLC 4JBWA 3J81i 3MA2B 5LMNL 1PZJD 3GP7A 2YYZA 4IPGA 5CV7A 3I55A 4DA2A 2VZAA 1B4OA 2DGYA 3KF8A 2N3SA 3DXJC 3PCOB 3VR2A 3PO3G 2E2HB 4JI6Q 3NENA 3BZKA 1VQ6A 1SN8A 1BF4A 3PMFA 2PZWA 1B8AA 4JI6L 2E2IB 1PTOC 2PQEA 4RGTA 4Z9CB 4V0BA 1K0SA 3I91A 4IUPA 5IYDH 2EJFC 4XQJA 3S1MH 2QILA 4X3KA 3NELA 3CCQA 1DCZA 1I3QB 1CQVA 1V43A 3SR1A 4C3JB 3OIQA 4POGA 5C3WA 3G71A 3KLSX 2N55A 4GN4B 3CP0A 4I7AA 3TZUA 3GTKB 5EPJA 4TRDA 4A3LG 3CPWA 1WYDA 1S72A 1IBKQ 4HJ9A 2A69D 2F0QA 1YEZA 4F7XA 1B1ZA 3U9OA 1TT2A 5D14A 1N8RC 3DEOA 5M3FH 3I56A 2K75A 2PQAB 3FKIG 5IT9E 1IBLQ 2JA8B 1PH9A 2B2TA 3VR4A 4ME3A 1WTWA 4A3BG 1IBLL 3V96A 2R93H 3KOJA 1JMCA 1BR9A 3LX0A 5AJ3Q 3V2TA 1WTQA 1KAWA 5AJ3L 4NXNQ 1HFGA 1DOKA 3P20A 1XTDA 2B2WA 3GTMB 1T9HA 5IYBH 4CHTB 3OOCA 4KMUC 1TWHB 5JAVA 2N88A 5T1IA 1K0RA 2MJ8A 4DV4Q 3J80L 4GOPA 2O5IC 1B7YB 1Z6HA 2BH2A 4Q0FA 1XNQQ 2Q2UA 2C5CA 4DV4L 1LTSD 1Q90A 3E3XA 2KJXA 3J80c 2KHIA 1XNQL 5IE8A 1MKHA 1QVFA 2F52A 4R8NA 1XMQQ 5C3EB 4K0KQ 3S1MB 2XSCA 4JBMA 1XMQL 1SNOA 4TVAB 4A3FG 2F0NA 2YU9B 3CC4A 1Q81C 4HAEA 2K01A 4K0KL 4ZQ3A 1IW7C 1WI5A 1SDFA 1UE1A 4IZ8A 3BS1A 1GUOA 4A3EG 2KOLA 3BDCA 5L37A 4C3HH 1VQDA 2NN6G 1PTOF 5JVG3 1PH6A 2LFNA 1SXTA 4H13C 2HUGA 1NSNS 1ESRA 1HTLD 1X3QA 2H1EA 1TY0A 1GD7A 3JC66 4K2LA 3RLOA 2PMZE 4X6AH 3HOZG 1B53A 3PO3B 1STHA 3K8AA 1ILQA 1TVXA 1FVIA 1WTVA 5M3MG 5JJIA 1SMXA 1S5CD 1XPOA 1STEA 1NBWA 4R1JA 2A19A 3NWSA 1F2ZA 1BXTA 2CWAA 3VYTA 1CTMA 4DAVA 1STGA 3QWNA 3IFDA 4DGZA 4HJAA 5LMUQ 4PZ6A 2ZJQA 2QF7A 1YZ6A 2AUJD 2BDOA 3RLFA 5FJ8G 5JPNC 5LMUL 4JI8Q 4NPSA 3ERSX 1CFMA 3EJIA 4HMIA 2Y0SG 4KTAA 4JI8L 5LL6X 4PMBA 3LWUA 1S5BD 3GTJB 2MQHA 1BCPD 5JJKA 1UWVA 4KKSA 2EDGA 2R6GA 1MIUA 1NR2A 2KA7A 2ICEC 1J8IA 2ENBA 2Q2HA 4POFA 3K5NA 2VQFQ 4GZYC 3K7UC 3E6ZX 2UUCQ 1PDQA 1PH3A 2VQFL 1TS2A 4XTCS 1CKMA 1B2TA 2UUCL 4A93H 3FKIB 3KF8B 1WVLA 1YNJD 5CYUA 3ULJA 1CK1A 4DR2Q 3HEJA 2NVQB 4A3BB 4PMCA 3J81j 4UDUC 1Y8OB 1HNZQ 3W3AA 2KEDA 4H0LC 4XYQA 1SYFA 1DJRD 2AQ3B 5ISRA 1SYCA 4DR2L 4JCVE 1Q7YC 2A6HC 1HNZL 1SE3A 5IGEA 1QNKA 4EQPA 4OO1H 1WTHA 2ZTCA 4QF4A 5CR3A 3H15A 1GUGA 1I6HH 1YJWA 2L11A 3CAMA 5E7NA 1DZ1A 1MJCA 1VQGA 1T5EA 1CZGA 3NQTA 2NBFA 4J1MA 4CKCA 4RGNA 1V1OA 1JR0D 2IPKD 4DXFA 2JA5H 1EIFA 5FO9B 1X6OA 3PF4A 5I9PA 1L0YB 2Z8LA 4KD4A 3OWFA 1I6VC 2UXCQ 3EN2A 3KF6A 2E2JH 1NCVA 2UXCL 1EIGA 2E5LQ 3R93A 4OWTB 4A3EB 2LMCB 4Y7NH 5M5XH 1HQMC 3HOUG 3HP3A 2E5LL 2QDBA 1KNAA 4ZLTF 3RZOH 1EOTA 3GDEA 4CJ1B 2K28A 1LT6D 3HKSA 4LNQA 4A3MH 2AUKA 3F2BA 4KK7A 1PFSA 3MWYW 3C1FA 2WP8J 2NVTB 4RA8A 3P1HA 1U4RA 4DUZQ 2F1MA 4DNTB 2JA6G 4HJ5A 3FDTA 1Q12A 2PZUA 1LUZA 4DUZL 3ITPA 1C48A 3Q23A 1QJOA 4GOPB 2MFIA 2ZT9C 3HOZB 3H3VI 1AE2A 4H02A 2JA7G 1K8GA 1RKNA 2WB1E 1CUKA 3T51B 5M3MB 2CCZA 3EA6A 5IP9H 2GN5A 4JG2A 4N9PA 4RFBA 1XPRA 1QILA 4A3GG 3OW2A 3IFTA 4JBJA 4DV7Q 1CA6A 1DYQA 1YIJA 1YNNC 3NK9A 1LT3D 1FYCA 2F0SA 2GVBA 5ELCA 2QEXA 4DV7L 5C4JH 2VB3X 1PYWD 2JK8A 3GQBA 1YITA 3TP6A 1PHJA 3UI2A 2NN6I 1GVPA 2Y0SB 1C7YA 2YV5A 4AH6A 1NAPA 1C8CA 1EL0A 4DV5Q 4YWMA 3AEVA 2L12A 1H9SB 1RJTA 4HSPA 3X3NA 1Y1WH 4BY1H 2JA5B 2QEJC 4DV5L 1EQRA 3D6WA 2UU9Q 1EYAA 2PYKA 4KD3A 2KEEA 3CCVA 3F2CA 2VXWA 5DNFA 2UU9L 1RCVD 4APVA 4RKLA 1BO0A 1SYGA 2SEBD 4YCUA 1KD1C 5M5XB 4A3KG 1PH2A 2IX3A 2EXZA 5IY0A 3KK7A 2A74C 3NSWA 4C1NI 3EVQA 4L6TB 1A0IA 3S1QH 1HH2P 1TWAH 1XWEA 3I4LA 3I4MH 3H0GG 1Q8KA 1EZ8A 4OWWB 2IL8A 4WJ4A 1VQKA 1VDZA 2I5LX 1I4QA 4TQUS 4L5QA 3IL8A 5CV9A 1PRTC 2K14A 4OELB 2K1BA 4RHSA 1RODA 3H09A 1W6KA 1S5DD 3QOLA 2CKZB 1TS4A 4QIWB 2ZXPA 3A5ZB 3E9HA 2E76C 3EFXD 4G57A 4KLKA 1Y69U 3I4NG 2KECA 1PFBA 2K7VA 3C3LA 1H9KA 4LW1A 4JOIA 2JP1A 4B3TQ 2EZVA 3PUVA 4B3TL 3QG1A 1UAPA 2HDMA 5HGQA 2FMCA 1KTKA 1GHJA 3HOUB 3D0FA 3HOXG 1VQPA 1MHWC 4FDBA 4AYBG 3MTSA 1NY4A 2RCFA 4KN4C 2Q8TA 5G3LF 1O78A 2YTYA 4UP7A 4K2KA 1OXTA 4LMQD 1HUMA 3DLLA 4JYAQ 4G4KA 4S3SA 3NTHA 4YY3Q 1CKNA 4JYAL 1XNRQ 1SRUA 4A76A 1VQMA 3C1EA 4YY3L 1WTRA 3CMAA 3J7A5 1XNRL 3FPPA 1PV4A 1EY0A 1JWSD 5C0XJ 1QUQA 3T56B 5D3DA 2JE6I 3GTQB 4A3GB 2HT1A 3AMUA 1JJ2A 4LF7Q 3J80E 3TS2A 5A2QL 2DNEA 2FHTA 3CD6A 1L1OA 3M4OH 4LF7L 3KF6B 1F9QA 3NPPA 1F9RA 1JOOA 4QY7A 3T13A 2R7FA 3PQIA 1SNDA 3IRBA 1PMRA 4QQBX 1NMGA 3VYUA 1A62A 2I5MX 4F8MA 1QG7A 4OXPA 4ME5A 1CZWA 4DV2Q 1AW7A 4ZAIA 4BBRG 2BA0A 2O2LD 3CCUA 4DV2L 1Q3LA 1PH5A 1I94L 4A3CH 2G9HD 2F0MA 4R4IA 1K83B 2E2HH 2KCMA 4HIDA 4YWKA 3HKZG 2F0FA 1PRTF 1NNXA 3JAML 5C6AA 2G5DA 1EQVA 1L2FA 1PH8A 1W3SA 4YIJA 5BN3A 4A3KB 2C9OA 3JAMc 1PXUA 4KJNA 2GA4B 1M90C 1AE3A 5IGGA 4QMGA 5C0XG 1I3QH 1F2LA 2F0DA 2K6AA 2RF4A 4C3JH 4QCLA 1A3VA 5JEAG 2XWBB 2ZXOA 4FF3A 1ESFA 2F3WA 2D62A 3BZDB 5CORA 5IODA 4QGUA 4DR1Q 3H0GB 1DOMA 4DR1L 3GTKH 2CW0D 4LUVA 1G51A 3T1YQ 1AEXA 2IHEA 5CV8A 5T1GA 1ICWA 1C4QA 3CQZB 3T1YL 2JA9A 2OXPA 4DK1A 3F2UA 1LM0A 2A6EC 3TDQA 5EBCA 2V4DA 4A75A 3I4NB 4O0AA 3WOFA 5HURA 1SSOA 3P7JA 2K5VA 2JA8H 1EYDA 1PTOD 2L0CA 3M4OB 1N34L 1E22A 5GAHC 2LXKA 4K5XA 1I4PA 2F03A 1TWFB 3HOXB 1IHZA 2K5WA 5EKIA 4B9WA 4X65Q 4TSSA 4AYBB 3P75A 1SJHD 4MN3A 3D4DA 4X65L 4DKAC 1CA5A 3A54A 4R4CA 4Q5VA 2CWPA 5KRUA 1SR3A 5BN4A 2B29A 4YWLA 1YJNA 1TWHH 3MXUA 5IOCA 1TWCB 5EPLA 4RG1A 1HR0W 3S1NH 1Z7TA 1G291 4UHVA 2MHVA 4QUCA 2AMCB 5KNBA 2PO4A 3S15H 5C3EH 1XXGA 1SNMA 2VUMG 1G2SA 2R7ZG 2ZM6Q 2YU9H 4K8IA 3K6OA 4RAUC 2ZM6L 1OTCA 1V1QA 4BXXH 1GO3E 3MFYA 4X3UA 3AU7A 1M1KC 2JSOA 4CDCC 4KN7C 3W1GA 3TMEA 2EOTA 4OONA 2KHJA 4ZRZA 2C35B 2B2VA 4QUFA 1D6EC 1VQ4A 2OF1A 3ER0A 2KHSA 2PNRC 3OSOA 4JK1C 3RUZA 1X3GA 1IBKL 3CCRA 5ELEA 3SK8A 2CHBD 1LTLA 1VMCA 4BBRB 3VR5A 2NVXH 2Q2IA 1LTAD 5C44G 1JJCB 3PO3H 1XJVA 4FXDA 1CKNB 2HCIA 3F8TA 3HKZB 3RMHA 4ODGA 4RWSC 5ELOA 4IPCA 4X62Q 1BBXC 4BY7G 3FMCA 1HXYD 3SVMA 1ICFB 4XDXA 1QUQB 4HR7B 1HNXQ 4LK1C 3I8ZA 4X62L 3QIAA 4DU9A 3GTLB 1HNXL 1AH9A 1IW7D 3NWTA 4NXNL 1TXYA 4DK0A 2IWHA 4LFBQ 1LO5D 1L1OB 2M9VA 1KDBA 4FO2A 4JI1Q 3U4VA 4LFBL 3K59A 4IN3A 4ID6A 4JI1L 3T16A 1JWUD 3FP9A 3SXHA 4A3LH 2RDFA 2EXDA 3L2PA 3GTJH 2R92G 1FR3A 4F87A 3S1NB 2B8FA 1EIYB 2IY5B 4DPGA 4NW2A 4DR6Q 3S15B 1VQEA 5FLMG 3UDGA 5C4XG 2WACA 4DR6L 1YHAA 1GUTA 1TS5A 4P75A 1HNWQ 3FHWA 4GKJQ 1STAA 3FKIH 2VY3A 1HNWL 4RHRA 1PZID 3J81L 2NVQH 4GKJL 1Y14B 4A3BH 2F0LA 4L5TA 5IWAQ 2EIFA 4FYDA 4DAMA 2LXJA 4GS3A 5BR8Q 5IWAL 3J81c 3K81C 1LTRD 2E2DC 3S14B 5GAEC 5BR8L 1H9SA 2HQLA 5C0XI 3U50C 5C4HA 3ICEA 3MXNB 3WOEA 2OEOA 1VQNA 4QL5A 5BN5A 4KV6A 1YBYA 4HIMA 1KRTA 2NVXB 4PZ8A 1YJ9A 1SLJA 3GTPB 4N9TA 1CQFA 2XIWA 4JPBW 1YHBA 1J9OA 5CBEE 1A15A 1HPCA 3D4RA 5K5PA 2ZTEA 3H3VH 4QJFA 4OGQC 5LMNW 3KLSA 3LGJA 3ULLA 1LTBD 2R7DA 2XRQD 2K5QA 2F0KA 3RZDB 2VUMB 1B9MA 4A3FH 1PYSB 1D8LA 4B3SQ 2R7ZB 1GJXA 2OQ0A 5EKKA 1ZEQX 4K5VA 1IL8A 4UP9A 4B3SL 1DXMA 3QJYA 3GTOB 1SNPA 4M8AA 3R8BA 3RLNA 2A6HD 3BVZA 4BA1I 1O7IA 4DFAA 5I6WA 4A3EH 1EY7A 2XRSD 3DUZA 3UE0A 2NN6H 4R9WA 2ES2A 1EU3A 1A6XA 2F0UA 1R9TB 1WD0A 5JOBA 3VYRA 3OTOQ 2NVTH 1A2UA 2B39A 1O7YA 2NVYB 4DXGA 1CM9A 3OTOL 2KQ3A 1MSHA 5C44B 3HOZH 1U4LA 3J7AF 1Z47A 4IUNA 1NE3A 3HG9A 4IURA 5M3MH 1VQ9A 3PIP3 3PUWA 4NDXA 5KIXA 4BY7B 5IYCG 3VYSA 5IGDA 3D4WA 1S40A 2Q8RE 2D0PA 3HOVG 5KGUA 1F2YA 3AB9A 5FK9C 3PUZA 1G6PA 2A1AA 1WTPA 2E8GA 1SNCA 1N36Q 4JBKA 1L0XB 2OTJA 5FLXL 3PSIA 5FJ8H 5DM73 5EPKA 4G7OC 2F0PA 1N36L 1A3TA 2WAQE 2EYOA 1MBYA 1SE2A 2CH4W 1Z9FA 5FLXc 2N8NA 1OXXK 3HRZC 1OXVA 2R92B 4M1UB 1P8LA 5FKAC 4OIJA 3VDYA 4PZ7A 3MAQA 1AP0A 5K36G 5A2QE 5GAGC 1Q1BA 1QWYA 4LF6Q 1DONA 4DK6C 2K04A 4QB4A 4A3FB 1Y8NB 4LF6L 4L63B 1G8ZD 1LTID 1RTNA 1TR5A 4GNXC 2BA1A 5DEHA 4P73A 2I07B 3G6EA 2EQSA 4IALA 3V05A 3D3RA 1YNND 2HQEA 2PI2A 1H9RA 4XT1B 1B3QA 3K0YA 4N8X1 5DM63 2B2YC 4A3IG 4A3DG 1I4XA 3EQLC 4OWXB 1SYBA 4DUYQ 3BYTB 1M8AA 1I4RA 1Q46A 1EEFD 2RDHA 4G7ZC 4A3JG 1H9JA 4DUYL 1ENFA 4OHJA 2K33A 4NKLA 1EY4A 4CDFC 1BBUA 4IQZA 4IO9A 1KNEA 1JB7A 5J22A 2ALYB 2B8GA 5EAYA 4IFDJ 3U4ZA 1FJGQ 2LSSA 3OWEB 2A68C 2XGTA 2F0TA 3K0XA 4HTHA 1FJGL 4DNIA 1WD1A 5K36H 1D1KA 1AFPA 4RKBA 2KENA 1JWMD 2X6GA 5J3BA 3SK5A 3RN2A 3CCLA 2LKVA 4JI7Q 2Y0SE 1ZYRC 3RR5A 2N49A 3S24A 4U673 3KFUA 3SDZA 4JI7L 3A7LA 4NP5A 3UDIA 2QW7A 5GADC 1SEBD 4L8JA 1WCMG 3I70A 3OIPA 4EGVA 1ML0D 3I90A 2DJGC 2RCNA 3A8IE 5E3FA 3KLWA 4DR3Q 2EYHA 3WDNA 3HOUH 1ASYA 2K4KA 2ATWA 4DR3L 1PTOB 3DM3A 3HOYG 4LF8Q 2KUMA 2FMMA 2O5JC 2YTXA 4LF8L 4A3DH 3GV6A 1D2BA 5ELFA 3NE5B 1HFNA 1SBBB 1GUWA 1PRTD 2VL6A 1EUJA 3VA5A 1ZKOA 2JA6H 1PLFA 1UEBA 1XMOQ 4EQ5A 2NZOA 5CC4A 3J7ZC 3SGIA 1A3UA 1TQOA 1SE4A 3C2PA 2JXMB 5EKLA 2I0QA 3CU7A 3CMEA 1XMOL 4JI5Q 3HS0C 2Z4HA 1CSPA 2JA7H 2B63G 3KUPA 4LF9Q 3BG3A 3K58A 3STBC 3J7AV 1GHKA 3TP5A 4JI5L 4IFDG 4LF9L 3K80C 3PV0A 1BCPF 5M9OA 3GTQH 4A3GH 1HZ9A 1TIID 3NBIA 2P5ZX 1KRSA 1MD2D 1SJED 2OQKA 2K32A 1JCKB 2L9HA 2PW5A 4N8FA 3URYA 4QIWE 1FD7D 5ELNA 1KDCA 2F4IA 5IGCA 3CPFA 1VQOA 2K05A 4OO1I 3BYYB 3EBEA 5C5LA 3HOWG 2R61A 2RVLA 3DWPA 3NTKA 4IUTA 1VF5C 3H6MA 1PH7A 1N32Q 5TSSA 3DHQA 5M5YB 1PZKD 3D8GA 4KY6A 1EQTA 4RCOA 2KCCA 3TZDA 1N32L 3K5MA 3W5OA 3TEHB 1K83H 2Z4IA 4ZCKA 4BS9A 3M3YH 1RHPA 4C3IG 2ZXRA 4H44C 5EBDA 4A3KH 1RDPD 1T5XD 4BBSG 3ND8A 1GUNA 3R3OA 4MHEA 4A3IB 3W1BA 4A3DB 3WWVA 4IJLA 5I9OA 4MNOA 1VQHA 3KDFB 3H0GH 2MPMA 1HUNA 4A3JB 1VS0A 3X3MA 2JA6B 1I5FA 2VQEQ 3S9WA 4J6HA 1IKLA 1EFID 2VQEL 1KABA 1TKWB 3CQZH 3I73A 2JA7B 1STYA 4JI2Q 1B70B 2X6LA 1VQ7A 1XX8A 4NMZA 2OCEA 1WTXA 4RH6A 4JI2L 3I4NH 1KIXA 2EY6A 1E2ZA 1KLUD 1E3PA 3QO2A 3LNNA 1EY9A 1EWHA 2MO0A 1SYEA 1IYVA 3U58A 1QZGA 1NJIC 2WV6D 1WCMB 5LHY1 1C0AA 1HZCA 3CKIB 2J7ZA 1CSQA 1DM0B 4AQYQ 4HCSA 4YCWA 2AWNA 1TWFH 2XNAC 3HOXH 5JVH3 1MI2A 2K5DA 2L15A 4GLVB 4PNYA 3HOYB 1F9SA 1Q82C 3QOJA 1AZPA 1N33Q 3C46A 3M7GA 1SROA 5KEEA 1N33L 1MJEA 4FF2A 3B6YA 4X64Q 3J81E 1XYIA 1EYCA 4K6LA 1TWCH 2PNHA 2MNAA 4C2MB 4HJ8A 2R3ZA 1QOHA 3MXGA 4G7HC 1H95A 2Z9HA 2A6ED 1NMFA 1RL2A 3M3YB 2AKWB 4HIOA 3S1RB 1SMYD 2ID0A 2D9UA 4WFN3 1J6QA 5HGTA 2B63B 2ICIA 1MGSA 1LABA 2VB2X 3HGBA 1ET6A 4I7ZC 3A7AB 2F3IA 4ZUJA 3MXNA 1E1OA 1XPUA 2ZTDA 1E24A 2MO1A 1LTGD 1YHQA 4R4TA 2WINB 2Q8IB 5JJLA 2NWGA 3J7YW 4GN5A 5NUCA 3PIOA 1K8OA 3KYHC 4DF7A 4PQXA 5D3IB 2JJQA 5A35A 4EQNA 2VW9A 3I4OA 1X3PA 3SHLA 3HOWB 2DJFC 1HA5A 3NUCA 2M00A 1N9WA 1I4HA 4BBRH 2CFMA 2Z6BA 1KAAA 1G91A 2B2UC 2B2TC 1BVSA 1STNA 4AYBE 2H4OA 4C3IB 1KL9A 5EGTA 4IFDI 1VQLA 3OW7A 5HY6A 3NBHA 3MZ5A 4HEDA 4EQOA 1IKMA 1LTTD 3PIO3 1VCIA 4IUVA 1BNZA 4BBSB 3GTLH 4UP8A 2B2WC 5E4WC 5C0XH 1X65A 3DMUA 3J80i 3OMGA 4L5SA 4CDEC 5JEAH 4MTNA 2GVAA 2NZHA 4DV3Q 1UE7A 1TWGH 1D5ZC 2LY7A 3HFZB 4GOPC 4DV3L 3AYHB 3ZJYC 3S16H 4GNXB 2D0OA 3L7ZC 4HN7A 3M4QA 1PH4A 1S5ED 4P2CB 2SOBA 1IXRA 4MZ9A 3RD4A 4DV0Q 1HA6A 2SNSA 3GD7A 5M5WB 2BE5C 3GTGB 1JT8A 5C5MA 4DV0L 5FLXE 5M3FG 3L3OC 1UE5A 3OMCA 3BU2A 3VR3A 1HRJA 4PMWA 5FO7B 4EVOA 4TKOB 1RIPA 4V190 4EX5A 1PA6A 5GQOA 2F0OA 1IL2A 1FGBD 4B3MQ 2HIXA 2R93G 2IJ0A 1S5FD 1OO9B 4CKBA 1KHIA 4KY7A 2MGSA 3RNUA 4B3ML 1A63A 2EY1A 1OXUA 2EJMA 2NTSA 3L0OA 3KBXA 4CDDC 3S14H 4JI3Q 5KYIA 4CJ0B 3S2DB
chains in the Genus database with same CATH topology
4ZUIA 1F9PA 2PW7A 2JYOA 3VA7A 3G6JB 3D31A 3TSSA 2AQ2B 2XWJB 1G2TA 3MFGA 1BUVT 3KBGA 1I4GA 4DAPA 2E74C 5JPMC 5I6YA 2B2UA 1NUCA 1TWGB 2HDLA 3MEHA 4C3HG 3S16B 2X69A 2AQ1B 3H94A 2D5DA 1V8QA 3FPUB 1V1PA 1LLRD 1U9RA 1LT4D 4K6DA 4KKTA 5F2DA 5E4XA 2WIIB 2A69C 4IUUA 4BWGB 1CI3M 1AZQA 3KLRA 1EIHA 2G9DA 4CGYB 2VNUD 2EYMA 1PRTB 3ZYYX 1PFNA 2O4XA 1ILPA 1E2WA 2EVBA 2RBMA 3T4AC 2EJGC 5I2YA 4KHVA 1M4VA 2L5TA 2QCPX 1EY6A 4FXKC 2QKIC 2EYLA 3ERQA 3GO5A 5CGKA 3R2TA 3NTIA 3S17B 1STBA 3I72A 2MUYA 2BDNA 5I2XA 2F0GA 3D6CA 3IKJA 4J8QA 1EEID 3IAYA 1AN8A 4MIUA 5M3FB 1BDOA 1TU2B 3FRPB 3K7AB 1ONLA 1D1IA 3DWQA 3K57A 3BDLA 5CV4A 2NTTA 1II3A 4K5WA 2EPBA 2R93B 3CHBD 3M85A 1B3AA 1EWCA 1JB3A 2PMZB 2DN8A 4OO1G 4K14A 5COYA 5JJZA 4KY5A 2LS01 4DN4M 2NYZD 4DNRB 3OPOA 3QB3A 3TP8A 1Q8IA 2JEAI 4ZYSA 1Y1VB 5C4ZA 4ILWA 5CMDA 1FNWA 2F0EA 3CRKC 1CT1D 5EQ0A 4KKUA 3ND9A 2TMPA 1X32A 2IT1A 2KVMA 4KI0A 2FINB 3DWAA 2JEBI 1UNSA 3TN2A 2WKCA 4XIGS 2EY5A 2EYFA 4XYOA 5C3XA 1FNUA 1SFOB 2EYPA 4F88A 4C3HB 1HQRD 2EE1A 2Z1CA 3SEBA 3N52A 1DD2A 1PTOH 1RD9D 1TY2A 2J4XA 5J39A 2DY7A 2NUCA 4CJ2C 1BCPC 1Q1EA 4LJZC 3HZXA 4ULLA 4UAIA 5C4XB 2MP1A 5CV5A 2A68D 1JQYD 2EYJA 1LACA 2RA4A 1KLGD 4WJWA 1JICA 2SNMA 3FEWX 1YNJC 2WAQB 3BDOA 3H91A 2K03A 4U68A 4CBVA 5G3LD 1ZYRD 1U4MA 3A8KE 4CKEA 1BQQT 1EY8A 1OXSC 1PFMA 3JAME 1R4PB 5IIFA 4DAYA 2IX1A 1HTPA 5AFWA 3U9SA 5IT9L 3K5LA 1QCBD 2RSNA 1ENAA 1D5MC 4FXGC 1V1PB 4X3SA 2F0VA 1SYDA 5KYLA 4K8JA 3K5OA 3LWEA 4HCEA 1U4PA 4FP5D 3S2HB 3T53B 2XVSA 4A93B 3MC0B 4KJOA 1MSGA 1TS3A 1GUSA 2PZTA 3BVMA 5CBAE 1JOKA 1GXDC 1B50A 3A56A 3FVQA 2WB1B 4OL7A 1VMPA 4B9XA 4XQQA 4I65A 1I6HB 1QB5D 4FF1A 1F77A 2L1BA 2RQXA 3ONAB 5KNCA 2TSSA 3EROA 2PPBC 4ZK9B 1H9MA 4R8IA 1RTOA 5KNDA 3HOVB 3MVVA 2XN9C 5I4DA 2EY2A 2KCNA 1F2MA 3DM1A 1E0BA 2E2JB 4X3TA 3PO2B 2F0HA 4HMJA 4Y7NB 5FOBB 2J0TD 3RZOB 5J1ZA 2B2YA 4A3MB 1JE4A 1IYUA 5LL6S 1ENCA 1SAPA 1CHQD 5EJWA 3M4YA 1EZ6A 2M2LA 1O80A 3O13A 4ZKBB 2DY8A 2OT2A 4IFDH 2FJ2A 5CV6A 3VR6A 1LT5D 1UUPA 1R4QB 3TP7A 3Q0AA 2D2CC 3NHHA 4PV1C 5C4JB 1ZXTA 1ET9A 2RSOA 3PUYA 3A55A 2F0WA 4KHZA 4XXEA 4LAAA 1EU4A 2A73B 1Y1WB 4BY1B 1BOSA 3Q22A 1B44D 2PCFB 4XT3B 1S4ZA 4FVMA 3A8JE 2RKSA 4C56C 5E1FA 1O7LA 2RDGA 3PUXA 1FNVA 1JORA 4O42A 1EY5A 5JEAJ 3L9AX 2FFKB 2WKDA 5FO8B 4C3JG 3S1QB 4C1NK 4WRDA 1TWAB 3G7LA 3I4MB 1SNQA 3Q24A 3DEPA 1HHVA 2NZ1D 2SDFA 4RGMA 5DAUA 4ABNA 4FF4A 3Q6SA 3GV3A 4IUQA 4B08A 3W2DA 1O7ZA 1G6ZA 5ELDA 3TBIB 2F0JA 2L4NA 3R2IA 4FNFA 1D5XC 2AWOA 4XQNA 2DNCA 4O1NA 3BVGA 1E2VA 1GOZA 2E75C 1DOLA 4E6IA 1JC7A 2BOSA 2B2VC 4RCNA 3H3VC 3NP8A 3E0JA 3N6RA 4OIKA 4WORA 3M7NA 3NXWA 5D65A 1B9NA 4HSVA 4RGOS 2A5HA 1UEAB 2IX0A 3SK4A 1JOQA 1NR4A 2F3VA 3MXPA 5IGBA 1HCZA 2BE5D 1VF7A 5IGFA 2NB0A 1K8MA 1XTCD 1SMYC 2F0IA 1CHPD 1BCPB 1Y8PB 3OHXC 2IW3A 2BCOA 1KDAA 1LV9A 4ZKCB 3SE0A 3MHBA 3SK6A 3I3CA 1RF2D 1W6JA 1WTOA 2I46A 2HCCA 4H7BA 1I50B 3NQIA 2CW0C 2CVRA 1QNUA 4BA2I 1A2TA 3E5SA 2L55A 1QE6A 5ELBA 2CQAA 3CRLC 4JBWA 3MA2B 1PZJD 3GP7A 2YYZA 5CV7A 4DA2A 3KF8A 1B4OA 3DXJC 2E2HB 3VR2A 1BF4A 3PMFA 2PZWA 2E2IB 1PTOC 2PQEA 4RGTA 4Z9CB 4V0BA 3I91A 4IUPA 2EJFC 4XQJA 2QILA 4X3KA 1DCZA 1I3QB 1CQVA 1V43A 3SR1A 4C3JB 3OIQA 5C3WA 3KLSX 2N55A 3TZUA 3GTKB 5EPJA 4TRDA 2A69D 2F0QA 4F7XA 1B1ZA 3U9OA 1TT2A 5D14A 3DEOA 5IT9E 2JA8B 2B2TA 3VR4A 1WTWA 3V96A 1BR9A 3LX0A 3V2TA 1WTQA 1HFGA 1DOKA 3P20A 2B2WA 3GTMB 4CHTB 3OOCA 4KMUC 1TWHB 5JAVA 2N88A 5T1IA 2MJ8A 3J80L 2O5IC 1Z6HA 4Q0FA 2C5CA 1LTSD 1Q90A 2KJXA 4R8NA 5C3EB 3S1MB 2XSCA 1SNOA 2F0NA 2YU9B 4HAEA 2K01A 4ZQ3A 1IW7C 1SDFA 4IZ8A 3BS1A 1GUOA 2KOLA 3BDCA 2NN6G 1PTOF 5JVG3 2LFNA 1SXTA 4H13C 2HUGA 1NSNS 1ESRA 1HTLD 1X3QA 2H1EA 1TY0A 4K2LA 1B53A 3PO3B 1STHA 1ILQA 1TVXA 1WTVA 1S5CD 1STEA 3NWSA 1F2ZA 1BXTA 3VYTA 1CTMA 4DAVA 1STGA 3QWNA 3IFDA 4DGZA 2QF7A 2AUJD 2BDOA 3RLFA 5JPNC 1CFMA 3EJIA 4HMIA 4KTAA 5LL6X 4PMBA 3LWUA 1S5BD 3GTJB 1BCPD 4KKSA 2EDGA 2R6GA 2KA7A 1NR2A 1J8IA 2ICEC 2ENBA 3K5NA 4GZYC 3E6ZX 1PDQA 1TS2A 4XTCS 1B2TA 3FKIB 1WVLA 1YNJD 5CYUA 1CK1A 2NVQB 3HEJA 4A3BB 4PMCA 4UDUC 1Y8OB 3W3AA 2KEDA 4H0LC 4XYQA 1SYFA 1DJRD 2AQ3B 5ISRA 1SYCA 2A6HC 1SE3A 5IGEA 1QNKA 4EQPA 4OO1H 4QF4A 5CR3A 1GUGA 2L11A 1DZ1A 1T5EA 1CZGA 3NQTA 2NBFA 4J1MA 4CKCA 4RGNA 1V1OA 1JR0D 2IPKD 4DXFA 5FO9B 5I9PA 1L0YB 2Z8LA 4KD4A 3OWFA 1I6VC 1NCVA 1EIGA 3R93A 4A3EB 2LMCB 1HQMC 3HP3A 2QDBA 1KNAA 4ZLTF 1EOTA 4CJ1B 2K28A 1LT6D 2AUKA 4KK7A 3MWYW 3C1FA 2WP8J 2NVTB 4RA8A 3P1HA 1U4RA 2F1MA 4DNTB 3FDTA 1Q12A 2PZUA 3ITPA 1C48A 3Q23A 1QJOA 2ZT9C 3HOZB 1RKNA 5M3MB 3T51B 3EA6A 4N9PA 4RFBA 1QILA 3IFTA 1CA6A 1DYQA 1YNNC 3NK9A 1LT3D 1FYCA 2F0SA 5ELCA 2VB3X 1PYWD 3GQBA 3TP6A 3UI2A 2NN6I 2Y0SB 1NAPA 1C8CA 1EL0A 2L12A 1H9SB 1RJTA 4HSPA 3X3NA 2JA5B 2QEJC 3D6WA 1EYAA 2PYKA 4KD3A 2KEEA 2VXWA 5DNFA 1RCVD 4RKLA 1BO0A 1SYGA 2SEBD 5M5XB 2IX3A 2EXZA 3KK7A 2A74C 3NSWA 4C1NI 3EVQA 4L6TB 1XWEA 3I4LA 1EZ8A 2IL8A 1VDZA 1I4QA 4TQUS 3IL8A 5CV9A 1PRTC 2K1BA 4RHSA 1RODA 3H09A 1W6KA 1S5DD 3QOLA 1TS4A 4QIWB 2ZXPA 2E76C 3EFXD 4G57A 1Y69U 2KECA 1PFBA 2K7VA 3C3LA 1H9KA 2JP1A 2EZVA 3PUVA 3QG1A 1UAPA 2HDMA 2FMCA 1KTKA 1GHJA 3HOUB 3MTSA 4KN4C 2Q8TA 5G3LF 1O78A 4K2KA 1OXTA 4LMQD 1HUMA 4G4KA 4S3SA 3NTHA 3C1EA 1WTRA 3FPPA 1EY0A 1JWSD 5C0XJ 3T56B 5D3DA 2JE6I 3GTQB 4A3GB 3AMUA 3J80E 5A2QL 2DNEA 2FHTA 1F9QA 3NPPA 1F9RA 1JOOA 3T13A 1SNDA 1PMRA 3VYUA 4F8MA 1QG7A 4ME5A 1CZWA 1AW7A 4ZAIA 2BA0A 2O2LD 1Q3LA 2G9HD 2F0MA 1K83B 2F0FA 1PRTF 3JAML 5C6AA 1EQVA 4YIJA 5BN3A 4A3KB 2C9OA 1PXUA 4KJNA 2GA4B 5IGGA 4QMGA 5C0XG 1F2LA 2F0DA 2K6AA 4QCLA 1A3VA 5JEAG 2XWBB 2ZXOA 4FF3A 5CORA 1ESFA 2D62A 2F3WA 3BZDB 5IODA 3J7AV 3H0GB 1DOMA 2CW0D 1AEXA 5CV8A 5T1GA 1ICWA 1C4QA 3CQZB 2OXPA 4DK1A 3F2UA 2A6EC 3TDQA 5EBCA 2V4DA 3I4NB 3WOFA 5HURA 1SSOA 3P7JA 1EYDA 1PTOD 2L0CA 3M4OB 4K5XA 1I4PA 2F03A 1TWFB 3HOXB 1IHZA 2K5WA 5EKIA 4B9WA 4TSSA 4AYBB 3P75A 1SJHD 4MN3A 3D4DA 1CA5A 3A54A 4Q5VA 5KRUA 5BN4A 3MXUA 5IOCA 1TWCB 5EPLA 1Z7TA 1G291 2MHVA 4QUCA 5KNBA 2PO4A 1XXGA 1SNMA 1G2SA 4K8IA 3K6OA 4RAUC 3MFYA 4X3UA 3AU7A 2JSOA 4KN7C 3TMEA 2EOTA 4ZRZA 2B2VA 4QUFA 1D6EC 2OF1A 2KHSA 2PNRC 3OSOA 4JK1C 3RUZA 5ELEA 3SK8A 2CHBD 4BBRB 1VMCA 3VR5A 1LTAD 4FXDA 2HCIA 3HKZB 3RMHA 4ODGA 4RWSC 1BBXC 3FMCA 1HXYD 3SVMA 4XDXA 4HR7B 4LK1C 3I8ZA 3QIAA 4DU9A 3GTLB 1IW7D 3NWTA 4DK0A 2IWHA 1LO5D 2M9VA 1KDBA 4FO2A 3K59A 4IN3A 4ID6A 3T16A 1JWUD 3SXHA 2RDFA 1FR3A 4F87A 3S1NB 2B8FA 4NW2A 3S15B 2WACA 1GUTA 1TS5A 1STAA 4RHRA 1PZID 3J81L 2F0LA 4FYDA 1LTRD 2E2DC 3S14B 1H9SA 5C0XI 5C4HA 3WOEA 2OEOA 5BN5A 4KV6A 2NVXB 3GTPB 4N9TA 1CQFA 2XIWA 1J9OA 5CBEE 1A15A 1HPCA 3D4RA 5K5PA 4OGQC 3KLSA 1LTBD 2XRQD 2K5QA 2F0KA 3RZDB 2VUMB 1B9MA 2R7ZB 1GJXA 5EKKA 1ZEQX 4K5VA 1IL8A 1DXMA 3QJYA 3GTOB 1SNPA 4DFAA 4M8AA 4BA1I 2A6HD 3BVZA 3R8BA 5I6WA 1EY7A 2XRSD 3DUZA 2NN6H 4R9WA 1EU3A 1A6XA 2F0UA 1R9TB 1WD0A 5JOBA 3VYRA 1A2UA 2B39A 1O7YA 2NVYB 4DXGA 1CM9A 2KQ3A 1MSHA 5C44B 1U4LA 3J7AF 1Z47A 4IUNA 3HG9A 4IURA 3PIP3 3PUWA 4NDXA 5KIXA 4BY7B 3VYSA 5IGDA 3D4WA 2Q8RE 5KGUA 1F2YA 3AB9A 5FK9C 3PUZA 1WTPA 1SNCA 1L0XB 5FLXL 5DM73 5EPKA 4G7OC 2F0PA 1A3TA 2EYOA 1MBYA 1SE2A 1OXXK 3HRZC 1OXVA 2R92B 4M1UB 5FKAC 4OIJA 3MAQA 1AP0A 5K36G 5A2QE 1Q1BA 1QWYA 1DONA 2K04A 4QB4A 4A3FB 1Y8NB 4L63B 1G8ZD 1LTID 1RTNA 1TR5A 2BA1A 5DEHA 2I07B 4IALA 3V05A 3D3RA 1YNND 2HQEA 1H9RA 4XT1B 3K0YA 5DM63 2B2YC 1I4XA 3EQLC 1SYBA 3BYTB 1M8AA 1I4RA 1EEFD 2RDHA 4G7ZC 1H9JA 1ENFA 4OHJA 2K33A 4NKLA 1EY4A 4IQZA 1KNEA 5J22A 4IFDJ 2B8GA 3OWEB 2A68C 2F0TA 4HTHA 1WD1A 5K36H 1D1KA 1AFPA 4RKBA 2X6GA 1JWMD 3SK5A 2LKVA 1ZYRC 4U673 3SDZA 3A7LA 4NP5A 1SEBD 4L8JA 3I70A 3OIPA 4EGVA 1ML0D 3I90A 5E3FA 3A8IE 2EYHA 3WDNA 1PTOB 2KUMA 2FMMA 2O5JC 3GV6A 1D2BA 5ELFA 3NE5B 1HFNA 1SBBB 1GUWA 1PRTD 3VA5A 1ZKOA 1PLFA 5CC4A 1A3UA 1TQOA 1SE4A 3C2PA 2JXMB 5EKLA 3CU7A 3HS0C 2Z4HA 3KUPA 3BG3A 3K58A 1GHKA 3TP5A 4IFDG 3PV0A 1BCPF 5M9OA 1TIID 3NBIA 1MD2D 1SJED 2K32A 1JCKB 2L9HA 2PW5A 3URYA 1FD7D 1KDCA 2F4IA 5IGCA 2K05A 4OO1I 3BYYB 5C5LA 2R61A 2RVLA 3DWPA 3NTKA 4IUTA 1VF5C 3H6MA 5TSSA 3DHQA 5M5YB 1PZKD 3D8GA 4KY6A 1EQTA 4RCOA 2KCCA 3TZDA 3K5MA 2Z4IA 4BS9A 1RHPA 4C3IG 2ZXRA 4H44C 5EBDA 1RDPD 1T5XD 3ND8A 1GUNA 3R3OA 4MHEA 4A3IB 4A3DB 5I9OA 2MPMA 1HUNA 4A3JB 3X3MA 2JA6B 3S9WA 4J6HA 1IKLA 1EFID 1KABA 1TKWB 3I73A 2JA7B 1STYA 2X6LA 1XX8A 4NMZA 1WTXA 4RH6A 2EY6A 1E2ZA 1KLUD 3QO2A 3LNNA 1EY9A 1EWHA 1SYEA 1IYVA 2WV6D 1WCMB 5LHY1 3CKIB 2J7ZA 1DM0B 4HCSA 2AWNA 2XNAC 5JVH3 1MI2A 2K5DA 4PNYA 3HOYB 1F9SA 3QOJA 1AZPA 3C46A 3M7GA 5KEEA 4FF2A 3J81E 1XYIA 1EYCA 4K6LA 4C2MB 4G7HC 2R3ZA 1QOHA 3MXGA 3M3YB 2A6ED 3S1RB 1SMYD 2ID0A 2D9UA 4WFN3 5HGTA 2B63B 2ICIA 1MGSA 1LABA 2VB2X 3HGBA 1ET6A 4I7ZC 3A7AB 4ZUJA 3MXNA 1LTGD 2WINB 2Q8IB 2NWGA 3J7YW 5NUCA 1K8OA 4DF7A 4PQXA 5D3IB 5A35A 4EQNA 1X3PA 3SHLA 3HOWB 1HA5A 3NUCA 2M00A 1I4HA 1KAAA 1G91A 2B2UC 2B2TC 1STNA 2H4OA 4C3IB 5EGTA 4IFDI 3OW7A 3NBHA 3MZ5A 4HEDA 4EQOA 1IKMA 1LTTD 3PIO3 1VCIA 4IUVA 1BNZA 4BBSB 2B2WC 5E4WC 5C0XH 3DMUA 3OMGA 5JEAH 1D5ZC 2LY7A 3L7ZC 4HN7A 1S5ED 4P2CB 2SOBA 3RD4A 1HA6A 2SNSA 3GD7A 5M5WB 2BE5C 3GTGB 5C5MA 5FLXE 3L3OC 3OMCA 3VR3A 1HRJA 4PMWA 5FO7B 4EVOA 4TKOB 4V190 2F0OA 1FGBD 2IJ0A 1S5FD 1OO9B 4CKBA 4KY7A 2MGSA 2EY1A 1OXUA 2EJMA 2NTSA 3KBXA 5KYIA 4CJ0B 3S2DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A V;  5IT9 L;  5LL6 X;  3J80 L;  3JAM L;  5FLX L;  3J81 L;  5A2Q L; 
#chains in the Genus database with same CATH topology
 2QDL A;  4ZUI A;  1F9P A;  3HKZ E;  4JI3 L;  2PW7 A;  2RHS B;  2JYO A;  5IYB G;  3VA7 A;  4LUO A;  4NXM Q;  1X54 A;  3S17 H;  3G6J B;  3GTP H;  1Y1V G;  4JV5 Q;  4NXM L;  3D31 A;  4JV5 L;  3TSS A;  2AQ2 B;  2XWJ B;  1G2T A;  2V1C C;  4RMF A;  3CCM A;  3MFG A;  4PG3 A;  1BUV T;  3KBG A;  1NTG A;  3RZD H;  2VUM H;  3K7A H;  1I4G A;  4DAP A;  2E74 C;  4L5R C;  3ULP A;  2R7Z H;  5JPM C;  1VQA A;  2QA4 A;  5I6Y A;  2B2U A;  2RHQ B;  1NUC A;  1J5E Q;  3QR8 A;  3UDF A;  1TWG B;  2HDL A;  3MEH A;  3GTO H;  1QVG A;  4C3H G;  3S16 B;  2X69 A;  3AFP A;  1J5E L;  2I5H A;  4DK3 C;  4OEM B;  2AQ1 B;  3H94 A;  4DR5 Q;  2D5D A;  1V8Q A;  2CQO A;  3FPU B;  1V1P A;  1LLR D;  4YHH Q;  1GKH A;  3AQQ A;  4DR5 L;  4YCV A;  1U9R A;  1R9T H;  2K50 A;  1LT4 D;  4K6D A;  4KKT A;  4YHH L;  5F2D A;  5E4X A;  1U5K A;  2WII B;  2A69 C;  2Z6K C;  4IUU A;  4BWG B;  2NVY H;  1IZ6 A;  1CI3 M;  5H1S E;  1AZQ A;  3KLR A;  1X56 A;  1EIH A;  2G9D A;  4CGY B;  5C44 H;  1Y1V H;  2VNU D;  2EYM A;  1PRT B;  3ZYY X;  1PFN A;  2O4X A;  1ILP A;  1E2W A;  2WAQ G;  1SE8 A;  2EVB A;  2RBM A;  4BY7 H;  4J15 A;  3T4A C;  2EJG C;  5I2Y A;  1EWI A;  4KHV A;  1M4V A;  2L5T A;  2QCP X;  1EY6 A;  3E0E A;  4FXK C;  2QKI C;  2EYL A;  3ERQ A;  3GO5 A;  2N78 A;  1SFO H;  5CGK A;  3R2T A;  3NTI A;  3S17 B;  1STB A;  3I72 A;  2MUY A;  2BDN A;  1LYL A;  5I2X A;  3CCE A;  4B3R Q;  1EQQ A;  2F0G A;  3D6C A;  2R92 H;  4B3R L;  3IKJ A;  3CF5 A;  4J8Q A;  1EEI D;  3IAY A;  3CC2 A;  1A8V A;  1VQB A;  1AN8 A;  4MIU A;  5FLM H;  5M3F B;  1BDO A;  1K9M C;  5C4X H;  1TU2 B;  3FRP B;  3K7A B;  1ONL A;  2K52 A;  1D1I A;  3DWQ A;  3K57 A;  3CXC A;  4IOC A;  3BDL A;  5CV4 A;  4A93 G;  2A8V A;  2NTT A;  1II3 A;  1K28 A;  4K5W A;  2EPB A;  3BZC A;  2FXQ A;  4P72 A;  2BH8 A;  3PIP A;  2R93 B;  3CHB D;  3M85 A;  1B3A A;  1EWC A;  1JB3 A;  2PMZ B;  2DN8 A;  3NBH B;  4GN3 B;  4IJH A;  4OO1 G;  2WB1 G;  4K14 A;  5COY A;  5JJZ A;  1KC8 C;  4KY5 A;  2LS0 1;  4DN4 M;  1K73 C;  2NYZ D;  4JVZ A;  4P74 A;  1VQI A;  4DNR B;  3OPO A;  3QB3 A;  3TP8 A;  1Q8I A;  4LFC Q;  2JEA I;  1FL0 A;  4ZYS A;  1Y1V B;  5C4Z A;  1JE5 A;  4ILW A;  5CMD A;  1FNW A;  4LFC L;  2F0E A;  3CRK C;  1CT1 D;  5EQ0 A;  4KKU A;  2JA5 G;  3ND9 A;  2TMP A;  1X32 A;  1K8A C;  2IT1 A;  1C9O A;  2KVM A;  4KI0 A;  2FIN B;  3Q8D A;  2Z6K A;  3DWA A;  2JEB I;  1UNS A;  3TN2 A;  2WKC A;  4XIG S;  2HD3 A;  2EY5 A;  2EYF A;  3S2H H;  4XYO A;  3KDF A;  5C3X A;  1FNU A;  1SFO B;  3PO2 G;  3F1Z A;  2EYP A;  4JI0 Q;  4F88 A;  4IOA A;  4C3H B;  1HQR D;  4JI0 L;  2EE1 A;  2Z1C A;  3N52 A;  3SEB A;  1DD2 A;  1PTO H;  2QGQ A;  1S3O A;  1RD9 D;  3UE1 A;  1TY2 A;  2J4X A;  5J39 A;  2DY7 A;  4A3M G;  2NUC A;  4CJ2 C;  1BCP C;  1Q1E A;  4LJZ C;  3HZX A;  4ULL A;  4UAI A;  5C4X B;  4LWC A;  2MP1 A;  1E7Z A;  5CV5 A;  4JW0 A;  2A68 D;  1JQY D;  2EYJ A;  2HIV A;  1W2B A;  1LAC A;  2KBN A;  2RA4 A;  1GM5 A;  1KLG D;  3BJU A;  4WJW A;  1JIC A;  3KJP A;  2SNM A;  5IP9 G;  3FEW X;  1YNJ C;  2WAQ B;  2Z0S A;  3BDO A;  3H91 A;  2K03 A;  4U68 A;  4CBV A;  3F2D A;  5G3L D;  1ZYR D;  5IYC H;  1U4M A;  3A8K E;  4CKE A;  1BQQ T;  3HOV H;  1EY8 A;  1OXS C;  1P16 A;  1PFM A;  2CH4 A;  1UE6 A;  3JAM E;  1R4P B;  3PO2 H;  5IIF A;  4DAY A;  1KQS A;  2IX1 A;  4UY8 C;  1HTP A;  2DUD A;  5AFW A;  3U9S A;  5IT9 L;  3K5L A;  1QCB D;  2RSN A;  3G4S A;  1ENA A;  1D5M C;  4FXG C;  1V1P B;  1Y1W G;  4BY1 G;  4LF4 Q;  4X3S A;  5IT9 c;  2F0V A;  1SYD A;  5KYL A;  4Y52 H;  3CW2 C;  3A0J A;  1JJG A;  4LF4 L;  4K8J A;  5M5Y H;  3K5O A;  3LWE A;  3CCS A;  4HCE A;  1U4P A;  4JOI C;  4FP5 D;  3S2H B;  3T53 B;  1ASZ A;  2XVS A;  4A93 B;  3STB D;  3MC0 B;  4KJO A;  1MSG A;  1TS3 A;  4IPD A;  4P71 A;  1GUS A;  2PZT A;  3BVM A;  4LFA Q;  3UDX A;  5CBA E;  1JOK A;  4DV6 Q;  1GXD C;  1B50 A;  3A56 A;  4LFA L;  5GRO A;  3FVQ A;  4DV6 L;  2WB1 B;  4A3I H;  4OL7 A;  1VMP A;  4B9X A;  4XQQ A;  3I2Z A;  3I4M G;  4I65 A;  1I6H B;  1QB5 D;  2B3G A;  4A3J H;  1YI2 A;  1F77 A;  4FF1 A;  2UXB Q;  2L1B A;  2RQX A;  3ONA B;  3NEM A;  3PF5 A;  2UXB L;  5IP7 G;  5KNC A;  2H5X A;  2TSS A;  3ERO A;  2PPB C;  2AHO B;  4ZK9 B;  1H9M A;  4R8I A;  1VQC A;  1X9N A;  1RTO A;  5KND A;  3HOV B;  3MVV A;  2XN9 C;  5I4D A;  2EY2 A;  3E9I A;  1L1O C;  1K3R A;  2KCN A;  1F2M A;  3TRZ A;  3DM1 A;  2Q2T A;  1E0B A;  2E2J B;  1WCM H;  1L0W A;  4X3T A;  3PO2 B;  2F0H A;  3CC7 A;  1X3F A;  4HMJ A;  4Y7N B;  4GNX A;  5FOB B;  4X66 Q;  2J0T D;  3CCJ A;  3HOY H;  3RZO B;  4X66 L;  5J1Z A;  2JQO A;  3A5U A;  2B2Y A;  4A3M B;  1JE4 A;  1IYU A;  4HIK A;  1EOV A;  2K5H A;  3JAM i;  5LL6 S;  4GKK Q;  1ENC A;  1SAP A;  2IHF A;  1CHQ D;  4C2M H;  4GKK L;  5EJW A;  3M4Y A;  1EZ6 A;  2M2L A;  1O80 A;  3O13 A;  3S1R H;  4ZKB B;  1QZH A;  5IP7 H;  2B63 H;  2DY8 A;  5DLQ E;  2OT2 A;  1YNX A;  1KXL A;  1X3E A;  2JN4 A;  4IFD H;  2FJ2 A;  5CV6 A;  3VR6 A;  4KHP Q;  1LT5 D;  1UUP A;  1R4Q B;  3TP7 A;  3Q0A A;  1U0L A;  2ZJP A;  1VQJ A;  1EYG A;  2D2C C;  1QVC A;  3NHH A;  4PV1 C;  4KHP L;  4LF5 Q;  4GLA C;  1CKO A;  5C4J B;  1ZXT A;  1ET9 A;  2RSO A;  3PUY A;  4R4Q A;  4LF5 L;  1YVC A;  4DR4 Q;  1V9P A;  3A55 A;  2F0W A;  1PYB A;  3KJO A;  4DR4 L;  3OYY A;  1HZB A;  4KHZ A;  4XXE A;  4LAA A;  1HJP A;  1VQF A;  3HOW H;  1EU4 A;  2A73 B;  1Y1W B;  4BY1 B;  1HR0 Q;  1BOS A;  3Q22 A;  4AIM A;  1B44 D;  2YTV A;  2PCF B;  4XT3 B;  1S4Z A;  1HR0 L;  2PQA A;  4FVM A;  3A8J E;  2RKS A;  4O2D A;  4A3C G;  4C56 C;  5E1F A;  1O7L A;  2RDG A;  4JC0 A;  3PUX A;  2PI2 E;  3M4P A;  4C3I H;  3G48 A;  1FNV A;  4HJ7 A;  1WFQ A;  1JOR A;  4O42 A;  1PH1 A;  2VS1 A;  1VQ5 A;  1EY5 A;  4ALP A;  4AQY L;  5JEA J;  4BBS H;  3L9A X;  2FFK B;  2WKD A;  5FO8 B;  4C3J G;  3S1Q B;  4C1N K;  1DGS A;  3TRE A;  4WRD A;  1TWA B;  2ASB A;  3G7L A;  3I4M B;  1SNQ A;  2WFW A;  3Q24 A;  1E1T A;  3DEP A;  1HHV A;  2NZ1 D;  2SDF A;  4X64 L;  4DAY B;  1X55 A;  4RGM A;  5DAU A;  3TS0 A;  1PVO A;  4R4O A;  4ABN A;  1I50 H;  4FF4 A;  3Q6S A;  1IBM Q;  3GV3 A;  4IUQ A;  4B08 A;  3W2D A;  1WJJ A;  1Q86 C;  1O7Z A;  1G6Z A;  5ELD A;  1IBM L;  3TBI B;  2F0J A;  5M5W H;  2L4N A;  3GTG H;  3MEF A;  1I94 Q;  3R2I A;  1D7Q A;  4FNF A;  1D5X C;  2AWO A;  4XQN A;  4MTK A;  2DNC A;  2JA8 G;  4O1N A;  1BBW A;  1VQ8 A;  4LUZ A;  3BVG A;  1E2V A;  1GOZ A;  2E75 C;  1DOL A;  4E6I A;  1JC7 A;  2BOS A;  2E2I H;  3T1H Q;  2B2V C;  4RCN A;  3H3V C;  3NP8 A;  3E0J A;  3T1H L;  4A4I A;  3N6R A;  4NB3 A;  4OIK A;  4WOR A;  3M7N A;  2ZJR A;  3NXW A;  3S2D H;  5D65 A;  1B9N A;  4HSV A;  4RGO S;  1WOC A;  4WJ3 M;  2HHH Q;  2A5H A;  3AFQ A;  4JI4 Q;  1EFW A;  4OX9 Q;  2UXD Q;  1UEA B;  2IX0 A;  2OTL A;  2HHH L;  3SK4 A;  4JI4 L;  4OX9 L;  1JOQ A;  1FGU A;  2UXD L;  2XTI A;  1NR4 A;  2F3V A;  3MXP A;  5IGB A;  1HCZ A;  2BE5 D;  1VF7 A;  5IGF A;  2NB0 A;  2UUA Q;  1K8M A;  1BKB A;  1XTC D;  1SMY C;  5C3E G;  2F0I A;  4IPH A;  5IYD G;  2UUA L;  1CHP D;  1BCP B;  1Y8P B;  3M9B A;  3OHX C;  2IW3 A;  1N34 Q;  2BCO A;  1IYJ B;  1KDA A;  1LV9 A;  4ZKC B;  1HZA A;  3SE0 A;  3MHB A;  3SK6 A;  3I3C A;  2UUB Q;  4BXX G;  3TQY A;  2K5N A;  3EIV A;  4DV1 Q;  1RF2 D;  1W6J A;  1WTO A;  2UUB L;  2I46 A;  2OWO A;  4DV1 L;  2HCC A;  4H7B A;  2F4V Q;  1I50 B;  3NQI A;  2CW0 C;  3RN5 A;  2CVR A;  4GLX A;  1QNU A;  4BA2 I;  1K3B C;  1A2T A;  3E5S A;  4DR7 Q;  4UPA A;  2L55 A;  2F4V L;  3A74 A;  3I7F A;  5LMN Q;  3GTM H;  2KCT A;  1QE6 A;  5ELB A;  4DR7 L;  3PGZ A;  2CQA A;  3CRL C;  4JBW A;  3J81 i;  3MA2 B;  5LMN L;  1PZJ D;  3GP7 A;  2YYZ A;  4IPG A;  5CV7 A;  3I55 A;  4DA2 A;  2VZA A;  1B4O A;  2DGY A;  3KF8 A;  2N3S A;  3DXJ C;  3PCO B;  3VR2 A;  3PO3 G;  2E2H B;  4JI6 Q;  3NEN A;  3BZK A;  1VQ6 A;  1SN8 A;  1BF4 A;  3PMF A;  2PZW A;  1B8A A;  4JI6 L;  2E2I B;  1PTO C;  2PQE A;  4RGT A;  4Z9C B;  4V0B A;  1K0S A;  3I91 A;  4IUP A;  5IYD H;  2EJF C;  4XQJ A;  3S1M H;  2QIL A;  4X3K A;  3NEL A;  3CCQ A;  1DCZ A;  1I3Q B;  1CQV A;  1V43 A;  3SR1 A;  4C3J B;  3OIQ A;  4POG A;  5C3W A;  3G71 A;  3KLS X;  2N55 A;  4GN4 B;  3CP0 A;  4I7A A;  3TZU A;  3GTK B;  5EPJ A;  4TRD A;  4A3L G;  3CPW A;  1WYD A;  1S72 A;  1IBK Q;  4HJ9 A;  2A69 D;  2F0Q A;  1YEZ A;  4F7X A;  1B1Z A;  3U9O A;  1TT2 A;  5D14 A;  1N8R C;  3DEO A;  5M3F H;  3I56 A;  2K75 A;  2PQA B;  3FKI G;  5IT9 E;  1IBL Q;  2JA8 B;  1PH9 A;  2B2T A;  3VR4 A;  4ME3 A;  1WTW A;  4A3B G;  1IBL L;  3V96 A;  2R93 H;  3KOJ A;  1JMC A;  1BR9 A;  3LX0 A;  5AJ3 Q;  3V2T A;  1WTQ A;  1KAW A;  5AJ3 L;  4NXN Q;  1HFG A;  1DOK A;  3P20 A;  1XTD A;  2B2W A;  3GTM B;  1T9H A;  5IYB H;  4CHT B;  3OOC A;  4KMU C;  1TWH B;  5JAV A;  2N88 A;  5T1I A;  1K0R A;  2MJ8 A;  4DV4 Q;  3J80 L;  4GOP A;  2O5I C;  1B7Y B;  1Z6H A;  2BH2 A;  4Q0F A;  1XNQ Q;  2Q2U A;  2C5C A;  4DV4 L;  1LTS D;  1Q90 A;  3E3X A;  2KJX A;  3J80 c;  2KHI A;  1XNQ L;  5IE8 A;  1MKH A;  1QVF A;  2F52 A;  4R8N A;  1XMQ Q;  5C3E B;  4K0K Q;  3S1M B;  2XSC A;  4JBM A;  1XMQ L;  1SNO A;  4TVA B;  4A3F G;  2F0N A;  2YU9 B;  3CC4 A;  1Q81 C;  4HAE A;  2K01 A;  4K0K L;  4ZQ3 A;  1IW7 C;  1WI5 A;  1SDF A;  1UE1 A;  4IZ8 A;  3BS1 A;  1GUO A;  4A3E G;  2KOL A;  3BDC A;  5L37 A;  4C3H H;  1VQD A;  2NN6 G;  1PTO F;  5JVG 3;  1PH6 A;  2LFN A;  1SXT A;  4H13 C;  2HUG A;  1NSN S;  1ESR A;  1HTL D;  1X3Q A;  2H1E A;  1TY0 A;  1GD7 A;  3JC6 6;  4K2L A;  3RLO A;  2PMZ E;  4X6A H;  3HOZ G;  1B53 A;  3PO3 B;  1STH A;  3K8A A;  1ILQ A;  1TVX A;  1FVI A;  1WTV A;  5M3M G;  5JJI A;  1SMX A;  1S5C D;  1XPO A;  1STE A;  1NBW A;  4R1J A;  2A19 A;  3NWS A;  1F2Z A;  1BXT A;  2CWA A;  3VYT A;  1CTM A;  4DAV A;  1STG A;  3QWN A;  3IFD A;  4DGZ A;  4HJA A;  5LMU Q;  4PZ6 A;  2ZJQ A;  2QF7 A;  1YZ6 A;  2AUJ D;  2BDO A;  3RLF A;  5FJ8 G;  5JPN C;  5LMU L;  4JI8 Q;  4NPS A;  3ERS X;  1CFM A;  3EJI A;  4HMI A;  2Y0S G;  4KTA A;  4JI8 L;  5LL6 X;  4PMB A;  3LWU A;  1S5B D;  3GTJ B;  2MQH A;  1BCP D;  5JJK A;  1UWV A;  4KKS A;  2EDG A;  2R6G A;  1MIU A;  1NR2 A;  2KA7 A;  2ICE C;  1J8I A;  2ENB A;  2Q2H A;  4POF A;  3K5N A;  2VQF Q;  4GZY C;  3K7U C;  3E6Z X;  2UUC Q;  1PDQ A;  1PH3 A;  2VQF L;  1TS2 A;  4XTC S;  1CKM A;  1B2T A;  2UUC L;  4A93 H;  3FKI B;  3KF8 B;  1WVL A;  1YNJ D;  5CYU A;  3ULJ A;  1CK1 A;  4DR2 Q;  3HEJ A;  2NVQ B;  4A3B B;  4PMC A;  3J81 j;  4UDU C;  1Y8O B;  1HNZ Q;  3W3A A;  2KED A;  4H0L C;  4XYQ A;  1SYF A;  1DJR D;  2AQ3 B;  5ISR A;  1SYC A;  4DR2 L;  4JCV E;  1Q7Y C;  2A6H C;  1HNZ L;  1SE3 A;  5IGE A;  1QNK A;  4EQP A;  4OO1 H;  1WTH A;  2ZTC A;  4QF4 A;  5CR3 A;  3H15 A;  1GUG A;  1I6H H;  1YJW A;  2L11 A;  3CAM A;  5E7N A;  1DZ1 A;  1MJC A;  1VQG A;  1T5E A;  1CZG A;  3NQT A;  2NBF A;  4J1M A;  4CKC A;  4RGN A;  1V1O A;  1JR0 D;  2IPK D;  4DXF A;  2JA5 H;  1EIF A;  5FO9 B;  1X6O A;  3PF4 A;  5I9P A;  1L0Y B;  2Z8L A;  4KD4 A;  3OWF A;  1I6V C;  2UXC Q;  3EN2 A;  3KF6 A;  2E2J H;  1NCV A;  2UXC L;  1EIG A;  2E5L Q;  3R93 A;  4OWT B;  4A3E B;  2LMC B;  4Y7N H;  5M5X H;  1HQM C;  3HOU G;  3HP3 A;  2E5L L;  2QDB A;  1KNA A;  4ZLT F;  3RZO H;  1EOT A;  3GDE A;  4CJ1 B;  2K28 A;  1LT6 D;  3HKS A;  4LNQ A;  4A3M H;  2AUK A;  3F2B A;  4KK7 A;  1PFS A;  3MWY W;  3C1F A;  2WP8 J;  2NVT B;  4RA8 A;  3P1H A;  1U4R A;  4DUZ Q;  2F1M A;  4DNT B;  2JA6 G;  4HJ5 A;  3FDT A;  1Q12 A;  2PZU A;  1LUZ A;  4DUZ L;  3ITP A;  1C48 A;  3Q23 A;  1QJO A;  4GOP B;  2MFI A;  2ZT9 C;  3HOZ B;  3H3V I;  1AE2 A;  4H02 A;  2JA7 G;  1K8G A;  1RKN A;  2WB1 E;  1CUK A;  3T51 B;  5M3M B;  2CCZ A;  3EA6 A;  5IP9 H;  2GN5 A;  4JG2 A;  4N9P A;  4RFB A;  1XPR A;  1QIL A;  4A3G G;  3OW2 A;  3IFT A;  4JBJ A;  4DV7 Q;  1CA6 A;  1DYQ A;  1YIJ A;  1YNN C;  3NK9 A;  1LT3 D;  1FYC A;  2F0S A;  2GVB A;  5ELC A;  2QEX A;  4DV7 L;  5C4J H;  2VB3 X;  1PYW D;  2JK8 A;  3GQB A;  1YIT A;  3TP6 A;  1PHJ A;  3UI2 A;  2NN6 I;  1GVP A;  2Y0S B;  1C7Y A;  2YV5 A;  4AH6 A;  1NAP A;  1C8C A;  1EL0 A;  4DV5 Q;  4YWM A;  3AEV A;  2L12 A;  1H9S B;  1RJT A;  4HSP A;  3X3N A;  1Y1W H;  4BY1 H;  2JA5 B;  2QEJ C;  4DV5 L;  1EQR A;  3D6W A;  2UU9 Q;  1EYA A;  2PYK A;  4KD3 A;  2KEE A;  3CCV A;  3F2C A;  2VXW A;  5DNF A;  2UU9 L;  1RCV D;  4APV A;  4RKL A;  1BO0 A;  1SYG A;  2SEB D;  4YCU A;  1KD1 C;  5M5X B;  4A3K G;  1PH2 A;  2IX3 A;  2EXZ A;  5IY0 A;  3KK7 A;  2A74 C;  3NSW A;  4C1N I;  3EVQ A;  4L6T B;  1A0I A;  3S1Q H;  1HH2 P;  1TWA H;  1XWE A;  3I4L A;  3I4M H;  3H0G G;  1Q8K A;  1EZ8 A;  4OWW B;  2IL8 A;  4WJ4 A;  1VQK A;  1VDZ A;  2I5L X;  1I4Q A;  4TQU S;  4L5Q A;  3IL8 A;  5CV9 A;  1PRT C;  2K14 A;  4OEL B;  2K1B A;  4RHS A;  1ROD A;  3H09 A;  1W6K A;  1S5D D;  3QOL A;  2CKZ B;  1TS4 A;  4QIW B;  2ZXP A;  3A5Z B;  3E9H A;  2E76 C;  3EFX D;  4G57 A;  4KLK A;  1Y69 U;  3I4N G;  2KEC A;  1PFB A;  2K7V A;  3C3L A;  1H9K A;  4LW1 A;  4JOI A;  2JP1 A;  4B3T Q;  2EZV A;  3PUV A;  4B3T L;  3QG1 A;  1UAP A;  2HDM A;  5HGQ A;  2FMC A;  1KTK A;  1GHJ A;  3HOU B;  3D0F A;  3HOX G;  1VQP A;  1MHW C;  4FDB A;  4AYB G;  3MTS A;  1NY4 A;  2RCF A;  4KN4 C;  2Q8T A;  5G3L F;  1O78 A;  2YTY A;  4UP7 A;  4K2K A;  1OXT A;  4LMQ D;  1HUM A;  3DLL A;  4JYA Q;  4G4K A;  4S3S A;  3NTH A;  4YY3 Q;  1CKN A;  4JYA L;  1XNR Q;  1SRU A;  4A76 A;  1VQM A;  3C1E A;  4YY3 L;  1WTR A;  3CMA A;  3J7A 5;  1XNR L;  3FPP A;  1PV4 A;  1EY0 A;  1JWS D;  5C0X J;  1QUQ A;  3T56 B;  5D3D A;  2JE6 I;  3GTQ B;  4A3G B;  2HT1 A;  3AMU A;  1JJ2 A;  4LF7 Q;  3J80 E;  3TS2 A;  5A2Q L;  2DNE A;  2FHT A;  3CD6 A;  1L1O A;  3M4O H;  4LF7 L;  3KF6 B;  1F9Q A;  3NPP A;  1F9R A;  1JOO A;  4QY7 A;  3T13 A;  2R7F A;  3PQI A;  1SND A;  3IRB A;  1PMR A;  4QQB X;  1NMG A;  3VYU A;  1A62 A;  2I5M X;  4F8M A;  1QG7 A;  4OXP A;  4ME5 A;  1CZW A;  4DV2 Q;  1AW7 A;  4ZAI A;  4BBR G;  2BA0 A;  2O2L D;  3CCU A;  4DV2 L;  1Q3L A;  1PH5 A;  1I94 L;  4A3C H;  2G9H D;  2F0M A;  4R4I A;  1K83 B;  2E2H H;  2KCM A;  4HID A;  4YWK A;  3HKZ G;  2F0F A;  1PRT F;  1NNX A;  3JAM L;  5C6A A;  2G5D A;  1EQV A;  1L2F A;  1PH8 A;  1W3S A;  4YIJ A;  5BN3 A;  4A3K B;  2C9O A;  3JAM c;  1PXU A;  4KJN A;  2GA4 B;  1M90 C;  1AE3 A;  5IGG A;  4QMG A;  5C0X G;  1I3Q H;  1F2L A;  2F0D A;  2K6A A;  2RF4 A;  4C3J H;  4QCL A;  1A3V A;  5JEA G;  2XWB B;  2ZXO A;  4FF3 A;  1ESF A;  2F3W A;  2D62 A;  3BZD B;  5COR A;  5IOD A;  4QGU A;  4DR1 Q;  3H0G B;  1DOM A;  4DR1 L;  3GTK H;  2CW0 D;  4LUV A;  1G51 A;  3T1Y Q;  1AEX A;  2IHE A;  5CV8 A;  5T1G A;  1ICW A;  1C4Q A;  3CQZ B;  3T1Y L;  2JA9 A;  2OXP A;  4DK1 A;  3F2U A;  1LM0 A;  2A6E C;  3TDQ A;  5EBC A;  2V4D A;  4A75 A;  3I4N B;  4O0A A;  3WOF A;  5HUR A;  1SSO A;  3P7J A;  2K5V A;  2JA8 H;  1EYD A;  1PTO D;  2L0C A;  3M4O B;  1N34 L;  1E22 A;  5GAH C;  2LXK A;  4K5X A;  1I4P A;  2F03 A;  1TWF B;  3HOX B;  1IHZ A;  2K5W A;  5EKI A;  4B9W A;  4X65 Q;  4TSS A;  4AYB B;  3P75 A;  1SJH D;  4MN3 A;  3D4D A;  4X65 L;  4DKA C;  1CA5 A;  3A54 A;  4R4C A;  4Q5V A;  2CWP A;  5KRU A;  1SR3 A;  5BN4 A;  2B29 A;  4YWL A;  1YJN A;  1TWH H;  3MXU A;  5IOC A;  1TWC B;  5EPL A;  4RG1 A;  1HR0 W;  3S1N H;  1Z7T A;  1G29 1;  4UHV A;  2MHV A;  4QUC A;  2AMC B;  5KNB A;  2PO4 A;  3S15 H;  5C3E H;  1XXG A;  1SNM A;  2VUM G;  1G2S A;  2R7Z G;  2ZM6 Q;  2YU9 H;  4K8I A;  3K6O A;  4RAU C;  2ZM6 L;  1OTC A;  1V1Q A;  4BXX H;  1GO3 E;  3MFY A;  4X3U A;  3AU7 A;  1M1K C;  2JSO A;  4CDC C;  4KN7 C;  3W1G A;  3TME A;  2EOT A;  4OON A;  2KHJ A;  4ZRZ A;  2C35 B;  2B2V A;  4QUF A;  1D6E C;  1VQ4 A;  2OF1 A;  3ER0 A;  2KHS A;  2PNR C;  3OSO A;  4JK1 C;  3RUZ A;  1X3G A;  1IBK L;  3CCR A;  5ELE A;  3SK8 A;  2CHB D;  1LTL A;  1VMC A;  4BBR B;  3VR5 A;  2NVX H;  2Q2I A;  1LTA D;  5C44 G;  1JJC B;  3PO3 H;  1XJV A;  4FXD A;  1CKN B;  2HCI A;  3F8T A;  3HKZ B;  3RMH A;  4ODG A;  4RWS C;  5ELO A;  4IPC A;  4X62 Q;  1BBX C;  4BY7 G;  3FMC A;  1HXY D;  3SVM A;  1ICF B;  4XDX A;  1QUQ B;  4HR7 B;  1HNX Q;  4LK1 C;  3I8Z A;  4X62 L;  3QIA A;  4DU9 A;  3GTL B;  1HNX L;  1AH9 A;  1IW7 D;  3NWT A;  4NXN L;  1TXY A;  4DK0 A;  2IWH A;  4LFB Q;  1LO5 D;  1L1O B;  2M9V A;  1KDB A;  4FO2 A;  4JI1 Q;  3U4V A;  4LFB L;  3K59 A;  4IN3 A;  4ID6 A;  4JI1 L;  3T16 A;  1JWU D;  3FP9 A;  3SXH A;  4A3L H;  2RDF A;  2EXD A;  3L2P A;  3GTJ H;  2R92 G;  1FR3 A;  4F87 A;  3S1N B;  2B8F A;  1EIY B;  2IY5 B;  4DPG A;  4NW2 A;  4DR6 Q;  3S15 B;  1VQE A;  5FLM G;  3UDG A;  5C4X G;  2WAC A;  4DR6 L;  1YHA A;  1GUT A;  1TS5 A;  4P75 A;  1HNW Q;  3FHW A;  4GKJ Q;  1STA A;  3FKI H;  2VY3 A;  1HNW L;  4RHR A;  1PZI D;  3J81 L;  2NVQ H;  4GKJ L;  1Y14 B;  4A3B H;  2F0L A;  4L5T A;  5IWA Q;  2EIF A;  4FYD A;  4DAM A;  2LXJ A;  4GS3 A;  5BR8 Q;  5IWA L;  3J81 c;  3K81 C;  1LTR D;  2E2D C;  3S14 B;  5GAE C;  5BR8 L;  1H9S A;  2HQL A;  5C0X I;  3U50 C;  5C4H A;  3ICE A;  3MXN B;  3WOE A;  2OEO A;  1VQN A;  4QL5 A;  5BN5 A;  4KV6 A;  1YBY A;  4HIM A;  1KRT A;  2NVX B;  4PZ8 A;  1YJ9 A;  1SLJ A;  3GTP B;  4N9T A;  1CQF A;  2XIW A;  4JPB W;  1YHB A;  1J9O A;  5CBE E;  1A15 A;  1HPC A;  3D4R A;  5K5P A;  2ZTE A;  3H3V H;  4QJF A;  4OGQ C;  5LMN W;  3KLS A;  3LGJ A;  3ULL A;  1LTB D;  2R7D A;  2XRQ D;  2K5Q A;  2F0K A;  3RZD B;  2VUM B;  1B9M A;  4A3F H;  1PYS B;  1D8L A;  4B3S Q;  2R7Z B;  1GJX A;  2OQ0 A;  5EKK A;  1ZEQ X;  4K5V A;  1IL8 A;  4UP9 A;  4B3S L;  1DXM A;  3QJY A;  3GTO B;  1SNP A;  4M8A A;  3R8B A;  3RLN A;  2A6H D;  3BVZ A;  4BA1 I;  1O7I A;  4DFA A;  5I6W A;  4A3E H;  1EY7 A;  2XRS D;  3DUZ A;  3UE0 A;  2NN6 H;  4R9W A;  2ES2 A;  1EU3 A;  1A6X A;  2F0U A;  1R9T B;  1WD0 A;  5JOB A;  3VYR A;  3OTO Q;  2NVT H;  1A2U A;  2B39 A;  1O7Y A;  2NVY B;  4DXG A;  1CM9 A;  3OTO L;  2KQ3 A;  1MSH A;  5C44 B;  3HOZ H;  1U4L A;  3J7A F;  1Z47 A;  4IUN A;  1NE3 A;  3HG9 A;  4IUR A;  5M3M H;  1VQ9 A;  3PIP 3;  3PUW A;  4NDX A;  5KIX A;  4BY7 B;  5IYC G;  3VYS A;  5IGD A;  3D4W A;  1S40 A;  2Q8R E;  2D0P A;  3HOV G;  5KGU A;  1F2Y A;  3AB9 A;  5FK9 C;  3PUZ A;  1G6P A;  2A1A A;  1WTP A;  2E8G A;  1SNC A;  1N36 Q;  4JBK A;  1L0X B;  2OTJ A;  5FLX L;  3PSI A;  5FJ8 H;  5DM7 3;  5EPK A;  4G7O C;  2F0P A;  1N36 L;  1A3T A;  2WAQ E;  2EYO A;  1MBY A;  1SE2 A;  2CH4 W;  1Z9F A;  5FLX c;  2N8N A;  1OXX K;  3HRZ C;  1OXV A;  2R92 B;  4M1U B;  1P8L A;  5FKA C;  4OIJ A;  3VDY A;  4PZ7 A;  3MAQ A;  1AP0 A;  5K36 G;  5A2Q E;  5GAG C;  1Q1B A;  1QWY A;  4LF6 Q;  1DON A;  4DK6 C;  2K04 A;  4QB4 A;  4A3F B;  1Y8N B;  4LF6 L;  4L63 B;  1G8Z D;  1LTI D;  1RTN A;  1TR5 A;  4GNX C;  2BA1 A;  5DEH A;  4P73 A;  2I07 B;  3G6E A;  2EQS A;  4IAL A;  3V05 A;  3D3R A;  1YNN D;  2HQE A;  2PI2 A;  1H9R A;  4XT1 B;  1B3Q A;  3K0Y A;  4N8X 1;  5DM6 3;  2B2Y C;  4A3I G;  4A3D G;  1I4X A;  3EQL C;  4OWX B;  1SYB A;  4DUY Q;  3BYT B;  1M8A A;  1I4R A;  1Q46 A;  1EEF D;  2RDH A;  4G7Z C;  4A3J G;  1H9J A;  4DUY L;  1ENF A;  4OHJ A;  2K33 A;  4NKL A;  1EY4 A;  4CDF C;  1BBU A;  4IQZ A;  4IO9 A;  1KNE A;  1JB7 A;  5J22 A;  2ALY B;  2B8G A;  5EAY A;  4IFD J;  3U4Z A;  1FJG Q;  2LSS A;  3OWE B;  2A68 C;  2XGT A;  2F0T A;  3K0X A;  4HTH A;  1FJG L;  4DNI A;  1WD1 A;  5K36 H;  1D1K A;  1AFP A;  4RKB A;  2KEN A;  1JWM D;  2X6G A;  5J3B A;  3SK5 A;  3RN2 A;  3CCL A;  2LKV A;  4JI7 Q;  2Y0S E;  1ZYR C;  3RR5 A;  2N49 A;  3S24 A;  4U67 3;  3KFU A;  3SDZ A;  4JI7 L;  3A7L A;  4NP5 A;  3UDI A;  2QW7 A;  5GAD C;  1SEB D;  4L8J A;  1WCM G;  3I70 A;  3OIP A;  4EGV A;  1ML0 D;  3I90 A;  2DJG C;  2RCN A;  3A8I E;  5E3F A;  3KLW A;  4DR3 Q;  2EYH A;  3WDN A;  3HOU H;  1ASY A;  2K4K A;  2ATW A;  4DR3 L;  1PTO B;  3DM3 A;  3HOY G;  4LF8 Q;  2KUM A;  2FMM A;  2O5J C;  2YTX A;  4LF8 L;  4A3D H;  3GV6 A;  1D2B A;  5ELF A;  3NE5 B;  1HFN A;  1SBB B;  1GUW A;  1PRT D;  2VL6 A;  1EUJ A;  3VA5 A;  1ZKO A;  2JA6 H;  1PLF A;  1UEB A;  1XMO Q;  4EQ5 A;  2NZO A;  5CC4 A;  3J7Z C;  3SGI A;  1A3U A;  1TQO A;  1SE4 A;  3C2P A;  2JXM B;  5EKL A;  2I0Q A;  3CU7 A;  3CME A;  1XMO L;  4JI5 Q;  3HS0 C;  2Z4H A;  1CSP A;  2JA7 H;  2B63 G;  3KUP A;  4LF9 Q;  3BG3 A;  3K58 A;  3STB C;  3J7A V;  1GHK A;  3TP5 A;  4JI5 L;  4IFD G;  4LF9 L;  3K80 C;  3PV0 A;  1BCP F;  5M9O A;  3GTQ H;  4A3G H;  1HZ9 A;  1TII D;  3NBI A;  2P5Z X;  1KRS A;  1MD2 D;  1SJE D;  2OQK A;  2K32 A;  1JCK B;  2L9H A;  2PW5 A;  4N8F A;  3URY A;  4QIW E;  1FD7 D;  5ELN A;  1KDC A;  2F4I A;  5IGC A;  3CPF A;  1VQO A;  2K05 A;  4OO1 I;  3BYY B;  3EBE A;  5C5L A;  3HOW G;  2R61 A;  2RVL A;  3DWP A;  3NTK A;  4IUT A;  1VF5 C;  3H6M A;  1PH7 A;  1N32 Q;  5TSS A;  3DHQ A;  5M5Y B;  1PZK D;  3D8G A;  4KY6 A;  1EQT A;  4RCO A;  2KCC A;  3TZD A;  1N32 L;  3K5M A;  3W5O A;  3TEH B;  1K83 H;  2Z4I A;  4ZCK A;  4BS9 A;  3M3Y H;  1RHP A;  4C3I G;  2ZXR A;  4H44 C;  5EBD A;  4A3K H;  1RDP D;  1T5X D;  4BBS G;  3ND8 A;  1GUN A;  3R3O A;  4MHE A;  4A3I B;  3W1B A;  4A3D B;  3WWV A;  4IJL A;  5I9O A;  4MNO A;  1VQH A;  3KDF B;  3H0G H;  2MPM A;  1HUN A;  4A3J B;  1VS0 A;  3X3M A;  2JA6 B;  1I5F A;  2VQE Q;  3S9W A;  4J6H A;  1IKL A;  1EFI D;  2VQE L;  1KAB A;  1TKW B;  3CQZ H;  3I73 A;  2JA7 B;  1STY A;  4JI2 Q;  1B70 B;  2X6L A;  1VQ7 A;  1XX8 A;  4NMZ A;  2OCE A;  1WTX A;  4RH6 A;  4JI2 L;  3I4N H;  1KIX A;  2EY6 A;  1E2Z A;  1KLU D;  1E3P A;  3QO2 A;  3LNN A;  1EY9 A;  1EWH A;  2MO0 A;  1SYE A;  1IYV A;  3U58 A;  1QZG A;  1NJI C;  2WV6 D;  1WCM B;  5LHY 1;  1C0A A;  1HZC A;  3CKI B;  2J7Z A;  1CSQ A;  1DM0 B;  4AQY Q;  4HCS A;  4YCW A;  2AWN A;  1TWF H;  2XNA C;  3HOX H;  5JVH 3;  1MI2 A;  2K5D A;  2L15 A;  4GLV B;  4PNY A;  3HOY B;  1F9S A;  1Q82 C;  3QOJ A;  1AZP A;  1N33 Q;  3C46 A;  3M7G A;  1SRO A;  5KEE A;  1N33 L;  1MJE A;  4FF2 A;  3B6Y A;  4X64 Q;  3J81 E;  1XYI A;  1EYC A;  4K6L A;  1TWC H;  2PNH A;  2MNA A;  4C2M B;  4HJ8 A;  2R3Z A;  1QOH A;  3MXG A;  4G7H C;  1H95 A;  2Z9H A;  2A6E D;  1NMF A;  1RL2 A;  3M3Y B;  2AKW B;  4HIO A;  3S1R B;  1SMY D;  2ID0 A;  2D9U A;  4WFN 3;  1J6Q A;  5HGT A;  2B63 B;  2ICI A;  1MGS A;  1LAB A;  2VB2 X;  3HGB A;  1ET6 A;  4I7Z C;  3A7A B;  2F3I A;  4ZUJ A;  3MXN A;  1E1O A;  1XPU A;  2ZTD A;  1E24 A;  2MO1 A;  1LTG D;  1YHQ A;  4R4T A;  2WIN B;  2Q8I B;  5JJL A;  2NWG A;  3J7Y W;  4GN5 A;  5NUC A;  3PIO A;  1K8O A;  3KYH C;  4DF7 A;  4PQX A;  5D3I B;  2JJQ A;  5A35 A;  4EQN A;  2VW9 A;  3I4O A;  1X3P A;  3SHL A;  3HOW B;  2DJF C;  1HA5 A;  3NUC A;  2M00 A;  1N9W A;  1I4H A;  4BBR H;  2CFM A;  2Z6B A;  1KAA A;  1G91 A;  2B2U C;  2B2T C;  1BVS A;  1STN A;  4AYB E;  2H4O A;  4C3I B;  1KL9 A;  5EGT A;  4IFD I;  1VQL A;  3OW7 A;  5HY6 A;  3NBH A;  3MZ5 A;  4HED A;  4EQO A;  1IKM A;  1LTT D;  3PIO 3;  1VCI A;  4IUV A;  1BNZ A;  4BBS B;  3GTL H;  4UP8 A;  2B2W C;  5E4W C;  5C0X H;  1X65 A;  3DMU A;  3J80 i;  3OMG A;  4L5S A;  4CDE C;  5JEA H;  4MTN A;  2GVA A;  2NZH A;  4DV3 Q;  1UE7 A;  1TWG H;  1D5Z C;  2LY7 A;  3HFZ B;  4GOP C;  4DV3 L;  3AYH B;  3ZJY C;  3S16 H;  4GNX B;  2D0O A;  3L7Z C;  4HN7 A;  3M4Q A;  1PH4 A;  1S5E D;  4P2C B;  2SOB A;  1IXR A;  4MZ9 A;  3RD4 A;  4DV0 Q;  1HA6 A;  2SNS A;  3GD7 A;  5M5W B;  2BE5 C;  3GTG B;  1JT8 A;  5C5M A;  4DV0 L;  5FLX E;  5M3F G;  3L3O C;  1UE5 A;  3OMC A;  3BU2 A;  3VR3 A;  1HRJ A;  4PMW A;  5FO7 B;  4EVO A;  4TKO B;  1RIP A;  4V19 0;  4EX5 A;  1PA6 A;  5GQO A;  2F0O A;  1IL2 A;  1FGB D;  4B3M Q;  2HIX A;  2R93 G;  2IJ0 A;  1S5F D;  1OO9 B;  4CKB A;  1KHI A;  4KY7 A;  2MGS A;  3RNU A;  4B3M L;  1A63 A;  2EY1 A;  1OXU A;  2EJM A;  2NTS A;  3L0O A;  3KBX A;  4CDD C;  3S14 H;  4JI3 Q;  5KYI A;  4CJ0 B;  3S2D B; 
#chains in the Genus database with same CATH homology
 4ZUI A;  1F9P A;  2PW7 A;  2JYO A;  3VA7 A;  3G6J B;  3D31 A;  3TSS A;  2AQ2 B;  2XWJ B;  1G2T A;  3MFG A;  1BUV T;  3KBG A;  1I4G A;  4DAP A;  2E74 C;  5JPM C;  5I6Y A;  2B2U A;  1NUC A;  1TWG B;  2HDL A;  3MEH A;  4C3H G;  3S16 B;  2X69 A;  2AQ1 B;  3H94 A;  2D5D A;  1V8Q A;  3FPU B;  1V1P A;  1LLR D;  1U9R A;  1LT4 D;  4K6D A;  4KKT A;  5F2D A;  5E4X A;  2WII B;  2A69 C;  4IUU A;  4BWG B;  1CI3 M;  1AZQ A;  3KLR A;  1EIH A;  2G9D A;  4CGY B;  2VNU D;  2EYM A;  1PRT B;  3ZYY X;  1PFN A;  2O4X A;  1ILP A;  1E2W A;  2EVB A;  2RBM A;  3T4A C;  2EJG C;  5I2Y A;  4KHV A;  1M4V A;  2L5T A;  2QCP X;  1EY6 A;  4FXK C;  2QKI C;  2EYL A;  3ERQ A;  3GO5 A;  5CGK A;  3R2T A;  3NTI A;  3S17 B;  1STB A;  3I72 A;  2MUY A;  2BDN A;  5I2X A;  2F0G A;  3D6C A;  3IKJ A;  4J8Q A;  1EEI D;  3IAY A;  1AN8 A;  4MIU A;  5M3F B;  1BDO A;  1TU2 B;  3FRP B;  3K7A B;  1ONL A;  1D1I A;  3DWQ A;  3K57 A;  3BDL A;  5CV4 A;  2NTT A;  1II3 A;  4K5W A;  2EPB A;  2R93 B;  3CHB D;  3M85 A;  1B3A A;  1EWC A;  1JB3 A;  2PMZ B;  2DN8 A;  4OO1 G;  4K14 A;  5COY A;  5JJZ A;  4KY5 A;  2LS0 1;  4DN4 M;  2NYZ D;  4DNR B;  3OPO A;  3QB3 A;  3TP8 A;  1Q8I A;  2JEA I;  4ZYS A;  1Y1V B;  5C4Z A;  4ILW A;  5CMD A;  1FNW A;  2F0E A;  3CRK C;  1CT1 D;  5EQ0 A;  4KKU A;  3ND9 A;  2TMP A;  1X32 A;  2IT1 A;  2KVM A;  4KI0 A;  2FIN B;  3DWA A;  2JEB I;  1UNS A;  3TN2 A;  2WKC A;  4XIG S;  2EY5 A;  2EYF A;  4XYO A;  5C3X A;  1FNU A;  1SFO B;  2EYP A;  4F88 A;  4C3H B;  1HQR D;  2EE1 A;  2Z1C A;  3SEB A;  3N52 A;  1DD2 A;  1PTO H;  1RD9 D;  1TY2 A;  2J4X A;  5J39 A;  2DY7 A;  2NUC A;  4CJ2 C;  1BCP C;  1Q1E A;  4LJZ C;  3HZX A;  4ULL A;  4UAI A;  5C4X B;  2MP1 A;  5CV5 A;  2A68 D;  1JQY D;  2EYJ A;  1LAC A;  2RA4 A;  1KLG D;  4WJW A;  1JIC A;  2SNM A;  3FEW X;  1YNJ C;  2WAQ B;  3BDO A;  3H91 A;  2K03 A;  4U68 A;  4CBV A;  5G3L D;  1ZYR D;  1U4M A;  3A8K E;  4CKE A;  1BQQ T;  1EY8 A;  1OXS C;  1PFM A;  3JAM E;  1R4P B;  5IIF A;  4DAY A;  2IX1 A;  1HTP A;  5AFW A;  3U9S A;  5IT9 L;  3K5L A;  1QCB D;  2RSN A;  1ENA A;  1D5M C;  4FXG C;  1V1P B;  4X3S A;  2F0V A;  1SYD A;  5KYL A;  4K8J A;  3K5O A;  3LWE A;  4HCE A;  1U4P A;  4FP5 D;  3S2H B;  3T53 B;  2XVS A;  4A93 B;  3MC0 B;  4KJO A;  1MSG A;  1TS3 A;  1GUS A;  2PZT A;  3BVM A;  5CBA E;  1JOK A;  1GXD C;  1B50 A;  3A56 A;  3FVQ A;  2WB1 B;  4OL7 A;  1VMP A;  4B9X A;  4XQQ A;  4I65 A;  1I6H B;  1QB5 D;  4FF1 A;  1F77 A;  2L1B A;  2RQX A;  3ONA B;  5KNC A;  2TSS A;  3ERO A;  2PPB C;  4ZK9 B;  1H9M A;  4R8I A;  1RTO A;  5KND A;  3HOV B;  3MVV A;  2XN9 C;  5I4D A;  2EY2 A;  2KCN A;  1F2M A;  3DM1 A;  1E0B A;  2E2J B;  4X3T A;  3PO2 B;  2F0H A;  4HMJ A;  4Y7N B;  5FOB B;  2J0T D;  3RZO B;  5J1Z A;  2B2Y A;  4A3M B;  1JE4 A;  1IYU A;  5LL6 S;  1ENC A;  1SAP A;  1CHQ D;  5EJW A;  3M4Y A;  1EZ6 A;  2M2L A;  1O80 A;  3O13 A;  4ZKB B;  2DY8 A;  2OT2 A;  4IFD H;  2FJ2 A;  5CV6 A;  3VR6 A;  1LT5 D;  1UUP A;  1R4Q B;  3TP7 A;  3Q0A A;  2D2C C;  3NHH A;  4PV1 C;  5C4J B;  1ZXT A;  1ET9 A;  2RSO A;  3PUY A;  3A55 A;  2F0W A;  4KHZ A;  4XXE A;  4LAA A;  1EU4 A;  2A73 B;  1Y1W B;  4BY1 B;  1BOS A;  3Q22 A;  1B44 D;  2PCF B;  4XT3 B;  1S4Z A;  4FVM A;  3A8J E;  2RKS A;  4C56 C;  5E1F A;  1O7L A;  2RDG A;  3PUX A;  1FNV A;  1JOR A;  4O42 A;  1EY5 A;  5JEA J;  3L9A X;  2FFK B;  2WKD A;  5FO8 B;  4C3J G;  3S1Q B;  4C1N K;  4WRD A;  1TWA B;  3G7L A;  3I4M B;  1SNQ A;  3Q24 A;  3DEP A;  1HHV A;  2NZ1 D;  2SDF A;  4RGM A;  5DAU A;  4ABN A;  4FF4 A;  3Q6S A;  3GV3 A;  4IUQ A;  4B08 A;  3W2D A;  1O7Z A;  1G6Z A;  5ELD A;  3TBI B;  2F0J A;  2L4N A;  3R2I A;  4FNF A;  1D5X C;  2AWO A;  4XQN A;  2DNC A;  4O1N A;  3BVG A;  1E2V A;  1GOZ A;  2E75 C;  1DOL A;  4E6I A;  1JC7 A;  2BOS A;  2B2V C;  4RCN A;  3H3V C;  3NP8 A;  3E0J A;  3N6R A;  4OIK A;  4WOR A;  3M7N A;  3NXW A;  5D65 A;  1B9N A;  4HSV A;  4RGO S;  2A5H A;  1UEA B;  2IX0 A;  3SK4 A;  1JOQ A;  1NR4 A;  2F3V A;  3MXP A;  5IGB A;  1HCZ A;  2BE5 D;  1VF7 A;  5IGF A;  2NB0 A;  1K8M A;  1XTC D;  1SMY C;  2F0I A;  1CHP D;  1BCP B;  1Y8P B;  3OHX C;  2IW3 A;  2BCO A;  1KDA A;  1LV9 A;  4ZKC B;  3SE0 A;  3MHB A;  3SK6 A;  3I3C A;  1RF2 D;  1W6J A;  1WTO A;  2I46 A;  2HCC A;  4H7B A;  1I50 B;  3NQI A;  2CW0 C;  2CVR A;  1QNU A;  4BA2 I;  1A2T A;  3E5S A;  2L55 A;  1QE6 A;  5ELB A;  2CQA A;  3CRL C;  4JBW A;  3MA2 B;  1PZJ D;  3GP7 A;  2YYZ A;  5CV7 A;  4DA2 A;  3KF8 A;  1B4O A;  3DXJ C;  2E2H B;  3VR2 A;  1BF4 A;  3PMF A;  2PZW A;  2E2I B;  1PTO C;  2PQE A;  4RGT A;  4Z9C B;  4V0B A;  3I91 A;  4IUP A;  2EJF C;  4XQJ A;  2QIL A;  4X3K A;  1DCZ A;  1I3Q B;  1CQV A;  1V43 A;  3SR1 A;  4C3J B;  3OIQ A;  5C3W A;  3KLS X;  2N55 A;  3TZU A;  3GTK B;  5EPJ A;  4TRD A;  2A69 D;  2F0Q A;  4F7X A;  1B1Z A;  3U9O A;  1TT2 A;  5D14 A;  3DEO A;  5IT9 E;  2JA8 B;  2B2T A;  3VR4 A;  1WTW A;  3V96 A;  1BR9 A;  3LX0 A;  3V2T A;  1WTQ A;  1HFG A;  1DOK A;  3P20 A;  2B2W A;  3GTM B;  4CHT B;  3OOC A;  4KMU C;  1TWH B;  5JAV A;  2N88 A;  5T1I A;  2MJ8 A;  3J80 L;  2O5I C;  1Z6H A;  4Q0F A;  2C5C A;  1LTS D;  1Q90 A;  2KJX A;  4R8N A;  5C3E B;  3S1M B;  2XSC A;  1SNO A;  2F0N A;  2YU9 B;  4HAE A;  2K01 A;  4ZQ3 A;  1IW7 C;  1SDF A;  4IZ8 A;  3BS1 A;  1GUO A;  2KOL A;  3BDC A;  2NN6 G;  1PTO F;  5JVG 3;  2LFN A;  1SXT A;  4H13 C;  2HUG A;  1NSN S;  1ESR A;  1HTL D;  1X3Q A;  2H1E A;  1TY0 A;  4K2L A;  1B53 A;  3PO3 B;  1STH A;  1ILQ A;  1TVX A;  1WTV A;  1S5C D;  1STE A;  3NWS A;  1F2Z A;  1BXT A;  3VYT A;  1CTM A;  4DAV A;  1STG A;  3QWN A;  3IFD A;  4DGZ A;  2QF7 A;  2AUJ D;  2BDO A;  3RLF A;  5JPN C;  1CFM A;  3EJI A;  4HMI A;  4KTA A;  5LL6 X;  4PMB A;  3LWU A;  1S5B D;  3GTJ B;  1BCP D;  4KKS A;  2EDG A;  2R6G A;  2KA7 A;  1NR2 A;  1J8I A;  2ICE C;  2ENB A;  3K5N A;  4GZY C;  3E6Z X;  1PDQ A;  1TS2 A;  4XTC S;  1B2T A;  3FKI B;  1WVL A;  1YNJ D;  5CYU A;  1CK1 A;  2NVQ B;  3HEJ A;  4A3B B;  4PMC A;  4UDU C;  1Y8O B;  3W3A A;  2KED A;  4H0L C;  4XYQ A;  1SYF A;  1DJR D;  2AQ3 B;  5ISR A;  1SYC A;  2A6H C;  1SE3 A;  5IGE A;  1QNK A;  4EQP A;  4OO1 H;  4QF4 A;  5CR3 A;  1GUG A;  2L11 A;  1DZ1 A;  1T5E A;  1CZG A;  3NQT A;  2NBF A;  4J1M A;  4CKC A;  4RGN A;  1V1O A;  1JR0 D;  2IPK D;  4DXF A;  5FO9 B;  5I9P A;  1L0Y B;  2Z8L A;  4KD4 A;  3OWF A;  1I6V C;  1NCV A;  1EIG A;  3R93 A;  4A3E B;  2LMC B;  1HQM C;  3HP3 A;  2QDB A;  1KNA A;  4ZLT F;  1EOT A;  4CJ1 B;  2K28 A;  1LT6 D;  2AUK A;  4KK7 A;  3MWY W;  3C1F A;  2WP8 J;  2NVT B;  4RA8 A;  3P1H A;  1U4R A;  2F1M A;  4DNT B;  3FDT A;  1Q12 A;  2PZU A;  3ITP A;  1C48 A;  3Q23 A;  1QJO A;  2ZT9 C;  3HOZ B;  1RKN A;  5M3M B;  3T51 B;  3EA6 A;  4N9P A;  4RFB A;  1QIL A;  3IFT A;  1CA6 A;  1DYQ A;  1YNN C;  3NK9 A;  1LT3 D;  1FYC A;  2F0S A;  5ELC A;  2VB3 X;  1PYW D;  3GQB A;  3TP6 A;  3UI2 A;  2NN6 I;  2Y0S B;  1NAP A;  1C8C A;  1EL0 A;  2L12 A;  1H9S B;  1RJT A;  4HSP A;  3X3N A;  2JA5 B;  2QEJ C;  3D6W A;  1EYA A;  2PYK A;  4KD3 A;  2KEE A;  2VXW A;  5DNF A;  1RCV D;  4RKL A;  1BO0 A;  1SYG A;  2SEB D;  5M5X B;  2IX3 A;  2EXZ A;  3KK7 A;  2A74 C;  3NSW A;  4C1N I;  3EVQ A;  4L6T B;  1XWE A;  3I4L A;  1EZ8 A;  2IL8 A;  1VDZ A;  1I4Q A;  4TQU S;  3IL8 A;  5CV9 A;  1PRT C;  2K1B A;  4RHS A;  1ROD A;  3H09 A;  1W6K A;  1S5D D;  3QOL A;  1TS4 A;  4QIW B;  2ZXP A;  2E76 C;  3EFX D;  4G57 A;  1Y69 U;  2KEC A;  1PFB A;  2K7V A;  3C3L A;  1H9K A;  2JP1 A;  2EZV A;  3PUV A;  3QG1 A;  1UAP A;  2HDM A;  2FMC A;  1KTK A;  1GHJ A;  3HOU B;  3MTS A;  4KN4 C;  2Q8T A;  5G3L F;  1O78 A;  4K2K A;  1OXT A;  4LMQ D;  1HUM A;  4G4K A;  4S3S A;  3NTH A;  3C1E A;  1WTR A;  3FPP A;  1EY0 A;  1JWS D;  5C0X J;  3T56 B;  5D3D A;  2JE6 I;  3GTQ B;  4A3G B;  3AMU A;  3J80 E;  5A2Q L;  2DNE A;  2FHT A;  1F9Q A;  3NPP A;  1F9R A;  1JOO A;  3T13 A;  1SND A;  1PMR A;  3VYU A;  4F8M A;  1QG7 A;  4ME5 A;  1CZW A;  1AW7 A;  4ZAI A;  2BA0 A;  2O2L D;  1Q3L A;  2G9H D;  2F0M A;  1K83 B;  2F0F A;  1PRT F;  3JAM L;  5C6A A;  1EQV A;  4YIJ A;  5BN3 A;  4A3K B;  2C9O A;  1PXU A;  4KJN A;  2GA4 B;  5IGG A;  4QMG A;  5C0X G;  1F2L A;  2F0D A;  2K6A A;  4QCL A;  1A3V A;  5JEA G;  2XWB B;  2ZXO A;  4FF3 A;  5COR A;  1ESF A;  2D62 A;  2F3W A;  3BZD B;  5IOD A;  3J7A V;  3H0G B;  1DOM A;  2CW0 D;  1AEX A;  5CV8 A;  5T1G A;  1ICW A;  1C4Q A;  3CQZ B;  2OXP A;  4DK1 A;  3F2U A;  2A6E C;  3TDQ A;  5EBC A;  2V4D A;  3I4N B;  3WOF A;  5HUR A;  1SSO A;  3P7J A;  1EYD A;  1PTO D;  2L0C A;  3M4O B;  4K5X A;  1I4P A;  2F03 A;  1TWF B;  3HOX B;  1IHZ A;  2K5W A;  5EKI A;  4B9W A;  4TSS A;  4AYB B;  3P75 A;  1SJH D;  4MN3 A;  3D4D A;  1CA5 A;  3A54 A;  4Q5V A;  5KRU A;  5BN4 A;  3MXU A;  5IOC A;  1TWC B;  5EPL A;  1Z7T A;  1G29 1;  2MHV A;  4QUC A;  5KNB A;  2PO4 A;  1XXG A;  1SNM A;  1G2S A;  4K8I A;  3K6O A;  4RAU C;  3MFY A;  4X3U A;  3AU7 A;  2JSO A;  4KN7 C;  3TME A;  2EOT A;  4ZRZ A;  2B2V A;  4QUF A;  1D6E C;  2OF1 A;  2KHS A;  2PNR C;  3OSO A;  4JK1 C;  3RUZ A;  5ELE A;  3SK8 A;  2CHB D;  4BBR B;  1VMC A;  3VR5 A;  1LTA D;  4FXD A;  2HCI A;  3HKZ B;  3RMH A;  4ODG A;  4RWS C;  1BBX C;  3FMC A;  1HXY D;  3SVM A;  4XDX A;  4HR7 B;  4LK1 C;  3I8Z A;  3QIA A;  4DU9 A;  3GTL B;  1IW7 D;  3NWT A;  4DK0 A;  2IWH A;  1LO5 D;  2M9V A;  1KDB A;  4FO2 A;  3K59 A;  4IN3 A;  4ID6 A;  3T16 A;  1JWU D;  3SXH A;  2RDF A;  1FR3 A;  4F87 A;  3S1N B;  2B8F A;  4NW2 A;  3S15 B;  2WAC A;  1GUT A;  1TS5 A;  1STA A;  4RHR A;  1PZI D;  3J81 L;  2F0L A;  4FYD A;  1LTR D;  2E2D C;  3S14 B;  1H9S A;  5C0X I;  5C4H A;  3WOE A;  2OEO A;  5BN5 A;  4KV6 A;  2NVX B;  3GTP B;  4N9T A;  1CQF A;  2XIW A;  1J9O A;  5CBE E;  1A15 A;  1HPC A;  3D4R A;  5K5P A;  4OGQ C;  3KLS A;  1LTB D;  2XRQ D;  2K5Q A;  2F0K A;  3RZD B;  2VUM B;  1B9M A;  2R7Z B;  1GJX A;  5EKK A;  1ZEQ X;  4K5V A;  1IL8 A;  1DXM A;  3QJY A;  3GTO B;  1SNP A;  4DFA A;  4M8A A;  4BA1 I;  2A6H D;  3BVZ A;  3R8B A;  5I6W A;  1EY7 A;  2XRS D;  3DUZ A;  2NN6 H;  4R9W A;  1EU3 A;  1A6X A;  2F0U A;  1R9T B;  1WD0 A;  5JOB A;  3VYR A;  1A2U A;  2B39 A;  1O7Y A;  2NVY B;  4DXG A;  1CM9 A;  2KQ3 A;  1MSH A;  5C44 B;  1U4L A;  3J7A F;  1Z47 A;  4IUN A;  3HG9 A;  4IUR A;  3PIP 3;  3PUW A;  4NDX A;  5KIX A;  4BY7 B;  3VYS A;  5IGD A;  3D4W A;  2Q8R E;  5KGU A;  1F2Y A;  3AB9 A;  5FK9 C;  3PUZ A;  1WTP A;  1SNC A;  1L0X B;  5FLX L;  5DM7 3;  5EPK A;  4G7O C;  2F0P A;  1A3T A;  2EYO A;  1MBY A;  1SE2 A;  1OXX K;  3HRZ C;  1OXV A;  2R92 B;  4M1U B;  5FKA C;  4OIJ A;  3MAQ A;  1AP0 A;  5K36 G;  5A2Q E;  1Q1B A;  1QWY A;  1DON A;  2K04 A;  4QB4 A;  4A3F B;  1Y8N B;  4L63 B;  1G8Z D;  1LTI D;  1RTN A;  1TR5 A;  2BA1 A;  5DEH A;  2I07 B;  4IAL A;  3V05 A;  3D3R A;  1YNN D;  2HQE A;  1H9R A;  4XT1 B;  3K0Y A;  5DM6 3;  2B2Y C;  1I4X A;  3EQL C;  1SYB A;  3BYT B;  1M8A A;  1I4R A;  1EEF D;  2RDH A;  4G7Z C;  1H9J A;  1ENF A;  4OHJ A;  2K33 A;  4NKL A;  1EY4 A;  4IQZ A;  1KNE A;  5J22 A;  4IFD J;  2B8G A;  3OWE B;  2A68 C;  2F0T A;  4HTH A;  1WD1 A;  5K36 H;  1D1K A;  1AFP A;  4RKB A;  2X6G A;  1JWM D;  3SK5 A;  2LKV A;  1ZYR C;  4U67 3;  3SDZ A;  3A7L A;  4NP5 A;  1SEB D;  4L8J A;  3I70 A;  3OIP A;  4EGV A;  1ML0 D;  3I90 A;  5E3F A;  3A8I E;  2EYH A;  3WDN A;  1PTO B;  2KUM A;  2FMM A;  2O5J C;  3GV6 A;  1D2B A;  5ELF A;  3NE5 B;  1HFN A;  1SBB B;  1GUW A;  1PRT D;  3VA5 A;  1ZKO A;  1PLF A;  5CC4 A;  1A3U A;  1TQO A;  1SE4 A;  3C2P A;  2JXM B;  5EKL A;  3CU7 A;  3HS0 C;  2Z4H A;  3KUP A;  3BG3 A;  3K58 A;  1GHK A;  3TP5 A;  4IFD G;  3PV0 A;  1BCP F;  5M9O A;  1TII D;  3NBI A;  1MD2 D;  1SJE D;  2K32 A;  1JCK B;  2L9H A;  2PW5 A;  3URY A;  1FD7 D;  1KDC A;  2F4I A;  5IGC A;  2K05 A;  4OO1 I;  3BYY B;  5C5L A;  2R61 A;  2RVL A;  3DWP A;  3NTK A;  4IUT A;  1VF5 C;  3H6M A;  5TSS A;  3DHQ A;  5M5Y B;  1PZK D;  3D8G A;  4KY6 A;  1EQT A;  4RCO A;  2KCC A;  3TZD A;  3K5M A;  2Z4I A;  4BS9 A;  1RHP A;  4C3I G;  2ZXR A;  4H44 C;  5EBD A;  1RDP D;  1T5X D;  3ND8 A;  1GUN A;  3R3O A;  4MHE A;  4A3I B;  4A3D B;  5I9O A;  2MPM A;  1HUN A;  4A3J B;  3X3M A;  2JA6 B;  3S9W A;  4J6H A;  1IKL A;  1EFI D;  1KAB A;  1TKW B;  3I73 A;  2JA7 B;  1STY A;  2X6L A;  1XX8 A;  4NMZ A;  1WTX A;  4RH6 A;  2EY6 A;  1E2Z A;  1KLU D;  3QO2 A;  3LNN A;  1EY9 A;  1EWH A;  1SYE A;  1IYV A;  2WV6 D;  1WCM B;  5LHY 1;  3CKI B;  2J7Z A;  1DM0 B;  4HCS A;  2AWN A;  2XNA C;  5JVH 3;  1MI2 A;  2K5D A;  4PNY A;  3HOY B;  1F9S A;  3QOJ A;  1AZP A;  3C46 A;  3M7G A;  5KEE A;  4FF2 A;  3J81 E;  1XYI A;  1EYC A;  4K6L A;  4C2M B;  4G7H C;  2R3Z A;  1QOH A;  3MXG A;  3M3Y B;  2A6E D;  3S1R B;  1SMY D;  2ID0 A;  2D9U A;  4WFN 3;  5HGT A;  2B63 B;  2ICI A;  1MGS A;  1LAB A;  2VB2 X;  3HGB A;  1ET6 A;  4I7Z C;  3A7A B;  4ZUJ A;  3MXN A;  1LTG D;  2WIN B;  2Q8I B;  2NWG A;  3J7Y W;  5NUC A;  1K8O A;  4DF7 A;  4PQX A;  5D3I B;  5A35 A;  4EQN A;  1X3P A;  3SHL A;  3HOW B;  1HA5 A;  3NUC A;  2M00 A;  1I4H A;  1KAA A;  1G91 A;  2B2U C;  2B2T C;  1STN A;  2H4O A;  4C3I B;  5EGT A;  4IFD I;  3OW7 A;  3NBH A;  3MZ5 A;  4HED A;  4EQO A;  1IKM A;  1LTT D;  3PIO 3;  1VCI A;  4IUV A;  1BNZ A;  4BBS B;  2B2W C;  5E4W C;  5C0X H;  3DMU A;  3OMG A;  5JEA H;  1D5Z C;  2LY7 A;  3L7Z C;  4HN7 A;  1S5E D;  4P2C B;  2SOB A;  3RD4 A;  1HA6 A;  2SNS A;  3GD7 A;  5M5W B;  2BE5 C;  3GTG B;  5C5M A;  5FLX E;  3L3O C;  3OMC A;  3VR3 A;  1HRJ A;  4PMW A;  5FO7 B;  4EVO A;  4TKO B;  4V19 0;  2F0O A;  1FGB D;  2IJ0 A;  1S5F D;  1OO9 B;  4CKB A;  4KY7 A;  2MGS A;  2EY1 A;  1OXU A;  2EJM A;  2NTS A;  3KBX A;  5KYI A;  4CJ0 B;  3S2D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...