5IT9L

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
155
structure length
155
Chain Sequence
STELTVQSERAFQKQPHIFTNPKAKANRKTKRWYKNVGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTRMHRTIVIRRDYLHYVPKYNRYEKRHKNVPAHVSPAFRVQVGDIVTVGQCRPISKTVRFNVLKVASATGKANKQFAKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
molecule keywords Ribosomal protein uS2
total genus 19
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00366 Ribosomal_S17 Ribosomal protein S17
L PF16205 Ribosomal_S17_N Ribosomal_S17 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1000 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5it9L00
5A2QL 5FLXL 3J7AV 3JAML 3J81L 5IT9L 3J80L 5LL6X
chains in the Genus database with same CATH superfamily
5IP9H 5CMDA 5BN5A 2O5IC 2K7VA 4CDDC 4I7AA 1L0XB 2E2HH 1QNKA 4OWTB 4FF1A 1JT8A 2BE5D 1VQ4A 5IGBA 4ME5A 2WINB 3S2DB 1HZCA 2QF7A 5JPNC 3STBC 5FLMH 5G3LF 2IX0A 1CM9A 5KNDA 1WJJA 2Z9HA 5D14A 5K36G 1PDQA 1QE6A 1PV4A 5C44G 4QL5A 1KRTA 1I4RA 3BVGA 4A76A 1TS3A 1GO3E 2AHOB 5C3EB 1D1IA 4DXGA 3OTOQ 4B3SL 1VQKA 4YY3L 3GTOB 2QDBA 2UXDL 3T1YQ 1BOSA 2IX3A 1OXTA 4MZ9A 1EYDA 4TKOB 4DUYL 2UXBQ 1MGSA 2J4XA 3CC4A 2RSOA 1CSPA 2CW0D 4R4QA 4ID6A 4CKBA 2EOTA 3STBD 1DOLA 1CT1D 1LTSD 4DK6C 1NJIC 3MXGA 2AQ1B 3PUWA 4Q0FA 4O42A 3I4OA 4A3KH 5A2QE 1QVGA 2AKWB 1S5BD 3P7JA 4RGTA 3SK5A 2A1AA 3T51B 4HCSA 3J81E 1SN8A 3CAMA 2B2YC 3JC66 4DV0L 1VDZA 4FVMA 1FD7D 3GTLH 2YU9B 4A3GG 1ENFA 1U0LA 1QNUA 5CV7A 3JAMi 1EEFD 1HZBA 5C3EG 1C7YA 2L55A 1T9HA 4DV1Q 2PQEA 3MXUA 3V2TA 1STBA 3M4PA 2F3WA 3GTKH 2UUBL 1CA5A 3NSWA 1SBBB 5A2QL 4GN3B 1IYUA 1KDAA 4KLKA 2K28A 4LUOA 3FVQA 5JJZA 3RUZA 1WTQA 1MHWC 3I7FA 1NMGA 5BN3A 4NXNL 2Y0SB 3AQQA 1PH3A 1HUMA 3D0FA 1YI2A 2RCNA 4G7OC 5IYCG 1S40A 3E0EA 1XX8A 1KLUD 2OQ0A 3OHXC 5M3FH 3A56A 3MC0B 2YTVA 4A3KB 2KHSA 1TWAH 1RHPA 4A75A 1PFNA 1I50B 1JORA 1SXTA 2WKCA 2OF1A 2UUCL 4LF9Q 3ER0A 3OW7A 5JEAJ 4K6DA 3HZXA 2K5VA 2B8FA 2F0NA 4OL7A 2A8VA 4KN4C 1VQ9A 3LGJA 5C3EH 4HR7B 3JAML 1KQSA 1WFQA 1Y1VG 2R7ZG 4GKJL 1ZEQX 4A3LG 1VMCA 3T4AC 1K8GA 1U5KA 4X65Q 2WFWA 1FGBD 1EL0A 2LS01 3CRLC 1J5EQ 2NVYH 2R7ZB 1B50A 1CK1A 2KEDA 2KENA 1HR0Q 3HP3A 2JA9A 5D3IB 4DV4Q 3CRKC 4O2DA 4OIJA 2NVQB 4X64L 3D6WA 4HTHA 5KGUA 1ZXTA 4IFDH 2OWOA 2ZXOA 3BYYB 4IPGA 2AMCB 2K5NA 3OW2A 5BR8Q 2R92G 1LUZA 1XNRL 4DR4Q 1GVPA 2GN5A 2VZAA 3T1YL 4POGA 1PRTB 3S1RH 3QJYA 1BUVT 5CR3A 3H3VH 1TWGH 3CF5A 4BBSB 2D5DA 3NBIA 1EIGA 4TQUS 3T56B 4A3DB 5FKAC 2BDNA 1U4LA 4DR7L 3VDYA 2B8GA 1TWCB 1DOMA 3K0YA 4IZ8A 1TS5A 2EYFA 1A2TA 1EY5A 3J81i 4CGYB 2KCCA 1N32L 2MHVA 3HOVB 3F2BA 2MP1A 4FXGC 5KEEA 3BG3A 2DJFC 2NBFA 1IBMQ 3VA7A 3FDTA 4HIOA 4BBRG 1G8ZD 2JE6I 4K5XA 2HDLA 5M5WH 4MTKA 3GTKB 5C0XH 3NELA 4ZK9B 4O0AA 4IOAA 1UEBA 4DUZL 4QY7A 1D5ZC 3ERQA 1V1PA 1PYBA 1JE4A 1Z7TA 2VQFQ 1EY7A 1JB7A 3PIO3 4PZ7A 3E6ZX 1JMCA 5AJ3Q 3SVMA 1KD1C 5I6YA 2Q2IA 2ID0A 3CC2A 3DXJC 1GUSA 3DUZA 4OIKA 4GOPA 1I3QB 3MFGA 3H6MA 4GLXA 3VR2A 3PUVA 1B3QA 4K2LA 4JI7L 4CJ2C 3PIOA 1YZ6A 3BDCA 3UE1A 1N9WA 4YWKA 2PI2A 3EN2A 4BY7H 5LMUL 1PH2A 1YIJA 1SYBA 2JK8A 3EIVA 1JICA 2Q8IB 3RLOA 1R4PB 1K9MC 4JI2L 3UDGA 1ILQA 1NMFA 3NPPA 2L15A 1DYQA 1JR0D 2UUAL 4BWGB 5C3XA 5C0XJ 1PTOC 1PYWD 4CJ1B 2NN6H 1GM5A 3ZYYX 1EIFA 1PA6A 1SYGA 1OTCA 1FR3A 3P1HA 4LWCA 1SMYC 2R61A 3K5NA 4A3CH 4B3RQ 4CJ0B 2PZUA 4CHTB 1HNZL 3H15A 3G71A 1QVCA 5ELCA 4ZKBB 5CV4A 3K5LA 1Y8NB 3BVMA 4DR3Q 2WAQE 2JQOA 3E5SA 4JI8Q 1MSHA 4NDXA 3MXPA 2K4KA 4IFDJ 2HT1A 5I2YA 1TQOA 4X3TA 2MNAA 2UXDQ 3KF6A 2K32A 2NZOA 1PZJD 2B2VA 2PMZB 1AZPA 1DJRD 1B1ZA 3I4MB 3LWUA 2CCZA 5CBEE 1KIXA 2EY6A 3L0OA 4R4CA 2R93B 1EUJA 4GN4B 2YV5A 3DWPA 3HOXH 1X55A 2JEAI 1WI5A 1EQRA 2NVTH 4NB3A 4POFA 5IP7H 1GD7A 4CKEA 4JCVE 2RF4A 1DM0B 1CUKA 2N88A 4RMFA 3VYUA 2VNUD 1YVCA 4QUCA 2EYOA 1EYGA 1LV9A 3G4SA 2RCFA 2OQKA 3MXNB 1Q46A 3H91A 1HNWL 1HXYD 4JW0A 4DK1A 1YNJC 2Y0SG 3EFXD 4S3SA 1EWIA 3PO3G 4Y7NH 3GTGH 1QUQA 3KLRA 1OO9B 3HOYB 1N33Q 4WORA 4J15A 3X3NA 1W6JA 1VF5C 3I56A 2F0PA 4GKJQ 1ET6A 2K6AA 4FXKC 4IUUA 2EJGC 1EYAA 4BY7B 1JCKB 5FJ8G 1X3FA 3CCRA 2AQ2B 4X3KA 1PH1A 1PFBA 1EIYB 3W1GA 2NVTB 4DUZQ 3PO2B 4HSPA 4EGVA 5M5YH 5IP7G 3SK6A 2CH4W 4YHHL 1Y1WG 4KTAA 4NMZA 1Q86C 2F4VL 3TMEA 2VQFL 4CBVA 1WTVA 1XMOQ 1CKOA 3AU7A 1U4RA 5ELNA 1I6HB 3KDFA 2IW3A 3DHQA 5HGTA 5IP9G 4X62L 2F03A 2E76C 1STAA 1SE3A 3FHWA 4UP8A 4WRDA 4GNXB 3HOYG 1NR4A 2I07B 4JC0A 2PQAA 4A3JH 1EFID 4U673 1O80A 2NTSA 3KUPA 4JOIC 4LF7Q 5IGFA 5KYIA 3JAMc 1NR2A 4X66Q 1SMXA 2F0IA 2OT2A 3J81j 4F7XA 1TU2B 1XMQL 5TSSA 4YY3Q 2I5LX 1NSNS 4UDUC 3NTIA 5I9PA 3GTJB 1H9MA 1E2VA 4CDFC 3P20A 5C4XG 1PFMA 4KKUA 1B8AA 2EY5A 2IL8A 3OIPA 3ERSX 2DJGC 1SFOH 4ME3A 4MN3A 1TWCH 5E4XA 2K1BA 5FLXL 1EZ6A 2JEBI 4DAPA 5D65A 2OCEA 2A68D 3O13A 4LK1C 4LW1A 1SSOA 3GTJH 1PH6A 4L5SA 3SE0A 1MI2A 5KRUA 1B2TA 1STHA 1KL9A 1LT4D 4PQXA 5JAVA 3PUYA 5GAGC 3QG1A 2JYOA 2G5DA 3M4QA 4DV0Q 3RZOH 1XPRA 1N8RC 2I5HA 2VUMH 2A6HD 1FNVA 1CA6A 1A6XA 3SK4A 4A3FB 3W5OA 2MUYA 2E74C 3WDNA 4BY1H 1F2ZA 3RNUA 3TEHB 3Q0AA 3ICEA 3I90A 3H0GH 3GTPH 3Q22A 4KHPL 4KK7A 5FLMG 1BVSA 1XNQL 4RG1A 2SDFA 4PMCA 4NXML 3EQLC 4KY6A 2XWBB 5JJIA 3NXWA 1U4PA 4R8IA 3HFZB 4C3IG 2JA6G 3S17H 3ULPA 5JJLA 3D31A 4BA1I 2EVBA 3BS1A 1IZ6A 2Q2UA 4A3MG 2EJMA 1Y69U 2F0GA 2GA4B 4XXEA 3FPPA 1YHAA 3BZCA 2JA6H 3CKIB 3GO5A 5ELFA 1TVXA 3D6CA 4FDBA 4XQNA 1ONLA 5EPJA 3MTSA 3J81L 3S15H 3I70A 3G7LA 1WTRA 3MAQA 1HCZA 1W6KA 1VS0A 3VYRA 1LTRD 1ML0D 1X6OA 1WCMG 1H9JA 1SNPA 2EZVA 3HG9A 2HQLA 2F0TA 4KKSA 2UUBQ 3OOCA 3OTOL 4Q5VA 4B3SQ 4K5VA 4FNFA 4ULLA 5GROA 2AWOA 4L6TB 5DAUA 3V05A 1AZQA 1BQQT 4IQZA 4R4IA 1II3A 2RDHA 2GVBA 2VS1A 4A3GB 2B2WA 3S1MB 4C2MB 4JI1Q 3N52A 3A5UA 3RR5A 3R2IA 4MNOA 1YHBA 2RSNA 5C6AA 1SAPA 4BA2I 2OTLA 2X6LA 1DD2A 1SROA 2A6HC 4F88A 1QOHA 1Q12A 3F8TA 2B63H 1IL2A 5KNCA 5ISRA 3BDLA 1K83B 1MBYA 2L5TA 3K7AB 4DR3L 2EJFC 1O78A 2JA5G 4Z9CB 5EBDA 2JSOA 5DNFA 1UWVA 1Q3LA 3E3XA 4IJHA 1QUQB 2F0JA 2R7FA 4WJ4A 4LF9L 1JC7A 2AUKA 5C4HA 5IYCH 4KHPQ 2NUCA 3OSOA 4XT1B 4DV2Q 1S3OA 1JWMD 4MIUA 2X69A 4AQYL 4DUYQ 2UXBL 4A3EB 1ESFA 2QDLA 1A3VA 5C44B 1VQIA 3PV0A 5IWAL 2KEEA 4I7ZC 1B3AA 5JPMC 2EYMA 1X9NA 1SE4A 3BYTB 1BF4A 4YWMA 3NP8A 4HIMA 4J8QA 3M4OH 3QOLA 4ZUIA 5EPKA 3ND9A 2CVRA 2D0OA 2HUGA 3S16B 4HJ5A 4HJ7A 2C9OA 2CQOA 2EXDA 1GJXA 4HEDA 1FNWA 2Z6KC 2PW5A 3C3LA 4A3FH 5KYLA 1J6QA 3VYTA 1EU4A 1BBUA 5FK9C 2F0DA 4KV6A 3I4NB 5I9OA 4JI3L 4HN7A 1LTID 1HFNA 4JOIA 3SDZA 3HKZE 4HMIA 1KXLA 3S16H 4DFAA 1V1OA 4LUVA 4OWWB 3QO2A 3E9IA 1QZHA 1RL2A 3K5OA 1FVIA 4A3JB 3M7NA 1O7IA 1D5MC 3OWFA 1WTOA 2RHSB 5EKIA 2FMCA 1YEZA 1OXXK 1VCIA 3MHBA 4DR7Q 3UI2A 3WOEA 2ZM6Q 5C44H 3BZDB 2JA5B 3VR3A 5AFWA 4OONA 4HMJA 1STEA 3N6RA 1FNUA 2Z6KA 5E4WC 3GDEA 3K81C 1B9MA 3ND8A 5GADC 3CC7A 4J1MA 3A8IE 1QVFA 2UU9Q 5IYBG 1BCPC 2KQ3A 2B2UC 1K8OA 2MQHA 5NUCA 1Z6HA 2EQSA 2ES2A 2E5LL 4EX5A 3BDOA 3H94A 2LXJA 2TMPA 3GV3A 4BXXH 4DV7L 5DLQE 1ASZA 3D4WA 4XQQA 3S14H 2OEOA 4DA2A 3U4VA 1PH5A 3EVQA 2YYZA 4BBRB 1UE1A 3TSSA 1KHIA 2NVYB 5ELOA 2F0QA 3BZKA 2E2HB 1YBYA 5EKLA 4NP5A 1KDCA 3HGBA 1E1TA 5JJKA 2HCIA 1U4MA 1XNQQ 1JE5A 4LF8L 4K0KQ 2ALYB 3A7AB 1G6PA 3TZUA 1H95A 4NXMQ 4QIWB 3RLNA 4ZCKA 3J80i 4JBWA 5IGDA 4LF5L 1GUNA 2HIXA 4B3RL 2RDFA 4X64Q 2Z6BA 1SFOB 3M4OB 2HHHQ 5JEAH 5ELEA 4GS3A 1QG7A 2HQEA 1TWGB 2EYJA 3FEWX 1JOOA 2ENBA 4ILWA 4F87A 5IODA 2ZJPA 1Y1WH 4PZ6A 1W2BA 1XTDA 4RGMA 2VUMG 4DAYB 4DK0A 3S1QB 3GP7A 3IKJA 1SYDA 2XRQD 2V4DA 4JBMA 3C1FA 1Q8KA 3NHHA 2JA8B 1XMQQ 3GD7A 1LT6D 1QJOA 4GOPB 3C2PA 2DY7A 5DEHA 4DNTB 3SXHA 3S14B 2Z1CA 3SK8A 3U58A 4RKBA 3Q23A 1IHZA 1C9OA 1Y1WB 2E2JH 1QCBD 4HSVA 3S1QH 5IYDG 2HIVA 2JN4A 2BDOA 4PV1C 3HOWB 5FO9B 2QEXA 4RWSC 4UY8C 3TQYA 5CYUA 3RMHA 4H44C 3GV6A 2K05A 2I46A 4E6IA 5K36H 3UE0A 5KNBA 4IURA 3FRPB 2CQAA 2NWGA 4A3GH 2N55A 1H9SB 1HNXQ 2WIIB 4H02A 1E1OA 3PO3B 1PRTD 1KAWA 4MTNA 3W2DA 2F4VQ 1XNRQ 1O7YA 5T1IA 2JA7H 4DV7Q 3HOZH 3U9OA 4IUTA 3F1ZA 1XJVA 5C4XB 3KBGA 4L5TA 4JVZA 1GUTA 1SNMA 4A3BB 2JA6B 4ODGA 3DMUA 4RA8A 4GOPC 2NZHA 2DN8A 1WYDA 3FKIG 1SYFA 5EQ0A 4HIDA 3QWNA 4AQYQ 4DNRB 1G291 5C4JB 1RTOA 3NE5B 4NW2A 5M5XH 4GNXC 4Y52H 3KF8A 4C3JB 3AFQA 3L2PA 2R93G 4LFBL 5D3DA 1I5FA 1SNOA 3U50C 3T1HL 4P2CB 1STYA 4IUVA 1NBWA 5FLXc 3J80c 1TWFB 4BY1G 1DCZA 4JYAQ 4DN4M 2UXCQ 1K0SA 4TRDA 1TT2A 1Q1BA 2EYPA 5IOCA 1ZYRD 1TWHH 3GTQH 4QB4A 4C1NI 4QJFA 2XTIA 4DV4L 1C48A 3K8AA 1JOKA 3IFDA 2R6GA 1XWEA 4LNQA 1VF7A 4X6AH 1HA6A 4A3MH 1TWFH 4B3MQ 3T53B 4A3LH 1RCVD 3KJPA 4DR2L 2G9HD 3W3AA 4IPHA 3PUXA 2JA5H 1LYLA 4LUZA 4A3BH 5FOBB 4X66L 1BBWA 3FP9A 3S1RB 4OO1G 4BBSH 2A6EC 5BN4A 1JWSD 2L0CA 2F0EA 5E3FA 4ZUJA 1LTLA 1NUCA 1KLGD 3R2TA 1EFWA 2Q8TA 4B08A 4JV5Q 2YTYA 4K2KA 1EOTA 4RAUC 4OO1H 1LT3D 4BBSG 2ZTDA 2NVXB 4ZLTF 1F2MA 4X3UA 4GLVB 2A69C 1PMRA 2H4OA 3MA2B 3GQBA 3KBXA 4A93G 1HNWQ 2XGTA 1VQEA 3S24A 2SNSA 1O7LA 5IE8A 1TXYA 1PH7A 3A54A 1MSGA 3SGIA 2KCTA 2CWAA 2B39A 1K3BC 1UE5A 4KD4A 2NN6G 5C3WA 5CV6A 3IRBA 2CFMA 4DV3Q 3CU7A 1HRJA 4CDEC 4G57A 4HAEA 1B9NA 2ZM6L 1HTPA 2RQXA 2DGYA 5M5XB 2SOBA 2ATWA 3I55A 1V43A 4EQPA 5GAHC 1G91A 2WAQG 3P75A 5EAYA 1I6HH 2B2TC 1SYCA 2AQ3B 4GKKL 1VQJA 2QGQA 3I73A 4XIGS 1K3RA 3K57A 2XNAC 2AUJD 2KA7A 3J7AV 2H1EA 2QKIC 4OGQC 1S72A 1G2TA 3PUZA 4JI3Q 1VQDA 3NK9A 3DWAA 2PI2E 4LAAA 1HUNA 2EPBA 4AYBE 2B2TA 1RIPA 1ENAA 1Q8IA 3IAYA 2CHBD 2EXZA 3RN2A 3HOUB 1F2YA 5KIXA 4AIMA 4ZYSA 1M1KC 1TKWB 3G48A 3CD6A 4P74A 5H1SE 4PMWA 2A73B 4A3FG 3GTGB 1SNCA 4JI7Q 3A8KE 3HRZC 3PQIA 1M4VA 1PH9A 5IWAQ 4IALA 4LF5Q 2WACA 2B29A 5M5WB 3M3YB 1Z9FA 3KK7A 3HOXB 1EY6A 1D6EC 4JG2A 5C4XH 3TREA 1I94Q 5IGCA 4XT3B 4WJ3M 1BDOA 3CCEA 1GXDC 3GTOH 1KRSA 1RDPD 2A6ED 2Z4IA 3OWEB 2ICEC 3UDIA 3MEFA 1LACA 2VL6A 1HR0W 3S2HB 3KLWA 5IYBH 4A3IH 1UAPA 1EQQA 2KECA 3MXNA 4A3IG 4K5WA 1GUWA 5J1ZA 1Z47A 4JI0L 1UE6A 3RZDB 2VB3X 2IJ0A 1KNEA 3DEPA 3KOJA 2LKVA 4IUNA 2KCMA 1ICFB 5CORA 1BXTA 1NAPA 4B3TQ 2D0PA 4FYDA 4WJWA 4QUFA 3G6JB 1CTMA 1EQVA 1NCVA 4DR5L 3CCLA 3KDFB 4KMUC 4FO2A 4UHVA 1K73C 5C4JH 1JJGA 4C3JH 1EWHA 2F0UA 3AFPA 2HHHL 1UE7A 4G4KA 1N34L 4RFBA 2VQEQ 2D2CC 3SR1A 4C3HB 3U4ZA 5GQOA 1XXGA 2Q2HA 4P71A 2N49A 4KHVA 2PZWA 2PCFB 4GZYC 1SMYD 4O1NA 2F0WA 1A63A 5IIFA 5LMNW 3PCOB 2RDGA 4C3HG 3VYSA 4X62Q 3I4MH 2ZXRA 1B44D 1PTOD 2D9UA 1VQ8A 4R4OA 2L11A 1I4XA 3QOJA 3WOFA 1IW7D 3AEVA 1B4OA 3CPWA 4JI4Q 1J5EL 4GLAC 1WTHA 3A8JE 4IFDI 3HKSA 2B2VC 2MJ8A 2ZJQA 4C56C 4N8FA 2WB1E 3E0JA 5JVG3 2A74C 1IBKL 5IY0A 4UP9A 2F4IA 4ZQ3A 1WVLA 2C35B 3J80L 2OXPA 1ICWA 5IGEA 4HCEA 1Y14B 3LWEA 2B2YA 1HZ9A 3LNNA 3VA5A 4JI5L 2K33A 3I72A 3HOVH 2AWNA 4DV6Q 2F0LA 1PHJA 2R93H 1BO0A 2L4NA 1KAAA 3W1BA 1E7ZA 2QCPX 4JK1C 1VQ6A 4A3KG 4A3JG 4EVOA 1XYIA 1VQHA 3QB3A 2P5ZX 2MFIA 1VQMA 1E24A 5EJWA 2LFNA 1CHPD 5M3MG 2E5LQ 4PMBA 4AH6A 2BA0A 2WAQB 2X6GA 3TP5A 1BCPF 1GHKA 3NQTA 1ILPA 1E2WA 1AH9A 2EYHA 4JBJA 5J22A 4RGOS 1OXVA 2E2DC 4HJ9A 1PLFA 1B70B 2WKDA 1PTOB 4MHEA 3I4MG 1SE8A 3OMCA 3OPOA 2K14A 2SEBD 4YCVA 2O2LD 2JA7G 4LF8Q 3J7AF 4K0KL 4A4IA 2CH4A 5FJ8H 3ULJA 2NVQH 1Y1VB 2DUDA 3CCUA 1KDBA 3F2DA 4EQOA 1F2LA 2MPMA 4C1NK 1TIID 3EROA 1L0WA 5C4ZA 4DR1L 2KJXA 5HY6A 3MZ5A 2UXCL 2HDMA 1RKNA 4JPBW 4QQBX 3HOUG 1FYCA 1H9KA 4EQ5A 1DGSA 4A93B 2E8GA 4OHJA 1IBLL 2WB1B 3R8BA 1MD2D 2C5CA 1HTLD 1LO5D 1UEAB 1BR9A 4DR6L 3TN2A 1RTNA 4KI0A 1ENCA 3BU2A 4H0LC 5M3FG 1X32A 4ZAIA 1I50H 3DM3A 3RLFA 5HGQA 2BH2A 2A68C 4X3SA 2IWHA 1F77A 2F0KA 1L1OA 2NN6I 1STGA 3VR4A 4DR5Q 1RODA 2CKZB 2IY5B 2DNCA 1ZYRC 5C5LA 3GTMB 1S4ZA 3DM1A 1HZAA 2MO1A 1PH8A 1U9RA 2VW9A 2F0VA 2Z0SA 3NBHA 4ALPA 4C3HH 1Y1VH 1WTXA 4GKKQ 1EIHA 4YCUA 4ZKCB 2KVMA 1WD0A 3CQZH 2FMMA 3TP6A 1I6VC 1MIUA 1SJED 1BKBA 2UU9L 3D4DA 2F0SA 2IPKD 3V96A 1A8VA 1AW7A 5I2XA 2RA4A 1JJ2A 1HNXL 1NE3A 1N36L 1WCMB 3TS0A 2K5QA 5I4DA 2HD3A 1HJPA 2H5XA 2VY3A 1LTAD 1C4QA 1PXUA 1VQAA 4B9XA 4IN3A 1EWCA 2I5MX 1VQCA 3K7AH 5EBCA 3AMUA 3TP8A 4IOCA 3Q8DA 2PZTA 2J0TD 2Z8LA 3EBEA 1Q81C 4JI6Q 2JXMB 4A3DG 1PRTC 5JOBA 4LF4Q 3PSIA 5C5MA 2ZXPA 2EY1A 1PFSA 1X3EA 2A69D 1L1OC 1LTBD 3GTLB 4KKTA 3MVVA 1EZ8A 2B63B 1F9QA 2DNEA 4LFCL 2IHEA 2RKSA 3KLSA 1V8QA 3SEBA 2GVAA 4HIKA 3I4NG 3K80C 1CFMA 3HKZG 3KYHC 1VQ7A 2Q2TA 1PTOH 3WWVA 5CV9A 5FLXE 4RGNA 3UDFA 1WCMH 1TY2A 4R8NA 2ZT9C 1KNAA 2BCOA 4NPSA 4WFN3 4B3ML 2OTJA 4KJNA 2PQAB 3HOWG 5E7NA 4DV5L 1V9PA 1X3PA 2VXWA 3CCJA 4LFAQ 3RZOB 2IT1A 2N3SA 4NKLA 2CW0C 1SNDA 3PIP3 3NQIA 3KF8B 1KC8C 4GN5A 2MO0A 4B9WA 4FF2A 5JVH3 5LMNL 2JA8G 2B63G 5E1FA 4QCLA 3FMCA 1L0YB 1CHQD 3KLSX 4KY5A 1N34Q 4H7BA 1HH2P 1RJTA 1GHJA 2G9DA 4KN7C 1B53A 2LMCB 1M90C 5J39A 3KJOA 4DAVA 3HS0C 3DWQA 3CXCA 1IYJB 2EIFA 4UAIA 1S5ED 4CKCA 1D1KA 1X3GA 1LT5D 1FJGQ 2PNHA 2EE1A 1H9SA 2XWJB 2K01A 3G6EA 1AN8A 1PYSB 3FPUB 1K8MA 2IX1A 4LMQD 5IGGA 2BE5C 1HQRD 2RBMA 2WP8J 1CQVA 1HA5A 3I8ZA 1I4GA 3CCMA 4RHRA 4JI2Q 1E2ZA 4DK3C 1P16A 4BY7G 3OMGA 4DPGA 3CCSA 4LFBQ 2NTTA 1XPOA 2R3ZA 4TVAB 2K5DA 4LFCQ 1SE2A 1VQGA 2QW7A 1D7QA 1MJEA 3MFYA 2L1BA 1A2UA 1IKLA 1R9TB 1G6ZA 2KHIA 4FP5D 4Y7NB 4ABNA 3H3VI 2LY7A 3HOVG 2BA1A 1IXRA 2K5WA 4IO9A 4XYQA 1WD1A 1NTGA 3CW2C 4RHSA 5M3MB 2VUMB 2K03A 3TS2A 1J9OA 3TBIB 3H09A 3RZDH 3NTKA 4IPDA 3PF4A 4OX9L 1VQBA 3PO3H 5IT9c 3KF6B 2FXQA 1CSQA 1YNXA 1WTPA 1PVOA 2F3VA 1V1QA 1C8CA 4N8X1 4TSSA 2B2UA 2HCCA 4KJOA 3NWTA 3TP7A 1WOCA 3J7A5 3CQZB 3NWSA 4PG3A 3T13A 2BH8A 4G7ZC 1EU3A 1K28A 4YIJA 1QB5D 2PO4A 4RCNA 2NYZD 5C0XI 4RKLA 1BCPB 3QR8A 2DY8A 2Y0SE 4M8AA 3CPFA 3K5MA 3NUCA 5M9OA 3GTMH 3HOXG 4LF6L 1CKMA 3VR6A 2E2JB 1EY4A 1MKHA 2K50A 2FJ2A 4OELB 2V1CC 5EKKA 2NZ1D 1K8AC 1VQNA 3ZJYC 3M85A 1FJGL 4JBKA 2VQEL 3TDQA 4AYBB 4JI8L 4YWLA 1J8IA 2UUCQ 5I6WA 3PO2H 5IYDH 5IT9E 1JWUD 3A55A 1GUOA 4DR4L 4FXDA 1VQFA 4QF4A 5EGTA 5J3BA 4APVA 5K5PA 4R1JA 4KD3A 1Q7YC 3BJUA 4OXPA 1HFGA 1GKHA 4C3JG 1BBXC 4L5RC 2A5HA 3CMAA 5HURA 1CI3M 1L2FA 2L12A 1SR3A 4XDXA 4B3TL 4IUQA 4DV3L 3R93A 3Q24A 4FF3A 1I4HA 3U9SA 4UPAA 5LMNQ 4DKAC 1CZGA 1TR5A 3HOYH 3PGZA 3CHBD 3CCQA 4A3EG 1IBKQ 2L9HA 3F2CA 3D8GA 3HOZG 1VQ5A 1OXSC 3OIQA 4A3DH 1YHQA 3D4RA 3I2ZA 5JEAG 3DLLA 3TRZA 3H3VC 1FGUA 2KUMA 4H13C 2NB0A 1N32Q 1T5XD 2A19A 1BCPD 1XMOL 2Q8RE 3L7ZC 1YNNC 2KCNA 4JI5Q 5L37A 1UNSA 2ICIA 1TS2A 1AP0A 1S5CD 3HOUH 3AYHB 1O7ZA 1D5XC 4V190 3R3OA 3GTPB 1PZID 3CP0A 2K5HA 3JAME 1STNA 4UP7A 3S1MH 4R4TA 2RHQB 1LTGD 2R92H 4YCWA 4JI6L 2B3GA 2EYLA 1OXUA 4L8JA 1SEBD 4BXXG 4BS9A 1QZGA 3J81c 3HOWH 2CWPA 1W3SA 4J6HA 5LHY1 1YITA 1VQOA 4HJ8A 4RH6A 1JOQA 1CZWA 1M8AA 3J7YW 5M5YB 3HEJA 4A93H 3A5ZB 3H0GB 2K75A 5EPLA 2JP1A 1V1PB 4N9PA 3IFTA 5T1GA 1I4QA 4G7HC 1UUPA 1XTCD 3ITPA 3NBHB 1CQFA 3URYA 4U68A 4XTCS 1I4PA 3T1HQ 2LXKA 5LL6S 2QILA 4OX9Q 1Q1EA 1NY4A 2ZJRA 3I4NH 3CMEA 1X56A 4KY7A 1AEXA 1FL0A 1SJHD 2FFKB 1IL8A 4PZ8A 1NNXA 1T5EA 1L1OB 4L5QA 5BR8L 2FINB 4K14A 4KHZA 3M4YA 1QWYA 2WB1G 4DV1L 2K04A 3S15B 3B6YA 1E22A 3OYYA 1A0IA 1BNZA 3FKIH 1JQYD 2TSSA 4RCOA 5ELDA 4DNIA 2XIWA 1GOZA 2F0OA 1A3TA 2B2WC 1S5DD 4LF4L 1IKMA 3M9BA 2YTXA 3DEOA 1DOKA 5A35A 3QIAA 1F9SA 3K6OA 4PNYA 1Q90A 1RF2D 4DAMA 4AYBG 3TZDA 1LM0A 5CGKA 1ESRA 5ELBA 4N9TA 2YU9H 1K0RA 3S1NH 4DR1Q 1X65A 1D8LA 4K8JA 2FHTA 1B7YB 1MJCA 2N8NA 4JV5L 2R7ZH 3S17B 1SYEA 4DV6L 3LX0A 4M1UB 4R9WA 2F52A 3A74A 3K7UC 1ASYA 3AB9A 4C3IH 1X54A 3C1EA 3M3YH 3S9WA 1I94L 1G51A 1IBLQ 4F8MA 1ZKOA 1S5FD 4BY1B 5FO7B 3KFUA 2XVSA 2F0MA 4DXFA 3HKZB 3NEMA 2PNRC 4OO1I 3ONAB 2F1MA 2E2IH 3K0XA 4OWXB 3S1NB 5C0XG 2MGSA 2JJQA 2KHJA 4QIWE 1WTWA 3NENA 1E0BA 1AE3A 4A3BG 4I65A 3HOZB 4C3IB 2R92B 1A62A 1PTOF 2PMZE 2RVLA 3I91A 1EEID 3FKIB 1TY0A 2E75C 3MEHA 4DF7A 2E2IB 4CDCC 4DU9A 5COYA 4IFDG 2NVXH 2O4XA 1VQLA 2KBNA 1EY0A 4IUPA 4DGZA 1YJ9A 5GAEC 3J7ZC 1SRUA 3CCVA 2Z4HA 3UDXA 1N36Q 2LSSA 1JJCB 1F9PA 1PZKD 3E9HA 1IBML 4XYOA 2XSCA 3RN5A 1SLJA 3SHLA 1QILA 5DM73 4LJZC 2PPBC 1ET9A 2ZTCA 1AFPA 1YNND 2JA8H 1K83H 4DV2L 1EOVA 1A15A 2KOLA 2QEJC 3D3RA 4LFAL 1DXMA 1VQPA 2XRSD 3VR5A 1SNQA 3MWYW 5G3LD 5IT9L 1KTKA 2SNMA 2O5JC 3K59A 3F2UA 4JI0Q 4A3CG 3IL8A 3I3CA 4FF4A 2EY2A 3T16A 1E3PA 1LTTD 1F9RA 1VMPA 4A3EH 4LF6Q 4X65L 3PIPA 1PH4A 4QMGA 5LMUQ 1AE2A 1EYCA 3A7LA 3M7GA 4GNXA 2M00A 1PRTF 1JB3A 4P75A 2I0QA 1LLRD 4K6LA 1HQMC 1YJWA 5LL6X 1P8LA 3ULLA 2QA4A 4OEMB 3Q6SA 3L9AX 1G2SA 4A3IB 4DR6Q 1RD9D 1TWHB 4JYAL 3EJIA 3RD4A 2BOSA 4XQJA 3H0GG 1YJNA 4P72A 2F3IA 2EDGA 1XPUA 1IYVA 3EA6A 3PO2G 1TWAB 1TS4A 3L3OC 4ZRZA 4C2MH 1GUGA 1KABA 1Q82C 4DAYA 4L63B 1HPCA 1EQTA 2PW7A 3PMFA 4DR2Q 1LABA 3BVZA 1H9RA 5F2DA 1R9TH 1DONA 4JI4L 2VB2X 5CV8A 4BBRH 2M9VA 1IW7C 1SDFA 2JA7B 2D62A 4JI1L 4P73A 3I4LA 1A3UA 3S2DH 4IPCA 1CKNB 4QGUA 4NXNQ 1HR0L 2ZTEA 5M3MH 4YHHQ 5CBAE 1DZ1A 1EY8A 2UUAQ 1D2BA 2ASBA 3PF5A 3GTQB 2F0HA 2J7ZA 4K8IA 2R7DA 4IJLA 3A0JA 1Y8OB 3J80E 1C0AA 2PYKA 3S2HH 4EQNA 5CC4A 1X3QA 4A3MB 1EY9A 2N78A 2XN9C 3NTHA 5DM63 1I3QH 2M2LA 1CKNA 1HNZQ 1HHVA 5M3FB 1N33L 4HJAA 1Y8PB 2WV6D 4V0BA 3K58A 3C46A 5FO8B 5AJ3L 2IHFA 4DV5Q 2F0FA 1R4QB 4LF7L 3X3MA 1YNJD 2K52A 5CV5A
chains in the Genus database with same CATH topology
5CMDA 5BN5A 2O5IC 2K7VA 1L0XB 1QNKA 4FF1A 2BE5D 5IGBA 4ME5A 2WINB 3S2DB 2QF7A 5JPNC 5G3LF 2IX0A 1CM9A 5KNDA 5D14A 5K36G 1PDQA 1QE6A 1I4RA 3BVGA 1TS3A 5C3EB 1D1IA 4DXGA 3GTOB 2QDBA 1BOSA 2IX3A 1OXTA 1EYDA 4TKOB 1MGSA 2J4XA 2RSOA 2CW0D 4ID6A 4CKBA 2EOTA 1DOLA 1CT1D 1LTSD 3MXGA 2AQ1B 3PUWA 4Q0FA 4O42A 5A2QE 1S5BD 3P7JA 4RGTA 3SK5A 3T51B 4HCSA 3J81E 2B2YC 1VDZA 4FVMA 1FD7D 2YU9B 1ENFA 1QNUA 5CV7A 1EEFD 2L55A 2PQEA 3MXUA 3V2TA 1STBA 2F3WA 1CA5A 3NSWA 1SBBB 5A2QL 1IYUA 1KDAA 2K28A 3FVQA 5JJZA 3RUZA 1WTQA 5BN3A 2Y0SB 1HUMA 4G7OC 1XX8A 1KLUD 3OHXC 3A56A 3MC0B 4A3KB 2KHSA 1RHPA 1I50B 1PFNA 1JORA 1SXTA 2WKCA 2OF1A 3OW7A 5JEAJ 4K6DA 3HZXA 2B8FA 2F0NA 4OL7A 4KN4C 4HR7B 3JAML 1ZEQX 1VMCA 3T4AC 1FGBD 1EL0A 2LS01 3CRLC 2R7ZB 1B50A 1CK1A 2KEDA 3HP3A 5D3IB 3CRKC 4OIJA 2NVQB 3D6WA 4HTHA 5KGUA 1ZXTA 4IFDH 2ZXOA 3BYYB 1PRTB 1BUVT 3QJYA 5CR3A 4BBSB 2D5DA 3NBIA 1EIGA 4TQUS 3T56B 4A3DB 5FKAC 2BDNA 1U4LA 2B8GA 1TWCB 1DOMA 3K0YA 4IZ8A 1TS5A 2EYFA 1A2TA 1EY5A 4CGYB 2KCCA 2MHVA 3HOVB 2MP1A 4FXGC 5KEEA 3BG3A 2NBFA 3VA7A 3FDTA 1G8ZD 2JE6I 4K5XA 2HDLA 3GTKB 5C0XH 4ZK9B 1D5ZC 3ERQA 1V1PA 1JE4A 1Z7TA 1EY7A 3PIO3 3E6ZX 3SVMA 5I6YA 2ID0A 3DXJC 1GUSA 3DUZA 4OIKA 1I3QB 3MFGA 3H6MA 3VR2A 3PUVA 4K2LA 4CJ2C 3BDCA 1SYBA 1JICA 2Q8IB 1R4PB 1ILQA 3NPPA 1DYQA 1JR0D 4BWGB 5C3XA 5C0XJ 1PTOC 1PYWD 4CJ1B 2NN6H 3ZYYX 1SYGA 1FR3A 3P1HA 1SMYC 2R61A 3K5NA 4CJ0B 2PZUA 4CHTB 4ZKBB 5ELCA 3K5LA 5CV4A 1Y8NB 3BVMA 3E5SA 1MSHA 4NDXA 3MXPA 4IFDJ 5I2YA 1TQOA 4X3TA 2K32A 1PZJD 2B2VA 2PMZB 1AZPA 1DJRD 1B1ZA 3I4MB 3LWUA 5CBEE 2EY6A 2R93B 3DWPA 2JEAI 4CKEA 1DM0B 2VNUD 2N88A 3VYUA 4QUCA 2EYOA 1LV9A 3H91A 1HXYD 4DK1A 1YNJC 3EFXD 4S3SA 3KLRA 1OO9B 3HOYB 4WORA 3X3NA 1W6JA 1VF5C 2F0PA 1ET6A 2K6AA 4FXKC 4IUUA 2EJGC 1EYAA 4BY7B 1JCKB 2AQ2B 4X3KA 1PFBA 2NVTB 3PO2B 4HSPA 4EGVA 3SK6A 4KTAA 4NMZA 3TMEA 4CBVA 1WTVA 3AU7A 1U4RA 1I6HB 2IW3A 3DHQA 5HGTA 2F03A 2E76C 1STAA 1SE3A 4WRDA 1NR4A 2I07B 1EFID 4U673 1O80A 2NTSA 3KUPA 5IGFA 5KYIA 1NR2A 2F0IA 2OT2A 4F7XA 1TU2B 5TSSA 1NSNS 4UDUC 3NTIA 5I9PA 3GTJB 1H9MA 1E2VA 3P20A 1PFMA 2EY5A 2IL8A 3OIPA 4KKUA 4MN3A 5E4XA 2K1BA 5FLXL 1EZ6A 2JEBI 4DAPA 5D65A 2A68D 3O13A 4LK1C 1SSOA 3SE0A 1MI2A 5KRUA 1B2TA 1STHA 1LT4D 4PQXA 5JAVA 3PUYA 3QG1A 2JYOA 2A6HD 1FNVA 1CA6A 1A6XA 3SK4A 4A3FB 2MUYA 2E74C 3WDNA 1F2ZA 3Q0AA 3I90A 3Q22A 4KK7A 2SDFA 4PMCA 3EQLC 4KY6A 2XWBB 3NXWA 1U4PA 4R8IA 4C3IG 3D31A 4BA1I 2EVBA 3BS1A 2EJMA 1Y69U 2F0GA 2GA4B 4XXEA 3FPPA 3CKIB 3GO5A 5ELFA 1TVXA 3D6CA 4XQNA 1ONLA 5EPJA 3MTSA 3J81L 3I70A 3G7LA 1WTRA 3MAQA 1HCZA 1W6KA 3VYRA 1LTRD 1ML0D 1H9JA 1SNPA 2EZVA 3HG9A 2F0TA 4KKSA 3OOCA 4Q5VA 4K5VA 4FNFA 4ULLA 2AWOA 4L6TB 5DAUA 3V05A 1AZQA 1BQQT 4IQZA 1II3A 2RDHA 4A3GB 2B2WA 3S1MB 4C2MB 3N52A 3R2IA 2RSNA 5C6AA 1SAPA 4BA2I 2X6LA 1DD2A 2A6HC 4F88A 1QOHA 1Q12A 5KNCA 5ISRA 3BDLA 1K83B 1MBYA 2L5TA 3K7AB 2EJFC 1O78A 4Z9CB 5EBDA 2JSOA 5DNFA 1Q3LA 2F0JA 1JC7A 2AUKA 5C4HA 2NUCA 3OSOA 4XT1B 1JWMD 4MIUA 2X69A 4A3EB 1ESFA 1A3VA 5C44B 3PV0A 2KEEA 4I7ZC 1B3AA 5JPMC 2EYMA 1SE4A 3BYTB 1BF4A 3NP8A 4J8QA 3QOLA 4ZUIA 5EPKA 3ND9A 2CVRA 2HUGA 3S16B 2C9OA 1GJXA 4HEDA 1FNWA 2PW5A 3C3LA 5KYLA 3VYTA 1EU4A 5FK9C 2F0DA 4KV6A 3I4NB 5I9OA 4HN7A 1LTID 1HFNA 3SDZA 4HMIA 4DFAA 1V1OA 3QO2A 3K5OA 3M7NA 4A3JB 1D5MC 3OWFA 1WTOA 5EKIA 2FMCA 3MHBA 1OXXK 1VCIA 3UI2A 3WOEA 3BZDB 2JA5B 3VR3A 5AFWA 4HMJA 1STEA 3N6RA 1FNUA 5E4WC 1B9MA 3ND8A 4J1MA 3A8IE 1BCPC 2KQ3A 2B2UC 1K8OA 5NUCA 1Z6HA 3BDOA 3H94A 2TMPA 3GV3A 3D4WA 4XQQA 2OEOA 4DA2A 3EVQA 2YYZA 4BBRB 3TSSA 2NVYB 2F0QA 2E2HB 5EKLA 4NP5A 1KDCA 3HGBA 2HCIA 1U4MA 3A7AB 3TZUA 4QIWB 4JBWA 5IGDA 1GUNA 2RDFA 3M4OB 1SFOB 5JEAH 5ELEA 1QG7A 2HQEA 1TWGB 2EYJA 3FEWX 1JOOA 2ENBA 4ILWA 4F87A 5IODA 4RGMA 4DK0A 3S1QB 3GP7A 3IKJA 1SYDA 2XRQD 2V4DA 3C1FA 3NHHA 2JA8B 3GD7A 1LT6D 1QJOA 3C2PA 2DY7A 5DEHA 4DNTB 3SXHA 3S14B 2Z1CA 1Y1WB 3SK8A 4RKBA 3Q23A 1IHZA 1QCBD 4HSVA 3HOWB 2BDOA 4PV1C 5FO9B 4RWSC 5CYUA 3RMHA 4H44C 3GV6A 2K05A 2I46A 4E6IA 5K36H 5KNBA 4IURA 3FRPB 2CQAA 2NWGA 2N55A 1H9SB 2WIIB 3PO3B 1PRTD 3W2DA 1O7YA 5T1IA 3U9OA 4IUTA 5C4XB 3KBGA 1GUTA 1SNMA 4A3BB 2JA6B 4ODGA 3DMUA 4RA8A 2DN8A 1SYFA 5EQ0A 3QWNA 4DNRB 1G291 5C4JB 1RTOA 3NE5B 4NW2A 3KF8A 4C3JB 5D3DA 1SNOA 4P2CB 1STYA 4IUVA 1TWFB 1DCZA 4DN4M 4TRDA 1TT2A 1Q1BA 2EYPA 5IOCA 1ZYRD 4QB4A 4C1NI 1C48A 1JOKA 3IFDA 2R6GA 1XWEA 1VF7A 1HA6A 3T53B 1RCVD 2G9HD 3W3AA 3PUXA 5FOBB 3S1RB 4OO1G 2A6EC 5BN4A 1JWSD 2L0CA 2F0EA 5E3FA 4ZUJA 1NUCA 1KLGD 3R2TA 2Q8TA 4B08A 4K2KA 1EOTA 4RAUC 4OO1H 1LT3D 2NVXB 4ZLTF 1F2MA 4X3UA 2A69C 1PMRA 2H4OA 3MA2B 3GQBA 3KBXA 2SNSA 1O7LA 3A54A 1MSGA 2B39A 4KD4A 2NN6G 5C3WA 5CV6A 3CU7A 1HRJA 4G57A 4HAEA 1B9NA 1HTPA 2RQXA 5M5XB 2SOBA 1V43A 4EQPA 1G91A 3P75A 2B2TC 1SYCA 2AQ3B 3I73A 4XIGS 3K57A 2XNAC 2AUJD 2KA7A 3J7AV 2H1EA 2QKIC 4OGQC 1G2TA 3PUZA 3NK9A 3DWAA 4LAAA 1HUNA 2EPBA 2B2TA 1ENAA 1Q8IA 3IAYA 2CHBD 2EXZA 3HOUB 1F2YA 5KIXA 4ZYSA 1TKWB 4PMWA 2A73B 3GTGB 1SNCA 3A8KE 3HRZC 1M4VA 4IALA 2WACA 5M5WB 3M3YB 3KK7A 3HOXB 1EY6A 1D6EC 5IGCA 4XT3B 1BDOA 1GXDC 1RDPD 2A6ED 2Z4IA 3OWEB 2ICEC 1LACA 3S2HB 1UAPA 2KECA 3MXNA 1GUWA 4K5WA 5J1ZA 1Z47A 3RZDB 2VB3X 2IJ0A 1KNEA 3DEPA 2LKVA 4IUNA 5CORA 1BXTA 1NAPA 4FYDA 4WJWA 4QUFA 3G6JB 1CTMA 1EQVA 1NCVA 4KMUC 4FO2A 1EWHA 2F0UA 4G4KA 4RFBA 2D2CC 3SR1A 4C3HB 1XXGA 4KHVA 2PZWA 2PCFB 4GZYC 1SMYD 4O1NA 2F0WA 5IIFA 2RDGA 4C3HG 3VYSA 2ZXRA 1B44D 1PTOD 2D9UA 2L11A 1I4XA 3QOJA 3WOFA 1IW7D 1B4OA 3A8JE 4IFDI 2B2VC 2MJ8A 4C56C 3E0JA 5JVG3 2A74C 2F4IA 4ZQ3A 1WVLA 3J80L 2OXPA 1ICWA 5IGEA 4HCEA 3LWEA 2B2YA 3LNNA 3VA5A 2K33A 3I72A 2AWNA 2F0LA 1BO0A 2L4NA 1KAAA 2QCPX 4JK1C 1XYIA 4EVOA 3QB3A 5EJWA 2LFNA 1CHPD 4PMBA 2BA0A 2WAQB 2X6GA 3TP5A 1BCPF 1GHKA 3NQTA 1ILPA 1E2WA 2EYHA 5J22A 4RGOS 1OXVA 2E2DC 1PLFA 2WKDA 1PTOB 4MHEA 3OMCA 3OPOA 2SEBD 2O2LD 3J7AF 1Y1VB 1KDBA 4EQOA 1F2LA 2MPMA 4C1NK 1TIID 3EROA 5C4ZA 2KJXA 3MZ5A 2HDMA 1RKNA 1FYCA 1H9KA 4A93B 4OHJA 2WB1B 3R8BA 1MD2D 2C5CA 1HTLD 1LO5D 1UEAB 1BR9A 3TN2A 1RTNA 4KI0A 1ENCA 4H0LC 1X32A 4ZAIA 3RLFA 2A68C 4X3SA 2IWHA 1F77A 2F0KA 2NN6I 1STGA 3VR4A 1RODA 2DNCA 1ZYRC 5C5LA 3GTMB 1S4ZA 3DM1A 1U9RA 2F0VA 3NBHA 1WTXA 1EIHA 4ZKCB 2KVMA 1WD0A 2FMMA 3TP6A 1I6VC 1SJED 3D4DA 2F0SA 2IPKD 3V96A 1AW7A 5I2XA 2RA4A 1WCMB 2K5QA 5I4DA 1LTAD 1C4QA 1PXUA 4B9XA 4IN3A 1EWCA 5EBCA 3AMUA 3TP8A 2PZTA 2J0TD 2Z8LA 2JXMB 1PRTC 5JOBA 5C5MA 2ZXPA 2EY1A 2A69D 1LTBD 3GTLB 4KKTA 3MVVA 1EZ8A 2B63B 1F9QA 2DNEA 2RKSA 3KLSA 1V8QA 3SEBA 1CFMA 1PTOH 5CV9A 5FLXE 4RGNA 1TY2A 4R8NA 2ZT9C 1KNAA 2BCOA 4WFN3 4KJNA 1X3PA 2VXWA 3RZOB 2IT1A 4NKLA 2CW0C 1SNDA 3PIP3 3NQIA 4B9WA 4FF2A 5JVH3 5E1FA 4QCLA 3FMCA 1L0YB 1CHQD 3KLSX 4KY5A 4H7BA 1RJTA 1GHJA 2G9DA 4KN7C 1B53A 2LMCB 5J39A 4DAVA 3HS0C 3DWQA 4UAIA 1S5ED 4CKCA 1D1KA 1LT5D 2EE1A 1H9SA 2XWJB 2K01A 1AN8A 3FPUB 1K8MA 2IX1A 5IGGA 4LMQD 2BE5C 1HQRD 2RBMA 2WP8J 1CQVA 1HA5A 3I8ZA 1I4GA 4RHRA 1E2ZA 3OMGA 2NTTA 2R3ZA 2K5DA 1SE2A 3MFYA 2L1BA 1A2UA 1IKLA 1R9TB 1G6ZA 4FP5D 4Y7NB 4ABNA 2LY7A 2BA1A 2K5WA 4XYQA 1WD1A 4RHSA 5M3MB 2VUMB 2K03A 1J9OA 3TBIB 3H09A 3NTKA 1WTPA 2F3VA 1C8CA 4TSSA 2B2UA 2HCCA 4KJOA 3NWTA 3TP7A 3CQZB 3NWSA 3T13A 4G7ZC 1EU3A 4YIJA 1QB5D 2PO4A 4RCNA 2NYZD 5C0XI 4RKLA 1BCPB 2DY8A 4M8AA 3K5MA 3NUCA 5M9OA 3VR6A 2E2JB 1EY4A 2FJ2A 5EKKA 2NZ1D 3M85A 3TDQA 4AYBB 1J8IA 5I6WA 5IT9E 1JWUD 3A55A 1GUOA 4FXDA 4QF4A 5EGTA 5K5PA 4KD3A 1BBXC 1HFGA 4C3JG 2A5HA 5HURA 1CI3M 2L12A 4XDXA 4IUQA 3R93A 3Q24A 4FF3A 1I4HA 3U9SA 1CZGA 1TR5A 3CHBD 2L9HA 3D8GA 1OXSC 3OIQA 3D4RA 5JEAG 3H3VC 2KUMA 4H13C 2NB0A 1T5XD 1BCPD 2Q8RE 3L7ZC 1YNNC 2KCNA 1UNSA 2ICIA 1TS2A 1AP0A 1S5CD 1O7ZA 1D5XC 4V190 3R3OA 3GTPB 1PZID 3JAME 1STNA 1LTGD 2EYLA 1OXUA 4L8JA 1SEBD 4BS9A 4J6HA 5LHY1 4RH6A 1JOQA 1CZWA 1M8AA 3J7YW 5M5YB 3HEJA 3H0GB 5EPLA 2JP1A 1V1PB 4N9PA 3IFTA 5T1GA 1I4QA 4G7HC 1UUPA 1XTCD 3ITPA 1CQFA 3URYA 4U68A 4XTCS 1I4PA 5LL6S 2QILA 1Q1EA 4KY7A 1AEXA 1SJHD 2FFKB 1IL8A 1T5EA 2FINB 4K14A 4KHZA 3M4YA 1QWYA 2K04A 3S15B 1BNZA 1JQYD 2TSSA 4RCOA 5ELDA 2XIWA 1GOZA 2F0OA 1A3TA 2B2WC 1S5DD 1IKMA 3DEOA 1DOKA 5A35A 3QIAA 1F9SA 3K6OA 4PNYA 1Q90A 1RF2D 3TZDA 5CGKA 1ESRA 5ELBA 4N9TA 4K8JA 2FHTA 3S17B 1SYEA 3LX0A 4M1UB 4R9WA 3AB9A 3C1EA 3S9WA 4F8MA 1ZKOA 1S5FD 4BY1B 5FO7B 2XVSA 2F0MA 4DXFA 3HKZB 2PNRC 4OO1I 3ONAB 2F1MA 3S1NB 5C0XG 2MGSA 1WTWA 1E0BA 4I65A 3HOZB 4C3IB 2R92B 1PTOF 2RVLA 3I91A 1EEID 3FKIB 1TY0A 2E75C 3MEHA 4DF7A 2E2IB 4DU9A 5COYA 4IFDG 2O4XA 1EY0A 4IUPA 4DGZA 2Z4HA 1F9PA 1PZKD 4XYOA 2XSCA 3SHLA 1QILA 5DM73 4LJZC 2PPBC 1ET9A 1AFPA 1YNND 1A15A 2KOLA 2QEJC 3D3RA 1DXMA 2XRSD 3VR5A 1SNQA 3MWYW 5G3LD 5IT9L 1KTKA 2SNMA 2O5JC 3K59A 3F2UA 3IL8A 3I3CA 4FF4A 2EY2A 3T16A 1LTTD 1F9RA 1VMPA 4QMGA 1EYCA 3A7LA 3M7GA 2M00A 1PRTF 1JB3A 1LLRD 4K6LA 1HQMC 5LL6X 3Q6SA 3L9AX 1G2SA 4A3IB 1RD9D 1TWHB 3EJIA 3RD4A 2BOSA 4XQJA 2EDGA 1IYVA 3EA6A 1TWAB 1TS4A 3L3OC 4ZRZA 1GUGA 1KABA 4DAYA 4L63B 1HPCA 1EQTA 2PW7A 3PMFA 1LABA 3BVZA 1H9RA 5F2DA 1DONA 2VB2X 5CV8A 2M9VA 1IW7C 1SDFA 2JA7B 2D62A 3I4LA 1A3UA 5CBAE 1DZ1A 1EY8A 1D2BA 3GTQB 2F0HA 2J7ZA 4K8IA 1Y8OB 3J80E 2PYKA 4EQNA 5CC4A 1X3QA 4A3MB 1EY9A 2XN9C 3NTHA 5DM63 1HHVA 2M2LA 5M3FB 1Y8PB 2WV6D 4V0BA 3K58A 3C46A 5FO8B 2F0FA 1R4QB 3X3MA 1YNJD 5CV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q L;  5FLX L;  3J7A V;  3JAM L;  3J81 L;  5IT9 L;  3J80 L;  5LL6 X; 
#chains in the Genus database with same CATH topology
 5IP9 H;  5CMD A;  5BN5 A;  2O5I C;  2K7V A;  4CDD C;  4I7A A;  1L0X B;  2E2H H;  1QNK A;  4OWT B;  4FF1 A;  1JT8 A;  2BE5 D;  1VQ4 A;  5IGB A;  4ME5 A;  2WIN B;  3S2D B;  1HZC A;  2QF7 A;  5JPN C;  3STB C;  5FLM H;  5G3L F;  2IX0 A;  1CM9 A;  5KND A;  1WJJ A;  2Z9H A;  5D14 A;  5K36 G;  1PDQ A;  1QE6 A;  1PV4 A;  5C44 G;  4QL5 A;  1KRT A;  1I4R A;  3BVG A;  4A76 A;  1TS3 A;  1GO3 E;  2AHO B;  5C3E B;  1D1I A;  4DXG A;  3OTO Q;  4B3S L;  1VQK A;  4YY3 L;  3GTO B;  2QDB A;  2UXD L;  3T1Y Q;  1BOS A;  2IX3 A;  1OXT A;  4MZ9 A;  1EYD A;  4TKO B;  4DUY L;  2UXB Q;  1MGS A;  2J4X A;  3CC4 A;  2RSO A;  1CSP A;  2CW0 D;  4R4Q A;  4ID6 A;  4CKB A;  2EOT A;  3STB D;  1DOL A;  1CT1 D;  1LTS D;  4DK6 C;  1NJI C;  3MXG A;  2AQ1 B;  3PUW A;  4Q0F A;  4O42 A;  3I4O A;  4A3K H;  5A2Q E;  1QVG A;  2AKW B;  1S5B D;  3P7J A;  4RGT A;  3SK5 A;  2A1A A;  3T51 B;  4HCS A;  3J81 E;  1SN8 A;  3CAM A;  2B2Y C;  3JC6 6;  4DV0 L;  1VDZ A;  4FVM A;  1FD7 D;  3GTL H;  2YU9 B;  4A3G G;  1ENF A;  1U0L A;  1QNU A;  5CV7 A;  3JAM i;  1EEF D;  1HZB A;  5C3E G;  1C7Y A;  2L55 A;  1T9H A;  4DV1 Q;  2PQE A;  3MXU A;  3V2T A;  1STB A;  3M4P A;  2F3W A;  3GTK H;  2UUB L;  1CA5 A;  3NSW A;  1SBB B;  5A2Q L;  4GN3 B;  1IYU A;  1KDA A;  4KLK A;  2K28 A;  4LUO A;  3FVQ A;  5JJZ A;  3RUZ A;  1WTQ A;  1MHW C;  3I7F A;  1NMG A;  5BN3 A;  4NXN L;  2Y0S B;  3AQQ A;  1PH3 A;  1HUM A;  3D0F A;  1YI2 A;  2RCN A;  4G7O C;  5IYC G;  1S40 A;  3E0E A;  1XX8 A;  1KLU D;  2OQ0 A;  3OHX C;  5M3F H;  3A56 A;  3MC0 B;  2YTV A;  4A3K B;  2KHS A;  1TWA H;  1RHP A;  4A75 A;  1PFN A;  1I50 B;  1JOR A;  1SXT A;  2WKC A;  2OF1 A;  2UUC L;  4LF9 Q;  3ER0 A;  3OW7 A;  5JEA J;  4K6D A;  3HZX A;  2K5V A;  2B8F A;  2F0N A;  4OL7 A;  2A8V A;  4KN4 C;  1VQ9 A;  3LGJ A;  5C3E H;  4HR7 B;  3JAM L;  1KQS A;  1WFQ A;  1Y1V G;  2R7Z G;  4GKJ L;  1ZEQ X;  4A3L G;  1VMC A;  3T4A C;  1K8G A;  1U5K A;  4X65 Q;  2WFW A;  1FGB D;  1EL0 A;  2LS0 1;  3CRL C;  1J5E Q;  2NVY H;  2R7Z B;  1B50 A;  1CK1 A;  2KED A;  2KEN A;  1HR0 Q;  3HP3 A;  2JA9 A;  5D3I B;  4DV4 Q;  3CRK C;  4O2D A;  4OIJ A;  2NVQ B;  4X64 L;  3D6W A;  4HTH A;  5KGU A;  1ZXT A;  4IFD H;  2OWO A;  2ZXO A;  3BYY B;  4IPG A;  2AMC B;  2K5N A;  3OW2 A;  5BR8 Q;  2R92 G;  1LUZ A;  1XNR L;  4DR4 Q;  1GVP A;  2GN5 A;  2VZA A;  3T1Y L;  4POG A;  1PRT B;  3S1R H;  3QJY A;  1BUV T;  5CR3 A;  3H3V H;  1TWG H;  3CF5 A;  4BBS B;  2D5D A;  3NBI A;  1EIG A;  4TQU S;  3T56 B;  4A3D B;  5FKA C;  2BDN A;  1U4L A;  4DR7 L;  3VDY A;  2B8G A;  1TWC B;  1DOM A;  3K0Y A;  4IZ8 A;  1TS5 A;  2EYF A;  1A2T A;  1EY5 A;  3J81 i;  4CGY B;  2KCC A;  1N32 L;  2MHV A;  3HOV B;  3F2B A;  2MP1 A;  4FXG C;  5KEE A;  3BG3 A;  2DJF C;  2NBF A;  1IBM Q;  3VA7 A;  3FDT A;  4HIO A;  4BBR G;  1G8Z D;  2JE6 I;  4K5X A;  2HDL A;  5M5W H;  4MTK A;  3GTK B;  5C0X H;  3NEL A;  4ZK9 B;  4O0A A;  4IOA A;  1UEB A;  4DUZ L;  4QY7 A;  1D5Z C;  3ERQ A;  1V1P A;  1PYB A;  1JE4 A;  1Z7T A;  2VQF Q;  1EY7 A;  1JB7 A;  3PIO 3;  4PZ7 A;  3E6Z X;  1JMC A;  5AJ3 Q;  3SVM A;  1KD1 C;  5I6Y A;  2Q2I A;  2ID0 A;  3CC2 A;  3DXJ C;  1GUS A;  3DUZ A;  4OIK A;  4GOP A;  1I3Q B;  3MFG A;  3H6M A;  4GLX A;  3VR2 A;  3PUV A;  1B3Q A;  4K2L A;  4JI7 L;  4CJ2 C;  3PIO A;  1YZ6 A;  3BDC A;  3UE1 A;  1N9W A;  4YWK A;  2PI2 A;  3EN2 A;  4BY7 H;  5LMU L;  1PH2 A;  1YIJ A;  1SYB A;  2JK8 A;  3EIV A;  1JIC A;  2Q8I B;  3RLO A;  1R4P B;  1K9M C;  4JI2 L;  3UDG A;  1ILQ A;  1NMF A;  3NPP A;  2L15 A;  1DYQ A;  1JR0 D;  2UUA L;  4BWG B;  5C3X A;  5C0X J;  1PTO C;  1PYW D;  4CJ1 B;  2NN6 H;  1GM5 A;  3ZYY X;  1EIF A;  1PA6 A;  1SYG A;  1OTC A;  1FR3 A;  3P1H A;  4LWC A;  1SMY C;  2R61 A;  3K5N A;  4A3C H;  4B3R Q;  4CJ0 B;  2PZU A;  4CHT B;  1HNZ L;  3H15 A;  3G71 A;  1QVC A;  5ELC A;  4ZKB B;  5CV4 A;  3K5L A;  1Y8N B;  3BVM A;  4DR3 Q;  2WAQ E;  2JQO A;  3E5S A;  4JI8 Q;  1MSH A;  4NDX A;  3MXP A;  2K4K A;  4IFD J;  2HT1 A;  5I2Y A;  1TQO A;  4X3T A;  2MNA A;  2UXD Q;  3KF6 A;  2K32 A;  2NZO A;  1PZJ D;  2B2V A;  2PMZ B;  1AZP A;  1DJR D;  1B1Z A;  3I4M B;  3LWU A;  2CCZ A;  5CBE E;  1KIX A;  2EY6 A;  3L0O A;  4R4C A;  2R93 B;  1EUJ A;  4GN4 B;  2YV5 A;  3DWP A;  3HOX H;  1X55 A;  2JEA I;  1WI5 A;  1EQR A;  2NVT H;  4NB3 A;  4POF A;  5IP7 H;  1GD7 A;  4CKE A;  4JCV E;  2RF4 A;  1DM0 B;  1CUK A;  2N88 A;  4RMF A;  3VYU A;  2VNU D;  1YVC A;  4QUC A;  2EYO A;  1EYG A;  1LV9 A;  3G4S A;  2RCF A;  2OQK A;  3MXN B;  1Q46 A;  3H91 A;  1HNW L;  1HXY D;  4JW0 A;  4DK1 A;  1YNJ C;  2Y0S G;  3EFX D;  4S3S A;  1EWI A;  3PO3 G;  4Y7N H;  3GTG H;  1QUQ A;  3KLR A;  1OO9 B;  3HOY B;  1N33 Q;  4WOR A;  4J15 A;  3X3N A;  1W6J A;  1VF5 C;  3I56 A;  2F0P A;  4GKJ Q;  1ET6 A;  2K6A A;  4FXK C;  4IUU A;  2EJG C;  1EYA A;  4BY7 B;  1JCK B;  5FJ8 G;  1X3F A;  3CCR A;  2AQ2 B;  4X3K A;  1PH1 A;  1PFB A;  1EIY B;  3W1G A;  2NVT B;  4DUZ Q;  3PO2 B;  4HSP A;  4EGV A;  5M5Y H;  5IP7 G;  3SK6 A;  2CH4 W;  4YHH L;  1Y1W G;  4KTA A;  4NMZ A;  1Q86 C;  2F4V L;  3TME A;  2VQF L;  4CBV A;  1WTV A;  1XMO Q;  1CKO A;  3AU7 A;  1U4R A;  5ELN A;  1I6H B;  3KDF A;  2IW3 A;  3DHQ A;  5HGT A;  5IP9 G;  4X62 L;  2F03 A;  2E76 C;  1STA A;  1SE3 A;  3FHW A;  4UP8 A;  4WRD A;  4GNX B;  3HOY G;  1NR4 A;  2I07 B;  4JC0 A;  2PQA A;  4A3J H;  1EFI D;  4U67 3;  1O80 A;  2NTS A;  3KUP A;  4JOI C;  4LF7 Q;  5IGF A;  5KYI A;  3JAM c;  1NR2 A;  4X66 Q;  1SMX A;  2F0I A;  2OT2 A;  3J81 j;  4F7X A;  1TU2 B;  1XMQ L;  5TSS A;  4YY3 Q;  2I5L X;  1NSN S;  4UDU C;  3NTI A;  5I9P A;  3GTJ B;  1H9M A;  1E2V A;  4CDF C;  3P20 A;  5C4X G;  1PFM A;  4KKU A;  1B8A A;  2EY5 A;  2IL8 A;  3OIP A;  3ERS X;  2DJG C;  1SFO H;  4ME3 A;  4MN3 A;  1TWC H;  5E4X A;  2K1B A;  5FLX L;  1EZ6 A;  2JEB I;  4DAP A;  5D65 A;  2OCE A;  2A68 D;  3O13 A;  4LK1 C;  4LW1 A;  1SSO A;  3GTJ H;  1PH6 A;  4L5S A;  3SE0 A;  1MI2 A;  5KRU A;  1B2T A;  1STH A;  1KL9 A;  1LT4 D;  4PQX A;  5JAV A;  3PUY A;  5GAG C;  3QG1 A;  2JYO A;  2G5D A;  3M4Q A;  4DV0 Q;  3RZO H;  1XPR A;  1N8R C;  2I5H A;  2VUM H;  2A6H D;  1FNV A;  1CA6 A;  1A6X A;  3SK4 A;  4A3F B;  3W5O A;  2MUY A;  2E74 C;  3WDN A;  4BY1 H;  1F2Z A;  3RNU A;  3TEH B;  3Q0A A;  3ICE A;  3I90 A;  3H0G H;  3GTP H;  3Q22 A;  4KHP L;  4KK7 A;  5FLM G;  1BVS A;  1XNQ L;  4RG1 A;  2SDF A;  4PMC A;  4NXM L;  3EQL C;  4KY6 A;  2XWB B;  5JJI A;  3NXW A;  1U4P A;  4R8I A;  3HFZ B;  4C3I G;  2JA6 G;  3S17 H;  3ULP A;  5JJL A;  3D31 A;  4BA1 I;  2EVB A;  3BS1 A;  1IZ6 A;  2Q2U A;  4A3M G;  2EJM A;  1Y69 U;  2F0G A;  2GA4 B;  4XXE A;  3FPP A;  1YHA A;  3BZC A;  2JA6 H;  3CKI B;  3GO5 A;  5ELF A;  1TVX A;  3D6C A;  4FDB A;  4XQN A;  1ONL A;  5EPJ A;  3MTS A;  3J81 L;  3S15 H;  3I70 A;  3G7L A;  1WTR A;  3MAQ A;  1HCZ A;  1W6K A;  1VS0 A;  3VYR A;  1LTR D;  1ML0 D;  1X6O A;  1WCM G;  1H9J A;  1SNP A;  2EZV A;  3HG9 A;  2HQL A;  2F0T A;  4KKS A;  2UUB Q;  3OOC A;  3OTO L;  4Q5V A;  4B3S Q;  4K5V A;  4FNF A;  4ULL A;  5GRO A;  2AWO A;  4L6T B;  5DAU A;  3V05 A;  1AZQ A;  1BQQ T;  4IQZ A;  4R4I A;  1II3 A;  2RDH A;  2GVB A;  2VS1 A;  4A3G B;  2B2W A;  3S1M B;  4C2M B;  4JI1 Q;  3N52 A;  3A5U A;  3RR5 A;  3R2I A;  4MNO A;  1YHB A;  2RSN A;  5C6A A;  1SAP A;  4BA2 I;  2OTL A;  2X6L A;  1DD2 A;  1SRO A;  2A6H C;  4F88 A;  1QOH A;  1Q12 A;  3F8T A;  2B63 H;  1IL2 A;  5KNC A;  5ISR A;  3BDL A;  1K83 B;  1MBY A;  2L5T A;  3K7A B;  4DR3 L;  2EJF C;  1O78 A;  2JA5 G;  4Z9C B;  5EBD A;  2JSO A;  5DNF A;  1UWV A;  1Q3L A;  3E3X A;  4IJH A;  1QUQ B;  2F0J A;  2R7F A;  4WJ4 A;  4LF9 L;  1JC7 A;  2AUK A;  5C4H A;  5IYC H;  4KHP Q;  2NUC A;  3OSO A;  4XT1 B;  4DV2 Q;  1S3O A;  1JWM D;  4MIU A;  2X69 A;  4AQY L;  4DUY Q;  2UXB L;  4A3E B;  1ESF A;  2QDL A;  1A3V A;  5C44 B;  1VQI A;  3PV0 A;  5IWA L;  2KEE A;  4I7Z C;  1B3A A;  5JPM C;  2EYM A;  1X9N A;  1SE4 A;  3BYT B;  1BF4 A;  4YWM A;  3NP8 A;  4HIM A;  4J8Q A;  3M4O H;  3QOL A;  4ZUI A;  5EPK A;  3ND9 A;  2CVR A;  2D0O A;  2HUG A;  3S16 B;  4HJ5 A;  4HJ7 A;  2C9O A;  2CQO A;  2EXD A;  1GJX A;  4HED A;  1FNW A;  2Z6K C;  2PW5 A;  3C3L A;  4A3F H;  5KYL A;  1J6Q A;  3VYT A;  1EU4 A;  1BBU A;  5FK9 C;  2F0D A;  4KV6 A;  3I4N B;  5I9O A;  4JI3 L;  4HN7 A;  1LTI D;  1HFN A;  4JOI A;  3SDZ A;  3HKZ E;  4HMI A;  1KXL A;  3S16 H;  4DFA A;  1V1O A;  4LUV A;  4OWW B;  3QO2 A;  3E9I A;  1QZH A;  1RL2 A;  3K5O A;  1FVI A;  4A3J B;  3M7N A;  1O7I A;  1D5M C;  3OWF A;  1WTO A;  2RHS B;  5EKI A;  2FMC A;  1YEZ A;  1OXX K;  1VCI A;  3MHB A;  4DR7 Q;  3UI2 A;  3WOE A;  2ZM6 Q;  5C44 H;  3BZD B;  2JA5 B;  3VR3 A;  5AFW A;  4OON A;  4HMJ A;  1STE A;  3N6R A;  1FNU A;  2Z6K A;  5E4W C;  3GDE A;  3K81 C;  1B9M A;  3ND8 A;  5GAD C;  3CC7 A;  4J1M A;  3A8I E;  1QVF A;  2UU9 Q;  5IYB G;  1BCP C;  2KQ3 A;  2B2U C;  1K8O A;  2MQH A;  5NUC A;  1Z6H A;  2EQS A;  2ES2 A;  2E5L L;  4EX5 A;  3BDO A;  3H94 A;  2LXJ A;  2TMP A;  3GV3 A;  4BXX H;  4DV7 L;  5DLQ E;  1ASZ A;  3D4W A;  4XQQ A;  3S14 H;  2OEO A;  4DA2 A;  3U4V A;  1PH5 A;  3EVQ A;  2YYZ A;  4BBR B;  1UE1 A;  3TSS A;  1KHI A;  2NVY B;  5ELO A;  2F0Q A;  3BZK A;  2E2H B;  1YBY A;  5EKL A;  4NP5 A;  1KDC A;  3HGB A;  1E1T A;  5JJK A;  2HCI A;  1U4M A;  1XNQ Q;  1JE5 A;  4LF8 L;  4K0K Q;  2ALY B;  3A7A B;  1G6P A;  3TZU A;  1H95 A;  4NXM Q;  4QIW B;  3RLN A;  4ZCK A;  3J80 i;  4JBW A;  5IGD A;  4LF5 L;  1GUN A;  2HIX A;  4B3R L;  2RDF A;  4X64 Q;  2Z6B A;  1SFO B;  3M4O B;  2HHH Q;  5JEA H;  5ELE A;  4GS3 A;  1QG7 A;  2HQE A;  1TWG B;  2EYJ A;  3FEW X;  1JOO A;  2ENB A;  4ILW A;  4F87 A;  5IOD A;  2ZJP A;  1Y1W H;  4PZ6 A;  1W2B A;  1XTD A;  4RGM A;  2VUM G;  4DAY B;  4DK0 A;  3S1Q B;  3GP7 A;  3IKJ A;  1SYD A;  2XRQ D;  2V4D A;  4JBM A;  3C1F A;  1Q8K A;  3NHH A;  2JA8 B;  1XMQ Q;  3GD7 A;  1LT6 D;  1QJO A;  4GOP B;  3C2P A;  2DY7 A;  5DEH A;  4DNT B;  3SXH A;  3S14 B;  2Z1C A;  3SK8 A;  3U58 A;  4RKB A;  3Q23 A;  1IHZ A;  1C9O A;  1Y1W B;  2E2J H;  1QCB D;  4HSV A;  3S1Q H;  5IYD G;  2HIV A;  2JN4 A;  2BDO A;  4PV1 C;  3HOW B;  5FO9 B;  2QEX A;  4RWS C;  4UY8 C;  3TQY A;  5CYU A;  3RMH A;  4H44 C;  3GV6 A;  2K05 A;  2I46 A;  4E6I A;  5K36 H;  3UE0 A;  5KNB A;  4IUR A;  3FRP B;  2CQA A;  2NWG A;  4A3G H;  2N55 A;  1H9S B;  1HNX Q;  2WII B;  4H02 A;  1E1O A;  3PO3 B;  1PRT D;  1KAW A;  4MTN A;  3W2D A;  2F4V Q;  1XNR Q;  1O7Y A;  5T1I A;  2JA7 H;  4DV7 Q;  3HOZ H;  3U9O A;  4IUT A;  3F1Z A;  1XJV A;  5C4X B;  3KBG A;  4L5T A;  4JVZ A;  1GUT A;  1SNM A;  4A3B B;  2JA6 B;  4ODG A;  3DMU A;  4RA8 A;  4GOP C;  2NZH A;  2DN8 A;  1WYD A;  3FKI G;  1SYF A;  5EQ0 A;  4HID A;  3QWN A;  4AQY Q;  4DNR B;  1G29 1;  5C4J B;  1RTO A;  3NE5 B;  4NW2 A;  5M5X H;  4GNX C;  4Y52 H;  3KF8 A;  4C3J B;  3AFQ A;  3L2P A;  2R93 G;  4LFB L;  5D3D A;  1I5F A;  1SNO A;  3U50 C;  3T1H L;  4P2C B;  1STY A;  4IUV A;  1NBW A;  5FLX c;  3J80 c;  1TWF B;  4BY1 G;  1DCZ A;  4JYA Q;  4DN4 M;  2UXC Q;  1K0S A;  4TRD A;  1TT2 A;  1Q1B A;  2EYP A;  5IOC A;  1ZYR D;  1TWH H;  3GTQ H;  4QB4 A;  4C1N I;  4QJF A;  2XTI A;  4DV4 L;  1C48 A;  3K8A A;  1JOK A;  3IFD A;  2R6G A;  1XWE A;  4LNQ A;  1VF7 A;  4X6A H;  1HA6 A;  4A3M H;  1TWF H;  4B3M Q;  3T53 B;  4A3L H;  1RCV D;  3KJP A;  4DR2 L;  2G9H D;  3W3A A;  4IPH A;  3PUX A;  2JA5 H;  1LYL A;  4LUZ A;  4A3B H;  5FOB B;  4X66 L;  1BBW A;  3FP9 A;  3S1R B;  4OO1 G;  4BBS H;  2A6E C;  5BN4 A;  1JWS D;  2L0C A;  2F0E A;  5E3F A;  4ZUJ A;  1LTL A;  1NUC A;  1KLG D;  3R2T A;  1EFW A;  2Q8T A;  4B08 A;  4JV5 Q;  2YTY A;  4K2K A;  1EOT A;  4RAU C;  4OO1 H;  1LT3 D;  4BBS G;  2ZTD A;  2NVX B;  4ZLT F;  1F2M A;  4X3U A;  4GLV B;  2A69 C;  1PMR A;  2H4O A;  3MA2 B;  3GQB A;  3KBX A;  4A93 G;  1HNW Q;  2XGT A;  1VQE A;  3S24 A;  2SNS A;  1O7L A;  5IE8 A;  1TXY A;  1PH7 A;  3A54 A;  1MSG A;  3SGI A;  2KCT A;  2CWA A;  2B39 A;  1K3B C;  1UE5 A;  4KD4 A;  2NN6 G;  5C3W A;  5CV6 A;  3IRB A;  2CFM A;  4DV3 Q;  3CU7 A;  1HRJ A;  4CDE C;  4G57 A;  4HAE A;  1B9N A;  2ZM6 L;  1HTP A;  2RQX A;  2DGY A;  5M5X B;  2SOB A;  2ATW A;  3I55 A;  1V43 A;  4EQP A;  5GAH C;  1G91 A;  2WAQ G;  3P75 A;  5EAY A;  1I6H H;  2B2T C;  1SYC A;  2AQ3 B;  4GKK L;  1VQJ A;  2QGQ A;  3I73 A;  4XIG S;  1K3R A;  3K57 A;  2XNA C;  2AUJ D;  2KA7 A;  3J7A V;  2H1E A;  2QKI C;  4OGQ C;  1S72 A;  1G2T A;  3PUZ A;  4JI3 Q;  1VQD A;  3NK9 A;  3DWA A;  2PI2 E;  4LAA A;  1HUN A;  2EPB A;  4AYB E;  2B2T A;  1RIP A;  1ENA A;  1Q8I A;  3IAY A;  2CHB D;  2EXZ A;  3RN2 A;  3HOU B;  1F2Y A;  5KIX A;  4AIM A;  4ZYS A;  1M1K C;  1TKW B;  3G48 A;  3CD6 A;  4P74 A;  5H1S E;  4PMW A;  2A73 B;  4A3F G;  3GTG B;  1SNC A;  4JI7 Q;  3A8K E;  3HRZ C;  3PQI A;  1M4V A;  1PH9 A;  5IWA Q;  4IAL A;  4LF5 Q;  2WAC A;  2B29 A;  5M5W B;  3M3Y B;  1Z9F A;  3KK7 A;  3HOX B;  1EY6 A;  1D6E C;  4JG2 A;  5C4X H;  3TRE A;  1I94 Q;  5IGC A;  4XT3 B;  4WJ3 M;  1BDO A;  3CCE A;  1GXD C;  3GTO H;  1KRS A;  1RDP D;  2A6E D;  2Z4I A;  3OWE B;  2ICE C;  3UDI A;  3MEF A;  1LAC A;  2VL6 A;  1HR0 W;  3S2H B;  3KLW A;  5IYB H;  4A3I H;  1UAP A;  1EQQ A;  2KEC A;  3MXN A;  4A3I G;  4K5W A;  1GUW A;  5J1Z A;  1Z47 A;  4JI0 L;  1UE6 A;  3RZD B;  2VB3 X;  2IJ0 A;  1KNE A;  3DEP A;  3KOJ A;  2LKV A;  4IUN A;  2KCM A;  1ICF B;  5COR A;  1BXT A;  1NAP A;  4B3T Q;  2D0P A;  4FYD A;  4WJW A;  4QUF A;  3G6J B;  1CTM A;  1EQV A;  1NCV A;  4DR5 L;  3CCL A;  3KDF B;  4KMU C;  4FO2 A;  4UHV A;  1K73 C;  5C4J H;  1JJG A;  4C3J H;  1EWH A;  2F0U A;  3AFP A;  2HHH L;  1UE7 A;  4G4K A;  1N34 L;  4RFB A;  2VQE Q;  2D2C C;  3SR1 A;  4C3H B;  3U4Z A;  5GQO A;  1XXG A;  2Q2H A;  4P71 A;  2N49 A;  4KHV A;  2PZW A;  2PCF B;  4GZY C;  1SMY D;  4O1N A;  2F0W A;  1A63 A;  5IIF A;  5LMN W;  3PCO B;  2RDG A;  4C3H G;  3VYS A;  4X62 Q;  3I4M H;  2ZXR A;  1B44 D;  1PTO D;  2D9U A;  1VQ8 A;  4R4O A;  2L11 A;  1I4X A;  3QOJ A;  3WOF A;  1IW7 D;  3AEV A;  1B4O A;  3CPW A;  4JI4 Q;  1J5E L;  4GLA C;  1WTH A;  3A8J E;  4IFD I;  3HKS A;  2B2V C;  2MJ8 A;  2ZJQ A;  4C56 C;  4N8F A;  2WB1 E;  3E0J A;  5JVG 3;  2A74 C;  1IBK L;  5IY0 A;  4UP9 A;  2F4I A;  4ZQ3 A;  1WVL A;  2C35 B;  3J80 L;  2OXP A;  1ICW A;  5IGE A;  4HCE A;  1Y14 B;  3LWE A;  2B2Y A;  1HZ9 A;  3LNN A;  3VA5 A;  4JI5 L;  2K33 A;  3I72 A;  3HOV H;  2AWN A;  4DV6 Q;  2F0L A;  1PHJ A;  2R93 H;  1BO0 A;  2L4N A;  1KAA A;  3W1B A;  1E7Z A;  2QCP X;  4JK1 C;  1VQ6 A;  4A3K G;  4A3J G;  4EVO A;  1XYI A;  1VQH A;  3QB3 A;  2P5Z X;  2MFI A;  1VQM A;  1E24 A;  5EJW A;  2LFN A;  1CHP D;  5M3M G;  2E5L Q;  4PMB A;  4AH6 A;  2BA0 A;  2WAQ B;  2X6G A;  3TP5 A;  1BCP F;  1GHK A;  3NQT A;  1ILP A;  1E2W A;  1AH9 A;  2EYH A;  4JBJ A;  5J22 A;  4RGO S;  1OXV A;  2E2D C;  4HJ9 A;  1PLF A;  1B70 B;  2WKD A;  1PTO B;  4MHE A;  3I4M G;  1SE8 A;  3OMC A;  3OPO A;  2K14 A;  2SEB D;  4YCV A;  2O2L D;  2JA7 G;  4LF8 Q;  3J7A F;  4K0K L;  4A4I A;  2CH4 A;  5FJ8 H;  3ULJ A;  2NVQ H;  1Y1V B;  2DUD A;  3CCU A;  1KDB A;  3F2D A;  4EQO A;  1F2L A;  2MPM A;  4C1N K;  1TII D;  3ERO A;  1L0W A;  5C4Z A;  4DR1 L;  2KJX A;  5HY6 A;  3MZ5 A;  2UXC L;  2HDM A;  1RKN A;  4JPB W;  4QQB X;  3HOU G;  1FYC A;  1H9K A;  4EQ5 A;  1DGS A;  4A93 B;  2E8G A;  4OHJ A;  1IBL L;  2WB1 B;  3R8B A;  1MD2 D;  2C5C A;  1HTL D;  1LO5 D;  1UEA B;  1BR9 A;  4DR6 L;  3TN2 A;  1RTN A;  4KI0 A;  1ENC A;  3BU2 A;  4H0L C;  5M3F G;  1X32 A;  4ZAI A;  1I50 H;  3DM3 A;  3RLF A;  5HGQ A;  2BH2 A;  2A68 C;  4X3S A;  2IWH A;  1F77 A;  2F0K A;  1L1O A;  2NN6 I;  1STG A;  3VR4 A;  4DR5 Q;  1ROD A;  2CKZ B;  2IY5 B;  2DNC A;  1ZYR C;  5C5L A;  3GTM B;  1S4Z A;  3DM1 A;  1HZA A;  2MO1 A;  1PH8 A;  1U9R A;  2VW9 A;  2F0V A;  2Z0S A;  3NBH A;  4ALP A;  4C3H H;  1Y1V H;  1WTX A;  4GKK Q;  1EIH A;  4YCU A;  4ZKC B;  2KVM A;  1WD0 A;  3CQZ H;  2FMM A;  3TP6 A;  1I6V C;  1MIU A;  1SJE D;  1BKB A;  2UU9 L;  3D4D A;  2F0S A;  2IPK D;  3V96 A;  1A8V A;  1AW7 A;  5I2X A;  2RA4 A;  1JJ2 A;  1HNX L;  1NE3 A;  1N36 L;  1WCM B;  3TS0 A;  2K5Q A;  5I4D A;  2HD3 A;  1HJP A;  2H5X A;  2VY3 A;  1LTA D;  1C4Q A;  1PXU A;  1VQA A;  4B9X A;  4IN3 A;  1EWC A;  2I5M X;  1VQC A;  3K7A H;  5EBC A;  3AMU A;  3TP8 A;  4IOC A;  3Q8D A;  2PZT A;  2J0T D;  2Z8L A;  3EBE A;  1Q81 C;  4JI6 Q;  2JXM B;  4A3D G;  1PRT C;  5JOB A;  4LF4 Q;  3PSI A;  5C5M A;  2ZXP A;  2EY1 A;  1PFS A;  1X3E A;  2A69 D;  1L1O C;  1LTB D;  3GTL B;  4KKT A;  3MVV A;  1EZ8 A;  2B63 B;  1F9Q A;  2DNE A;  4LFC L;  2IHE A;  2RKS A;  3KLS A;  1V8Q A;  3SEB A;  2GVA A;  4HIK A;  3I4N G;  3K80 C;  1CFM A;  3HKZ G;  3KYH C;  1VQ7 A;  2Q2T A;  1PTO H;  3WWV A;  5CV9 A;  5FLX E;  4RGN A;  3UDF A;  1WCM H;  1TY2 A;  4R8N A;  2ZT9 C;  1KNA A;  2BCO A;  4NPS A;  4WFN 3;  4B3M L;  2OTJ A;  4KJN A;  2PQA B;  3HOW G;  5E7N A;  4DV5 L;  1V9P A;  1X3P A;  2VXW A;  3CCJ A;  4LFA Q;  3RZO B;  2IT1 A;  2N3S A;  4NKL A;  2CW0 C;  1SND A;  3PIP 3;  3NQI A;  3KF8 B;  1KC8 C;  4GN5 A;  2MO0 A;  4B9W A;  4FF2 A;  5JVH 3;  5LMN L;  2JA8 G;  2B63 G;  5E1F A;  4QCL A;  3FMC A;  1L0Y B;  1CHQ D;  3KLS X;  4KY5 A;  1N34 Q;  4H7B A;  1HH2 P;  1RJT A;  1GHJ A;  2G9D A;  4KN7 C;  1B53 A;  2LMC B;  1M90 C;  5J39 A;  3KJO A;  4DAV A;  3HS0 C;  3DWQ A;  3CXC A;  1IYJ B;  2EIF A;  4UAI A;  1S5E D;  4CKC A;  1D1K A;  1X3G A;  1LT5 D;  1FJG Q;  2PNH A;  2EE1 A;  1H9S A;  2XWJ B;  2K01 A;  3G6E A;  1AN8 A;  1PYS B;  3FPU B;  1K8M A;  2IX1 A;  4LMQ D;  5IGG A;  2BE5 C;  1HQR D;  2RBM A;  2WP8 J;  1CQV A;  1HA5 A;  3I8Z A;  1I4G A;  3CCM A;  4RHR A;  4JI2 Q;  1E2Z A;  4DK3 C;  1P16 A;  4BY7 G;  3OMG A;  4DPG A;  3CCS A;  4LFB Q;  2NTT A;  1XPO A;  2R3Z A;  4TVA B;  2K5D A;  4LFC Q;  1SE2 A;  1VQG A;  2QW7 A;  1D7Q A;  1MJE A;  3MFY A;  2L1B A;  1A2U A;  1IKL A;  1R9T B;  1G6Z A;  2KHI A;  4FP5 D;  4Y7N B;  4ABN A;  3H3V I;  2LY7 A;  3HOV G;  2BA1 A;  1IXR A;  2K5W A;  4IO9 A;  4XYQ A;  1WD1 A;  1NTG A;  3CW2 C;  4RHS A;  5M3M B;  2VUM B;  2K03 A;  3TS2 A;  1J9O A;  3TBI B;  3H09 A;  3RZD H;  3NTK A;  4IPD A;  3PF4 A;  4OX9 L;  1VQB A;  3PO3 H;  5IT9 c;  3KF6 B;  2FXQ A;  1CSQ A;  1YNX A;  1WTP A;  1PVO A;  2F3V A;  1V1Q A;  1C8C A;  4N8X 1;  4TSS A;  2B2U A;  2HCC A;  4KJO A;  3NWT A;  3TP7 A;  1WOC A;  3J7A 5;  3CQZ B;  3NWS A;  4PG3 A;  3T13 A;  2BH8 A;  4G7Z C;  1EU3 A;  1K28 A;  4YIJ A;  1QB5 D;  2PO4 A;  4RCN A;  2NYZ D;  5C0X I;  4RKL A;  1BCP B;  3QR8 A;  2DY8 A;  2Y0S E;  4M8A A;  3CPF A;  3K5M A;  3NUC A;  5M9O A;  3GTM H;  3HOX G;  4LF6 L;  1CKM A;  3VR6 A;  2E2J B;  1EY4 A;  1MKH A;  2K50 A;  2FJ2 A;  4OEL B;  2V1C C;  5EKK A;  2NZ1 D;  1K8A C;  1VQN A;  3ZJY C;  3M85 A;  1FJG L;  4JBK A;  2VQE L;  3TDQ A;  4AYB B;  4JI8 L;  4YWL A;  1J8I A;  2UUC Q;  5I6W A;  3PO2 H;  5IYD H;  5IT9 E;  1JWU D;  3A55 A;  1GUO A;  4DR4 L;  4FXD A;  1VQF A;  4QF4 A;  5EGT A;  5J3B A;  4APV A;  5K5P A;  4R1J A;  4KD3 A;  1Q7Y C;  3BJU A;  4OXP A;  1HFG A;  1GKH A;  4C3J G;  1BBX C;  4L5R C;  2A5H A;  3CMA A;  5HUR A;  1CI3 M;  1L2F A;  2L12 A;  1SR3 A;  4XDX A;  4B3T L;  4IUQ A;  4DV3 L;  3R93 A;  3Q24 A;  4FF3 A;  1I4H A;  3U9S A;  4UPA A;  5LMN Q;  4DKA C;  1CZG A;  1TR5 A;  3HOY H;  3PGZ A;  3CHB D;  3CCQ A;  4A3E G;  1IBK Q;  2L9H A;  3F2C A;  3D8G A;  3HOZ G;  1VQ5 A;  1OXS C;  3OIQ A;  4A3D H;  1YHQ A;  3D4R A;  3I2Z A;  5JEA G;  3DLL A;  3TRZ A;  3H3V C;  1FGU A;  2KUM A;  4H13 C;  2NB0 A;  1N32 Q;  1T5X D;  2A19 A;  1BCP D;  1XMO L;  2Q8R E;  3L7Z C;  1YNN C;  2KCN A;  4JI5 Q;  5L37 A;  1UNS A;  2ICI A;  1TS2 A;  1AP0 A;  1S5C D;  3HOU H;  3AYH B;  1O7Z A;  1D5X C;  4V19 0;  3R3O A;  3GTP B;  1PZI D;  3CP0 A;  2K5H A;  3JAM E;  1STN A;  4UP7 A;  3S1M H;  4R4T A;  2RHQ B;  1LTG D;  2R92 H;  4YCW A;  4JI6 L;  2B3G A;  2EYL A;  1OXU A;  4L8J A;  1SEB D;  4BXX G;  4BS9 A;  1QZG A;  3J81 c;  3HOW H;  2CWP A;  1W3S A;  4J6H A;  5LHY 1;  1YIT A;  1VQO A;  4HJ8 A;  4RH6 A;  1JOQ A;  1CZW A;  1M8A A;  3J7Y W;  5M5Y B;  3HEJ A;  4A93 H;  3A5Z B;  3H0G B;  2K75 A;  5EPL A;  2JP1 A;  1V1P B;  4N9P A;  3IFT A;  5T1G A;  1I4Q A;  4G7H C;  1UUP A;  1XTC D;  3ITP A;  3NBH B;  1CQF A;  3URY A;  4U68 A;  4XTC S;  1I4P A;  3T1H Q;  2LXK A;  5LL6 S;  2QIL A;  4OX9 Q;  1Q1E A;  1NY4 A;  2ZJR A;  3I4N H;  3CME A;  1X56 A;  4KY7 A;  1AEX A;  1FL0 A;  1SJH D;  2FFK B;  1IL8 A;  4PZ8 A;  1NNX A;  1T5E A;  1L1O B;  4L5Q A;  5BR8 L;  2FIN B;  4K14 A;  4KHZ A;  3M4Y A;  1QWY A;  2WB1 G;  4DV1 L;  2K04 A;  3S15 B;  3B6Y A;  1E22 A;  3OYY A;  1A0I A;  1BNZ A;  3FKI H;  1JQY D;  2TSS A;  4RCO A;  5ELD A;  4DNI A;  2XIW A;  1GOZ A;  2F0O A;  1A3T A;  2B2W C;  1S5D D;  4LF4 L;  1IKM A;  3M9B A;  2YTX A;  3DEO A;  1DOK A;  5A35 A;  3QIA A;  1F9S A;  3K6O A;  4PNY A;  1Q90 A;  1RF2 D;  4DAM A;  4AYB G;  3TZD A;  1LM0 A;  5CGK A;  1ESR A;  5ELB A;  4N9T A;  2YU9 H;  1K0R A;  3S1N H;  4DR1 Q;  1X65 A;  1D8L A;  4K8J A;  2FHT A;  1B7Y B;  1MJC A;  2N8N A;  4JV5 L;  2R7Z H;  3S17 B;  1SYE A;  4DV6 L;  3LX0 A;  4M1U B;  4R9W A;  2F52 A;  3A74 A;  3K7U C;  1ASY A;  3AB9 A;  4C3I H;  1X54 A;  3C1E A;  3M3Y H;  3S9W A;  1I94 L;  1G51 A;  1IBL Q;  4F8M A;  1ZKO A;  1S5F D;  4BY1 B;  5FO7 B;  3KFU A;  2XVS A;  2F0M A;  4DXF A;  3HKZ B;  3NEM A;  2PNR C;  4OO1 I;  3ONA B;  2F1M A;  2E2I H;  3K0X A;  4OWX B;  3S1N B;  5C0X G;  2MGS A;  2JJQ A;  2KHJ A;  4QIW E;  1WTW A;  3NEN A;  1E0B A;  1AE3 A;  4A3B G;  4I65 A;  3HOZ B;  4C3I B;  2R92 B;  1A62 A;  1PTO F;  2PMZ E;  2RVL A;  3I91 A;  1EEI D;  3FKI B;  1TY0 A;  2E75 C;  3MEH A;  4DF7 A;  2E2I B;  4CDC C;  4DU9 A;  5COY A;  4IFD G;  2NVX H;  2O4X A;  1VQL A;  2KBN A;  1EY0 A;  4IUP A;  4DGZ A;  1YJ9 A;  5GAE C;  3J7Z C;  1SRU A;  3CCV A;  2Z4H A;  3UDX A;  1N36 Q;  2LSS A;  1JJC B;  1F9P A;  1PZK D;  3E9H A;  1IBM L;  4XYO A;  2XSC A;  3RN5 A;  1SLJ A;  3SHL A;  1QIL A;  5DM7 3;  4LJZ C;  2PPB C;  1ET9 A;  2ZTC A;  1AFP A;  1YNN D;  2JA8 H;  1K83 H;  4DV2 L;  1EOV A;  1A15 A;  2KOL A;  2QEJ C;  3D3R A;  4LFA L;  1DXM A;  1VQP A;  2XRS D;  3VR5 A;  1SNQ A;  3MWY W;  5G3L D;  5IT9 L;  1KTK A;  2SNM A;  2O5J C;  3K59 A;  3F2U A;  4JI0 Q;  4A3C G;  3IL8 A;  3I3C A;  4FF4 A;  2EY2 A;  3T16 A;  1E3P A;  1LTT D;  1F9R A;  1VMP A;  4A3E H;  4LF6 Q;  4X65 L;  3PIP A;  1PH4 A;  4QMG A;  5LMU Q;  1AE2 A;  1EYC A;  3A7L A;  3M7G A;  4GNX A;  2M00 A;  1PRT F;  1JB3 A;  4P75 A;  2I0Q A;  1LLR D;  4K6L A;  1HQM C;  1YJW A;  5LL6 X;  1P8L A;  3ULL A;  2QA4 A;  4OEM B;  3Q6S A;  3L9A X;  1G2S A;  4A3I B;  4DR6 Q;  1RD9 D;  1TWH B;  4JYA L;  3EJI A;  3RD4 A;  2BOS A;  4XQJ A;  3H0G G;  1YJN A;  4P72 A;  2F3I A;  2EDG A;  1XPU A;  1IYV A;  3EA6 A;  3PO2 G;  1TWA B;  1TS4 A;  3L3O C;  4ZRZ A;  4C2M H;  1GUG A;  1KAB A;  1Q82 C;  4DAY A;  4L63 B;  1HPC A;  1EQT A;  2PW7 A;  3PMF A;  4DR2 Q;  1LAB A;  3BVZ A;  1H9R A;  5F2D A;  1R9T H;  1DON A;  4JI4 L;  2VB2 X;  5CV8 A;  4BBR H;  2M9V A;  1IW7 C;  1SDF A;  2JA7 B;  2D62 A;  4JI1 L;  4P73 A;  3I4L A;  1A3U A;  3S2D H;  4IPC A;  1CKN B;  4QGU A;  4NXN Q;  1HR0 L;  2ZTE A;  5M3M H;  4YHH Q;  5CBA E;  1DZ1 A;  1EY8 A;  2UUA Q;  1D2B A;  2ASB A;  3PF5 A;  3GTQ B;  2F0H A;  2J7Z A;  4K8I A;  2R7D A;  4IJL A;  3A0J A;  1Y8O B;  3J80 E;  1C0A A;  2PYK A;  3S2H H;  4EQN A;  5CC4 A;  1X3Q A;  4A3M B;  1EY9 A;  2N78 A;  2XN9 C;  3NTH A;  5DM6 3;  1I3Q H;  2M2L A;  1CKN A;  1HNZ Q;  1HHV A;  5M3F B;  1N33 L;  4HJA A;  1Y8P B;  2WV6 D;  4V0B A;  3K58 A;  3C46 A;  5FO8 B;  5AJ3 L;  2IHF A;  4DV5 Q;  2F0F A;  1R4Q B;  4LF7 L;  3X3M A;  1YNJ D;  2K52 A;  5CV5 A; 
#chains in the Genus database with same CATH homology
 5CMD A;  5BN5 A;  2O5I C;  2K7V A;  1L0X B;  1QNK A;  4FF1 A;  2BE5 D;  5IGB A;  4ME5 A;  2WIN B;  3S2D B;  2QF7 A;  5JPN C;  5G3L F;  2IX0 A;  1CM9 A;  5KND A;  5D14 A;  5K36 G;  1PDQ A;  1QE6 A;  1I4R A;  3BVG A;  1TS3 A;  5C3E B;  1D1I A;  4DXG A;  3GTO B;  2QDB A;  1BOS A;  2IX3 A;  1OXT A;  1EYD A;  4TKO B;  1MGS A;  2J4X A;  2RSO A;  2CW0 D;  4ID6 A;  4CKB A;  2EOT A;  1DOL A;  1CT1 D;  1LTS D;  3MXG A;  2AQ1 B;  3PUW A;  4Q0F A;  4O42 A;  5A2Q E;  1S5B D;  3P7J A;  4RGT A;  3SK5 A;  3T51 B;  4HCS A;  3J81 E;  2B2Y C;  1VDZ A;  4FVM A;  1FD7 D;  2YU9 B;  1ENF A;  1QNU A;  5CV7 A;  1EEF D;  2L55 A;  2PQE A;  3MXU A;  3V2T A;  1STB A;  2F3W A;  1CA5 A;  3NSW A;  1SBB B;  5A2Q L;  1IYU A;  1KDA A;  2K28 A;  3FVQ A;  5JJZ A;  3RUZ A;  1WTQ A;  5BN3 A;  2Y0S B;  1HUM A;  4G7O C;  1XX8 A;  1KLU D;  3OHX C;  3A56 A;  3MC0 B;  4A3K B;  2KHS A;  1RHP A;  1I50 B;  1PFN A;  1JOR A;  1SXT A;  2WKC A;  2OF1 A;  3OW7 A;  5JEA J;  4K6D A;  3HZX A;  2B8F A;  2F0N A;  4OL7 A;  4KN4 C;  4HR7 B;  3JAM L;  1ZEQ X;  1VMC A;  3T4A C;  1FGB D;  1EL0 A;  2LS0 1;  3CRL C;  2R7Z B;  1B50 A;  1CK1 A;  2KED A;  3HP3 A;  5D3I B;  3CRK C;  4OIJ A;  2NVQ B;  3D6W A;  4HTH A;  5KGU A;  1ZXT A;  4IFD H;  2ZXO A;  3BYY B;  1PRT B;  1BUV T;  3QJY A;  5CR3 A;  4BBS B;  2D5D A;  3NBI A;  1EIG A;  4TQU S;  3T56 B;  4A3D B;  5FKA C;  2BDN A;  1U4L A;  2B8G A;  1TWC B;  1DOM A;  3K0Y A;  4IZ8 A;  1TS5 A;  2EYF A;  1A2T A;  1EY5 A;  4CGY B;  2KCC A;  2MHV A;  3HOV B;  2MP1 A;  4FXG C;  5KEE A;  3BG3 A;  2NBF A;  3VA7 A;  3FDT A;  1G8Z D;  2JE6 I;  4K5X A;  2HDL A;  3GTK B;  5C0X H;  4ZK9 B;  1D5Z C;  3ERQ A;  1V1P A;  1JE4 A;  1Z7T A;  1EY7 A;  3PIO 3;  3E6Z X;  3SVM A;  5I6Y A;  2ID0 A;  3DXJ C;  1GUS A;  3DUZ A;  4OIK A;  1I3Q B;  3MFG A;  3H6M A;  3VR2 A;  3PUV A;  4K2L A;  4CJ2 C;  3BDC A;  1SYB A;  1JIC A;  2Q8I B;  1R4P B;  1ILQ A;  3NPP A;  1DYQ A;  1JR0 D;  4BWG B;  5C3X A;  5C0X J;  1PTO C;  1PYW D;  4CJ1 B;  2NN6 H;  3ZYY X;  1SYG A;  1FR3 A;  3P1H A;  1SMY C;  2R61 A;  3K5N A;  4CJ0 B;  2PZU A;  4CHT B;  4ZKB B;  5ELC A;  3K5L A;  5CV4 A;  1Y8N B;  3BVM A;  3E5S A;  1MSH A;  4NDX A;  3MXP A;  4IFD J;  5I2Y A;  1TQO A;  4X3T A;  2K32 A;  1PZJ D;  2B2V A;  2PMZ B;  1AZP A;  1DJR D;  1B1Z A;  3I4M B;  3LWU A;  5CBE E;  2EY6 A;  2R93 B;  3DWP A;  2JEA I;  4CKE A;  1DM0 B;  2VNU D;  2N88 A;  3VYU A;  4QUC A;  2EYO A;  1LV9 A;  3H91 A;  1HXY D;  4DK1 A;  1YNJ C;  3EFX D;  4S3S A;  3KLR A;  1OO9 B;  3HOY B;  4WOR A;  3X3N A;  1W6J A;  1VF5 C;  2F0P A;  1ET6 A;  2K6A A;  4FXK C;  4IUU A;  2EJG C;  1EYA A;  4BY7 B;  1JCK B;  2AQ2 B;  4X3K A;  1PFB A;  2NVT B;  3PO2 B;  4HSP A;  4EGV A;  3SK6 A;  4KTA A;  4NMZ A;  3TME A;  4CBV A;  1WTV A;  3AU7 A;  1U4R A;  1I6H B;  2IW3 A;  3DHQ A;  5HGT A;  2F03 A;  2E76 C;  1STA A;  1SE3 A;  4WRD A;  1NR4 A;  2I07 B;  1EFI D;  4U67 3;  1O80 A;  2NTS A;  3KUP A;  5IGF A;  5KYI A;  1NR2 A;  2F0I A;  2OT2 A;  4F7X A;  1TU2 B;  5TSS A;  1NSN S;  4UDU C;  3NTI A;  5I9P A;  3GTJ B;  1H9M A;  1E2V A;  3P20 A;  1PFM A;  2EY5 A;  2IL8 A;  3OIP A;  4KKU A;  4MN3 A;  5E4X A;  2K1B A;  5FLX L;  1EZ6 A;  2JEB I;  4DAP A;  5D65 A;  2A68 D;  3O13 A;  4LK1 C;  1SSO A;  3SE0 A;  1MI2 A;  5KRU A;  1B2T A;  1STH A;  1LT4 D;  4PQX A;  5JAV A;  3PUY A;  3QG1 A;  2JYO A;  2A6H D;  1FNV A;  1CA6 A;  1A6X A;  3SK4 A;  4A3F B;  2MUY A;  2E74 C;  3WDN A;  1F2Z A;  3Q0A A;  3I90 A;  3Q22 A;  4KK7 A;  2SDF A;  4PMC A;  3EQL C;  4KY6 A;  2XWB B;  3NXW A;  1U4P A;  4R8I A;  4C3I G;  3D31 A;  4BA1 I;  2EVB A;  3BS1 A;  2EJM A;  1Y69 U;  2F0G A;  2GA4 B;  4XXE A;  3FPP A;  3CKI B;  3GO5 A;  5ELF A;  1TVX A;  3D6C A;  4XQN A;  1ONL A;  5EPJ A;  3MTS A;  3J81 L;  3I70 A;  3G7L A;  1WTR A;  3MAQ A;  1HCZ A;  1W6K A;  3VYR A;  1LTR D;  1ML0 D;  1H9J A;  1SNP A;  2EZV A;  3HG9 A;  2F0T A;  4KKS A;  3OOC A;  4Q5V A;  4K5V A;  4FNF A;  4ULL A;  2AWO A;  4L6T B;  5DAU A;  3V05 A;  1AZQ A;  1BQQ T;  4IQZ A;  1II3 A;  2RDH A;  4A3G B;  2B2W A;  3S1M B;  4C2M B;  3N52 A;  3R2I A;  2RSN A;  5C6A A;  1SAP A;  4BA2 I;  2X6L A;  1DD2 A;  2A6H C;  4F88 A;  1QOH A;  1Q12 A;  5KNC A;  5ISR A;  3BDL A;  1K83 B;  1MBY A;  2L5T A;  3K7A B;  2EJF C;  1O78 A;  4Z9C B;  5EBD A;  2JSO A;  5DNF A;  1Q3L A;  2F0J A;  1JC7 A;  2AUK A;  5C4H A;  2NUC A;  3OSO A;  4XT1 B;  1JWM D;  4MIU A;  2X69 A;  4A3E B;  1ESF A;  1A3V A;  5C44 B;  3PV0 A;  2KEE A;  4I7Z C;  1B3A A;  5JPM C;  2EYM A;  1SE4 A;  3BYT B;  1BF4 A;  3NP8 A;  4J8Q A;  3QOL A;  4ZUI A;  5EPK A;  3ND9 A;  2CVR A;  2HUG A;  3S16 B;  2C9O A;  1GJX A;  4HED A;  1FNW A;  2PW5 A;  3C3L A;  5KYL A;  3VYT A;  1EU4 A;  5FK9 C;  2F0D A;  4KV6 A;  3I4N B;  5I9O A;  4HN7 A;  1LTI D;  1HFN A;  3SDZ A;  4HMI A;  4DFA A;  1V1O A;  3QO2 A;  3K5O A;  3M7N A;  4A3J B;  1D5M C;  3OWF A;  1WTO A;  5EKI A;  2FMC A;  3MHB A;  1OXX K;  1VCI A;  3UI2 A;  3WOE A;  3BZD B;  2JA5 B;  3VR3 A;  5AFW A;  4HMJ A;  1STE A;  3N6R A;  1FNU A;  5E4W C;  1B9M A;  3ND8 A;  4J1M A;  3A8I E;  1BCP C;  2KQ3 A;  2B2U C;  1K8O A;  5NUC A;  1Z6H A;  3BDO A;  3H94 A;  2TMP A;  3GV3 A;  3D4W A;  4XQQ A;  2OEO A;  4DA2 A;  3EVQ A;  2YYZ A;  4BBR B;  3TSS A;  2NVY B;  2F0Q A;  2E2H B;  5EKL A;  4NP5 A;  1KDC A;  3HGB A;  2HCI A;  1U4M A;  3A7A B;  3TZU A;  4QIW B;  4JBW A;  5IGD A;  1GUN A;  2RDF A;  3M4O B;  1SFO B;  5JEA H;  5ELE A;  1QG7 A;  2HQE A;  1TWG B;  2EYJ A;  3FEW X;  1JOO A;  2ENB A;  4ILW A;  4F87 A;  5IOD A;  4RGM A;  4DK0 A;  3S1Q B;  3GP7 A;  3IKJ A;  1SYD A;  2XRQ D;  2V4D A;  3C1F A;  3NHH A;  2JA8 B;  3GD7 A;  1LT6 D;  1QJO A;  3C2P A;  2DY7 A;  5DEH A;  4DNT B;  3SXH A;  3S14 B;  2Z1C A;  1Y1W B;  3SK8 A;  4RKB A;  3Q23 A;  1IHZ A;  1QCB D;  4HSV A;  3HOW B;  2BDO A;  4PV1 C;  5FO9 B;  4RWS C;  5CYU A;  3RMH A;  4H44 C;  3GV6 A;  2K05 A;  2I46 A;  4E6I A;  5K36 H;  5KNB A;  4IUR A;  3FRP B;  2CQA A;  2NWG A;  2N55 A;  1H9S B;  2WII B;  3PO3 B;  1PRT D;  3W2D A;  1O7Y A;  5T1I A;  3U9O A;  4IUT A;  5C4X B;  3KBG A;  1GUT A;  1SNM A;  4A3B B;  2JA6 B;  4ODG A;  3DMU A;  4RA8 A;  2DN8 A;  1SYF A;  5EQ0 A;  3QWN A;  4DNR B;  1G29 1;  5C4J B;  1RTO A;  3NE5 B;  4NW2 A;  3KF8 A;  4C3J B;  5D3D A;  1SNO A;  4P2C B;  1STY A;  4IUV A;  1TWF B;  1DCZ A;  4DN4 M;  4TRD A;  1TT2 A;  1Q1B A;  2EYP A;  5IOC A;  1ZYR D;  4QB4 A;  4C1N I;  1C48 A;  1JOK A;  3IFD A;  2R6G A;  1XWE A;  1VF7 A;  1HA6 A;  3T53 B;  1RCV D;  2G9H D;  3W3A A;  3PUX A;  5FOB B;  3S1R B;  4OO1 G;  2A6E C;  5BN4 A;  1JWS D;  2L0C A;  2F0E A;  5E3F A;  4ZUJ A;  1NUC A;  1KLG D;  3R2T A;  2Q8T A;  4B08 A;  4K2K A;  1EOT A;  4RAU C;  4OO1 H;  1LT3 D;  2NVX B;  4ZLT F;  1F2M A;  4X3U A;  2A69 C;  1PMR A;  2H4O A;  3MA2 B;  3GQB A;  3KBX A;  2SNS A;  1O7L A;  3A54 A;  1MSG A;  2B39 A;  4KD4 A;  2NN6 G;  5C3W A;  5CV6 A;  3CU7 A;  1HRJ A;  4G57 A;  4HAE A;  1B9N A;  1HTP A;  2RQX A;  5M5X B;  2SOB A;  1V43 A;  4EQP A;  1G91 A;  3P75 A;  2B2T C;  1SYC A;  2AQ3 B;  3I73 A;  4XIG S;  3K57 A;  2XNA C;  2AUJ D;  2KA7 A;  3J7A V;  2H1E A;  2QKI C;  4OGQ C;  1G2T A;  3PUZ A;  3NK9 A;  3DWA A;  4LAA A;  1HUN A;  2EPB A;  2B2T A;  1ENA A;  1Q8I A;  3IAY A;  2CHB D;  2EXZ A;  3HOU B;  1F2Y A;  5KIX A;  4ZYS A;  1TKW B;  4PMW A;  2A73 B;  3GTG B;  1SNC A;  3A8K E;  3HRZ C;  1M4V A;  4IAL A;  2WAC A;  5M5W B;  3M3Y B;  3KK7 A;  3HOX B;  1EY6 A;  1D6E C;  5IGC A;  4XT3 B;  1BDO A;  1GXD C;  1RDP D;  2A6E D;  2Z4I A;  3OWE B;  2ICE C;  1LAC A;  3S2H B;  1UAP A;  2KEC A;  3MXN A;  1GUW A;  4K5W A;  5J1Z A;  1Z47 A;  3RZD B;  2VB3 X;  2IJ0 A;  1KNE A;  3DEP A;  2LKV A;  4IUN A;  5COR A;  1BXT A;  1NAP A;  4FYD A;  4WJW A;  4QUF A;  3G6J B;  1CTM A;  1EQV A;  1NCV A;  4KMU C;  4FO2 A;  1EWH A;  2F0U A;  4G4K A;  4RFB A;  2D2C C;  3SR1 A;  4C3H B;  1XXG A;  4KHV A;  2PZW A;  2PCF B;  4GZY C;  1SMY D;  4O1N A;  2F0W A;  5IIF A;  2RDG A;  4C3H G;  3VYS A;  2ZXR A;  1B44 D;  1PTO D;  2D9U A;  2L11 A;  1I4X A;  3QOJ A;  3WOF A;  1IW7 D;  1B4O A;  3A8J E;  4IFD I;  2B2V C;  2MJ8 A;  4C56 C;  3E0J A;  5JVG 3;  2A74 C;  2F4I A;  4ZQ3 A;  1WVL A;  3J80 L;  2OXP A;  1ICW A;  5IGE A;  4HCE A;  3LWE A;  2B2Y A;  3LNN A;  3VA5 A;  2K33 A;  3I72 A;  2AWN A;  2F0L A;  1BO0 A;  2L4N A;  1KAA A;  2QCP X;  4JK1 C;  1XYI A;  4EVO A;  3QB3 A;  5EJW A;  2LFN A;  1CHP D;  4PMB A;  2BA0 A;  2WAQ B;  2X6G A;  3TP5 A;  1BCP F;  1GHK A;  3NQT A;  1ILP A;  1E2W A;  2EYH A;  5J22 A;  4RGO S;  1OXV A;  2E2D C;  1PLF A;  2WKD A;  1PTO B;  4MHE A;  3OMC A;  3OPO A;  2SEB D;  2O2L D;  3J7A F;  1Y1V B;  1KDB A;  4EQO A;  1F2L A;  2MPM A;  4C1N K;  1TII D;  3ERO A;  5C4Z A;  2KJX A;  3MZ5 A;  2HDM A;  1RKN A;  1FYC A;  1H9K A;  4A93 B;  4OHJ A;  2WB1 B;  3R8B A;  1MD2 D;  2C5C A;  1HTL D;  1LO5 D;  1UEA B;  1BR9 A;  3TN2 A;  1RTN A;  4KI0 A;  1ENC A;  4H0L C;  1X32 A;  4ZAI A;  3RLF A;  2A68 C;  4X3S A;  2IWH A;  1F77 A;  2F0K A;  2NN6 I;  1STG A;  3VR4 A;  1ROD A;  2DNC A;  1ZYR C;  5C5L A;  3GTM B;  1S4Z A;  3DM1 A;  1U9R A;  2F0V A;  3NBH A;  1WTX A;  1EIH A;  4ZKC B;  2KVM A;  1WD0 A;  2FMM A;  3TP6 A;  1I6V C;  1SJE D;  3D4D A;  2F0S A;  2IPK D;  3V96 A;  1AW7 A;  5I2X A;  2RA4 A;  1WCM B;  2K5Q A;  5I4D A;  1LTA D;  1C4Q A;  1PXU A;  4B9X A;  4IN3 A;  1EWC A;  5EBC A;  3AMU A;  3TP8 A;  2PZT A;  2J0T D;  2Z8L A;  2JXM B;  1PRT C;  5JOB A;  5C5M A;  2ZXP A;  2EY1 A;  2A69 D;  1LTB D;  3GTL B;  4KKT A;  3MVV A;  1EZ8 A;  2B63 B;  1F9Q A;  2DNE A;  2RKS A;  3KLS A;  1V8Q A;  3SEB A;  1CFM A;  1PTO H;  5CV9 A;  5FLX E;  4RGN A;  1TY2 A;  4R8N A;  2ZT9 C;  1KNA A;  2BCO A;  4WFN 3;  4KJN A;  1X3P A;  2VXW A;  3RZO B;  2IT1 A;  4NKL A;  2CW0 C;  1SND A;  3PIP 3;  3NQI A;  4B9W A;  4FF2 A;  5JVH 3;  5E1F A;  4QCL A;  3FMC A;  1L0Y B;  1CHQ D;  3KLS X;  4KY5 A;  4H7B A;  1RJT A;  1GHJ A;  2G9D A;  4KN7 C;  1B53 A;  2LMC B;  5J39 A;  4DAV A;  3HS0 C;  3DWQ A;  4UAI A;  1S5E D;  4CKC A;  1D1K A;  1LT5 D;  2EE1 A;  1H9S A;  2XWJ B;  2K01 A;  1AN8 A;  3FPU B;  1K8M A;  2IX1 A;  5IGG A;  4LMQ D;  2BE5 C;  1HQR D;  2RBM A;  2WP8 J;  1CQV A;  1HA5 A;  3I8Z A;  1I4G A;  4RHR A;  1E2Z A;  3OMG A;  2NTT A;  2R3Z A;  2K5D A;  1SE2 A;  3MFY A;  2L1B A;  1A2U A;  1IKL A;  1R9T B;  1G6Z A;  4FP5 D;  4Y7N B;  4ABN A;  2LY7 A;  2BA1 A;  2K5W A;  4XYQ A;  1WD1 A;  4RHS A;  5M3M B;  2VUM B;  2K03 A;  1J9O A;  3TBI B;  3H09 A;  3NTK A;  1WTP A;  2F3V A;  1C8C A;  4TSS A;  2B2U A;  2HCC A;  4KJO A;  3NWT A;  3TP7 A;  3CQZ B;  3NWS A;  3T13 A;  4G7Z C;  1EU3 A;  4YIJ A;  1QB5 D;  2PO4 A;  4RCN A;  2NYZ D;  5C0X I;  4RKL A;  1BCP B;  2DY8 A;  4M8A A;  3K5M A;  3NUC A;  5M9O A;  3VR6 A;  2E2J B;  1EY4 A;  2FJ2 A;  5EKK A;  2NZ1 D;  3M85 A;  3TDQ A;  4AYB B;  1J8I A;  5I6W A;  5IT9 E;  1JWU D;  3A55 A;  1GUO A;  4FXD A;  4QF4 A;  5EGT A;  5K5P A;  4KD3 A;  1BBX C;  1HFG A;  4C3J G;  2A5H A;  5HUR A;  1CI3 M;  2L12 A;  4XDX A;  4IUQ A;  3R93 A;  3Q24 A;  4FF3 A;  1I4H A;  3U9S A;  1CZG A;  1TR5 A;  3CHB D;  2L9H A;  3D8G A;  1OXS C;  3OIQ A;  3D4R A;  5JEA G;  3H3V C;  2KUM A;  4H13 C;  2NB0 A;  1T5X D;  1BCP D;  2Q8R E;  3L7Z C;  1YNN C;  2KCN A;  1UNS A;  2ICI A;  1TS2 A;  1AP0 A;  1S5C D;  1O7Z A;  1D5X C;  4V19 0;  3R3O A;  3GTP B;  1PZI D;  3JAM E;  1STN A;  1LTG D;  2EYL A;  1OXU A;  4L8J A;  1SEB D;  4BS9 A;  4J6H A;  5LHY 1;  4RH6 A;  1JOQ A;  1CZW A;  1M8A A;  3J7Y W;  5M5Y B;  3HEJ A;  3H0G B;  5EPL A;  2JP1 A;  1V1P B;  4N9P A;  3IFT A;  5T1G A;  1I4Q A;  4G7H C;  1UUP A;  1XTC D;  3ITP A;  1CQF A;  3URY A;  4U68 A;  4XTC S;  1I4P A;  5LL6 S;  2QIL A;  1Q1E A;  4KY7 A;  1AEX A;  1SJH D;  2FFK B;  1IL8 A;  1T5E A;  2FIN B;  4K14 A;  4KHZ A;  3M4Y A;  1QWY A;  2K04 A;  3S15 B;  1BNZ A;  1JQY D;  2TSS A;  4RCO A;  5ELD A;  2XIW A;  1GOZ A;  2F0O A;  1A3T A;  2B2W C;  1S5D D;  1IKM A;  3DEO A;  1DOK A;  5A35 A;  3QIA A;  1F9S A;  3K6O A;  4PNY A;  1Q90 A;  1RF2 D;  3TZD A;  5CGK A;  1ESR A;  5ELB A;  4N9T A;  4K8J A;  2FHT A;  3S17 B;  1SYE A;  3LX0 A;  4M1U B;  4R9W A;  3AB9 A;  3C1E A;  3S9W A;  4F8M A;  1ZKO A;  1S5F D;  4BY1 B;  5FO7 B;  2XVS A;  2F0M A;  4DXF A;  3HKZ B;  2PNR C;  4OO1 I;  3ONA B;  2F1M A;  3S1N B;  5C0X G;  2MGS A;  1WTW A;  1E0B A;  4I65 A;  3HOZ B;  4C3I B;  2R92 B;  1PTO F;  2RVL A;  3I91 A;  1EEI D;  3FKI B;  1TY0 A;  2E75 C;  3MEH A;  4DF7 A;  2E2I B;  4DU9 A;  5COY A;  4IFD G;  2O4X A;  1EY0 A;  4IUP A;  4DGZ A;  2Z4H A;  1F9P A;  1PZK D;  4XYO A;  2XSC A;  3SHL A;  1QIL A;  5DM7 3;  4LJZ C;  2PPB C;  1ET9 A;  1AFP A;  1YNN D;  1A15 A;  2KOL A;  2QEJ C;  3D3R A;  1DXM A;  2XRS D;  3VR5 A;  1SNQ A;  3MWY W;  5G3L D;  5IT9 L;  1KTK A;  2SNM A;  2O5J C;  3K59 A;  3F2U A;  3IL8 A;  3I3C A;  4FF4 A;  2EY2 A;  3T16 A;  1LTT D;  1F9R A;  1VMP A;  4QMG A;  1EYC A;  3A7L A;  3M7G A;  2M00 A;  1PRT F;  1JB3 A;  1LLR D;  4K6L A;  1HQM C;  5LL6 X;  3Q6S A;  3L9A X;  1G2S A;  4A3I B;  1RD9 D;  1TWH B;  3EJI A;  3RD4 A;  2BOS A;  4XQJ A;  2EDG A;  1IYV A;  3EA6 A;  1TWA B;  1TS4 A;  3L3O C;  4ZRZ A;  1GUG A;  1KAB A;  4DAY A;  4L63 B;  1HPC A;  1EQT A;  2PW7 A;  3PMF A;  1LAB A;  3BVZ A;  1H9R A;  5F2D A;  1DON A;  2VB2 X;  5CV8 A;  2M9V A;  1IW7 C;  1SDF A;  2JA7 B;  2D62 A;  3I4L A;  1A3U A;  5CBA E;  1DZ1 A;  1EY8 A;  1D2B A;  3GTQ B;  2F0H A;  2J7Z A;  4K8I A;  1Y8O B;  3J80 E;  2PYK A;  4EQN A;  5CC4 A;  1X3Q A;  4A3M B;  1EY9 A;  2XN9 C;  3NTH A;  5DM6 3;  1HHV A;  2M2L A;  5M3F B;  1Y8P B;  2WV6 D;  4V0B A;  3K58 A;  3C46 A;  5FO8 B;  2F0F A;  1R4Q B;  3X3M A;  1YNJ D;  5CV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...