5IT9L

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
155
structure length
155
Chain Sequence
b'STELTVQSERAFQKQPHIFTNPKAKANRKTKRWYKNVGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTRMHRTIVIRRDYLHYVPKYNRYEKRHKNVPAHVSPAFRVQVGDIVTVGQCRPISKTVRFNVLKVASATGKANKQFAKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
total genus 19
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00366 Ribosomal_S17 Ribosomal protein S17
L PF16205 Ribosomal_S17_N Ribosomal_S17 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1000 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5it9L00
5IT9L 3J81L 3JAML 5LL6X 3J7AV 5A2QL 5FLXL 3J80L
chains in the Genus database with same CATH superfamily
1KL9A 4M1UB 1KDAA 3TP5A 4A76A 4B08A 3U50C 4K6LA 5FLXL 1H9JA 5E4WC 4IQZA 2IHFA 3A8IE 2VW9A 2JQOA 5K36G 1ZXTA 1U4RA 1EY5A 1A3TA 4FO2A 1V43A 1VMPA 5ELCA 2F0FA 3HOYG 1F9RA 2C5CA 4O1NA 3H0GH 3J7AV 2O4XA 1EWIA 4YCUA 2EYJA 3H3VC 4X6AH 2L0CA 1IBMQ 4RGNA 4C2MH 4AYBB 3KDFB 5D65A 4FVMA 1EU3A 3SE0A 1DZ1A 2QA4A 5IYCH 1VDZA 1PDQA 2K5HA 1TQOA 1MSGA 3U9OA 5J39A 1TS5A 3CU7A 4WJ3M 3ZYYX 2WACA 2C35B 3NELA 4N9PA 1ET9A 4IFDJ 3QOLA 4A93H 2N3SA 2Z0SA 2LFNA 4A3KB 2E2JH 3SEBA 2Z6KA 4DXGA 4H7BA 2K4KA 1C48A 3D4WA 1D7QA 1UE5A 4DN4M 5JAVA 2Z1CA 1E3PA 2KOLA 3DEPA 5K36H 4A3CG 4H02A 4TVAB 3FRPB 4JI6Q 1V1PA 2NVXH 2SDFA 1BCPF 3AFPA 5C3WA 1KDCA 1B70B 3HOYH 4EX5A 2YTYA 4A3FB 4BY1H 2OQKA 1VQCA 4JG2A 1CHPD 3S14H 3CMAA 2CW0C 2UUAQ 4LMQD 1FL0A 4YWMA 2F0IA 1JOKA 4H44C 5M5WB 1E2VA 4QB4A 4LNQA 2PW5A 2AKWB 2B2YC 3K6OA 2F3WA 2MJ8A 4R9WA 1EY0A 3ITPA 4A3EG 4KI0A 4Q5VA 3K0YA 1ICWA 4NB3A 2GN5A 3NQIA 2RDGA 3PO2H 1DCZA 1AN8A 1NE3A 4DK6C 1PH9A 1KQSA 2EDGA 4DR6Q 1AE3A 3H6MA 2NB0A 2ZM6L 2L4NA 2HDLA 3RZDH 1HPCA 3KF8A 5GAEC 3T51B 1WI5A 3I4NH 4R4IA 5C0XG 3I4LA 1FD7D 1J5EQ 4A3CH 3HZXA 3GTGH 2KEEA 3R8BA 1HNZQ 1AFPA 1PZKD 1SJHD 1N34L 1OXSC 4B3RL 1VQ6A 3H09A 2Q2HA 2AHOB 2F4IA 3H15A 2B2WA 2F0SA 1HRJA 4PZ6A 5EGTA 1C4QA 4L63B 3M85A 3HOZH 2JSOA 3STBD 1VQLA 5J1ZA 5COYA 3T1HL 3K5LA 1JWMD 1BCPD 2IX1A 4QY7A 1D2BA 1PXUA 1U4LA 1Q1EA 3EFXD 4PZ8A 5C0XI 4CDDC 5EKKA 1VQBA 1RD9D 4A3EH 5CV9A 2I5LX 2RKSA 2Q8IB 2VXWA 5LMNQ 2OCEA 1Z9FA 2HIXA 3OPOA 2EE1A 4DR3L 5CMDA 2EZVA 1YJNA 2JEAI 5EAYA 1HR0W 5CV8A 4DV4L 5C4JB 4ZLTF 4A75A 1QZHA 1PHJA 5AFWA 1H95A 2FHTA 5C0XH 1SNPA 2R7FA 2X6LA 4UPAA 1A2TA 1VQKA 4G57A 1JR0D 1NBWA 5ELOA 4POFA 1YJWA 4YWKA 3OOCA 4JC0A 1EYGA 4A3FG 1H9SB 3T1YL 4ZUJA 4DPGA 4JI3L 2EXDA 3FMCA 1OXVA 3S1QB 3EVQA 4MIUA 2KCTA 3SDZA 4M8AA 4NP5A 3M4QA 4G7ZC 1KNEA 1NJIC 3FVQA 3UDXA 2RDHA 1SR3A 1ZYRC 3PV0A 5EBDA 3S1RB 4NXNL 2WIIB 4I7ZC 5I2YA 1VF7A 3GTQB 2RA4A 3A8JE 2PMZB 2O2LD 2PO4A 4ZUIA 4IO9A 3S17B 4X65L 1IXRA 2K14A 3WOEA 4A3KH 3GD7A 1ENFA 5IYDH 3MXNB 1DOLA 3LX0A 1TWAH 1CM9A 1QZGA 3J81L 3A7AB 1NMFA 1K8AC 3WOFA 1Y1VB 5ELEA 2ZM6Q 1XPRA 1DOMA 3K0XA 3K7UC 3ZJYC 2QDLA 3H3VI 2JA7H 1N32Q 1STEA 1TIID 1GM5A 1A6XA 1V9PA 2Q8TA 4XQNA 1KHIA 1HFGA 3WDNA 1OTCA 2PNHA 4DV0L 3PGZA 1Z47A 4KD3A 1N34Q 4B3RQ 2JA6B 4N8X1 4EQNA 3SVMA 4A3GG 4UP9A 3S2DH 3R2IA 5M5WH 4R4TA 3H3VH 4RG1A 3PF4A 3T1HQ 3FKIH 3QWNA 3HOUB 4DR5Q 4BBSB 1E24A 2MPMA 3CP0A 4V0BA 2MFIA 4JI5L 2BE5C 1SMYD 3M9BA 1PA6A 2RVLA 4LF4L 1HUMA 5D3DA 2F1MA 3L3OC 1CTMA 1Q3LA 3L7ZC 1PYWD 3NHHA 3TP8A 3HOWB 3DM3A 1O7LA 1CKOA 3MA2B 4DR3Q 3D3RA 1XMOQ 1A8VA 3DWQA 4GNXA 1W3SA 4DV4Q 2KHSA 1Y69U 1Y1WB 1NTGA 2ZJPA 2D9UA 5ELBA 4C3IG 1C0AA 2B2UA 2F4VL 4BY7B 2PNRC 4XDXA 2OTJA 4DAPA 3T1YQ 2HD3A 3CPFA 2XVSA 1X65A 2HT1A 2PMZE 4JI3Q 5IP7H 4OXPA 1EIFA 2FJ2A 3FP9A 1HQMC 1R4QB 5E4XA 1XNQQ 1MHWC 1IKLA 4ME3A 3BVGA 3FHWA 4K5XA 4FF2A 4G7HC 1SNDA 1WCMB 3S15B 1EL0A 1PFNA 4RA8A 2B63H 2E75C 3QG1A 4NXNQ 4CDFC 1AEXA 2FMMA 4WORA 1IYUA 1S5BD 1PYBA 3KBXA 1IKMA 2F3VA 4KHZA 1SYGA 4I7AA 2VY3A 1GHKA 1EQVA 1ML0D 4RH6A 1Y1VG 3PUYA 3A7LA 4IPHA 2IJ0A 1CFMA 1IBLL 1RHPA 4U68A 2VUMB 3MHBA 3K80C 2WAQB 1D1KA 3HG9A 3NK9A 4QIWE 2XN9C 5IIFA 1DONA 3AB9A 1D5MC 1VQAA 1UE1A 2OF1A 3IFTA 2K01A 5A2QE 4LUVA 3K5NA 2JA6G 4DV0Q 2FFKB 4DV6L 3M3YB 4G7OC 1KAAA 1ENCA 1OXUA 2M2LA 1LT5D 3S1QH 2R6GA 2JN4A 4NMZA 1BBXC 3S1MB 2A1AA 4MHEA 1X56A 3DM1A 3NXWA 4JI8L 3M4OB 1V1OA 2KBNA 3HOUG 4J1MA 4BBSG 5HY6A 4LFCL 3S1RH 1B1ZA 3RZOB 1EOTA 4KJOA 2K5WA 3QO2A 4OELB 1WTQA 2NUCA 1M90C 4FF4A 1XMQL 1S5ED 4LF4Q 4BXXG 2NZOA 1B3QA 3J80L 4DR1L 2K04A 3HRZC 1I50B 1X9NA 2WINB 3HOWG 2Z6BA 4HCEA 4JVZA 1E22A 1LTLA 1Y1VH 2MP1A 5KYLA 5IE8A 2R61A 1I3QH 3I4OA 3S24A 3HOXB 2EVBA 3TZUA 1Y1WG 1I94L 3SK8A 3A74A 3W2DA 5EPKA 5JPNC 4K0KL 1Q8KA 2ZXRA 1OXXK 3PIOA 4HIKA 3S9WA 3U4VA 5JPMC 4BY7G 2E2HB 5IOCA 2JA6H 3OW2A 1HR0L 5BN4A 5DM63 4LFAL 4HJAA 1S72A 3KOJA 1HUNA 3FEWX 1I4XA 2DN8A 3BDOA 3TREA 3CCJA 2PQAB 4F8MA 1YNJC 4BBSH 1X55A 2QEJC 4HJ9A 3V05A 2MGSA 2XNAC 4FNFA 1ESFA 2VB3X 1WFQA 4LFBL 4OX9L 3NTIA 4BXXH 2LMCB 1PFBA 4DR4Q 4BBRB 5EKIA 3HOWH 1YNNC 4DAYA 3R93A 3I3CA 1WTRA 1A3UA 5LHY1 2SEBD 5C3EB 3GTKB 4P74A 3ONAB 4R8NA 2DNCA 2VUMG 1SLJA 2GVBA 5M3MB 2DJFC 2B2WC 4KMUC 1Y1WH 4JI1L 1IBLQ 1ZKOA 2A69C 2ZJRA 1XPOA 4OO1I 4UHVA 4KD4A 3RN2A 5IT9L 3I8ZA 2DJGC 4IJHA 3D8GA 4X62L 4P72A 2VQFL 2HCIA 4GKKL 4YWLA 4BY7H 3VR3A 1UE6A 1N33L 1QNUA 1JORA 1RF2D 1IBKL 1V8QA 2HCCA 2WB1E 3QIAA 1G2TA 1O80A 2JJQA 4A3JB 3PIO3 2MHVA 3TDQA 1QUQB 3RLNA 2PQEA 4OIJA 1IYJB 2XTIA 2FMCA 5TSSA 1KABA 1PRTF 4OO1H 4JI8Q 1JC7A 1SNOA 1WCMH 3URYA 3AQQA 3N6RA 3G7LA 4V190 1QCBD 1EQQA 1XTCD 1S3OA 5C5LA 4YHHL 2WB1G 2LXKA 1R9TB 1HHVA 3SGIA 5C4HA 4DXFA 1XMQQ 2JA5H 4WJ4A 3CC4A 4POGA 2A8VA 1E2ZA 1NAPA 4LF9L 4HMIA 1SBBB 2M9VA 4F88A 1M1KC 2F0HA 1H9KA 1SE2A 2BA0A 3J7A5 3E9IA 4I65A 1KNAA 3S1NB 1EU4A 2EJGC 3VR5A 2VUMH 3RLFA 3T4AC 4IN3A 1KTKA 1I94Q 2NN6G 3RR5A 4NKLA 4CDEC 2OXPA 3I4MB 4L6TB 4K0KQ 4JCVE 4Z9CB 1F2ZA 3OMGA 3ERQA 1BVSA 5G3LF 3M3YH 4A3MH 4GLAC 2RF4A 3IFDA 4JI2L 1UE7A 5I6WA 1PH7A 2HUGA 2VZAA 3AMUA 4LF6L 1X3PA 1WTPA 3M4OH 4JI7Q 4IFDI 2N78A 4TQUS 4KK7A 5JVH3 3RZOH 2IY5B 1JICA 1U4MA 4RHRA 1J8IA 3A0JA 1BBUA 4B3SL 1LTRD 3C3LA 3OTOL 2F0VA 4C56C 5CV6A 1EUJA 5I9OA 3A5ZB 1GUWA 1JWSD 4BBRG 5M5YB 2K7VA 3P20A 4JBKA 1NY4A 3MEHA 4MTKA 3RN5A 3NWTA 3NENA 4DK3C 5C3EG 3HOXH 4QJFA 1PV4A 1EY6A 4P73A 5M3MG 1CSQA 4TRDA 1VQ9A 1SMXA 3T16A 3CCQA 5KNDA 4N8FA 3K7AB 4JI1Q 2YYZA 1B2TA 2A19A 4P75A 2A5HA 2IHEA 2ZJQA 1FNUA 1W6KA 2E2HH 2RSOA 2OEOA 4K8JA 1E1OA 2VQFQ 3EIVA 4GKKQ 2FXQA 3TZDA 1X54A 1N33Q 3C2PA 3E6ZX 4AIMA 2H4OA 1C8CA 4A3JG 4CHTB 2C9OA 5J3BA 1IBKQ 1VQPA 3J80i 2A6HD 3DUZA 2E2DC 3NBHB 2IPKD 2Z4HA 4KV6A 4LJZC 5G3LD 1F77A 2VL6A 2NZ1D 3PMFA 2I46A 1T5XD 2NVYB 4A3LG 4K5WA 4YHHQ 3KF6A 2F0MA 2SNMA 4OL7A 1SROA 1RJTA 4OGQC 4DA2A 4XTCS 4IOCA 4LF9Q 2B2UC 3GTKH 3CCMA 4S3SA 3NBIA 5I9PA 1LTID 5M3MH 3W1BA 2CCZA 1LTAD 1JJCB 3R3OA 2UUCL 4K5VA 5HGQA 3K8AA 3I4MG 5BN5A 2QGQA 4R8IA 1B7YB 1VQNA 2K5NA 4LK1C 4LF5L 3AEVA 3RNUA 2PZTA 1JJ2A 4XYQA 2DY7A 1PTOD 3M4YA 3ND9A 4B3TL 4IUNA 4JYAQ 1GOZA 4HMJA 3V96A 2Q8RE 1K8GA 4JPBW 4JI2Q 1K3BC 1TT2A 3GTJB 3OSOA 4WRDA 5D14A 4LF8L 2PW7A 4CJ1B 4KTAA 4LF6Q 1MJEA 1EEFD 1HZCA 2H1EA 1JWUD 5M5XB 4L5TA 4WFN3 4FF1A 2CQOA 3FPUB 3KLRA 4L5QA 1STYA 2BDNA 3VR2A 2R92B 4AQYL 1R9TH 3OYYA 1XWEA 3OTOQ 4JV5L 4A3LH 3W5OA 2MQHA 4RFBA 2E5LQ 5IGEA 1WTWA 1KLUD 4J15A 3A54A 1TS3A 1A62A 3TEHB 4GS3A 1WYDA 2UXCL 1GKHA 1GUNA 2EY2A 4JW0A 5KYIA 3EA6A 1DJRD 2VS1A 3S1NH 4IJLA 1QJOA 2R3ZA 5FLXE 3K5OA 5EJWA 1MJCA 1QVCA 3DMUA 1TXYA 4HSVA 4R4CA 1FGBD 2E74C 3STBC 1ONLA 4ULLA 1L0XB 5FLXc 2NTTA 3DXJC 4GN3B 3IRBA 2XWJB 5M3FG 3EN2A 1X3EA 1BO0A 3IAYA 4P2CB 4DUYL 1PVOA 3OHXC 1B9MA 1QVGA 5LL6X 2LSSA 5LMUL 2PI2E 4XQQA 4YCWA 3SXHA 1CKNA 2OWOA 2D0PA 4CGYB 4A3GB 3HFZB 3Q24A 3CD6A 3MFGA 1RL2A 2KCNA 1PH2A 1TS2A 5M5YH 3D4RA 1TWFB 2I5MX 3CC7A 1S40A 1VQ7A 4K8IA 1K0RA 3QB3A 1WVLA 3KBGA 2KJXA 4ILWA 1LT6D 4A4IA 1XYIA 3K7AH 4KY6A 4DV7L 1E7ZA 2WV6D 2EYFA 4FYDA 4XQJA 1SN8A 3PUWA 4IUPA 3DEOA 4LF5Q 4XT1B 2RCFA 3NQTA 1N36L 1LYLA 1Q12A 4KN4C 4HN7A 2ZTCA 2Q2TA 1GUSA 1BCPB 2BH8A 2ICEC 1STNA 4C3IB 5JJKA 4LF8Q 4UP8A 2HQLA 4L5SA 3R2TA 2F0NA 3A55A 2H5XA 3RLOA 2CH4A 2A6ED 3BZDB 5CBAE 4A3IB 2R92G 2NVYH 4DV5L 5CV7A 1D5XC 1ILPA 4OHJA 2IX0A 5LL6S 4G4KA 3F1ZA 3OWEB 5F2DA 2J7ZA 2L1BA 1STHA 5C4ZA 3K57A 3TP6A 3Q22A 2UXCQ 4GZYC 2UUBL 1U5KA 1RTNA 1TKWB 3BVMA 1WJJA 1CA5A 2IT1A 4EQOA 3QOJA 4QL5A 4PMWA 5IODA 2QDBA 4F7XA 3BZCA 1JT8A 1P16A 1LACA 3K81C 4DUZL 3S16B 2L15A 3CCLA 3T13A 1HNWL 2GA4B 4Y7NB 2LKVA 3FPPA 2F0EA 4L5RC 2K32A 2PI2A 4R4OA 2PYKA 3I72A 2B2TC 4C1NK 1SMYC 3PIPA 3GTJH 3E0EA 1VQ4A 1FGUA 4DUYQ 2F0LA 4A3FH 2CFMA 1X3GA 5CBEE 5M5XH 3CXCA 2B3GA 1K73C 4OWTB 4QIWB 1LM0A 5IP9G 1HZ9A 1IYVA 1IZ6A 4GOPA 1GUTA 4HSPA 3TMEA 4JOIA 2VQEL 3SK4A 4B9XA 3H94A 1BXTA 4X3UA 1EYDA 1HA5A 2BOSA 4TSSA 3UE0A 1PLFA 2SNSA 1XX8A 1AH9A 2KHJA 1WTVA 2Z4IA 1S5CD 1GVPA 1F2MA 1O7IA 3BYYB 4CBVA 2R93B 1QB5D 1WTHA 5EPJA 3CCRA 1I4GA 1Y8PB 3I7FA 1N36Q 1U0LA 3OWFA 3HOVB 1Y8NB 3OMCA 3CMEA 4HAEA 5CV4A 3GTLB 2EY5A 1LV9A 3P1HA 1B4OA 3VYSA 2EYHA 3K59A 4RGMA 1S4ZA 1B8AA 1TWHB 3BS1A 3L0OA 4QCLA 4A3IG 1HCZA 4A3GH 4BWGB 2B2VC 3PIP3 4DV1L 4PG3A 1Q7YC 3M7GA 1UUPA 4BA2I 5IP9H 1MIUA 1TWFH 4A3BB 3NTHA 3EBEA 1D6EC 1NMGA 4KKUA 1SE3A 1JQYD 1X3FA 1TWCB 2UUBQ 3J81E 5DEHA 1H9MA 2MNAA 2CHBD 4DR7L 4X65Q 1LTSD 2JE6I 4DR2L 4DKAC 1L2FA 4LF7L 1HTLD 2QEXA 5C4JH 3J81c 2ENBA 1G91A 3JC66 1Q86C 5E1FA 3GTPB 3NWSA 2CH4W 2K5QA 2N49A 3GV3A 4IPDA 3QR8A 1PH4A 1KRSA 3VDYA 1CUKA 4HJ5A 1HNWQ 1TY0A 3D31A 3CQZB 3SK5A 1NUCA 1SYEA 4C3IH 1PH8A 2O5IC 1B44D 1CI3M 4LW1A 2RHSB 4LUOA 3HKZE 2N88A 3MAQA 3PUXA 4A3IH 3G6EA 4DAVA 1A0IA 3JAML 3P7JA 1N8RC 3CF5A 4F87A 1EWHA 1SYFA 2EQSA 1K83B 4X3SA 1EY7A 3GTMB 1AP0A 5CYUA 1VQMA 2Z6KC 2V4DA 3GO5A 2KVMA 3SK6A 2B2YA 3DWAA 4ZQ3A 1BBWA 3GTQH 3HKZG 3VA7A 1AZPA 4DGZA 4JI5Q 4RWSC 2ZT9C 1II3A 2F03A 3S17H 1E1TA 2WB1B 1EIYB 4IUQA 1EYCA 1JE4A 5DAUA 4A3DG 3S2HB 2R93G 2ALYB 1B50A 1IW7D 1K8MA 3S16H 3T56B 3MXPA 4CKCA 3UDFA 2YV5A 4FP5D 3E3XA 1CKMA 1K28A 1MSHA 5LMNW 1CA6A 4DFAA 4UDUC 1HQRD 1H9SA 4H0LC 3HOVG 1X3QA 2NVQB 1MD2D 1MBYA 1EY8A 1ENAA 3NPPA 1L0WA 2RQXA 2EY6A 2F4VQ 4KN7C 5FKAC 4QUFA 4KHPL 1BKBA 1G6ZA 5CC4A 5C3XA 1PH1A 4JBMA 2G9HD 1I6HB 1HZAA 1T9HA 1VQEA 4DV1Q 3HEJA 5FJ8G 4A3BG 3Q8DA 3HOUH 1XTDA 3TBIB 1H9RA 3V2TA 4B3ML 4WJWA 3J81i 1JB3A 1Y8OB 4GLXA 2AQ1B 3TQYA 4ZKBB 3G4SA 2K03A 3P75A 2A68C 2EYOA 5FOBB 3MXNA 1DGSA 1GUGA 2CQAA 2DNEA 3NSWA 4IURA 1L1OA 5JVG3 2L12A 1I4HA 2AMCB 4DR7Q 2P5ZX 1QG7A 4DR2Q 3H91A 4LF7Q 1V1PB 1MI2A 2F0PA 3H0GB 3SR1A 4CJ2C 5I6YA 1I4PA 4DV3L 1HJPA 4LAAA 2ZXPA 4HR7B 3HS0C 3GTLH 4EVOA 1YI2A 1YNXA 2HIVA 3PF5A 1KLGD 5BN3A 1FNVA 4ZK9B 1SXTA 1TWHH 1EQTA 4QQBX 4DV6Q 1AW7A 2NWGA 1QOHA 4U673 1LT3D 2TSSA 4A3BH 4NDXA 2E2JB 1JJGA 1OXTA 2EJMA 2ATWA 1UEBA 4ZRZA 1EFWA 3S15H 5E7NA 2BA1A 1G8ZD 4LFCQ 2RCNA 3J80E 4KHVA 1FNWA 1TWCH 3D0FA 2QW7A 2UXDL 1D5ZC 3CKIB 4GKJL 1STGA 2J0TD 1GD7A 2F0JA 3KLWA 1R4PB 1EYAA 3KF8B 4DR1Q 3BU2A 3J80c 5C4XB 1FR3A 5DLQE 3G71A 2YTXA 3GTPH 3KYHC 3S14B 3D6CA 4PQXA 4DNTB 4GN4B 3CW2C 1EFID 3CQZH 1CKNB 1SEBD 1STBA 3OIQA 1V1QA 3C1EA 2K28A 1G2SA 1Q46A 4JBJA 1G6PA 2HHHL 2B8GA 3K58A 4C1NI 2EYLA 1W2BA 4UY8C 1T5EA 1HR0Q 3S1MH 4LFAQ 2J4XA 4XXEA 2V1CC 3GTMH 1SAPA 1MGSA 1RKNA 3PO2B 3MC0B 2KECA 2QCPX 3RD4A 2AQ2B 1EEID 1CQFA 2F0OA 2NN6I 3BDCA 3I4NB 3GV6A 1GHJA 4HEDA 4JI6L 2Z9HA 1I50H 4LFBQ 1K0SA 4OX9Q 5JEAG 3NP8A 2XRQD 3S2HH 3UE1A 5IGDA 2AUKA 1PRTD 1GUOA 3E5SA 1VQIA 3H0GG 2HDMA 3FDTA 1LTTD 1O78A 2A6HC 5IGGA 1O7ZA 1SJED 5IT9E 2UUAL 4HJ8A 1LUZA 5EBCA 1SRUA 5AJ3L 2NN6H 4PMCA 4YCVA 2PZWA 5JOBA 2I0QA 3HOZB 3W1GA 2K5DA 3ICEA 1E2WA 4DK0A 5IYCG 5IT9c 1CT1D 4APVA 4X62Q 1SNMA 5T1GA 5JJLA 2XIWA 4JOIC 1WD1A 2ES2A 3I56A 3U9SA 3K5MA 1QWYA 5FLMG 2LY7A 5M3FB 1TU2B 2F0GA 2EYPA 2X69A 4DR6L 1P8LA 3F2DA 4RGTA 5C6AA 5BR8L 2O5JC 1N9WA 5FO7B 3M4PA 1VQOA 1SYCA 3Q0AA 2F52A 1J5EL 4GNXC 3J7ZC 4YY3L 5IGBA 4RMFA 2CKZB 4BBRH 2UXDQ 1HXYD 4GKJQ 3MXGA 3AU7A 3MZ5A 5JEAH 1HNZL 5C4XG 4KJNA 1PTOC 3KLSA 3I55A 4C3JB 4KKSA 5C3EH 4BY1G 3CCSA 1VF5C 5C44B 1W6JA 1DXMA 2UU9L 3U58A 4MN3A 1LLRD 1BR9A 4K14A 2EYMA 2DUDA 4CDCC 5KNBA 2K33A 4CKBA 5A35A 4PV1C 4MZ9A 5CORA 4Y52H 5L37A 2HHHQ 1I4QA 3SHLA 1WOCA 1B3AA 2PQAA 5FLMH 4ID6A 1TY2A 3PUVA 4GOPB 4A3JH 5LMNL 2L5TA 4ZAIA 1VQHA 3PO2G 1CHQD 2RBMA 4X3KA 1TWAB 1VQDA 2L55A 2EXZA 2MUYA 1C9OA 2F0DA 3I4NG 4B3SQ 1YBYA 1WTOA 1D1IA 5ELDA 3BG3A 2JA7B 2ICIA 3D4DA 2JK8A 4FXKC 1ASYA 3ER0A 1SE8A 4GNXB 5C4XH 3MWYW 2D2CC 2B39A 3TP7A 4KLKA 4QUCA 4MTNA 5JEAJ 1F9SA 2YTVA 1QVFA 3L2PA 3PUZA 2OQ0A 1PTOB 1EWCA 4XIGS 1Z7TA 2Y0SB 3S2DB 1IHZA 3VYUA 3HOZG 1Q81C 1LO5D 1KRTA 1VQGA 3I4MH 2F3IA 3DLLA 3T53B 3LGJA 5AJ3Q 4EQPA 1WD0A 2UXBL 1OO9B 3FKIB 5C5MA 2I07B 1BCPC 1EY9A 1QUQA 3N52A 4KY5A 1EIGA 1S5FD 1LT4D 4IPGA 1ICFB 2EOTA 2WKDA 3BJUA 4HIMA 1UAPA 2CW0D 2D5DA 1B53A 4UP7A 1EZ6A 1U4PA 5BR8Q 1X32A 2F0UA 1UEAB 2K05A 1BDOA 2L9HA 2DGYA 1B9NA 3GDEA 1N32L 4FDBA 4AYBE 4YY3Q 3MXUA 1TWGB 4PMBA 3RUZA 1M8AA 2N8NA 2A73B 3AYHB 4QF4A 3WWVA 4C3JG 5NUCA 3E9HA 5CR3A 3MFYA 5C44G 2K5VA 1JOQA 2EJFC 3ERSX 1A3VA 2UU9Q 1SSOA 3F2CA 2K75A 2QILA 4AYBG 1NR4A 1ZEQX 1X6OA 4KKTA 1SNCA 3OW7A 2A6EC 2UUCQ 5KNCA 4DR5L 1ASZA 5IGFA 1A15A 4RCOA 1I6VC 4RGOS 2B29A 3J7AF 3AFQA 4H13C 2CVRA 4K2KA 2B63B 1JOOA 5KGUA 5GQOA 5M3FH 1Z6HA 4IUUA 2TMPA 3D6WA 1L1OC 4B3TQ 1CQVA 4A3KG 5IYDG 3GP7A 4DF7A 3TSSA 2F0TA 3BZKA 2CWPA 2NBFA 1VQ8A 1AE2A 1XMOL 4OIKA 4LUZA 1Q8IA 3VR4A 2Y0SE 2JA7G 3KJOA 4DNIA 4FF3A 4AQYQ 4JV5Q 2F0QA 1GO3E 3BVZA 2IX3A 2KENA 5JJIA 2QKIC 4IUVA 4C3JH 1KIXA 1STAA 3J81j 5IY0A 4HJ7A 3PO3B 2EPBA 2E2IB 5C44H 1EOVA 4IALA 3MTSA 4R4QA 1L0YB 1XXGA 3LWEA 2VB2X 2Y0SG 1KD1C 3B6YA 3KJPA 1XNQL 2JXMB 3G6JB 2G9DA 2KCMA 1YZ6A 3Q23A 1YEZA 1F9QA 3FKIG 5GROA 4X64L 2UXBQ 1SE4A 2VNUD 3MVVA 4ME5A 2EIFA 2PZUA 1YITA 2IL8A 4HCSA 5IGCA 1BF4A 1YVCA 1DD2A 1CK1A 3NBHA 3CRLC 3QJYA 4O0AA 1O7YA 2KUMA 3OIPA 4EGVA 1PMRA 3L9AX 4PNYA 5CV5A 3KDFA 1L1OB 1AZQA 2G5DA 5LMUQ 1YHAA 4GLVB 1I3QB 1PH6A 2R92H 2YU9B 3UDIA 4DAYB 1BOSA 2K1BA 3PQIA 1ZYRD 2KQ3A 2BH2A 1QNKA 5C0XJ 1CSPA 3F2UA 3EQLC 2MO0A 3M7NA 3I70A 3CPWA 2Z8LA 4DV2L 4N9TA 3HKZB 1PTOH 2JA8B 5FK9C 1UWVA 1F9PA 5A2QL 5IP7G 1SNQA 4NW2A 3IL8A 3KUPA 4A3DB 1YJ9A 2AQ3B 4DV7Q 2JA9A 5DNFA 1GXDC 1WTXA 4ZYSA 1KC8C 1HH2P 2B63G 4R1JA 3F8TA 5M9OA 2PPBC 2AUJD 1F2YA 1RDPD 1LABA 4RHSA 1TR5A 3KLSX 4PZ7A 2NZHA 3O13A 2XGTA 3RMHA 2PCFB 3U4ZA 3LNNA 2X6GA 1HFNA 2E76C 2IW3A 4DV5Q 2Q2IA 5DM73 2KHIA 1TWGH 1SFOB 2XSCA 5CGKA 1CZGA 2BE5D 1YHQA 4ODGA 3PO3G 2NVTB 2ZTDA 3C1FA 5ELNA 1S5DD 1XJVA 4IPCA 1PZID 4K2LA 4QMGA 5GAGC 2AWNA 5J22A 2KEDA 4DUZQ 1XNRL 3HP3A 3X3NA 4X64Q 4K6DA 2E8GA 4DK1A 1J9OA 2WP8J 1RTOA 4RCNA 1M4VA 4DR4L 2B8FA 3PCOB 1DYQA 4C3HB 1EQRA 1TS4A 4MNOA 2ZTEA 2JA5B 1SYDA 5H1SE 1TVXA 3CAMA 5IYBG 1K8OA 4BS9A 1Q90A 1SDFA 4OWWB 2DY8A 1NSNS 2BDOA 1RIPA 4KY7A 1JMCA 1IW7C 1BUVT 1KDBA 2NTSA 1JE5A 3J7YW 2Q2UA 3X3MA 1ILQA 1F2LA 3TS0A 1SYBA 4CJ0B 4ZCKA 5JJZA 1NCVA 1PFMA 3NUCA 3PO3H 4IZ8A 3CRKC 2E2IH 4UAIA 3CC2A 4LWCA 1FJGL 3GTOB 3ULPA 4A3MB 3CHBD 2VQEQ 1HNXL 2JA8G 1PZJD 4DV2Q 1EIHA 2RDFA 1IL8A 2I5HA 4CKEA 4JI4L 1J6QA 2D0OA 2ASBA 2F0WA 4OWXB 5IWAL 5EPLA 4JK1C 3DHQA 4HIDA 4Y7NH 2K52A 5KRUA 1EZ8A 4B9WA 2R7ZB 4X66L 3A8KE 5I4DA 1GJXA 3EROA 1JB7A 1VMCA 1XPUA 3W3AA 3A56A 5IYBH 4FXGC 4ABNA 3KF6B 3ULLA 2YU9H 2K50A 3I2ZA 1PFSA 1HZBA 4OEMB 4RAUC 3UI2A 1LTGD 3LWUA 2M00A 3I73A 2IWHA 1IL2A 2MO1A 3IKJA 1I5FA 3Q6SA 1D8LA 4NXML 3TRZA 2JA8H 4FXDA 1Y14B 3BYTB 1C7YA 1VQ5A 3GQBA 3CCEA 5KIXA 4A3DH 4JI0L 4JI7L 4JBWA 4X3TA 2R93H 1PYSB 4OO1G 1G51A 1DOKA 4E6IA 4IOAA 1RODA 1WCMG 4P71A 3UDGA 1XNRQ 1BNZA 3HOVH 2WAQE 4C2MB 2R7DA 4C3HG 1EY4A 2OT2A 2N55A 4RKBA 4DU9A 4O42A 3MEFA 4DAMA 2JA5G 1CZWA 2ZXOA 3JAME 3NEMA 4J6HA 3DWPA 3CCUA 1KXLA 5GAHC 3A5UA 1BQQT 3PSIA 4HIOA 3NE5B 3BDLA 1QE6A 1YNJD 2WAQG 1MKHA 2KA7A 3VA5A 3ND8A 5FJ8H 1DM0B 3JAMc 4A93B 3I90A 1SFOH 1E0BA 5I2XA 5EQ0A 1LTBD 3TN2A 1PH5A 2A68D 3C46A 1VQFA 2NVTH 2F0KA 2ID0A 1K3RA 2K6AA 4A3MG 5EKLA 1FJGQ 1VS0A 1YIJA 1FYCA 1HNXQ 4ALPA 4YIJA 1YNND 2LXJA 3KK7A 1VQJA 4JI4Q 2BCOA 1G291 2A74C 2NVXB 4XT3B 4Q0FA 5GADC 3HOYB 3VYTA 4BY1B 2WFWA 2A69D 5IWAQ 1IBML 1Q1BA 2R7ZG 2RSNA 2SOBA 4NPSA 5T1IA 2QF7A 1K9MC 1ESRA 2AWOA 2B2TA 4C3HH 3F2BA 1FVIA 4X66Q 2HQEA 4EQ5A 1QILA 5E3FA 5ELFA 4XYOA 1A2UA 1U9RA 3HOXG 5FO8B 4IFDG 1PRTC 4KHPQ 3NTKA 1PH3A 2NYZD 3I91A 3KFUA 1K83H 1RCVD 1YHBA 2D62A 1A63A 1VCIA 2FINB 4OONA 4HTHA 1UNSA 1Q82C 4B3MQ 2KCCA 2GVAA 3GTOH 2JEBI 3RZDB 4NXMQ 3VR6A 4TKOB 2XRSD 2CWAA 4DNRB 4JYAL 3CCVA 2JYOA 1NR2A 4ZKCB 2LS01 3GTGB 4AH6A 4JI0Q 1JCKB 2RHQB 4GN5A 5K5PA 2EY1A 1I4RA 1HTPA 3HGBA 4O2DA 4QGUA 3HKSA 2R7ZH 1ET6A 3JAMi 2NVQH 3G48A 2E5LL 3E0JA 5HURA 4L8JA 4DV3Q 1KAWA 2OTLA 5KEEA 5HGTA 2WKCA 4IUTA 2L11A 4RKLA 3VYRA 4GOPC 1HA6A 3TS2A 4IFDH 3EJIA 3ULJA 4J8QA 2B2VA 2JP1A 2XWBB 5D3IB 4A3EB 1I6HH 4BA1I 1NNXA 1PTOF 5FO9B 5ISRA 4A93G 1PRTB
chains in the Genus database with same CATH topology
4M1UB 1KDAA 3TP5A 4B08A 4K6LA 5FLXL 1H9JA 5E4WC 4IQZA 3A8IE 5K36G 1ZXTA 1U4RA 1EY5A 1A3TA 4FO2A 1V43A 1VMPA 5ELCA 2F0FA 1F9RA 2C5CA 4O1NA 3J7AV 2O4XA 2EYJA 3H3VC 2L0CA 4RGNA 4AYBB 5D65A 4FVMA 1EU3A 3SE0A 1DZ1A 1VDZA 1PDQA 1TQOA 1MSGA 3U9OA 5J39A 1TS5A 3CU7A 3ZYYX 2WACA 4N9PA 1ET9A 4IFDJ 3QOLA 2LFNA 4A3KB 3SEBA 4DXGA 4H7BA 1C48A 3D4WA 4DN4M 5JAVA 2Z1CA 2KOLA 3DEPA 5K36H 3FRPB 1V1PA 2SDFA 1BCPF 5C3WA 1KDCA 4A3FB 1CHPD 2CW0C 4LMQD 2F0IA 1JOKA 4H44C 5M5WB 1E2VA 4QB4A 2PW5A 2B2YC 2F3WA 2MJ8A 3K6OA 4R9WA 1EY0A 3ITPA 4KI0A 4Q5VA 3K0YA 1ICWA 3NQIA 2RDGA 1DCZA 1AN8A 2EDGA 3H6MA 2NB0A 2L4NA 2HDLA 1HPCA 3KF8A 3T51B 5C0XG 3I4LA 1FD7D 3HZXA 2KEEA 3R8BA 1AFPA 1PZKD 1SJHD 1OXSC 3H09A 2F4IA 2B2WA 2F0SA 1HRJA 5EGTA 1C4QA 4L63B 3M85A 2JSOA 5J1ZA 5COYA 3K5LA 1JWMD 1BCPD 2IX1A 1D2BA 1PXUA 1U4LA 1Q1EA 3EFXD 5C0XI 5EKKA 1RD9D 5CV9A 2RKSA 2Q8IB 2VXWA 3OPOA 2EE1A 2EZVA 5CMDA 2JEAI 5CV8A 5C4JB 4ZLTF 5AFWA 2FHTA 5C0XH 1SNPA 2X6LA 1A2TA 4G57A 1JR0D 3OOCA 1H9SB 4ZUJA 3FMCA 1OXVA 3S1QB 3EVQA 4MIUA 3SDZA 4M8AA 4NP5A 4G7ZC 1KNEA 3FVQA 2RDHA 1ZYRC 3PV0A 5EBDA 3S1RB 2WIIB 4I7ZC 5I2YA 1VF7A 3GTQB 2RA4A 3A8JE 2PMZB 2O2LD 2PO4A 4ZUIA 3S17B 3WOEA 3GD7A 1ENFA 1DOLA 3LX0A 1CM9A 3J81L 3A7AB 3WOFA 1Y1VB 5ELEA 1DOMA 1STEA 1TIID 1A6XA 2Q8TA 4XQNA 1HFGA 3WDNA 1Z47A 4KD3A 2JA6B 4EQNA 3SVMA 3R2IA 3QWNA 3HOUB 4BBSB 2MPMA 4V0BA 2BE5C 1SMYD 2RVLA 1HUMA 5D3DA 2F1MA 3L3OC 1CTMA 1Q3LA 3L7ZC 1PYWD 3NHHA 3TP8A 3HOWB 1O7LA 3MA2B 3D3RA 3DWQA 2KHSA 1Y69U 1Y1WB 2D9UA 5ELBA 4C3IG 2B2UA 4BY7B 2PNRC 4XDXA 4DAPA 2XVSA 2FJ2A 1HQMC 1R4QB 5E4XA 1IKLA 3BVGA 4K5XA 4FF2A 4G7HC 1SNDA 1WCMB 3S15B 1EL0A 4RA8A 1PFNA 2E75C 3QG1A 1AEXA 2FMMA 4WORA 1IYUA 1S5BD 3KBXA 1IKMA 2F3VA 4KHZA 1SYGA 1GHKA 1EQVA 1ML0D 4RH6A 3PUYA 3A7LA 2IJ0A 1CFMA 1RHPA 4U68A 2VUMB 3MHBA 2WAQB 1D1KA 3HG9A 3NK9A 2XN9C 5IIFA 1DONA 3AB9A 1D5MC 2OF1A 3IFTA 2K01A 5A2QE 3K5NA 4G7OC 2FFKB 3M3YB 1KAAA 1ENCA 1OXUA 2M2LA 1LT5D 2R6GA 4NMZA 1BBXC 3S1MB 4MHEA 3DM1A 3NXWA 3M4OB 1V1OA 4J1MA 1B1ZA 3RZOB 1EOTA 4KJOA 2K5WA 3QO2A 1WTQA 2NUCA 4FF4A 1S5ED 3J80L 2K04A 3HRZC 1I50B 2WINB 4HCEA 5KYLA 2MP1A 2R61A 3HOXB 2EVBA 3TZUA 3SK8A 3W2DA 5EPKA 5JPNC 2ZXRA 1OXXK 3S9WA 5JPMC 2E2HB 5IOCA 5BN4A 5DM63 1HUNA 3FEWX 1I4XA 2DN8A 3BDOA 4F8MA 1YNJC 2QEJC 3V05A 2MGSA 2XNAC 4FNFA 1ESFA 2VB3X 3NTIA 2LMCB 1PFBA 4BBRB 5EKIA 1YNNC 4DAYA 3R93A 3I3CA 1WTRA 1A3UA 5LHY1 2SEBD 5C3EB 3GTKB 3ONAB 4R8NA 2DNCA 5M3MB 2B2WC 4KMUC 1ZKOA 2A69C 4OO1I 4KD4A 5IT9L 3I8ZA 3D8GA 2HCIA 3VR3A 1QNUA 1JORA 1RF2D 1V8QA 2HCCA 3QIAA 1G2TA 1O80A 4A3JB 3PIO3 2MHVA 3TDQA 2PQEA 4OIJA 5TSSA 4OO1H 2FMCA 1KABA 1PRTF 1JC7A 1SNOA 4V190 3URYA 3N6RA 3G7LA 1QCBD 1XTCD 5C5LA 1R9TB 1HHVA 5C4HA 4DXFA 1E2ZA 1NAPA 4HMIA 1SBBB 2M9VA 4F88A 2F0HA 1H9KA 1SE2A 2BA0A 4I65A 1KNAA 3S1NB 1EU4A 2EJGC 3VR5A 3RLFA 3T4AC 4IN3A 1KTKA 2NN6G 4NKLA 2OXPA 3I4MB 4L6TB 4Z9CB 1F2ZA 3OMGA 3ERQA 5G3LF 3IFDA 5I6WA 2HUGA 3AMUA 1X3PA 1WTPA 4IFDI 4TQUS 4KK7A 5JVH3 1JICA 1U4MA 4RHRA 1J8IA 1LTRD 3C3LA 2F0VA 4C56C 5CV6A 5I9OA 1GUWA 1JWSD 5M5YB 2K7VA 3P20A 3MEHA 3NWTA 1EY6A 4TRDA 3T16A 5KNDA 3K7AB 2YYZA 1B2TA 2A5HA 1FNUA 1W6KA 2RSOA 2OEOA 4K8JA 3TZDA 3C2PA 3E6ZX 2H4OA 1C8CA 4CHTB 2C9OA 2A6HD 3DUZA 2E2DC 2IPKD 2Z4HA 4KV6A 4LJZC 5G3LD 1F77A 2NZ1D 3PMFA 2I46A 1T5XD 2NVYB 4K5WA 2F0MA 2SNMA 4OL7A 1RJTA 4OGQC 4DA2A 4XTCS 2B2UC 4S3SA 3NBIA 5I9PA 1LTID 1LTAD 3R3OA 4K5VA 5BN5A 4R8IA 4LK1C 2PZTA 4XYQA 2DY7A 1PTOD 3M4YA 3ND9A 4IUNA 1GOZA 4HMJA 3V96A 2Q8RE 1TT2A 3GTJB 3OSOA 4WRDA 5D14A 2PW7A 4CJ1B 4KTAA 1EEFD 2H1EA 1JWUD 5M5XB 4WFN3 4FF1A 3FPUB 3KLRA 1STYA 2BDNA 3VR2A 2R92B 1XWEA 4RFBA 5IGEA 1WTWA 1KLUD 3A54A 1TS3A 1GUNA 2EY2A 5KYIA 3EA6A 1DJRD 1QJOA 2R3ZA 5FLXE 3K5OA 5EJWA 3DMUA 4HSVA 1FGBD 2E74C 1ONLA 4ULLA 1L0XB 2NTTA 3DXJC 2XWJB 1BO0A 3IAYA 4P2CB 3OHXC 1B9MA 5LL6X 4XQQA 3SXHA 4CGYB 4A3GB 3Q24A 3MFGA 2KCNA 1TS2A 3D4RA 1TWFB 4K8IA 3QB3A 1WVLA 3KBGA 2KJXA 4ILWA 1LT6D 1XYIA 4KY6A 2WV6D 2EYFA 4FYDA 4XQJA 3PUWA 4IUPA 3DEOA 4XT1B 3NQTA 1Q12A 4KN4C 4HN7A 1GUSA 1BCPB 2ICEC 1STNA 4C3IB 3R2TA 2F0NA 3A55A 3BZDB 2A6ED 5CBAE 4A3IB 5CV7A 1D5XC 1ILPA 4OHJA 2IX0A 5LL6S 4G4KA 3OWEB 5F2DA 2J7ZA 2L1BA 1STHA 5C4ZA 3K57A 3TP6A 3Q22A 4GZYC 1RTNA 1TKWB 3BVMA 1CA5A 2IT1A 4EQOA 3QOJA 4PMWA 5IODA 2QDBA 4F7XA 1LACA 3S16B 3T13A 2GA4B 4Y7NB 2LKVA 3FPPA 2F0EA 2K32A 2PYKA 3I72A 2B2TC 4C1NK 1SMYC 2F0LA 5CBEE 4QIWB 1IYVA 1GUTA 4HSPA 3TMEA 3SK4A 4B9XA 3H94A 1BXTA 4X3UA 1EYDA 1HA5A 2BOSA 4TSSA 1PLFA 2SNSA 1XX8A 1WTVA 2Z4IA 1S5CD 1F2MA 3BYYB 4CBVA 2R93B 1QB5D 5EPJA 1I4GA 1Y8PB 3OWFA 3HOVB 1Y8NB 3OMCA 4HAEA 5CV4A 3GTLB 2EY5A 1LV9A 3P1HA 1B4OA 3VYSA 2EYHA 3K59A 4RGMA 1S4ZA 1TWHB 3BS1A 4QCLA 1HCZA 4BWGB 2B2VC 3PIP3 3M7GA 1UUPA 4BA2I 4A3BB 3NTHA 1D6EC 4KKUA 1SE3A 1JQYD 1TWCB 3J81E 5DEHA 1H9MA 2CHBD 1LTSD 2JE6I 1HTLD 2ENBA 1G91A 3GTPB 5E1FA 3NWSA 2K5QA 3GV3A 1TY0A 3D31A 3CQZB 3SK5A 1NUCA 1SYEA 2O5IC 1B44D 1CI3M 3MAQA 2N88A 3PUXA 4DAVA 3JAML 3P7JA 4F87A 1EWHA 1SYFA 4X3SA 1K83B 1EY7A 3GTMB 1AP0A 5CYUA 2V4DA 3GO5A 2KVMA 3SK6A 2B2YA 3DWAA 4ZQ3A 3VA7A 1AZPA 4DGZA 4RWSC 2ZT9C 1II3A 2F03A 2WB1B 4IUQA 1EYCA 1JE4A 5DAUA 3S2HB 1B50A 1IW7D 1K8MA 3T56B 3MXPA 4CKCA 4FP5D 1MSHA 1CA6A 4DFAA 4UDUC 1HQRD 1H9SA 4H0LC 1X3QA 2NVQB 1MD2D 1MBYA 1EY8A 1ENAA 3NPPA 2RQXA 2EY6A 4KN7C 5FKAC 4QUFA 1G6ZA 5CC4A 5C3XA 2G9HD 1I6HB 3HEJA 3TBIB 1H9RA 3V2TA 4WJWA 1JB3A 1Y8OB 2AQ1B 4ZKBB 2K03A 3P75A 2A68C 2EYOA 5FOBB 3MXNA 1GUGA 2CQAA 2DNEA 3NSWA 4IURA 5JVG3 2L12A 1I4HA 1QG7A 3H91A 1V1PB 1MI2A 2F0PA 3H0GB 3SR1A 4CJ2C 5I6YA 1I4PA 4LAAA 2ZXPA 4HR7B 3HS0C 4EVOA 1KLGD 5BN3A 1FNVA 4ZK9B 1SXTA 1EQTA 1AW7A 2NWGA 1QOHA 4U673 1LT3D 2TSSA 4NDXA 2E2JB 1OXTA 2EJMA 4ZRZA 2BA1A 1G8ZD 3J80E 4KHVA 1FNWA 1D5ZC 3CKIB 1STGA 2J0TD 2F0JA 1R4PB 1EYAA 5C4XB 1FR3A 3S14B 3D6CA 4PQXA 4DNTB 1EFID 1SEBD 1STBA 3OIQA 3C1EA 2K28A 1G2SA 2B8GA 3K58A 4C1NI 2EYLA 1T5EA 2J4XA 4XXEA 1SAPA 1MGSA 1RKNA 3PO2B 3MC0B 2KECA 2QCPX 3RD4A 2AQ2B 1EEID 1CQFA 2F0OA 2NN6I 3BDCA 3I4NB 3GV6A 1GHJA 4HEDA 5JEAG 3NP8A 2XRQD 5IGDA 2AUKA 1PRTD 1GUOA 3E5SA 2HDMA 3FDTA 1LTTD 1O78A 2A6HC 5IGGA 1O7ZA 1SJED 5IT9E 5EBCA 2NN6H 4PMCA 2PZWA 5JOBA 3HOZB 2K5DA 1E2WA 4DK0A 1CT1D 1SNMA 5T1GA 2XIWA 1WD1A 3U9SA 3K5MA 1QWYA 2LY7A 5M3FB 1TU2B 2F0GA 2EYPA 2X69A 4RGTA 5C6AA 2O5JC 5FO7B 1SYCA 3Q0AA 5IGBA 1HXYD 3MXGA 3AU7A 3MZ5A 5JEAH 4KJNA 1PTOC 3KLSA 4C3JB 4KKSA 1VF5C 5C44B 1W6JA 1DXMA 4MN3A 1LLRD 1BR9A 4K14A 2EYMA 5KNBA 2K33A 4CKBA 5A35A 4PV1C 5CORA 1I4QA 3SHLA 1B3AA 4ID6A 1TY2A 3PUVA 2L5TA 4ZAIA 1CHQD 2RBMA 4X3KA 1TWAB 2L55A 2EXZA 2MUYA 2F0DA 1WTOA 1D1IA 5ELDA 3BG3A 2JA7B 2ICIA 3D4DA 4FXKC 3MWYW 2D2CC 2B39A 3TP7A 4QUCA 5JEAJ 1F9SA 3PUZA 1PTOB 1EWCA 4XIGS 1Z7TA 2Y0SB 3S2DB 1IHZA 3VYUA 1LO5D 3T53B 4EQPA 1WD0A 1OO9B 3FKIB 5C5MA 2I07B 1BCPC 1EY9A 3N52A 4KY5A 1EIGA 1S5FD 1LT4D 2EOTA 2WKDA 1UAPA 2CW0D 2D5DA 1B53A 1EZ6A 1U4PA 1X32A 2F0UA 1UEAB 2K05A 1BDOA 2L9HA 1B9NA 3MXUA 1TWGB 4PMBA 3RUZA 1M8AA 4QF4A 2A73B 4C3JG 5NUCA 5CR3A 3MFYA 1JOQA 2EJFC 1A3VA 1SSOA 2QILA 1NR4A 1ZEQX 4KKTA 1SNCA 3OW7A 2A6EC 5KNCA 5IGFA 1A15A 4RCOA 1I6VC 4RGOS 3J7AF 4H13C 2CVRA 4K2KA 2B63B 1JOOA 5KGUA 1Z6HA 4IUUA 2TMPA 3D6WA 1CQVA 3GP7A 4DF7A 3TSSA 2F0TA 2NBFA 4OIKA 1Q8IA 3VR4A 4FF3A 2F0QA 3BVZA 2IX3A 2QKIC 4IUVA 1STAA 3PO3B 2EPBA 2E2IB 4IALA 3MTSA 1L0YB 1XXGA 3LWEA 2VB2X 2JXMB 3G6JB 2G9DA 3Q23A 1F9QA 1SE4A 2VNUD 3MVVA 4ME5A 2PZUA 2IL8A 4HCSA 5IGCA 1BF4A 1DD2A 1CK1A 3NBHA 3CRLC 3QJYA 1O7YA 2KUMA 3OIPA 4EGVA 1PMRA 3L9AX 4PNYA 5CV5A 1AZQA 1I3QB 2YU9B 1BOSA 2K1BA 1ZYRD 2KQ3A 1QNKA 5C0XJ 3F2UA 3EQLC 3M7NA 3I70A 2Z8LA 4N9TA 3HKZB 1PTOH 2JA8B 5FK9C 1F9PA 5A2QL 1SNQA 4NW2A 3IL8A 3KUPA 4A3DB 2AQ3B 5DNFA 1GXDC 1WTXA 4ZYSA 5M9OA 2PPBC 2AUJD 1F2YA 1RDPD 1LABA 4RHSA 1TR5A 3KLSX 3O13A 3RMHA 2PCFB 3LNNA 2X6GA 1HFNA 2E76C 2IW3A 5DM73 1SFOB 2XSCA 5CGKA 1CZGA 2BE5D 4ODGA 2NVTB 3C1FA 1S5DD 1PZID 4K2LA 4QMGA 2AWNA 5J22A 2KEDA 3HP3A 3X3NA 4K6DA 4DK1A 1J9OA 2WP8J 1RTOA 4RCNA 1M4VA 2B8FA 1DYQA 4C3HB 1TS4A 2JA5B 1SYDA 1TVXA 1K8OA 4BS9A 1Q90A 1SDFA 2DY8A 1NSNS 2BDOA 4KY7A 1IW7C 1BUVT 1KDBA 2NTSA 3J7YW 3X3MA 1ILQA 1F2LA 1SYBA 4CJ0B 5JJZA 1NCVA 1PFMA 3NUCA 4IZ8A 3CRKC 4UAIA 3GTOB 4A3MB 3CHBD 1PZJD 1EIHA 2RDFA 1IL8A 4CKEA 2F0WA 5EPLA 4JK1C 3DHQA 5KRUA 1EZ8A 4B9WA 2R7ZB 3A8KE 5I4DA 1GJXA 3EROA 1VMCA 3W3AA 3A56A 4FXGC 4ABNA 3UI2A 4RAUC 1LTGD 3LWUA 2M00A 3I73A 2IWHA 3IKJA 3Q6SA 4FXDA 3BYTB 3GQBA 5KIXA 4JBWA 4X3TA 4OO1G 1DOKA 4E6IA 1RODA 1BNZA 4C2MB 4C3HG 1EY4A 2OT2A 2N55A 4RKBA 4DU9A 4O42A 1CZWA 2ZXOA 3JAME 4J6HA 3DWPA 1BQQT 3NE5B 3BDLA 1QE6A 1YNJD 2KA7A 3VA5A 3ND8A 1DM0B 4A93B 3I90A 1E0BA 5I2XA 5EQ0A 1LTBD 3TN2A 2A68D 3C46A 2F0KA 2ID0A 2K6AA 5EKLA 1FYCA 4YIJA 1YNND 3KK7A 2NVXB 2BCOA 1G291 2A74C 4XT3B 4Q0FA 3HOYB 3VYTA 4BY1B 2A69D 1Q1BA 2RSNA 2SOBA 5T1IA 2QF7A 1ESRA 2AWOA 2B2TA 2HQEA 1QILA 5E3FA 5ELFA 4XYOA 1A2UA 1U9RA 4IFDG 5FO8B 1PRTC 3NTKA 2NYZD 3I91A 1RCVD 2D62A 1VCIA 2FINB 4HTHA 1UNSA 2KCCA 2JEBI 3RZDB 3VR6A 4TKOB 2XRSD 4DNRB 2JYOA 1NR2A 4ZKCB 2LS01 3GTGB 1JCKB 5K5PA 2EY1A 1I4RA 1HTPA 3HGBA 1ET6A 3E0JA 5HURA 4L8JA 5KEEA 5HGTA 2WKCA 4IUTA 2L11A 4RKLA 3VYRA 1HA6A 4IFDH 3EJIA 4J8QA 2B2VA 2JP1A 2XWBB 5D3IB 4A3EB 4BA1I 1PTOF 5FO9B 5ISRA 1PRTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 L;  3J81 L;  3JAM L;  5LL6 X;  3J7A V;  5A2Q L;  5FLX L;  3J80 L; 
#chains in the Genus database with same CATH topology
 1KL9 A;  4M1U B;  1KDA A;  3TP5 A;  4A76 A;  4B08 A;  3U50 C;  4K6L A;  5FLX L;  1H9J A;  5E4W C;  4IQZ A;  2IHF A;  3A8I E;  2VW9 A;  2JQO A;  5K36 G;  1ZXT A;  1U4R A;  1EY5 A;  1A3T A;  4FO2 A;  1V43 A;  1VMP A;  5ELC A;  2F0F A;  3HOY G;  1F9R A;  2C5C A;  4O1N A;  3H0G H;  3J7A V;  2O4X A;  1EWI A;  4YCU A;  2EYJ A;  3H3V C;  4X6A H;  2L0C A;  1IBM Q;  4RGN A;  4C2M H;  4AYB B;  3KDF B;  5D65 A;  4FVM A;  1EU3 A;  3SE0 A;  1DZ1 A;  2QA4 A;  5IYC H;  1VDZ A;  1PDQ A;  2K5H A;  1TQO A;  1MSG A;  3U9O A;  5J39 A;  1TS5 A;  3CU7 A;  4WJ3 M;  3ZYY X;  2WAC A;  2C35 B;  3NEL A;  4N9P A;  1ET9 A;  4IFD J;  3QOL A;  4A93 H;  2N3S A;  2Z0S A;  2LFN A;  4A3K B;  2E2J H;  3SEB A;  2Z6K A;  4DXG A;  4H7B A;  2K4K A;  1C48 A;  3D4W A;  1D7Q A;  1UE5 A;  4DN4 M;  5JAV A;  2Z1C A;  1E3P A;  2KOL A;  3DEP A;  5K36 H;  4A3C G;  4H02 A;  4TVA B;  3FRP B;  4JI6 Q;  1V1P A;  2NVX H;  2SDF A;  1BCP F;  3AFP A;  5C3W A;  1KDC A;  1B70 B;  3HOY H;  4EX5 A;  2YTY A;  4A3F B;  4BY1 H;  2OQK A;  1VQC A;  4JG2 A;  1CHP D;  3S14 H;  3CMA A;  2CW0 C;  2UUA Q;  4LMQ D;  1FL0 A;  4YWM A;  2F0I A;  1JOK A;  4H44 C;  5M5W B;  1E2V A;  4QB4 A;  4LNQ A;  2PW5 A;  2AKW B;  2B2Y C;  3K6O A;  2F3W A;  2MJ8 A;  4R9W A;  1EY0 A;  3ITP A;  4A3E G;  4KI0 A;  4Q5V A;  3K0Y A;  1ICW A;  4NB3 A;  2GN5 A;  3NQI A;  2RDG A;  3PO2 H;  1DCZ A;  1AN8 A;  1NE3 A;  4DK6 C;  1PH9 A;  1KQS A;  2EDG A;  4DR6 Q;  1AE3 A;  3H6M A;  2NB0 A;  2ZM6 L;  2L4N A;  2HDL A;  3RZD H;  1HPC A;  3KF8 A;  5GAE C;  3T51 B;  1WI5 A;  3I4N H;  4R4I A;  5C0X G;  3I4L A;  1FD7 D;  1J5E Q;  4A3C H;  3HZX A;  3GTG H;  2KEE A;  3R8B A;  1HNZ Q;  1AFP A;  1PZK D;  1SJH D;  1N34 L;  1OXS C;  4B3R L;  1VQ6 A;  3H09 A;  2Q2H A;  2AHO B;  2F4I A;  3H15 A;  2B2W A;  2F0S A;  1HRJ A;  4PZ6 A;  5EGT A;  1C4Q A;  4L63 B;  3M85 A;  3HOZ H;  2JSO A;  3STB D;  1VQL A;  5J1Z A;  5COY A;  3T1H L;  3K5L A;  1JWM D;  1BCP D;  2IX1 A;  4QY7 A;  1D2B A;  1PXU A;  1U4L A;  1Q1E A;  3EFX D;  4PZ8 A;  5C0X I;  4CDD C;  5EKK A;  1VQB A;  1RD9 D;  4A3E H;  5CV9 A;  2I5L X;  2RKS A;  2Q8I B;  2VXW A;  5LMN Q;  2OCE A;  1Z9F A;  2HIX A;  3OPO A;  2EE1 A;  4DR3 L;  5CMD A;  2EZV A;  1YJN A;  2JEA I;  5EAY A;  1HR0 W;  5CV8 A;  4DV4 L;  5C4J B;  4ZLT F;  4A75 A;  1QZH A;  1PHJ A;  5AFW A;  1H95 A;  2FHT A;  5C0X H;  1SNP A;  2R7F A;  2X6L A;  4UPA A;  1A2T A;  1VQK A;  4G57 A;  1JR0 D;  1NBW A;  5ELO A;  4POF A;  1YJW A;  4YWK A;  3OOC A;  4JC0 A;  1EYG A;  4A3F G;  1H9S B;  3T1Y L;  4ZUJ A;  4DPG A;  4JI3 L;  2EXD A;  3FMC A;  1OXV A;  3S1Q B;  3EVQ A;  4MIU A;  2KCT A;  3SDZ A;  4M8A A;  4NP5 A;  3M4Q A;  4G7Z C;  1KNE A;  1NJI C;  3FVQ A;  3UDX A;  2RDH A;  1SR3 A;  1ZYR C;  3PV0 A;  5EBD A;  3S1R B;  4NXN L;  2WII B;  4I7Z C;  5I2Y A;  1VF7 A;  3GTQ B;  2RA4 A;  3A8J E;  2PMZ B;  2O2L D;  2PO4 A;  4ZUI A;  4IO9 A;  3S17 B;  4X65 L;  1IXR A;  2K14 A;  3WOE A;  4A3K H;  3GD7 A;  1ENF A;  5IYD H;  3MXN B;  1DOL A;  3LX0 A;  1TWA H;  1CM9 A;  1QZG A;  3J81 L;  3A7A B;  1NMF A;  1K8A C;  3WOF A;  1Y1V B;  5ELE A;  2ZM6 Q;  1XPR A;  1DOM A;  3K0X A;  3K7U C;  3ZJY C;  2QDL A;  3H3V I;  2JA7 H;  1N32 Q;  1STE A;  1TII D;  1GM5 A;  1A6X A;  1V9P A;  2Q8T A;  4XQN A;  1KHI A;  1HFG A;  3WDN A;  1OTC A;  2PNH A;  4DV0 L;  3PGZ A;  1Z47 A;  4KD3 A;  1N34 Q;  4B3R Q;  2JA6 B;  4N8X 1;  4EQN A;  3SVM A;  4A3G G;  4UP9 A;  3S2D H;  3R2I A;  5M5W H;  4R4T A;  3H3V H;  4RG1 A;  3PF4 A;  3T1H Q;  3FKI H;  3QWN A;  3HOU B;  4DR5 Q;  4BBS B;  1E24 A;  2MPM A;  3CP0 A;  4V0B A;  2MFI A;  4JI5 L;  2BE5 C;  1SMY D;  3M9B A;  1PA6 A;  2RVL A;  4LF4 L;  1HUM A;  5D3D A;  2F1M A;  3L3O C;  1CTM A;  1Q3L A;  3L7Z C;  1PYW D;  3NHH A;  3TP8 A;  3HOW B;  3DM3 A;  1O7L A;  1CKO A;  3MA2 B;  4DR3 Q;  3D3R A;  1XMO Q;  1A8V A;  3DWQ A;  4GNX A;  1W3S A;  4DV4 Q;  2KHS A;  1Y69 U;  1Y1W B;  1NTG A;  2ZJP A;  2D9U A;  5ELB A;  4C3I G;  1C0A A;  2B2U A;  2F4V L;  4BY7 B;  2PNR C;  4XDX A;  2OTJ A;  4DAP A;  3T1Y Q;  2HD3 A;  3CPF A;  2XVS A;  1X65 A;  2HT1 A;  2PMZ E;  4JI3 Q;  5IP7 H;  4OXP A;  1EIF A;  2FJ2 A;  3FP9 A;  1HQM C;  1R4Q B;  5E4X A;  1XNQ Q;  1MHW C;  1IKL A;  4ME3 A;  3BVG A;  3FHW A;  4K5X A;  4FF2 A;  4G7H C;  1SND A;  1WCM B;  3S15 B;  1EL0 A;  1PFN A;  4RA8 A;  2B63 H;  2E75 C;  3QG1 A;  4NXN Q;  4CDF C;  1AEX A;  2FMM A;  4WOR A;  1IYU A;  1S5B D;  1PYB A;  3KBX A;  1IKM A;  2F3V A;  4KHZ A;  1SYG A;  4I7A A;  2VY3 A;  1GHK A;  1EQV A;  1ML0 D;  4RH6 A;  1Y1V G;  3PUY A;  3A7L A;  4IPH A;  2IJ0 A;  1CFM A;  1IBL L;  1RHP A;  4U68 A;  2VUM B;  3MHB A;  3K80 C;  2WAQ B;  1D1K A;  3HG9 A;  3NK9 A;  4QIW E;  2XN9 C;  5IIF A;  1DON A;  3AB9 A;  1D5M C;  1VQA A;  1UE1 A;  2OF1 A;  3IFT A;  2K01 A;  5A2Q E;  4LUV A;  3K5N A;  2JA6 G;  4DV0 Q;  2FFK B;  4DV6 L;  3M3Y B;  4G7O C;  1KAA A;  1ENC A;  1OXU A;  2M2L A;  1LT5 D;  3S1Q H;  2R6G A;  2JN4 A;  4NMZ A;  1BBX C;  3S1M B;  2A1A A;  4MHE A;  1X56 A;  3DM1 A;  3NXW A;  4JI8 L;  3M4O B;  1V1O A;  2KBN A;  3HOU G;  4J1M A;  4BBS G;  5HY6 A;  4LFC L;  3S1R H;  1B1Z A;  3RZO B;  1EOT A;  4KJO A;  2K5W A;  3QO2 A;  4OEL B;  1WTQ A;  2NUC A;  1M90 C;  4FF4 A;  1XMQ L;  1S5E D;  4LF4 Q;  4BXX G;  2NZO A;  1B3Q A;  3J80 L;  4DR1 L;  2K04 A;  3HRZ C;  1I50 B;  1X9N A;  2WIN B;  3HOW G;  2Z6B A;  4HCE A;  4JVZ A;  1E22 A;  1LTL A;  1Y1V H;  2MP1 A;  5KYL A;  5IE8 A;  2R61 A;  1I3Q H;  3I4O A;  3S24 A;  3HOX B;  2EVB A;  3TZU A;  1Y1W G;  1I94 L;  3SK8 A;  3A74 A;  3W2D A;  5EPK A;  5JPN C;  4K0K L;  1Q8K A;  2ZXR A;  1OXX K;  3PIO A;  4HIK A;  3S9W A;  3U4V A;  5JPM C;  4BY7 G;  2E2H B;  5IOC A;  2JA6 H;  3OW2 A;  1HR0 L;  5BN4 A;  5DM6 3;  4LFA L;  4HJA A;  1S72 A;  3KOJ A;  1HUN A;  3FEW X;  1I4X A;  2DN8 A;  3BDO A;  3TRE A;  3CCJ A;  2PQA B;  4F8M A;  1YNJ C;  4BBS H;  1X55 A;  2QEJ C;  4HJ9 A;  3V05 A;  2MGS A;  2XNA C;  4FNF A;  1ESF A;  2VB3 X;  1WFQ A;  4LFB L;  4OX9 L;  3NTI A;  4BXX H;  2LMC B;  1PFB A;  4DR4 Q;  4BBR B;  5EKI A;  3HOW H;  1YNN C;  4DAY A;  3R93 A;  3I3C A;  1WTR A;  1A3U A;  5LHY 1;  2SEB D;  5C3E B;  3GTK B;  4P74 A;  3ONA B;  4R8N A;  2DNC A;  2VUM G;  1SLJ A;  2GVB A;  5M3M B;  2DJF C;  2B2W C;  4KMU C;  1Y1W H;  4JI1 L;  1IBL Q;  1ZKO A;  2A69 C;  2ZJR A;  1XPO A;  4OO1 I;  4UHV A;  4KD4 A;  3RN2 A;  5IT9 L;  3I8Z A;  2DJG C;  4IJH A;  3D8G A;  4X62 L;  4P72 A;  2VQF L;  2HCI A;  4GKK L;  4YWL A;  4BY7 H;  3VR3 A;  1UE6 A;  1N33 L;  1QNU A;  1JOR A;  1RF2 D;  1IBK L;  1V8Q A;  2HCC A;  2WB1 E;  3QIA A;  1G2T A;  1O80 A;  2JJQ A;  4A3J B;  3PIO 3;  2MHV A;  3TDQ A;  1QUQ B;  3RLN A;  2PQE A;  4OIJ A;  1IYJ B;  2XTI A;  2FMC A;  5TSS A;  1KAB A;  1PRT F;  4OO1 H;  4JI8 Q;  1JC7 A;  1SNO A;  1WCM H;  3URY A;  3AQQ A;  3N6R A;  3G7L A;  4V19 0;  1QCB D;  1EQQ A;  1XTC D;  1S3O A;  5C5L A;  4YHH L;  2WB1 G;  2LXK A;  1R9T B;  1HHV A;  3SGI A;  5C4H A;  4DXF A;  1XMQ Q;  2JA5 H;  4WJ4 A;  3CC4 A;  4POG A;  2A8V A;  1E2Z A;  1NAP A;  4LF9 L;  4HMI A;  1SBB B;  2M9V A;  4F88 A;  1M1K C;  2F0H A;  1H9K A;  1SE2 A;  2BA0 A;  3J7A 5;  3E9I A;  4I65 A;  1KNA A;  3S1N B;  1EU4 A;  2EJG C;  3VR5 A;  2VUM H;  3RLF A;  3T4A C;  4IN3 A;  1KTK A;  1I94 Q;  2NN6 G;  3RR5 A;  4NKL A;  4CDE C;  2OXP A;  3I4M B;  4L6T B;  4K0K Q;  4JCV E;  4Z9C B;  1F2Z A;  3OMG A;  3ERQ A;  1BVS A;  5G3L F;  3M3Y H;  4A3M H;  4GLA C;  2RF4 A;  3IFD A;  4JI2 L;  1UE7 A;  5I6W A;  1PH7 A;  2HUG A;  2VZA A;  3AMU A;  4LF6 L;  1X3P A;  1WTP A;  3M4O H;  4JI7 Q;  4IFD I;  2N78 A;  4TQU S;  4KK7 A;  5JVH 3;  3RZO H;  2IY5 B;  1JIC A;  1U4M A;  4RHR A;  1J8I A;  3A0J A;  1BBU A;  4B3S L;  1LTR D;  3C3L A;  3OTO L;  2F0V A;  4C56 C;  5CV6 A;  1EUJ A;  5I9O A;  3A5Z B;  1GUW A;  1JWS D;  4BBR G;  5M5Y B;  2K7V A;  3P20 A;  4JBK A;  1NY4 A;  3MEH A;  4MTK A;  3RN5 A;  3NWT A;  3NEN A;  4DK3 C;  5C3E G;  3HOX H;  4QJF A;  1PV4 A;  1EY6 A;  4P73 A;  5M3M G;  1CSQ A;  4TRD A;  1VQ9 A;  1SMX A;  3T16 A;  3CCQ A;  5KND A;  4N8F A;  3K7A B;  4JI1 Q;  2YYZ A;  1B2T A;  2A19 A;  4P75 A;  2A5H A;  2IHE A;  2ZJQ A;  1FNU A;  1W6K A;  2E2H H;  2RSO A;  2OEO A;  4K8J A;  1E1O A;  2VQF Q;  3EIV A;  4GKK Q;  2FXQ A;  3TZD A;  1X54 A;  1N33 Q;  3C2P A;  3E6Z X;  4AIM A;  2H4O A;  1C8C A;  4A3J G;  4CHT B;  2C9O A;  5J3B A;  1IBK Q;  1VQP A;  3J80 i;  2A6H D;  3DUZ A;  2E2D C;  3NBH B;  2IPK D;  2Z4H A;  4KV6 A;  4LJZ C;  5G3L D;  1F77 A;  2VL6 A;  2NZ1 D;  3PMF A;  2I46 A;  1T5X D;  2NVY B;  4A3L G;  4K5W A;  4YHH Q;  3KF6 A;  2F0M A;  2SNM A;  4OL7 A;  1SRO A;  1RJT A;  4OGQ C;  4DA2 A;  4XTC S;  4IOC A;  4LF9 Q;  2B2U C;  3GTK H;  3CCM A;  4S3S A;  3NBI A;  5I9P A;  1LTI D;  5M3M H;  3W1B A;  2CCZ A;  1LTA D;  1JJC B;  3R3O A;  2UUC L;  4K5V A;  5HGQ A;  3K8A A;  3I4M G;  5BN5 A;  2QGQ A;  4R8I A;  1B7Y B;  1VQN A;  2K5N A;  4LK1 C;  4LF5 L;  3AEV A;  3RNU A;  2PZT A;  1JJ2 A;  4XYQ A;  2DY7 A;  1PTO D;  3M4Y A;  3ND9 A;  4B3T L;  4IUN A;  4JYA Q;  1GOZ A;  4HMJ A;  3V96 A;  2Q8R E;  1K8G A;  4JPB W;  4JI2 Q;  1K3B C;  1TT2 A;  3GTJ B;  3OSO A;  4WRD A;  5D14 A;  4LF8 L;  2PW7 A;  4CJ1 B;  4KTA A;  4LF6 Q;  1MJE A;  1EEF D;  1HZC A;  2H1E A;  1JWU D;  5M5X B;  4L5T A;  4WFN 3;  4FF1 A;  2CQO A;  3FPU B;  3KLR A;  4L5Q A;  1STY A;  2BDN A;  3VR2 A;  2R92 B;  4AQY L;  1R9T H;  3OYY A;  1XWE A;  3OTO Q;  4JV5 L;  4A3L H;  3W5O A;  2MQH A;  4RFB A;  2E5L Q;  5IGE A;  1WTW A;  1KLU D;  4J15 A;  3A54 A;  1TS3 A;  1A62 A;  3TEH B;  4GS3 A;  1WYD A;  2UXC L;  1GKH A;  1GUN A;  2EY2 A;  4JW0 A;  5KYI A;  3EA6 A;  1DJR D;  2VS1 A;  3S1N H;  4IJL A;  1QJO A;  2R3Z A;  5FLX E;  3K5O A;  5EJW A;  1MJC A;  1QVC A;  3DMU A;  1TXY A;  4HSV A;  4R4C A;  1FGB D;  2E74 C;  3STB C;  1ONL A;  4ULL A;  1L0X B;  5FLX c;  2NTT A;  3DXJ C;  4GN3 B;  3IRB A;  2XWJ B;  5M3F G;  3EN2 A;  1X3E A;  1BO0 A;  3IAY A;  4P2C B;  4DUY L;  1PVO A;  3OHX C;  1B9M A;  1QVG A;  5LL6 X;  2LSS A;  5LMU L;  2PI2 E;  4XQQ A;  4YCW A;  3SXH A;  1CKN A;  2OWO A;  2D0P A;  4CGY B;  4A3G B;  3HFZ B;  3Q24 A;  3CD6 A;  3MFG A;  1RL2 A;  2KCN A;  1PH2 A;  1TS2 A;  5M5Y H;  3D4R A;  1TWF B;  2I5M X;  3CC7 A;  1S40 A;  1VQ7 A;  4K8I A;  1K0R A;  3QB3 A;  1WVL A;  3KBG A;  2KJX A;  4ILW A;  1LT6 D;  4A4I A;  1XYI A;  3K7A H;  4KY6 A;  4DV7 L;  1E7Z A;  2WV6 D;  2EYF A;  4FYD A;  4XQJ A;  1SN8 A;  3PUW A;  4IUP A;  3DEO A;  4LF5 Q;  4XT1 B;  2RCF A;  3NQT A;  1N36 L;  1LYL A;  1Q12 A;  4KN4 C;  4HN7 A;  2ZTC A;  2Q2T A;  1GUS A;  1BCP B;  2BH8 A;  2ICE C;  1STN A;  4C3I B;  5JJK A;  4LF8 Q;  4UP8 A;  2HQL A;  4L5S A;  3R2T A;  2F0N A;  3A55 A;  2H5X A;  3RLO A;  2CH4 A;  2A6E D;  3BZD B;  5CBA E;  4A3I B;  2R92 G;  2NVY H;  4DV5 L;  5CV7 A;  1D5X C;  1ILP A;  4OHJ A;  2IX0 A;  5LL6 S;  4G4K A;  3F1Z A;  3OWE B;  5F2D A;  2J7Z A;  2L1B A;  1STH A;  5C4Z A;  3K57 A;  3TP6 A;  3Q22 A;  2UXC Q;  4GZY C;  2UUB L;  1U5K A;  1RTN A;  1TKW B;  3BVM A;  1WJJ A;  1CA5 A;  2IT1 A;  4EQO A;  3QOJ A;  4QL5 A;  4PMW A;  5IOD A;  2QDB A;  4F7X A;  3BZC A;  1JT8 A;  1P16 A;  1LAC A;  3K81 C;  4DUZ L;  3S16 B;  2L15 A;  3CCL A;  3T13 A;  1HNW L;  2GA4 B;  4Y7N B;  2LKV A;  3FPP A;  2F0E A;  4L5R C;  2K32 A;  2PI2 A;  4R4O A;  2PYK A;  3I72 A;  2B2T C;  4C1N K;  1SMY C;  3PIP A;  3GTJ H;  3E0E A;  1VQ4 A;  1FGU A;  4DUY Q;  2F0L A;  4A3F H;  2CFM A;  1X3G A;  5CBE E;  5M5X H;  3CXC A;  2B3G A;  1K73 C;  4OWT B;  4QIW B;  1LM0 A;  5IP9 G;  1HZ9 A;  1IYV A;  1IZ6 A;  4GOP A;  1GUT A;  4HSP A;  3TME A;  4JOI A;  2VQE L;  3SK4 A;  4B9X A;  3H94 A;  1BXT A;  4X3U A;  1EYD A;  1HA5 A;  2BOS A;  4TSS A;  3UE0 A;  1PLF A;  2SNS A;  1XX8 A;  1AH9 A;  2KHJ A;  1WTV A;  2Z4I A;  1S5C D;  1GVP A;  1F2M A;  1O7I A;  3BYY B;  4CBV A;  2R93 B;  1QB5 D;  1WTH A;  5EPJ A;  3CCR A;  1I4G A;  1Y8P B;  3I7F A;  1N36 Q;  1U0L A;  3OWF A;  3HOV B;  1Y8N B;  3OMC A;  3CME A;  4HAE A;  5CV4 A;  3GTL B;  2EY5 A;  1LV9 A;  3P1H A;  1B4O A;  3VYS A;  2EYH A;  3K59 A;  4RGM A;  1S4Z A;  1B8A A;  1TWH B;  3BS1 A;  3L0O A;  4QCL A;  4A3I G;  1HCZ A;  4A3G H;  4BWG B;  2B2V C;  3PIP 3;  4DV1 L;  4PG3 A;  1Q7Y C;  3M7G A;  1UUP A;  4BA2 I;  5IP9 H;  1MIU A;  1TWF H;  4A3B B;  3NTH A;  3EBE A;  1D6E C;  1NMG A;  4KKU A;  1SE3 A;  1JQY D;  1X3F A;  1TWC B;  2UUB Q;  3J81 E;  5DEH A;  1H9M A;  2MNA A;  2CHB D;  4DR7 L;  4X65 Q;  1LTS D;  2JE6 I;  4DR2 L;  4DKA C;  1L2F A;  4LF7 L;  1HTL D;  2QEX A;  5C4J H;  3J81 c;  2ENB A;  1G91 A;  3JC6 6;  1Q86 C;  5E1F A;  3GTP B;  3NWS A;  2CH4 W;  2K5Q A;  2N49 A;  3GV3 A;  4IPD A;  3QR8 A;  1PH4 A;  1KRS A;  3VDY A;  1CUK A;  4HJ5 A;  1HNW Q;  1TY0 A;  3D31 A;  3CQZ B;  3SK5 A;  1NUC A;  1SYE A;  4C3I H;  1PH8 A;  2O5I C;  1B44 D;  1CI3 M;  4LW1 A;  2RHS B;  4LUO A;  3HKZ E;  2N88 A;  3MAQ A;  3PUX A;  4A3I H;  3G6E A;  4DAV A;  1A0I A;  3JAM L;  3P7J A;  1N8R C;  3CF5 A;  4F87 A;  1EWH A;  1SYF A;  2EQS A;  1K83 B;  4X3S A;  1EY7 A;  3GTM B;  1AP0 A;  5CYU A;  1VQM A;  2Z6K C;  2V4D A;  3GO5 A;  2KVM A;  3SK6 A;  2B2Y A;  3DWA A;  4ZQ3 A;  1BBW A;  3GTQ H;  3HKZ G;  3VA7 A;  1AZP A;  4DGZ A;  4JI5 Q;  4RWS C;  2ZT9 C;  1II3 A;  2F03 A;  3S17 H;  1E1T A;  2WB1 B;  1EIY B;  4IUQ A;  1EYC A;  1JE4 A;  5DAU A;  4A3D G;  3S2H B;  2R93 G;  2ALY B;  1B50 A;  1IW7 D;  1K8M A;  3S16 H;  3T56 B;  3MXP A;  4CKC A;  3UDF A;  2YV5 A;  4FP5 D;  3E3X A;  1CKM A;  1K28 A;  1MSH A;  5LMN W;  1CA6 A;  4DFA A;  4UDU C;  1HQR D;  1H9S A;  4H0L C;  3HOV G;  1X3Q A;  2NVQ B;  1MD2 D;  1MBY A;  1EY8 A;  1ENA A;  3NPP A;  1L0W A;  2RQX A;  2EY6 A;  2F4V Q;  4KN7 C;  5FKA C;  4QUF A;  4KHP L;  1BKB A;  1G6Z A;  5CC4 A;  5C3X A;  1PH1 A;  4JBM A;  2G9H D;  1I6H B;  1HZA A;  1T9H A;  1VQE A;  4DV1 Q;  3HEJ A;  5FJ8 G;  4A3B G;  3Q8D A;  3HOU H;  1XTD A;  3TBI B;  1H9R A;  3V2T A;  4B3M L;  4WJW A;  3J81 i;  1JB3 A;  1Y8O B;  4GLX A;  2AQ1 B;  3TQY A;  4ZKB B;  3G4S A;  2K03 A;  3P75 A;  2A68 C;  2EYO A;  5FOB B;  3MXN A;  1DGS A;  1GUG A;  2CQA A;  2DNE A;  3NSW A;  4IUR A;  1L1O A;  5JVG 3;  2L12 A;  1I4H A;  2AMC B;  4DR7 Q;  2P5Z X;  1QG7 A;  4DR2 Q;  3H91 A;  4LF7 Q;  1V1P B;  1MI2 A;  2F0P A;  3H0G B;  3SR1 A;  4CJ2 C;  5I6Y A;  1I4P A;  4DV3 L;  1HJP A;  4LAA A;  2ZXP A;  4HR7 B;  3HS0 C;  3GTL H;  4EVO A;  1YI2 A;  1YNX A;  2HIV A;  3PF5 A;  1KLG D;  5BN3 A;  1FNV A;  4ZK9 B;  1SXT A;  1TWH H;  1EQT A;  4QQB X;  4DV6 Q;  1AW7 A;  2NWG A;  1QOH A;  4U67 3;  1LT3 D;  2TSS A;  4A3B H;  4NDX A;  2E2J B;  1JJG A;  1OXT A;  2EJM A;  2ATW A;  1UEB A;  4ZRZ A;  1EFW A;  3S15 H;  5E7N A;  2BA1 A;  1G8Z D;  4LFC Q;  2RCN A;  3J80 E;  4KHV A;  1FNW A;  1TWC H;  3D0F A;  2QW7 A;  2UXD L;  1D5Z C;  3CKI B;  4GKJ L;  1STG A;  2J0T D;  1GD7 A;  2F0J A;  3KLW A;  1R4P B;  1EYA A;  3KF8 B;  4DR1 Q;  3BU2 A;  3J80 c;  5C4X B;  1FR3 A;  5DLQ E;  3G71 A;  2YTX A;  3GTP H;  3KYH C;  3S14 B;  3D6C A;  4PQX A;  4DNT B;  4GN4 B;  3CW2 C;  1EFI D;  3CQZ H;  1CKN B;  1SEB D;  1STB A;  3OIQ A;  1V1Q A;  3C1E A;  2K28 A;  1G2S A;  1Q46 A;  4JBJ A;  1G6P A;  2HHH L;  2B8G A;  3K58 A;  4C1N I;  2EYL A;  1W2B A;  4UY8 C;  1T5E A;  1HR0 Q;  3S1M H;  4LFA Q;  2J4X A;  4XXE A;  2V1C C;  3GTM H;  1SAP A;  1MGS A;  1RKN A;  3PO2 B;  3MC0 B;  2KEC A;  2QCP X;  3RD4 A;  2AQ2 B;  1EEI D;  1CQF A;  2F0O A;  2NN6 I;  3BDC A;  3I4N B;  3GV6 A;  1GHJ A;  4HED A;  4JI6 L;  2Z9H A;  1I50 H;  4LFB Q;  1K0S A;  4OX9 Q;  5JEA G;  3NP8 A;  2XRQ D;  3S2H H;  3UE1 A;  5IGD A;  2AUK A;  1PRT D;  1GUO A;  3E5S A;  1VQI A;  3H0G G;  2HDM A;  3FDT A;  1LTT D;  1O78 A;  2A6H C;  5IGG A;  1O7Z A;  1SJE D;  5IT9 E;  2UUA L;  4HJ8 A;  1LUZ A;  5EBC A;  1SRU A;  5AJ3 L;  2NN6 H;  4PMC A;  4YCV A;  2PZW A;  5JOB A;  2I0Q A;  3HOZ B;  3W1G A;  2K5D A;  3ICE A;  1E2W A;  4DK0 A;  5IYC G;  5IT9 c;  1CT1 D;  4APV A;  4X62 Q;  1SNM A;  5T1G A;  5JJL A;  2XIW A;  4JOI C;  1WD1 A;  2ES2 A;  3I56 A;  3U9S A;  3K5M A;  1QWY A;  5FLM G;  2LY7 A;  5M3F B;  1TU2 B;  2F0G A;  2EYP A;  2X69 A;  4DR6 L;  1P8L A;  3F2D A;  4RGT A;  5C6A A;  5BR8 L;  2O5J C;  1N9W A;  5FO7 B;  3M4P A;  1VQO A;  1SYC A;  3Q0A A;  2F52 A;  1J5E L;  4GNX C;  3J7Z C;  4YY3 L;  5IGB A;  4RMF A;  2CKZ B;  4BBR H;  2UXD Q;  1HXY D;  4GKJ Q;  3MXG A;  3AU7 A;  3MZ5 A;  5JEA H;  1HNZ L;  5C4X G;  4KJN A;  1PTO C;  3KLS A;  3I55 A;  4C3J B;  4KKS A;  5C3E H;  4BY1 G;  3CCS A;  1VF5 C;  5C44 B;  1W6J A;  1DXM A;  2UU9 L;  3U58 A;  4MN3 A;  1LLR D;  1BR9 A;  4K14 A;  2EYM A;  2DUD A;  4CDC C;  5KNB A;  2K33 A;  4CKB A;  5A35 A;  4PV1 C;  4MZ9 A;  5COR A;  4Y52 H;  5L37 A;  2HHH Q;  1I4Q A;  3SHL A;  1WOC A;  1B3A A;  2PQA A;  5FLM H;  4ID6 A;  1TY2 A;  3PUV A;  4GOP B;  4A3J H;  5LMN L;  2L5T A;  4ZAI A;  1VQH A;  3PO2 G;  1CHQ D;  2RBM A;  4X3K A;  1TWA B;  1VQD A;  2L55 A;  2EXZ A;  2MUY A;  1C9O A;  2F0D A;  3I4N G;  4B3S Q;  1YBY A;  1WTO A;  1D1I A;  5ELD A;  3BG3 A;  2JA7 B;  2ICI A;  3D4D A;  2JK8 A;  4FXK C;  1ASY A;  3ER0 A;  1SE8 A;  4GNX B;  5C4X H;  3MWY W;  2D2C C;  2B39 A;  3TP7 A;  4KLK A;  4QUC A;  4MTN A;  5JEA J;  1F9S A;  2YTV A;  1QVF A;  3L2P A;  3PUZ A;  2OQ0 A;  1PTO B;  1EWC A;  4XIG S;  1Z7T A;  2Y0S B;  3S2D B;  1IHZ A;  3VYU A;  3HOZ G;  1Q81 C;  1LO5 D;  1KRT A;  1VQG A;  3I4M H;  2F3I A;  3DLL A;  3T53 B;  3LGJ A;  5AJ3 Q;  4EQP A;  1WD0 A;  2UXB L;  1OO9 B;  3FKI B;  5C5M A;  2I07 B;  1BCP C;  1EY9 A;  1QUQ A;  3N52 A;  4KY5 A;  1EIG A;  1S5F D;  1LT4 D;  4IPG A;  1ICF B;  2EOT A;  2WKD A;  3BJU A;  4HIM A;  1UAP A;  2CW0 D;  2D5D A;  1B53 A;  4UP7 A;  1EZ6 A;  1U4P A;  5BR8 Q;  1X32 A;  2F0U A;  1UEA B;  2K05 A;  1BDO A;  2L9H A;  2DGY A;  1B9N A;  3GDE A;  1N32 L;  4FDB A;  4AYB E;  4YY3 Q;  3MXU A;  1TWG B;  4PMB A;  3RUZ A;  1M8A A;  2N8N A;  2A73 B;  3AYH B;  4QF4 A;  3WWV A;  4C3J G;  5NUC A;  3E9H A;  5CR3 A;  3MFY A;  5C44 G;  2K5V A;  1JOQ A;  2EJF C;  3ERS X;  1A3V A;  2UU9 Q;  1SSO A;  3F2C A;  2K75 A;  2QIL A;  4AYB G;  1NR4 A;  1ZEQ X;  1X6O A;  4KKT A;  1SNC A;  3OW7 A;  2A6E C;  2UUC Q;  5KNC A;  4DR5 L;  1ASZ A;  5IGF A;  1A15 A;  4RCO A;  1I6V C;  4RGO S;  2B29 A;  3J7A F;  3AFQ A;  4H13 C;  2CVR A;  4K2K A;  2B63 B;  1JOO A;  5KGU A;  5GQO A;  5M3F H;  1Z6H A;  4IUU A;  2TMP A;  3D6W A;  1L1O C;  4B3T Q;  1CQV A;  4A3K G;  5IYD G;  3GP7 A;  4DF7 A;  3TSS A;  2F0T A;  3BZK A;  2CWP A;  2NBF A;  1VQ8 A;  1AE2 A;  1XMO L;  4OIK A;  4LUZ A;  1Q8I A;  3VR4 A;  2Y0S E;  2JA7 G;  3KJO A;  4DNI A;  4FF3 A;  4AQY Q;  4JV5 Q;  2F0Q A;  1GO3 E;  3BVZ A;  2IX3 A;  2KEN A;  5JJI A;  2QKI C;  4IUV A;  4C3J H;  1KIX A;  1STA A;  3J81 j;  5IY0 A;  4HJ7 A;  3PO3 B;  2EPB A;  2E2I B;  5C44 H;  1EOV A;  4IAL A;  3MTS A;  4R4Q A;  1L0Y B;  1XXG A;  3LWE A;  2VB2 X;  2Y0S G;  1KD1 C;  3B6Y A;  3KJP A;  1XNQ L;  2JXM B;  3G6J B;  2G9D A;  2KCM A;  1YZ6 A;  3Q23 A;  1YEZ A;  1F9Q A;  3FKI G;  5GRO A;  4X64 L;  2UXB Q;  1SE4 A;  2VNU D;  3MVV A;  4ME5 A;  2EIF A;  2PZU A;  1YIT A;  2IL8 A;  4HCS A;  5IGC A;  1BF4 A;  1YVC A;  1DD2 A;  1CK1 A;  3NBH A;  3CRL C;  3QJY A;  4O0A A;  1O7Y A;  2KUM A;  3OIP A;  4EGV A;  1PMR A;  3L9A X;  4PNY A;  5CV5 A;  3KDF A;  1L1O B;  1AZQ A;  2G5D A;  5LMU Q;  1YHA A;  4GLV B;  1I3Q B;  1PH6 A;  2R92 H;  2YU9 B;  3UDI A;  4DAY B;  1BOS A;  2K1B A;  3PQI A;  1ZYR D;  2KQ3 A;  2BH2 A;  1QNK A;  5C0X J;  1CSP A;  3F2U A;  3EQL C;  2MO0 A;  3M7N A;  3I70 A;  3CPW A;  2Z8L A;  4DV2 L;  4N9T A;  3HKZ B;  1PTO H;  2JA8 B;  5FK9 C;  1UWV A;  1F9P A;  5A2Q L;  5IP7 G;  1SNQ A;  4NW2 A;  3IL8 A;  3KUP A;  4A3D B;  1YJ9 A;  2AQ3 B;  4DV7 Q;  2JA9 A;  5DNF A;  1GXD C;  1WTX A;  4ZYS A;  1KC8 C;  1HH2 P;  2B63 G;  4R1J A;  3F8T A;  5M9O A;  2PPB C;  2AUJ D;  1F2Y A;  1RDP D;  1LAB A;  4RHS A;  1TR5 A;  3KLS X;  4PZ7 A;  2NZH A;  3O13 A;  2XGT A;  3RMH A;  2PCF B;  3U4Z A;  3LNN A;  2X6G A;  1HFN A;  2E76 C;  2IW3 A;  4DV5 Q;  2Q2I A;  5DM7 3;  2KHI A;  1TWG H;  1SFO B;  2XSC A;  5CGK A;  1CZG A;  2BE5 D;  1YHQ A;  4ODG A;  3PO3 G;  2NVT B;  2ZTD A;  3C1F A;  5ELN A;  1S5D D;  1XJV A;  4IPC A;  1PZI D;  4K2L A;  4QMG A;  5GAG C;  2AWN A;  5J22 A;  2KED A;  4DUZ Q;  1XNR L;  3HP3 A;  3X3N A;  4X64 Q;  4K6D A;  2E8G A;  4DK1 A;  1J9O A;  2WP8 J;  1RTO A;  4RCN A;  1M4V A;  4DR4 L;  2B8F A;  3PCO B;  1DYQ A;  4C3H B;  1EQR A;  1TS4 A;  4MNO A;  2ZTE A;  2JA5 B;  1SYD A;  5H1S E;  1TVX A;  3CAM A;  5IYB G;  1K8O A;  4BS9 A;  1Q90 A;  1SDF A;  4OWW B;  2DY8 A;  1NSN S;  2BDO A;  1RIP A;  4KY7 A;  1JMC A;  1IW7 C;  1BUV T;  1KDB A;  2NTS A;  1JE5 A;  3J7Y W;  2Q2U A;  3X3M A;  1ILQ A;  1F2L A;  3TS0 A;  1SYB A;  4CJ0 B;  4ZCK A;  5JJZ A;  1NCV A;  1PFM A;  3NUC A;  3PO3 H;  4IZ8 A;  3CRK C;  2E2I H;  4UAI A;  3CC2 A;  4LWC A;  1FJG L;  3GTO B;  3ULP A;  4A3M B;  3CHB D;  2VQE Q;  1HNX L;  2JA8 G;  1PZJ D;  4DV2 Q;  1EIH A;  2RDF A;  1IL8 A;  2I5H A;  4CKE A;  4JI4 L;  1J6Q A;  2D0O A;  2ASB A;  2F0W A;  4OWX B;  5IWA L;  5EPL A;  4JK1 C;  3DHQ A;  4HID A;  4Y7N H;  2K52 A;  5KRU A;  1EZ8 A;  4B9W A;  2R7Z B;  4X66 L;  3A8K E;  5I4D A;  1GJX A;  3ERO A;  1JB7 A;  1VMC A;  1XPU A;  3W3A A;  3A56 A;  5IYB H;  4FXG C;  4ABN A;  3KF6 B;  3ULL A;  2YU9 H;  2K50 A;  3I2Z A;  1PFS A;  1HZB A;  4OEM B;  4RAU C;  3UI2 A;  1LTG D;  3LWU A;  2M00 A;  3I73 A;  2IWH A;  1IL2 A;  2MO1 A;  3IKJ A;  1I5F A;  3Q6S A;  1D8L A;  4NXM L;  3TRZ A;  2JA8 H;  4FXD A;  1Y14 B;  3BYT B;  1C7Y A;  1VQ5 A;  3GQB A;  3CCE A;  5KIX A;  4A3D H;  4JI0 L;  4JI7 L;  4JBW A;  4X3T A;  2R93 H;  1PYS B;  4OO1 G;  1G51 A;  1DOK A;  4E6I A;  4IOA A;  1ROD A;  1WCM G;  4P71 A;  3UDG A;  1XNR Q;  1BNZ A;  3HOV H;  2WAQ E;  4C2M B;  2R7D A;  4C3H G;  1EY4 A;  2OT2 A;  2N55 A;  4RKB A;  4DU9 A;  4O42 A;  3MEF A;  4DAM A;  2JA5 G;  1CZW A;  2ZXO A;  3JAM E;  3NEM A;  4J6H A;  3DWP A;  3CCU A;  1KXL A;  5GAH C;  3A5U A;  1BQQ T;  3PSI A;  4HIO A;  3NE5 B;  3BDL A;  1QE6 A;  1YNJ D;  2WAQ G;  1MKH A;  2KA7 A;  3VA5 A;  3ND8 A;  5FJ8 H;  1DM0 B;  3JAM c;  4A93 B;  3I90 A;  1SFO H;  1E0B A;  5I2X A;  5EQ0 A;  1LTB D;  3TN2 A;  1PH5 A;  2A68 D;  3C46 A;  1VQF A;  2NVT H;  2F0K A;  2ID0 A;  1K3R A;  2K6A A;  4A3M G;  5EKL A;  1FJG Q;  1VS0 A;  1YIJ A;  1FYC A;  1HNX Q;  4ALP A;  4YIJ A;  1YNN D;  2LXJ A;  3KK7 A;  1VQJ A;  4JI4 Q;  2BCO A;  1G29 1;  2A74 C;  2NVX B;  4XT3 B;  4Q0F A;  5GAD C;  3HOY B;  3VYT A;  4BY1 B;  2WFW A;  2A69 D;  5IWA Q;  1IBM L;  1Q1B A;  2R7Z G;  2RSN A;  2SOB A;  4NPS A;  5T1I A;  2QF7 A;  1K9M C;  1ESR A;  2AWO A;  2B2T A;  4C3H H;  3F2B A;  1FVI A;  4X66 Q;  2HQE A;  4EQ5 A;  1QIL A;  5E3F A;  5ELF A;  4XYO A;  1A2U A;  1U9R A;  3HOX G;  5FO8 B;  4IFD G;  1PRT C;  4KHP Q;  3NTK A;  1PH3 A;  2NYZ D;  3I91 A;  3KFU A;  1K83 H;  1RCV D;  1YHB A;  2D62 A;  1A63 A;  1VCI A;  2FIN B;  4OON A;  4HTH A;  1UNS A;  1Q82 C;  4B3M Q;  2KCC A;  2GVA A;  3GTO H;  2JEB I;  3RZD B;  4NXM Q;  3VR6 A;  4TKO B;  2XRS D;  2CWA A;  4DNR B;  4JYA L;  3CCV A;  2JYO A;  1NR2 A;  4ZKC B;  2LS0 1;  3GTG B;  4AH6 A;  4JI0 Q;  1JCK B;  2RHQ B;  4GN5 A;  5K5P A;  2EY1 A;  1I4R A;  1HTP A;  3HGB A;  4O2D A;  4QGU A;  3HKS A;  2R7Z H;  1ET6 A;  3JAM i;  2NVQ H;  3G48 A;  2E5L L;  3E0J A;  5HUR A;  4L8J A;  4DV3 Q;  1KAW A;  2OTL A;  5KEE A;  5HGT A;  2WKC A;  4IUT A;  2L11 A;  4RKL A;  3VYR A;  4GOP C;  1HA6 A;  3TS2 A;  4IFD H;  3EJI A;  3ULJ A;  4J8Q A;  2B2V A;  2JP1 A;  2XWB B;  5D3I B;  4A3E B;  1I6H H;  4BA1 I;  1NNX A;  1PTO F;  5FO9 B;  5ISR A;  4A93 G;  1PRT B; 
#chains in the Genus database with same CATH homology
 4M1U B;  1KDA A;  3TP5 A;  4B08 A;  4K6L A;  5FLX L;  1H9J A;  5E4W C;  4IQZ A;  3A8I E;  5K36 G;  1ZXT A;  1U4R A;  1EY5 A;  1A3T A;  4FO2 A;  1V43 A;  1VMP A;  5ELC A;  2F0F A;  1F9R A;  2C5C A;  4O1N A;  3J7A V;  2O4X A;  2EYJ A;  3H3V C;  2L0C A;  4RGN A;  4AYB B;  5D65 A;  4FVM A;  1EU3 A;  3SE0 A;  1DZ1 A;  1VDZ A;  1PDQ A;  1TQO A;  1MSG A;  3U9O A;  5J39 A;  1TS5 A;  3CU7 A;  3ZYY X;  2WAC A;  4N9P A;  1ET9 A;  4IFD J;  3QOL A;  2LFN A;  4A3K B;  3SEB A;  4DXG A;  4H7B A;  1C48 A;  3D4W A;  4DN4 M;  5JAV A;  2Z1C A;  2KOL A;  3DEP A;  5K36 H;  3FRP B;  1V1P A;  2SDF A;  1BCP F;  5C3W A;  1KDC A;  4A3F B;  1CHP D;  2CW0 C;  4LMQ D;  2F0I A;  1JOK A;  4H44 C;  5M5W B;  1E2V A;  4QB4 A;  2PW5 A;  2B2Y C;  2F3W A;  2MJ8 A;  3K6O A;  4R9W A;  1EY0 A;  3ITP A;  4KI0 A;  4Q5V A;  3K0Y A;  1ICW A;  3NQI A;  2RDG A;  1DCZ A;  1AN8 A;  2EDG A;  3H6M A;  2NB0 A;  2L4N A;  2HDL A;  1HPC A;  3KF8 A;  3T51 B;  5C0X G;  3I4L A;  1FD7 D;  3HZX A;  2KEE A;  3R8B A;  1AFP A;  1PZK D;  1SJH D;  1OXS C;  3H09 A;  2F4I A;  2B2W A;  2F0S A;  1HRJ A;  5EGT A;  1C4Q A;  4L63 B;  3M85 A;  2JSO A;  5J1Z A;  5COY A;  3K5L A;  1JWM D;  1BCP D;  2IX1 A;  1D2B A;  1PXU A;  1U4L A;  1Q1E A;  3EFX D;  5C0X I;  5EKK A;  1RD9 D;  5CV9 A;  2RKS A;  2Q8I B;  2VXW A;  3OPO A;  2EE1 A;  2EZV A;  5CMD A;  2JEA I;  5CV8 A;  5C4J B;  4ZLT F;  5AFW A;  2FHT A;  5C0X H;  1SNP A;  2X6L A;  1A2T A;  4G57 A;  1JR0 D;  3OOC A;  1H9S B;  4ZUJ A;  3FMC A;  1OXV A;  3S1Q B;  3EVQ A;  4MIU A;  3SDZ A;  4M8A A;  4NP5 A;  4G7Z C;  1KNE A;  3FVQ A;  2RDH A;  1ZYR C;  3PV0 A;  5EBD A;  3S1R B;  2WII B;  4I7Z C;  5I2Y A;  1VF7 A;  3GTQ B;  2RA4 A;  3A8J E;  2PMZ B;  2O2L D;  2PO4 A;  4ZUI A;  3S17 B;  3WOE A;  3GD7 A;  1ENF A;  1DOL A;  3LX0 A;  1CM9 A;  3J81 L;  3A7A B;  3WOF A;  1Y1V B;  5ELE A;  1DOM A;  1STE A;  1TII D;  1A6X A;  2Q8T A;  4XQN A;  1HFG A;  3WDN A;  1Z47 A;  4KD3 A;  2JA6 B;  4EQN A;  3SVM A;  3R2I A;  3QWN A;  3HOU B;  4BBS B;  2MPM A;  4V0B A;  2BE5 C;  1SMY D;  2RVL A;  1HUM A;  5D3D A;  2F1M A;  3L3O C;  1CTM A;  1Q3L A;  3L7Z C;  1PYW D;  3NHH A;  3TP8 A;  3HOW B;  1O7L A;  3MA2 B;  3D3R A;  3DWQ A;  2KHS A;  1Y69 U;  1Y1W B;  2D9U A;  5ELB A;  4C3I G;  2B2U A;  4BY7 B;  2PNR C;  4XDX A;  4DAP A;  2XVS A;  2FJ2 A;  1HQM C;  1R4Q B;  5E4X A;  1IKL A;  3BVG A;  4K5X A;  4FF2 A;  4G7H C;  1SND A;  1WCM B;  3S15 B;  1EL0 A;  4RA8 A;  1PFN A;  2E75 C;  3QG1 A;  1AEX A;  2FMM A;  4WOR A;  1IYU A;  1S5B D;  3KBX A;  1IKM A;  2F3V A;  4KHZ A;  1SYG A;  1GHK A;  1EQV A;  1ML0 D;  4RH6 A;  3PUY A;  3A7L A;  2IJ0 A;  1CFM A;  1RHP A;  4U68 A;  2VUM B;  3MHB A;  2WAQ B;  1D1K A;  3HG9 A;  3NK9 A;  2XN9 C;  5IIF A;  1DON A;  3AB9 A;  1D5M C;  2OF1 A;  3IFT A;  2K01 A;  5A2Q E;  3K5N A;  4G7O C;  2FFK B;  3M3Y B;  1KAA A;  1ENC A;  1OXU A;  2M2L A;  1LT5 D;  2R6G A;  4NMZ A;  1BBX C;  3S1M B;  4MHE A;  3DM1 A;  3NXW A;  3M4O B;  1V1O A;  4J1M A;  1B1Z A;  3RZO B;  1EOT A;  4KJO A;  2K5W A;  3QO2 A;  1WTQ A;  2NUC A;  4FF4 A;  1S5E D;  3J80 L;  2K04 A;  3HRZ C;  1I50 B;  2WIN B;  4HCE A;  5KYL A;  2MP1 A;  2R61 A;  3HOX B;  2EVB A;  3TZU A;  3SK8 A;  3W2D A;  5EPK A;  5JPN C;  2ZXR A;  1OXX K;  3S9W A;  5JPM C;  2E2H B;  5IOC A;  5BN4 A;  5DM6 3;  1HUN A;  3FEW X;  1I4X A;  2DN8 A;  3BDO A;  4F8M A;  1YNJ C;  2QEJ C;  3V05 A;  2MGS A;  2XNA C;  4FNF A;  1ESF A;  2VB3 X;  3NTI A;  2LMC B;  1PFB A;  4BBR B;  5EKI A;  1YNN C;  4DAY A;  3R93 A;  3I3C A;  1WTR A;  1A3U A;  5LHY 1;  2SEB D;  5C3E B;  3GTK B;  3ONA B;  4R8N A;  2DNC A;  5M3M B;  2B2W C;  4KMU C;  1ZKO A;  2A69 C;  4OO1 I;  4KD4 A;  5IT9 L;  3I8Z A;  3D8G A;  2HCI A;  3VR3 A;  1QNU A;  1JOR A;  1RF2 D;  1V8Q A;  2HCC A;  3QIA A;  1G2T A;  1O80 A;  4A3J B;  3PIO 3;  2MHV A;  3TDQ A;  2PQE A;  4OIJ A;  5TSS A;  4OO1 H;  2FMC A;  1KAB A;  1PRT F;  1JC7 A;  1SNO A;  4V19 0;  3URY A;  3N6R A;  3G7L A;  1QCB D;  1XTC D;  5C5L A;  1R9T B;  1HHV A;  5C4H A;  4DXF A;  1E2Z A;  1NAP A;  4HMI A;  1SBB B;  2M9V A;  4F88 A;  2F0H A;  1H9K A;  1SE2 A;  2BA0 A;  4I65 A;  1KNA A;  3S1N B;  1EU4 A;  2EJG C;  3VR5 A;  3RLF A;  3T4A C;  4IN3 A;  1KTK A;  2NN6 G;  4NKL A;  2OXP A;  3I4M B;  4L6T B;  4Z9C B;  1F2Z A;  3OMG A;  3ERQ A;  5G3L F;  3IFD A;  5I6W A;  2HUG A;  3AMU A;  1X3P A;  1WTP A;  4IFD I;  4TQU S;  4KK7 A;  5JVH 3;  1JIC A;  1U4M A;  4RHR A;  1J8I A;  1LTR D;  3C3L A;  2F0V A;  4C56 C;  5CV6 A;  5I9O A;  1GUW A;  1JWS D;  5M5Y B;  2K7V A;  3P20 A;  3MEH A;  3NWT A;  1EY6 A;  4TRD A;  3T16 A;  5KND A;  3K7A B;  2YYZ A;  1B2T A;  2A5H A;  1FNU A;  1W6K A;  2RSO A;  2OEO A;  4K8J A;  3TZD A;  3C2P A;  3E6Z X;  2H4O A;  1C8C A;  4CHT B;  2C9O A;  2A6H D;  3DUZ A;  2E2D C;  2IPK D;  2Z4H A;  4KV6 A;  4LJZ C;  5G3L D;  1F77 A;  2NZ1 D;  3PMF A;  2I46 A;  1T5X D;  2NVY B;  4K5W A;  2F0M A;  2SNM A;  4OL7 A;  1RJT A;  4OGQ C;  4DA2 A;  4XTC S;  2B2U C;  4S3S A;  3NBI A;  5I9P A;  1LTI D;  1LTA D;  3R3O A;  4K5V A;  5BN5 A;  4R8I A;  4LK1 C;  2PZT A;  4XYQ A;  2DY7 A;  1PTO D;  3M4Y A;  3ND9 A;  4IUN A;  1GOZ A;  4HMJ A;  3V96 A;  2Q8R E;  1TT2 A;  3GTJ B;  3OSO A;  4WRD A;  5D14 A;  2PW7 A;  4CJ1 B;  4KTA A;  1EEF D;  2H1E A;  1JWU D;  5M5X B;  4WFN 3;  4FF1 A;  3FPU B;  3KLR A;  1STY A;  2BDN A;  3VR2 A;  2R92 B;  1XWE A;  4RFB A;  5IGE A;  1WTW A;  1KLU D;  3A54 A;  1TS3 A;  1GUN A;  2EY2 A;  5KYI A;  3EA6 A;  1DJR D;  1QJO A;  2R3Z A;  5FLX E;  3K5O A;  5EJW A;  3DMU A;  4HSV A;  1FGB D;  2E74 C;  1ONL A;  4ULL A;  1L0X B;  2NTT A;  3DXJ C;  2XWJ B;  1BO0 A;  3IAY A;  4P2C B;  3OHX C;  1B9M A;  5LL6 X;  4XQQ A;  3SXH A;  4CGY B;  4A3G B;  3Q24 A;  3MFG A;  2KCN A;  1TS2 A;  3D4R A;  1TWF B;  4K8I A;  3QB3 A;  1WVL A;  3KBG A;  2KJX A;  4ILW A;  1LT6 D;  1XYI A;  4KY6 A;  2WV6 D;  2EYF A;  4FYD A;  4XQJ A;  3PUW A;  4IUP A;  3DEO A;  4XT1 B;  3NQT A;  1Q12 A;  4KN4 C;  4HN7 A;  1GUS A;  1BCP B;  2ICE C;  1STN A;  4C3I B;  3R2T A;  2F0N A;  3A55 A;  3BZD B;  2A6E D;  5CBA E;  4A3I B;  5CV7 A;  1D5X C;  1ILP A;  4OHJ A;  2IX0 A;  5LL6 S;  4G4K A;  3OWE B;  5F2D A;  2J7Z A;  2L1B A;  1STH A;  5C4Z A;  3K57 A;  3TP6 A;  3Q22 A;  4GZY C;  1RTN A;  1TKW B;  3BVM A;  1CA5 A;  2IT1 A;  4EQO A;  3QOJ A;  4PMW A;  5IOD A;  2QDB A;  4F7X A;  1LAC A;  3S16 B;  3T13 A;  2GA4 B;  4Y7N B;  2LKV A;  3FPP A;  2F0E A;  2K32 A;  2PYK A;  3I72 A;  2B2T C;  4C1N K;  1SMY C;  2F0L A;  5CBE E;  4QIW B;  1IYV A;  1GUT A;  4HSP A;  3TME A;  3SK4 A;  4B9X A;  3H94 A;  1BXT A;  4X3U A;  1EYD A;  1HA5 A;  2BOS A;  4TSS A;  1PLF A;  2SNS A;  1XX8 A;  1WTV A;  2Z4I A;  1S5C D;  1F2M A;  3BYY B;  4CBV A;  2R93 B;  1QB5 D;  5EPJ A;  1I4G A;  1Y8P B;  3OWF A;  3HOV B;  1Y8N B;  3OMC A;  4HAE A;  5CV4 A;  3GTL B;  2EY5 A;  1LV9 A;  3P1H A;  1B4O A;  3VYS A;  2EYH A;  3K59 A;  4RGM A;  1S4Z A;  1TWH B;  3BS1 A;  4QCL A;  1HCZ A;  4BWG B;  2B2V C;  3PIP 3;  3M7G A;  1UUP A;  4BA2 I;  4A3B B;  3NTH A;  1D6E C;  4KKU A;  1SE3 A;  1JQY D;  1TWC B;  3J81 E;  5DEH A;  1H9M A;  2CHB D;  1LTS D;  2JE6 I;  1HTL D;  2ENB A;  1G91 A;  3GTP B;  5E1F A;  3NWS A;  2K5Q A;  3GV3 A;  1TY0 A;  3D31 A;  3CQZ B;  3SK5 A;  1NUC A;  1SYE A;  2O5I C;  1B44 D;  1CI3 M;  3MAQ A;  2N88 A;  3PUX A;  4DAV A;  3JAM L;  3P7J A;  4F87 A;  1EWH A;  1SYF A;  4X3S A;  1K83 B;  1EY7 A;  3GTM B;  1AP0 A;  5CYU A;  2V4D A;  3GO5 A;  2KVM A;  3SK6 A;  2B2Y A;  3DWA A;  4ZQ3 A;  3VA7 A;  1AZP A;  4DGZ A;  4RWS C;  2ZT9 C;  1II3 A;  2F03 A;  2WB1 B;  4IUQ A;  1EYC A;  1JE4 A;  5DAU A;  3S2H B;  1B50 A;  1IW7 D;  1K8M A;  3T56 B;  3MXP A;  4CKC A;  4FP5 D;  1MSH A;  1CA6 A;  4DFA A;  4UDU C;  1HQR D;  1H9S A;  4H0L C;  1X3Q A;  2NVQ B;  1MD2 D;  1MBY A;  1EY8 A;  1ENA A;  3NPP A;  2RQX A;  2EY6 A;  4KN7 C;  5FKA C;  4QUF A;  1G6Z A;  5CC4 A;  5C3X A;  2G9H D;  1I6H B;  3HEJ A;  3TBI B;  1H9R A;  3V2T A;  4WJW A;  1JB3 A;  1Y8O B;  2AQ1 B;  4ZKB B;  2K03 A;  3P75 A;  2A68 C;  2EYO A;  5FOB B;  3MXN A;  1GUG A;  2CQA A;  2DNE A;  3NSW A;  4IUR A;  5JVG 3;  2L12 A;  1I4H A;  1QG7 A;  3H91 A;  1V1P B;  1MI2 A;  2F0P A;  3H0G B;  3SR1 A;  4CJ2 C;  5I6Y A;  1I4P A;  4LAA A;  2ZXP A;  4HR7 B;  3HS0 C;  4EVO A;  1KLG D;  5BN3 A;  1FNV A;  4ZK9 B;  1SXT A;  1EQT A;  1AW7 A;  2NWG A;  1QOH A;  4U67 3;  1LT3 D;  2TSS A;  4NDX A;  2E2J B;  1OXT A;  2EJM A;  4ZRZ A;  2BA1 A;  1G8Z D;  3J80 E;  4KHV A;  1FNW A;  1D5Z C;  3CKI B;  1STG A;  2J0T D;  2F0J A;  1R4P B;  1EYA A;  5C4X B;  1FR3 A;  3S14 B;  3D6C A;  4PQX A;  4DNT B;  1EFI D;  1SEB D;  1STB A;  3OIQ A;  3C1E A;  2K28 A;  1G2S A;  2B8G A;  3K58 A;  4C1N I;  2EYL A;  1T5E A;  2J4X A;  4XXE A;  1SAP A;  1MGS A;  1RKN A;  3PO2 B;  3MC0 B;  2KEC A;  2QCP X;  3RD4 A;  2AQ2 B;  1EEI D;  1CQF A;  2F0O A;  2NN6 I;  3BDC A;  3I4N B;  3GV6 A;  1GHJ A;  4HED A;  5JEA G;  3NP8 A;  2XRQ D;  5IGD A;  2AUK A;  1PRT D;  1GUO A;  3E5S A;  2HDM A;  3FDT A;  1LTT D;  1O78 A;  2A6H C;  5IGG A;  1O7Z A;  1SJE D;  5IT9 E;  5EBC A;  2NN6 H;  4PMC A;  2PZW A;  5JOB A;  3HOZ B;  2K5D A;  1E2W A;  4DK0 A;  1CT1 D;  1SNM A;  5T1G A;  2XIW A;  1WD1 A;  3U9S A;  3K5M A;  1QWY A;  2LY7 A;  5M3F B;  1TU2 B;  2F0G A;  2EYP A;  2X69 A;  4RGT A;  5C6A A;  2O5J C;  5FO7 B;  1SYC A;  3Q0A A;  5IGB A;  1HXY D;  3MXG A;  3AU7 A;  3MZ5 A;  5JEA H;  4KJN A;  1PTO C;  3KLS A;  4C3J B;  4KKS A;  1VF5 C;  5C44 B;  1W6J A;  1DXM A;  4MN3 A;  1LLR D;  1BR9 A;  4K14 A;  2EYM A;  5KNB A;  2K33 A;  4CKB A;  5A35 A;  4PV1 C;  5COR A;  1I4Q A;  3SHL A;  1B3A A;  4ID6 A;  1TY2 A;  3PUV A;  2L5T A;  4ZAI A;  1CHQ D;  2RBM A;  4X3K A;  1TWA B;  2L55 A;  2EXZ A;  2MUY A;  2F0D A;  1WTO A;  1D1I A;  5ELD A;  3BG3 A;  2JA7 B;  2ICI A;  3D4D A;  4FXK C;  3MWY W;  2D2C C;  2B39 A;  3TP7 A;  4QUC A;  5JEA J;  1F9S A;  3PUZ A;  1PTO B;  1EWC A;  4XIG S;  1Z7T A;  2Y0S B;  3S2D B;  1IHZ A;  3VYU A;  1LO5 D;  3T53 B;  4EQP A;  1WD0 A;  1OO9 B;  3FKI B;  5C5M A;  2I07 B;  1BCP C;  1EY9 A;  3N52 A;  4KY5 A;  1EIG A;  1S5F D;  1LT4 D;  2EOT A;  2WKD A;  1UAP A;  2CW0 D;  2D5D A;  1B53 A;  1EZ6 A;  1U4P A;  1X32 A;  2F0U A;  1UEA B;  2K05 A;  1BDO A;  2L9H A;  1B9N A;  3MXU A;  1TWG B;  4PMB A;  3RUZ A;  1M8A A;  4QF4 A;  2A73 B;  4C3J G;  5NUC A;  5CR3 A;  3MFY A;  1JOQ A;  2EJF C;  1A3V A;  1SSO A;  2QIL A;  1NR4 A;  1ZEQ X;  4KKT A;  1SNC A;  3OW7 A;  2A6E C;  5KNC A;  5IGF A;  1A15 A;  4RCO A;  1I6V C;  4RGO S;  3J7A F;  4H13 C;  2CVR A;  4K2K A;  2B63 B;  1JOO A;  5KGU A;  1Z6H A;  4IUU A;  2TMP A;  3D6W A;  1CQV A;  3GP7 A;  4DF7 A;  3TSS A;  2F0T A;  2NBF A;  4OIK A;  1Q8I A;  3VR4 A;  4FF3 A;  2F0Q A;  3BVZ A;  2IX3 A;  2QKI C;  4IUV A;  1STA A;  3PO3 B;  2EPB A;  2E2I B;  4IAL A;  3MTS A;  1L0Y B;  1XXG A;  3LWE A;  2VB2 X;  2JXM B;  3G6J B;  2G9D A;  3Q23 A;  1F9Q A;  1SE4 A;  2VNU D;  3MVV A;  4ME5 A;  2PZU A;  2IL8 A;  4HCS A;  5IGC A;  1BF4 A;  1DD2 A;  1CK1 A;  3NBH A;  3CRL C;  3QJY A;  1O7Y A;  2KUM A;  3OIP A;  4EGV A;  1PMR A;  3L9A X;  4PNY A;  5CV5 A;  1AZQ A;  1I3Q B;  2YU9 B;  1BOS A;  2K1B A;  1ZYR D;  2KQ3 A;  1QNK A;  5C0X J;  3F2U A;  3EQL C;  3M7N A;  3I70 A;  2Z8L A;  4N9T A;  3HKZ B;  1PTO H;  2JA8 B;  5FK9 C;  1F9P A;  5A2Q L;  1SNQ A;  4NW2 A;  3IL8 A;  3KUP A;  4A3D B;  2AQ3 B;  5DNF A;  1GXD C;  1WTX A;  4ZYS A;  5M9O A;  2PPB C;  2AUJ D;  1F2Y A;  1RDP D;  1LAB A;  4RHS A;  1TR5 A;  3KLS X;  3O13 A;  3RMH A;  2PCF B;  3LNN A;  2X6G A;  1HFN A;  2E76 C;  2IW3 A;  5DM7 3;  1SFO B;  2XSC A;  5CGK A;  1CZG A;  2BE5 D;  4ODG A;  2NVT B;  3C1F A;  1S5D D;  1PZI D;  4K2L A;  4QMG A;  2AWN A;  5J22 A;  2KED A;  3HP3 A;  3X3N A;  4K6D A;  4DK1 A;  1J9O A;  2WP8 J;  1RTO A;  4RCN A;  1M4V A;  2B8F A;  1DYQ A;  4C3H B;  1TS4 A;  2JA5 B;  1SYD A;  1TVX A;  1K8O A;  4BS9 A;  1Q90 A;  1SDF A;  2DY8 A;  1NSN S;  2BDO A;  4KY7 A;  1IW7 C;  1BUV T;  1KDB A;  2NTS A;  3J7Y W;  3X3M A;  1ILQ A;  1F2L A;  1SYB A;  4CJ0 B;  5JJZ A;  1NCV A;  1PFM A;  3NUC A;  4IZ8 A;  3CRK C;  4UAI A;  3GTO B;  4A3M B;  3CHB D;  1PZJ D;  1EIH A;  2RDF A;  1IL8 A;  4CKE A;  2F0W A;  5EPL A;  4JK1 C;  3DHQ A;  5KRU A;  1EZ8 A;  4B9W A;  2R7Z B;  3A8K E;  5I4D A;  1GJX A;  3ERO A;  1VMC A;  3W3A A;  3A56 A;  4FXG C;  4ABN A;  3UI2 A;  4RAU C;  1LTG D;  3LWU A;  2M00 A;  3I73 A;  2IWH A;  3IKJ A;  3Q6S A;  4FXD A;  3BYT B;  3GQB A;  5KIX A;  4JBW A;  4X3T A;  4OO1 G;  1DOK A;  4E6I A;  1ROD A;  1BNZ A;  4C2M B;  4C3H G;  1EY4 A;  2OT2 A;  2N55 A;  4RKB A;  4DU9 A;  4O42 A;  1CZW A;  2ZXO A;  3JAM E;  4J6H A;  3DWP A;  1BQQ T;  3NE5 B;  3BDL A;  1QE6 A;  1YNJ D;  2KA7 A;  3VA5 A;  3ND8 A;  1DM0 B;  4A93 B;  3I90 A;  1E0B A;  5I2X A;  5EQ0 A;  1LTB D;  3TN2 A;  2A68 D;  3C46 A;  2F0K A;  2ID0 A;  2K6A A;  5EKL A;  1FYC A;  4YIJ A;  1YNN D;  3KK7 A;  2NVX B;  2BCO A;  1G29 1;  2A74 C;  4XT3 B;  4Q0F A;  3HOY B;  3VYT A;  4BY1 B;  2A69 D;  1Q1B A;  2RSN A;  2SOB A;  5T1I A;  2QF7 A;  1ESR A;  2AWO A;  2B2T A;  2HQE A;  1QIL A;  5E3F A;  5ELF A;  4XYO A;  1A2U A;  1U9R A;  4IFD G;  5FO8 B;  1PRT C;  3NTK A;  2NYZ D;  3I91 A;  1RCV D;  2D62 A;  1VCI A;  2FIN B;  4HTH A;  1UNS A;  2KCC A;  2JEB I;  3RZD B;  3VR6 A;  4TKO B;  2XRS D;  4DNR B;  2JYO A;  1NR2 A;  4ZKC B;  2LS0 1;  3GTG B;  1JCK B;  5K5P A;  2EY1 A;  1I4R A;  1HTP A;  3HGB A;  1ET6 A;  3E0J A;  5HUR A;  4L8J A;  5KEE A;  5HGT A;  2WKC A;  4IUT A;  2L11 A;  4RKL A;  3VYR A;  1HA6 A;  4IFD H;  3EJI A;  4J8Q A;  2B2V A;  2JP1 A;  2XWB B;  5D3I B;  4A3E B;  4BA1 I;  1PTO F;  5FO9 B;  5ISR A;  1PRT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...