5IT9Q

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
141
structure length
141
Chain Sequence
TVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVQPEILRFKVYEPLLLVGLDKFANIDIRVKVTGGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKFGGRGARSRFQKSYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
total genus 35
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5it9Q00
1HR0I 1MU5A 4OX9I 3H4LA 4PRXA 4KHPE 2E5LE 4AQYE 4DUZE 4R1FA 4DV6I 1Z5CA 4LF6E 4FWDA 1I94E 4YHHI 1IBLI 1HR0E 2VQFI 4OX9E 1Z0CA 4DPUA 3T1HE 1BKNA 1MG7A 4FN5A 4LF8I 5FLXQ 3QT5A 4JG4A 4K0KI 3HULA 4DV0I 4P7AA 1N33E 4DV4E 2HKEA 4YHHE 1IBLE 1ELOA 2HHHI 3T1YI 3V5RA 4DR3I 4DV0E 2HFUA 1RREA 3PYEA 5L3JA 4X62I 1ZM4A 4DR2I 1PKPA 1S4EA 1FI4A 3WU4A 1XNQI 3T1YE 4JI6I 4HY1A 2UUBE 1XMOI 3ZKBA 1XHKA 4YY3E 1ZM3A 4XTJA 4NXMI 2A2CA 3J81C 4USKA 4DXLA 4JI7I 4DV3E 2NPFA 1XNQE 1ZM2A 4KQVA 4JI5I 5IWAI 4MYTA 1HNZE 1OJ4A 4JI2E 3J80C 1Z0TA 4JI7E 3B82A 2UXDI 4DR7I 4DV2E 4DV5I 4LF9E 3ZZ0A 2ZBKB 3LNUA 4PU9A 2UXDE 4GKJE 4FW9A 1FKAE 1WUUA 4DR7E 4X64I 4JI0I 4Z7YA 1QZRA 2CZ9A 2F4VI 3J80Q 4DR4I 5A2QQ 4B3TI 5IT9C 4X64E 3JAMQ 3OTOE 4JI0E 1Z0WA 2BM0A 2HFSA 4LFAE 1EI1A 4GKKE 2E5LI 1UEKA 2OI2A 4DUZI 1XNRI 4DR4E 4B3TE 1B63A 4LFCI 3K17A 2DEJA 3T1HI 4MYUA 2ZITA 1XNRE 2X36A 1Z0BA 1N33I 4DV4I 2V2VA 4X65E 5IT9Q 4USMA 4JI1E 4LFCE 2UUCE 1VISA 2HKJA 3Q1QA 1B62A 4M1KA 4WUDA 3M6AA 2R42A 4LFBI 3GONA 4DV1I 3ZKDA 1FJGI 2A2DA 2UUBI 3CWVA 1H7SA 3ZM7A 1ZXNA 1N0VC 1NHIA 4YY3I 4DR5I 2AJ4A 4LFBE 4HXZA 4FWHA 4LF4I 4DPWA 4DV3I 4DV1E 4DV7E 4ED4A 1FJGE 2GS8A 4LF7I 4LF5E 4HYMA 4DR5E 1HNZI 4WUBA 4JI2I 4B3RI 4LF4E 3ZZUA 4WUCA 1N36I 1Z0VA 4DV2I 3WU3A 1H72C 2UUAI 4DUYE 4LF7E 4LF9I 4B3RE 1N36E 4JV5E 4GKJI 4P52A 2UUAE 4DU7A 4JI3I 3J81Q 1IBMI 4UT4A 4B3MI 1N32I 1HNXI 4DPXA 4DPYA 2BM1A 1FWKA 4B3SI 2V8PA 3B78A 2UU9E 2E1RA 3OTOI 4LFAI 4GKKI 4JYAI 5LMUE 4JI3E 1IBME 1D6TA 4B3ME 1N32E 1HNXE 3WU6A 4X66E 4B3SE 4HACA 4UTGA 4JYAE 1ZXMA 1KTVA 3ZZTA 5GMDA 4DR6I 1MX0A 1IBKI 4X65I 4JI1I 1J5EE 2UUCI 1ZM9A 3QT8A 2EFGA 1H7UA 1XMQI 4DR6E 3LPSA 1IBKE 1KVKA 5GMEA 1H74A 4JI4E 4HACB 4FWGA 1XMQE 2UXBI 4I3HA 3V2UC 1H73A 4ZVIA 1N34E 1Z5AA 4JI8E 2HK2A 3J7AG 4EMDA 4DV7I 1Z5BA 1KIJA 2UXBE 4LF5I 4DV6E 1DARA 1FWLA 3WU5A 2J7KA 3B8HA 4PRVA 2VQFE 2XEXA 4DUYI 2ZM6I 3J7AM 4LF8E 4K0KE 3K1JA 1FNMA 1RR9A 4JV5I 3PYGA 4Z7CA 1PVGA 2HHHE 2ZM6E 1NHHA 1KKHA 5LMNI 2X7IA 4DR3E 4X62E 4DR2E 2R3VA 2UU9I 1PIEA 1S16A 3QT6A 4DU8A 2VF3A 4JI6E 5BR8I 5LMUI 1A6FA 1XMOE 5LMNE 4NXNI 1Z59A 1HNWI 1Z0EA 4DR1I 4X66I 4NXME 2LJPA 2UXCI 2WW4A 3D4JA 5A2QC 2DEIA 3F0NA 5BR8E 3JAMC 4NXNE 1HNWE 4JI5E 5IWAE 4DR1E 2V2ZA 4RPFA 1U2RA 2V34A 1J5EI 2UXCE 2V2QA 3PYFA 2HK3A 4DV5E 2VQEI 5LL6R 4JI4I 3QT7A 4URLA 4KHPI 4DPTA 1NZ0A 1N0UA 1K47A 4AQYI 2F4VE 5FLXC 3PYDA 1Z0GA 1N34I 2BV3A 4JI8I 2Q2EB 1NHJA 3LTOA 2VQEE 1EA6A 4LF6I 1I94I
chains in the Genus database with same CATH superfamily
2C38B 4MU3A 1HR0I 1MU5A 4OX9I 3H4LA 3HJCA 4PRXA 4KHPE 4U3BA 1UDNA 2E5LE 4AQYE 2WNRB 4DUZE 4OZEA 4LCHA 1VI7A 4R1FA 4NBQA 4DV6I 3M7ND 1Z5CA 2JT2A 4OO1B 4LF6E 4FWDA 1I94E 1P42A 4YHHI 1IBLI 1HR0E 2VQFI 4OX9E 1Z0CA 4DPUA 3T1HE 1BKNA 1MG7A 4FN5A 4LF8I 3U1YA 5FLXQ 3QT5A 4JG4A 4K0KI 3HULA 5EKWA 4DV0I 4P7AA 1N33E 4DV4E 4OO1D 5C0XB 2JE6A 2HKEA 4YHHE 1IBLE 1ELOA 3GMEA 4IZKA 2HHHI 3T1YI 2F1DA 3P3GA 4FW3A 3V5RA 4DV0E 2HFUA 3PYEA 1RREA 4DR3I 5L3JA 2C37A 4X62I 5C0XD 2Z5CA 1ZM4A 4DR2I 4LOMA 1PKPA 1S4EA 1FI4A 3WU4A 1XNQI 3T1YE 4JI6I 3GCMA 4HY1A 2UUBE 1XMOI 5K36A 1OYPA 3ZKBA 4FW4A 1XHKA 4YY3E 1ZM3A 2JE6B 4XTJA 4NXMI 2A2CA 4IZJA 3J81C 4USKA 4DXLA 4JI7I 1HK7A 4DV3E 2NPFA 1XNQE 4IZKB 5DRPA 1USUA 2C39A 1ZM2A 2CVEA 5JEAB 3PS2A 4KQVA 4JI5I 5IWAI 2Z5CB 4MYTA 1HNZE 1OJ4A 3PS3A 4JI2E 3J80C 2BA0D 1Z0TA 4JI7E 3B82A 2UXDI 4AIDA 5JEAD 4BA2A 4DR7I 4DV2E 4FW6A 4DV5I 4LF9E 2O1WA 1UDSA 3ZZ0A 4IZJB 2ZBKB 3LNUA 3Q6MA 4PU9A 2UXDE 4GKJE 1E3HA 4FW9A 1FKAE 1WUUA 2C39B 4X64I 4DR7E 4JI0I 3HKMA 4Z7YA 1QZRA 4MQYA 2CZ9A 1Y60A 3J80Q 2F4VI 4IZJD 4DR4I 5A2QQ 5K36C 3B4TA 4B3TI 2BR2A 5IT9C 4BA2B 4X64E 3JAMQ 3OTOE 4JI0E 1Z0WA 2BM0A 2HFSA 4LFAE 1EI1A 4GKKE 2E5LI 1UEKA 2JEAA 2OI2A 4DUZI 1XNRI 4DR4E 2IOQA 4B3TE 2PO2A 1B63A 4LFCI 5DROA 2VESA 3K17A 2DEJA 3T1HI 4IFDE 4MYUA 1R6LA 2ZITA 4QNJA 2X36A 1XNRE 1Z0BA 1N33I 4DV4I 4IFDF 2BA1D 2BR2B 2V2VA 4X65E 5IT9Q 4USMA 4JI1E 4IS9A 4LFCE 4LCGA 2PNZA 2UUCE 1VISA 2HKJA 2JEAB 3Q1QA 1B62A 4LPFA 4M1KA 4WUDA 3M6AA 3DD6A 2R42A 2PO2B 4LFBI 4J3DA 3GONA 3H1CA 4DV1I 3ZKDA 4FW7A 1FJGI 2A2DA 2UUBI 2Z5EA 3CWVA 1H7SA 3ZM7A 5DNXA 1ZXNA 1N0VC 1NHIA 4YY3I 4DR5I 2AJ4A 4LFBE 4GQUA 2PNLA 4HXZA 4FWHA 3U1KA 4LF4I 4DPWA 2PNZB 4DV3I 3NZKA 4DV1E 4N3OA 4DV7E 4ED4A 1FJGE 4BA1A 2GS8A 4LF7I 4LF5E 4HYMA 4DR5E 1HNZI 4WUBA 4JI2I 4B3RI 1Y5YA 4LF4E 3ZZUA 4WUCA 4OO1F 1N36I 1Z0VA 3Q6NA 4DV2I 2AE8A 3WU3A 1H72C 2UUAI 4DUYE 4LF7E 3M85G 2C37B 4LF9I 4AM3A 4B3RE 1N36E 4JV5E 3L7ZA 4GKJI 4IFDA 1OYSA 5K36B 4P52A 2UUAE 4DU7A 4BA1B 5DRQA 3K85A 4JI3I 3J81Q 1IBMI 4ISAA 4UT4A 4B3MI 2O1VA 1USVA 1N32I 1E3PA 1HNXI 4DPXA 4DPYA 2BM1A 1FWKA 4B3SI 2V8PA 2O1UA 3B78A 2UU9E 2E1RA 5K36D 3OTOI 4LFAI 2NN6E 4GKKI 4JYAI 5LMUE 4JI3E 1IBME 2O3ZA 1D6TA 1RHYA 2Z5BA 4B3ME 1N32E 2NN6F 2J65A 1HNXE 3P76A 3WU6A 4X66E 3L7ZB 4B3SE 4IFDB 2IOPA 4HACA 4UTGA 5JEAF 1ZXMA 4JYAE 3PRYA 1KTVA 3ZZTA 5GMDA 4DR6I 1MX0A 4IFDD 1IBKI 4X65I 5EL9A 4JI1I 1J5EE 2PO1A 1UDQA 2UUCI 4OO1A 1ZM9A 4MDTA 5FWKA 3P06A 3QT8A 4IFDC 2EFGA 1H7UA 1XMQI 2Z5BB 4DR6E 1YH8A 4QNKA 3CDIA 3LPSA 2IESA 1IBKE 4AIMA 3CDJA 4MU4A 1KVKA 5GMEA 1H74A 2WP8A 4JI4E 4HACB 3M85D 2BA0G 4FWGA 5DRRA 1Y4UA 1XMQE 2UXBI 4I3HA 4FW5A 3V2UC 1H73A 4ZVIA 1N34E 1Z5AA 2PO1B 4JI8E 2HK2A 2JEBA 3J7AG 2IERA 4EMDA 1Y6ZA 4DV7I 1Z5BA 1KIJA 2UXBE 4LF5I 5DNLA 4DV6E 2NN6A 1DARA 1FWLA 3WU5A 2WP8B 2CG9A 2GO4A 2J7KA 3B8HA 4PRVA 2VQFE 2XEXA 4DUYI 1Y4SA 4OO1E 2ZM6I 3J7AM 5ELWA 4OO1C 5JEAA 4LF8E 4K0KE 3K1JA 2PO0A 3PS1A 1FNMA 1RR9A 4JV5I 3P3CA 2JEBB 1XXEA 3UHMA 2O1TA 3PYGA 4Z7CA 1PVGA 5C0XE 2HHHE 2ZM6E 5C0XC 1NHHA 1KKHA 5LMNI 2X7IA 4DR3E 5C0XF 4X62E 2NN6B 4DR2E 2R3VA 2UU9I 3M7NG 1PIEA 1S16A 3QT6A 2BA1G 1R6MA 4DU8A 2VF3A 4JI6E 5BR8I 5LMUI 1A6FA 1XMOE 5LMNE 4NXNI 2CGEA 1Z59A 1HNWI 1Z0EA 2GO3A 2PO0B 2NN6D 4DR1I 4X66I 4NXME 2LJPA 2UXCI 2WW4A 3D4JA 4U3DA 5A2QC 2NN6C 2DEIA 3F0NA 5BR8E 2GQ0A 3JAMC 4NXNE 1HNWE 4JI5E 5IWAE 4DR1E 2V2ZA 4RPFA 5JEAE 1U2RA 2PNMA 2V34A 5JEAC 1J5EI 1YHCA 2UXCE 2C38A 2V2QA 3PYFA 3GLLA 2HK3A 4OKGA 2WNRA 4DV5E 5K36E 1UDOA 3P3EA 2VQEI 4MU1A 5LL6R 4JI4I 5K36F 3QT7A 4URLA 4KHPI 4DPTA 1NZ0A 1N0UA 1K47A 4AQYI 2F4VE 5FLXC 3PYDA 1Z0GA 1N34I 2BV3A 4JI8I 5C0XA 2Q2EB 4LCFA 1NHJA 3KRNA 3LTOA 2VQEE 1OYRA 4MU0A 1EA6A 4LF6I 1I94I
chains in the Genus database with same CATH topology
1HR0I 1MU5A 4OX9I 3H4LA 3HJCA 4PRXA 4KHPE 2E5LE 4AQYE 4DUZE 4R1FA 4DV6I 1Z5CA 4LF6E 4FWDA 1I94E 4YHHI 1IBLI 1HR0E 2VQFI 4OX9E 1Z0CA 4DPUA 3T1HE 1BKNA 1MG7A 4FN5A 4LF8I 5FLXQ 3QT5A 4JG4A 4K0KI 3HULA 4DV0I 4P7AA 1N33E 4DV4E 2HKEA 4YHHE 1IBLE 1ELOA 4IZKA 2HHHI 3T1YI 3V5RA 4DR3I 4DV0E 2HFUA 1RREA 3PYEA 5L3JA 4X62I 2Z5CA 1ZM4A 4DR2I 1PKPA 1S4EA 1FI4A 3WU4A 1XNQI 3T1YE 4JI6I 4HY1A 2UUBE 1XMOI 3ZKBA 1XHKA 4YY3E 1ZM3A 4XTJA 4NXMI 2A2CA 4IZJA 3J81C 4USKA 4DXLA 4JI7I 1HK7A 4DV3E 2NPFA 1XNQE 4IZKB 1USUA 1ZM2A 4KQVA 4JI5I 5IWAI 2Z5CB 4MYTA 1HNZE 1OJ4A 4JI2E 3J80C 1Z0TA 4JI7E 3B82A 2UXDI 4DR7I 4DV2E 4DV5I 4LF9E 2O1WA 3ZZ0A 4IZJB 2ZBKB 3LNUA 3Q6MA 4PU9A 2UXDE 4GKJE 4FW9A 1FKAE 1WUUA 4DR7E 4X64I 4JI0I 4Z7YA 1QZRA 2CZ9A 2F4VI 3J80Q 4IZJD 4DR4I 5A2QQ 4B3TI 5IT9C 4X64E 3JAMQ 3OTOE 4JI0E 1Z0WA 2BM0A 2HFSA 4LFAE 1EI1A 4GKKE 2E5LI 1UEKA 2OI2A 4DUZI 1XNRI 4DR4E 2IOQA 4B3TE 1B63A 4LFCI 3K17A 2DEJA 3T1HI 4MYUA 2ZITA 1XNRE 2X36A 1Z0BA 1N33I 4DV4I 2V2VA 4X65E 5IT9Q 4USMA 4JI1E 4LFCE 2UUCE 1VISA 2HKJA 3Q1QA 1B62A 4M1KA 4WUDA 3M6AA 2R42A 4LFBI 3GONA 4DV1I 3ZKDA 1FJGI 2A2DA 2UUBI 2Z5EA 3CWVA 1H7SA 3ZM7A 1ZXNA 1N0VC 1NHIA 4YY3I 4DR5I 2AJ4A 4LFBE 2PNLA 4HXZA 4FWHA 4LF4I 4DPWA 4DV3I 4DV1E 4N3OA 4DV7E 4ED4A 1FJGE 2GS8A 4LF7I 4LF5E 4HYMA 4DR5E 1HNZI 4WUBA 4JI2I 4B3RI 4LF4E 3ZZUA 4WUCA 1N36I 1Z0VA 3Q6NA 4DV2I 3WU3A 1H72C 2UUAI 4DUYE 4LF7E 4LF9I 4B3RE 1N36E 4JV5E 4GKJI 4P52A 2UUAE 4DU7A 3K85A 4JI3I 3J81Q 1IBMI 4UT4A 4B3MI 2O1VA 1USVA 1N32I 1HNXI 4DPXA 4DPYA 2BM1A 1FWKA 4B3SI 2V8PA 2O1UA 3B78A 2UU9E 2E1RA 3OTOI 4LFAI 4GKKI 4JYAI 5LMUE 4JI3E 1IBME 1D6TA 2Z5BA 4B3ME 1N32E 1HNXE 3WU6A 4X66E 4B3SE 2IOPA 4HACA 4UTGA 4JYAE 1ZXMA 3PRYA 1KTVA 3ZZTA 5GMDA 4DR6I 1MX0A 1IBKI 4X65I 4JI1I 1J5EE 2UUCI 1ZM9A 5FWKA 3P06A 3QT8A 2EFGA 1H7UA 1XMQI 2Z5BB 4DR6E 3LPSA 1IBKE 1KVKA 5GMEA 1H74A 4JI4E 4HACB 4FWGA 1Y4UA 1XMQE 2UXBI 4I3HA 3V2UC 1H73A 4ZVIA 1N34E 1Z5AA 4JI8E 2HK2A 3J7AG 4EMDA 1Y6ZA 4DV7I 1Z5BA 1KIJA 2UXBE 4LF5I 4DV6E 1DARA 1FWLA 3WU5A 2CG9A 2J7KA 3B8HA 4PRVA 2VQFE 2XEXA 4DUYI 1Y4SA 2ZM6I 3J7AM 4LF8E 4K0KE 3K1JA 1FNMA 1RR9A 4JV5I 2O1TA 3PYGA 4Z7CA 1PVGA 2HHHE 2ZM6E 1NHHA 1KKHA 5LMNI 2X7IA 4DR3E 4X62E 4DR2E 2R3VA 2UU9I 1PIEA 1S16A 3QT6A 4DU8A 2VF3A 4JI6E 5BR8I 5LMUI 1A6FA 1XMOE 5LMNE 4NXNI 2CGEA 1Z59A 1HNWI 1Z0EA 4DR1I 4X66I 4NXME 2LJPA 2UXCI 2WW4A 3D4JA 5A2QC 2DEIA 3F0NA 5BR8E 2GQ0A 3JAMC 4NXNE 1HNWE 4JI5E 5IWAE 4DR1E 2V2ZA 4RPFA 1U2RA 2PNMA 2V34A 1J5EI 2UXCE 2V2QA 3PYFA 2HK3A 4DV5E 2VQEI 5LL6R 4JI4I 3QT7A 4URLA 4KHPI 4DPTA 1NZ0A 1N0UA 1K47A 4AQYI 2F4VE 5FLXC 3PYDA 1Z0GA 1N34I 2BV3A 4JI8I 2Q2EB 1NHJA 3LTOA 2VQEE 1EA6A 4LF6I 1I94I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HR0 I;  1MU5 A;  4OX9 I;  3H4L A;  4PRX A;  4KHP E;  2E5L E;  4AQY E;  4DUZ E;  4R1F A;  4DV6 I;  1Z5C A;  4LF6 E;  4FWD A;  1I94 E;  4YHH I;  1IBL I;  1HR0 E;  2VQF I;  4OX9 E;  1Z0C A;  4DPU A;  3T1H E;  1BKN A;  1MG7 A;  4FN5 A;  4LF8 I;  5FLX Q;  3QT5 A;  4JG4 A;  4K0K I;  3HUL A;  4DV0 I;  4P7A A;  1N33 E;  4DV4 E;  2HKE A;  4YHH E;  1IBL E;  1ELO A;  2HHH I;  3T1Y I;  3V5R A;  4DR3 I;  4DV0 E;  2HFU A;  1RRE A;  3PYE A;  5L3J A;  4X62 I;  1ZM4 A;  4DR2 I;  1PKP A;  1S4E A;  1FI4 A;  3WU4 A;  1XNQ I;  3T1Y E;  4JI6 I;  4HY1 A;  2UUB E;  1XMO I;  3ZKB A;  1XHK A;  4YY3 E;  1ZM3 A;  4XTJ A;  4NXM I;  2A2C A;  3J81 C;  4USK A;  4DXL A;  4JI7 I;  4DV3 E;  2NPF A;  1XNQ E;  1ZM2 A;  4KQV A;  4JI5 I;  5IWA I;  4MYT A;  1HNZ E;  1OJ4 A;  4JI2 E;  3J80 C;  1Z0T A;  4JI7 E;  3B82 A;  2UXD I;  4DR7 I;  4DV2 E;  4DV5 I;  4LF9 E;  3ZZ0 A;  2ZBK B;  3LNU A;  4PU9 A;  2UXD E;  4GKJ E;  4FW9 A;  1FKA E;  1WUU A;  4DR7 E;  4X64 I;  4JI0 I;  4Z7Y A;  1QZR A;  2CZ9 A;  2F4V I;  3J80 Q;  4DR4 I;  5A2Q Q;  4B3T I;  5IT9 C;  4X64 E;  3JAM Q;  3OTO E;  4JI0 E;  1Z0W A;  2BM0 A;  2HFS A;  4LFA E;  1EI1 A;  4GKK E;  2E5L I;  1UEK A;  2OI2 A;  4DUZ I;  1XNR I;  4DR4 E;  4B3T E;  1B63 A;  4LFC I;  3K17 A;  2DEJ A;  3T1H I;  4MYU A;  2ZIT A;  1XNR E;  2X36 A;  1Z0B A;  1N33 I;  4DV4 I;  2V2V A;  4X65 E;  5IT9 Q;  4USM A;  4JI1 E;  4LFC E;  2UUC E;  1VIS A;  2HKJ A;  3Q1Q A;  1B62 A;  4M1K A;  4WUD A;  3M6A A;  2R42 A;  4LFB I;  3GON A;  4DV1 I;  3ZKD A;  1FJG I;  2A2D A;  2UUB I;  3CWV A;  1H7S A;  3ZM7 A;  1ZXN A;  1N0V C;  1NHI A;  4YY3 I;  4DR5 I;  2AJ4 A;  4LFB E;  4HXZ A;  4FWH A;  4LF4 I;  4DPW A;  4DV3 I;  4DV1 E;  4DV7 E;  4ED4 A;  1FJG E;  2GS8 A;  4LF7 I;  4LF5 E;  4HYM A;  4DR5 E;  1HNZ I;  4WUB A;  4JI2 I;  4B3R I;  4LF4 E;  3ZZU A;  4WUC A;  1N36 I;  1Z0V A;  4DV2 I;  3WU3 A;  1H72 C;  2UUA I;  4DUY E;  4LF7 E;  4LF9 I;  4B3R E;  1N36 E;  4JV5 E;  4GKJ I;  4P52 A;  2UUA E;  4DU7 A;  4JI3 I;  3J81 Q;  1IBM I;  4UT4 A;  4B3M I;  1N32 I;  1HNX I;  4DPX A;  4DPY A;  2BM1 A;  1FWK A;  4B3S I;  2V8P A;  3B78 A;  2UU9 E;  2E1R A;  3OTO I;  4LFA I;  4GKK I;  4JYA I;  5LMU E;  4JI3 E;  1IBM E;  1D6T A;  4B3M E;  1N32 E;  1HNX E;  3WU6 A;  4X66 E;  4B3S E;  4HAC A;  4UTG A;  4JYA E;  1ZXM A;  1KTV A;  3ZZT A;  5GMD A;  4DR6 I;  1MX0 A;  1IBK I;  4X65 I;  4JI1 I;  1J5E E;  2UUC I;  1ZM9 A;  3QT8 A;  2EFG A;  1H7U A;  1XMQ I;  4DR6 E;  3LPS A;  1IBK E;  1KVK A;  5GME A;  1H74 A;  4JI4 E;  4HAC B;  4FWG A;  1XMQ E;  2UXB I;  4I3H A;  3V2U C;  1H73 A;  4ZVI A;  1N34 E;  1Z5A A;  4JI8 E;  2HK2 A;  3J7A G;  4EMD A;  4DV7 I;  1Z5B A;  1KIJ A;  2UXB E;  4LF5 I;  4DV6 E;  1DAR A;  1FWL A;  3WU5 A;  2J7K A;  3B8H A;  4PRV A;  2VQF E;  2XEX A;  4DUY I;  2ZM6 I;  3J7A M;  4LF8 E;  4K0K E;  3K1J A;  1FNM A;  1RR9 A;  4JV5 I;  3PYG A;  4Z7C A;  1PVG A;  2HHH E;  2ZM6 E;  1NHH A;  1KKH A;  5LMN I;  2X7I A;  4DR3 E;  4X62 E;  4DR2 E;  2R3V A;  2UU9 I;  1PIE A;  1S16 A;  3QT6 A;  4DU8 A;  2VF3 A;  4JI6 E;  5BR8 I;  5LMU I;  1A6F A;  1XMO E;  5LMN E;  4NXN I;  1Z59 A;  1HNW I;  1Z0E A;  4DR1 I;  4X66 I;  4NXM E;  2LJP A;  2UXC I;  2WW4 A;  3D4J A;  5A2Q C;  2DEI A;  3F0N A;  5BR8 E;  3JAM C;  4NXN E;  1HNW E;  4JI5 E;  5IWA E;  4DR1 E;  2V2Z A;  4RPF A;  1U2R A;  2V34 A;  1J5E I;  2UXC E;  2V2Q A;  3PYF A;  2HK3 A;  4DV5 E;  2VQE I;  5LL6 R;  4JI4 I;  3QT7 A;  4URL A;  4KHP I;  4DPT A;  1NZ0 A;  1N0U A;  1K47 A;  4AQY I;  2F4V E;  5FLX C;  3PYD A;  1Z0G A;  1N34 I;  2BV3 A;  4JI8 I;  2Q2E B;  1NHJ A;  3LTO A;  2VQE E;  1EA6 A;  4LF6 I;  1I94 I; 
#chains in the Genus database with same CATH topology
 2C38 B;  4MU3 A;  1HR0 I;  1MU5 A;  4OX9 I;  3H4L A;  3HJC A;  4PRX A;  4KHP E;  4U3B A;  1UDN A;  2E5L E;  4AQY E;  2WNR B;  4DUZ E;  4OZE A;  4LCH A;  1VI7 A;  4R1F A;  4NBQ A;  4DV6 I;  3M7N D;  1Z5C A;  2JT2 A;  4OO1 B;  4LF6 E;  4FWD A;  1I94 E;  1P42 A;  4YHH I;  1IBL I;  1HR0 E;  2VQF I;  4OX9 E;  1Z0C A;  4DPU A;  3T1H E;  1BKN A;  1MG7 A;  4FN5 A;  4LF8 I;  3U1Y A;  5FLX Q;  3QT5 A;  4JG4 A;  4K0K I;  3HUL A;  5EKW A;  4DV0 I;  4P7A A;  1N33 E;  4DV4 E;  4OO1 D;  5C0X B;  2JE6 A;  2HKE A;  4YHH E;  1IBL E;  1ELO A;  3GME A;  4IZK A;  2HHH I;  3T1Y I;  2F1D A;  3P3G A;  4FW3 A;  3V5R A;  4DV0 E;  2HFU A;  3PYE A;  1RRE A;  4DR3 I;  5L3J A;  2C37 A;  4X62 I;  5C0X D;  2Z5C A;  1ZM4 A;  4DR2 I;  4LOM A;  1PKP A;  1S4E A;  1FI4 A;  3WU4 A;  1XNQ I;  3T1Y E;  4JI6 I;  3GCM A;  4HY1 A;  2UUB E;  1XMO I;  5K36 A;  1OYP A;  3ZKB A;  4FW4 A;  1XHK A;  4YY3 E;  1ZM3 A;  2JE6 B;  4XTJ A;  4NXM I;  2A2C A;  4IZJ A;  3J81 C;  4USK A;  4DXL A;  4JI7 I;  1HK7 A;  4DV3 E;  2NPF A;  1XNQ E;  4IZK B;  5DRP A;  1USU A;  2C39 A;  1ZM2 A;  2CVE A;  5JEA B;  3PS2 A;  4KQV A;  4JI5 I;  5IWA I;  2Z5C B;  4MYT A;  1HNZ E;  1OJ4 A;  3PS3 A;  4JI2 E;  3J80 C;  2BA0 D;  1Z0T A;  4JI7 E;  3B82 A;  2UXD I;  4AID A;  5JEA D;  4BA2 A;  4DR7 I;  4DV2 E;  4FW6 A;  4DV5 I;  4LF9 E;  2O1W A;  1UDS A;  3ZZ0 A;  4IZJ B;  2ZBK B;  3LNU A;  3Q6M A;  4PU9 A;  2UXD E;  4GKJ E;  1E3H A;  4FW9 A;  1FKA E;  1WUU A;  2C39 B;  4X64 I;  4DR7 E;  4JI0 I;  3HKM A;  4Z7Y A;  1QZR A;  4MQY A;  2CZ9 A;  1Y60 A;  3J80 Q;  2F4V I;  4IZJ D;  4DR4 I;  5A2Q Q;  5K36 C;  3B4T A;  4B3T I;  2BR2 A;  5IT9 C;  4BA2 B;  4X64 E;  3JAM Q;  3OTO E;  4JI0 E;  1Z0W A;  2BM0 A;  2HFS A;  4LFA E;  1EI1 A;  4GKK E;  2E5L I;  1UEK A;  2JEA A;  2OI2 A;  4DUZ I;  1XNR I;  4DR4 E;  2IOQ A;  4B3T E;  2PO2 A;  1B63 A;  4LFC I;  5DRO A;  2VES A;  3K17 A;  2DEJ A;  3T1H I;  4IFD E;  4MYU A;  1R6L A;  2ZIT A;  4QNJ A;  2X36 A;  1XNR E;  1Z0B A;  1N33 I;  4DV4 I;  4IFD F;  2BA1 D;  2BR2 B;  2V2V A;  4X65 E;  5IT9 Q;  4USM A;  4JI1 E;  4IS9 A;  4LFC E;  4LCG A;  2PNZ A;  2UUC E;  1VIS A;  2HKJ A;  2JEA B;  3Q1Q A;  1B62 A;  4LPF A;  4M1K A;  4WUD A;  3M6A A;  3DD6 A;  2R42 A;  2PO2 B;  4LFB I;  4J3D A;  3GON A;  3H1C A;  4DV1 I;  3ZKD A;  4FW7 A;  1FJG I;  2A2D A;  2UUB I;  2Z5E A;  3CWV A;  1H7S A;  3ZM7 A;  5DNX A;  1ZXN A;  1N0V C;  1NHI A;  4YY3 I;  4DR5 I;  2AJ4 A;  4LFB E;  4GQU A;  2PNL A;  4HXZ A;  4FWH A;  3U1K A;  4LF4 I;  4DPW A;  2PNZ B;  4DV3 I;  3NZK A;  4DV1 E;  4N3O A;  4DV7 E;  4ED4 A;  1FJG E;  4BA1 A;  2GS8 A;  4LF7 I;  4LF5 E;  4HYM A;  4DR5 E;  1HNZ I;  4WUB A;  4JI2 I;  4B3R I;  1Y5Y A;  4LF4 E;  3ZZU A;  4WUC A;  4OO1 F;  1N36 I;  1Z0V A;  3Q6N A;  4DV2 I;  2AE8 A;  3WU3 A;  1H72 C;  2UUA I;  4DUY E;  4LF7 E;  3M85 G;  2C37 B;  4LF9 I;  4AM3 A;  4B3R E;  1N36 E;  4JV5 E;  3L7Z A;  4GKJ I;  4IFD A;  1OYS A;  5K36 B;  4P52 A;  2UUA E;  4DU7 A;  4BA1 B;  5DRQ A;  3K85 A;  4JI3 I;  3J81 Q;  1IBM I;  4ISA A;  4UT4 A;  4B3M I;  2O1V A;  1USV A;  1N32 I;  1E3P A;  1HNX I;  4DPX A;  4DPY A;  2BM1 A;  1FWK A;  4B3S I;  2V8P A;  2O1U A;  3B78 A;  2UU9 E;  2E1R A;  5K36 D;  3OTO I;  4LFA I;  2NN6 E;  4GKK I;  4JYA I;  5LMU E;  4JI3 E;  1IBM E;  2O3Z A;  1D6T A;  1RHY A;  2Z5B A;  4B3M E;  1N32 E;  2NN6 F;  2J65 A;  1HNX E;  3P76 A;  3WU6 A;  4X66 E;  3L7Z B;  4B3S E;  4IFD B;  2IOP A;  4HAC A;  4UTG A;  5JEA F;  1ZXM A;  4JYA E;  3PRY A;  1KTV A;  3ZZT A;  5GMD A;  4DR6 I;  1MX0 A;  4IFD D;  1IBK I;  4X65 I;  5EL9 A;  4JI1 I;  1J5E E;  2PO1 A;  1UDQ A;  2UUC I;  4OO1 A;  1ZM9 A;  4MDT A;  5FWK A;  3P06 A;  3QT8 A;  4IFD C;  2EFG A;  1H7U A;  1XMQ I;  2Z5B B;  4DR6 E;  1YH8 A;  4QNK A;  3CDI A;  3LPS A;  2IES A;  1IBK E;  4AIM A;  3CDJ A;  4MU4 A;  1KVK A;  5GME A;  1H74 A;  2WP8 A;  4JI4 E;  4HAC B;  3M85 D;  2BA0 G;  4FWG A;  5DRR A;  1Y4U A;  1XMQ E;  2UXB I;  4I3H A;  4FW5 A;  3V2U C;  1H73 A;  4ZVI A;  1N34 E;  1Z5A A;  2PO1 B;  4JI8 E;  2HK2 A;  2JEB A;  3J7A G;  2IER A;  4EMD A;  1Y6Z A;  4DV7 I;  1Z5B A;  1KIJ A;  2UXB E;  4LF5 I;  5DNL A;  4DV6 E;  2NN6 A;  1DAR A;  1FWL A;  3WU5 A;  2WP8 B;  2CG9 A;  2GO4 A;  2J7K A;  3B8H A;  4PRV A;  2VQF E;  2XEX A;  4DUY I;  1Y4S A;  4OO1 E;  2ZM6 I;  3J7A M;  5ELW A;  4OO1 C;  5JEA A;  4LF8 E;  4K0K E;  3K1J A;  2PO0 A;  3PS1 A;  1FNM A;  1RR9 A;  4JV5 I;  3P3C A;  2JEB B;  1XXE A;  3UHM A;  2O1T A;  3PYG A;  4Z7C A;  1PVG A;  5C0X E;  2HHH E;  2ZM6 E;  5C0X C;  1NHH A;  1KKH A;  5LMN I;  2X7I A;  4DR3 E;  5C0X F;  4X62 E;  2NN6 B;  4DR2 E;  2R3V A;  2UU9 I;  3M7N G;  1PIE A;  1S16 A;  3QT6 A;  2BA1 G;  1R6M A;  4DU8 A;  2VF3 A;  4JI6 E;  5BR8 I;  5LMU I;  1A6F A;  1XMO E;  5LMN E;  4NXN I;  2CGE A;  1Z59 A;  1HNW I;  1Z0E A;  2GO3 A;  2PO0 B;  2NN6 D;  4DR1 I;  4X66 I;  4NXM E;  2LJP A;  2UXC I;  2WW4 A;  3D4J A;  4U3D A;  5A2Q C;  2NN6 C;  2DEI A;  3F0N A;  5BR8 E;  2GQ0 A;  3JAM C;  4NXN E;  1HNW E;  4JI5 E;  5IWA E;  4DR1 E;  2V2Z A;  4RPF A;  5JEA E;  1U2R A;  2PNM A;  2V34 A;  5JEA C;  1J5E I;  1YHC A;  2UXC E;  2C38 A;  2V2Q A;  3PYF A;  3GLL A;  2HK3 A;  4OKG A;  2WNR A;  4DV5 E;  5K36 E;  1UDO A;  3P3E A;  2VQE I;  4MU1 A;  5LL6 R;  4JI4 I;  5K36 F;  3QT7 A;  4URL A;  4KHP I;  4DPT A;  1NZ0 A;  1N0U A;  1K47 A;  4AQY I;  2F4V E;  5FLX C;  3PYD A;  1Z0G A;  1N34 I;  2BV3 A;  4JI8 I;  5C0X A;  2Q2E B;  4LCF A;  1NHJ A;  3KRN A;  3LTO A;  2VQE E;  1OYR A;  4MU0 A;  1EA6 A;  4LF6 I;  1I94 I; 
#chains in the Genus database with same CATH homology
 1HR0 I;  1MU5 A;  4OX9 I;  3H4L A;  3HJC A;  4PRX A;  4KHP E;  2E5L E;  4AQY E;  4DUZ E;  4R1F A;  4DV6 I;  1Z5C A;  4LF6 E;  4FWD A;  1I94 E;  4YHH I;  1IBL I;  1HR0 E;  2VQF I;  4OX9 E;  1Z0C A;  4DPU A;  3T1H E;  1BKN A;  1MG7 A;  4FN5 A;  4LF8 I;  5FLX Q;  3QT5 A;  4JG4 A;  4K0K I;  3HUL A;  4DV0 I;  4P7A A;  1N33 E;  4DV4 E;  2HKE A;  4YHH E;  1IBL E;  1ELO A;  4IZK A;  2HHH I;  3T1Y I;  3V5R A;  4DR3 I;  4DV0 E;  2HFU A;  1RRE A;  3PYE A;  5L3J A;  4X62 I;  2Z5C A;  1ZM4 A;  4DR2 I;  1PKP A;  1S4E A;  1FI4 A;  3WU4 A;  1XNQ I;  3T1Y E;  4JI6 I;  4HY1 A;  2UUB E;  1XMO I;  3ZKB A;  1XHK A;  4YY3 E;  1ZM3 A;  4XTJ A;  4NXM I;  2A2C A;  4IZJ A;  3J81 C;  4USK A;  4DXL A;  4JI7 I;  1HK7 A;  4DV3 E;  2NPF A;  1XNQ E;  4IZK B;  1USU A;  1ZM2 A;  4KQV A;  4JI5 I;  5IWA I;  2Z5C B;  4MYT A;  1HNZ E;  1OJ4 A;  4JI2 E;  3J80 C;  1Z0T A;  4JI7 E;  3B82 A;  2UXD I;  4DR7 I;  4DV2 E;  4DV5 I;  4LF9 E;  2O1W A;  3ZZ0 A;  4IZJ B;  2ZBK B;  3LNU A;  3Q6M A;  4PU9 A;  2UXD E;  4GKJ E;  4FW9 A;  1FKA E;  1WUU A;  4DR7 E;  4X64 I;  4JI0 I;  4Z7Y A;  1QZR A;  2CZ9 A;  2F4V I;  3J80 Q;  4IZJ D;  4DR4 I;  5A2Q Q;  4B3T I;  5IT9 C;  4X64 E;  3JAM Q;  3OTO E;  4JI0 E;  1Z0W A;  2BM0 A;  2HFS A;  4LFA E;  1EI1 A;  4GKK E;  2E5L I;  1UEK A;  2OI2 A;  4DUZ I;  1XNR I;  4DR4 E;  2IOQ A;  4B3T E;  1B63 A;  4LFC I;  3K17 A;  2DEJ A;  3T1H I;  4MYU A;  2ZIT A;  1XNR E;  2X36 A;  1Z0B A;  1N33 I;  4DV4 I;  2V2V A;  4X65 E;  5IT9 Q;  4USM A;  4JI1 E;  4LFC E;  2UUC E;  1VIS A;  2HKJ A;  3Q1Q A;  1B62 A;  4M1K A;  4WUD A;  3M6A A;  2R42 A;  4LFB I;  3GON A;  4DV1 I;  3ZKD A;  1FJG I;  2A2D A;  2UUB I;  2Z5E A;  3CWV A;  1H7S A;  3ZM7 A;  1ZXN A;  1N0V C;  1NHI A;  4YY3 I;  4DR5 I;  2AJ4 A;  4LFB E;  2PNL A;  4HXZ A;  4FWH A;  4LF4 I;  4DPW A;  4DV3 I;  4DV1 E;  4N3O A;  4DV7 E;  4ED4 A;  1FJG E;  2GS8 A;  4LF7 I;  4LF5 E;  4HYM A;  4DR5 E;  1HNZ I;  4WUB A;  4JI2 I;  4B3R I;  4LF4 E;  3ZZU A;  4WUC A;  1N36 I;  1Z0V A;  3Q6N A;  4DV2 I;  3WU3 A;  1H72 C;  2UUA I;  4DUY E;  4LF7 E;  4LF9 I;  4B3R E;  1N36 E;  4JV5 E;  4GKJ I;  4P52 A;  2UUA E;  4DU7 A;  3K85 A;  4JI3 I;  3J81 Q;  1IBM I;  4UT4 A;  4B3M I;  2O1V A;  1USV A;  1N32 I;  1HNX I;  4DPX A;  4DPY A;  2BM1 A;  1FWK A;  4B3S I;  2V8P A;  2O1U A;  3B78 A;  2UU9 E;  2E1R A;  3OTO I;  4LFA I;  4GKK I;  4JYA I;  5LMU E;  4JI3 E;  1IBM E;  1D6T A;  2Z5B A;  4B3M E;  1N32 E;  1HNX E;  3WU6 A;  4X66 E;  4B3S E;  2IOP A;  4HAC A;  4UTG A;  4JYA E;  1ZXM A;  3PRY A;  1KTV A;  3ZZT A;  5GMD A;  4DR6 I;  1MX0 A;  1IBK I;  4X65 I;  4JI1 I;  1J5E E;  2UUC I;  1ZM9 A;  5FWK A;  3P06 A;  3QT8 A;  2EFG A;  1H7U A;  1XMQ I;  2Z5B B;  4DR6 E;  3LPS A;  1IBK E;  1KVK A;  5GME A;  1H74 A;  4JI4 E;  4HAC B;  4FWG A;  1Y4U A;  1XMQ E;  2UXB I;  4I3H A;  3V2U C;  1H73 A;  4ZVI A;  1N34 E;  1Z5A A;  4JI8 E;  2HK2 A;  3J7A G;  4EMD A;  1Y6Z A;  4DV7 I;  1Z5B A;  1KIJ A;  2UXB E;  4LF5 I;  4DV6 E;  1DAR A;  1FWL A;  3WU5 A;  2CG9 A;  2J7K A;  3B8H A;  4PRV A;  2VQF E;  2XEX A;  4DUY I;  1Y4S A;  2ZM6 I;  3J7A M;  4LF8 E;  4K0K E;  3K1J A;  1FNM A;  1RR9 A;  4JV5 I;  2O1T A;  3PYG A;  4Z7C A;  1PVG A;  2HHH E;  2ZM6 E;  1NHH A;  1KKH A;  5LMN I;  2X7I A;  4DR3 E;  4X62 E;  4DR2 E;  2R3V A;  2UU9 I;  1PIE A;  1S16 A;  3QT6 A;  4DU8 A;  2VF3 A;  4JI6 E;  5BR8 I;  5LMU I;  1A6F A;  1XMO E;  5LMN E;  4NXN I;  2CGE A;  1Z59 A;  1HNW I;  1Z0E A;  4DR1 I;  4X66 I;  4NXM E;  2LJP A;  2UXC I;  2WW4 A;  3D4J A;  5A2Q C;  2DEI A;  3F0N A;  5BR8 E;  2GQ0 A;  3JAM C;  4NXN E;  1HNW E;  4JI5 E;  5IWA E;  4DR1 E;  2V2Z A;  4RPF A;  1U2R A;  2PNM A;  2V34 A;  1J5E I;  2UXC E;  2V2Q A;  3PYF A;  2HK3 A;  4DV5 E;  2VQE I;  5LL6 R;  4JI4 I;  3QT7 A;  4URL A;  4KHP I;  4DPT A;  1NZ0 A;  1N0U A;  1K47 A;  4AQY I;  2F4V E;  5FLX C;  3PYD A;  1Z0G A;  1N34 I;  2BV3 A;  4JI8 I;  2Q2E B;  1NHJ A;  3LTO A;  2VQE E;  1EA6 A;  4LF6 I;  1I94 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...