5IT9Q

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
141
structure length
141
Chain Sequence
TVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVQPEILRFKVYEPLLLVGLDKFANIDIRVKVTGGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKFGGRGARSRFQKSYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
molecule keywords Ribosomal protein uS2
total genus 35
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5it9Q00
4HACB 3J81C 5LL6R 5IT9Q 3B8HA 1H73A 3J80Q 1N34I 1HR0I 1UEKA 2UUBE 2UXCI 3ZKDA 3CWVA 4DV0I 1IBKE 3LPSA 4GKJE 4LF7I 5LMNE 3T1HE 1H7SA 5LMUE 3WU3A 1Z0CA 5FLXC 4DV1E 4JG4A 2UU9I 1N33I 4DV5I 2X7IA 1RR9A 3QT7A 4WUBA 4PU9A 4DPTA 1NHJA 1FJGE 4OX9I 4X62E 3PYGA 2VQFE 2VF3A 4LF6E 2UXDE 4USKA 1IBLE 2V34A 5BR8I 4XTJA 3QT8A 1HNZI 2UUCI 4DUYI 4DUZE 4LF9E 4DR4I 4DV4I 1XMOE 1J5EE 2HHHI 2DEJA 4DR2E 4LFCI 4DV0E 1XNRI 2NPFA 3D4JA 1KIJA 4UTGA 1XHKA 4GKKI 3Q1QA 4FW9A 4JI4I 3QT5A 4MYTA 4JI0E 4JI3I 4DV5E 1N34E 2ZM6E 2VQEE 1MX0A 1WUUA 2UUAI 4X64E 4NXNE 4DR6I 4DPYA 1IBLI 1OJ4A 5LMNI 3T1YI 4HYMA 2VQEI 4JV5I 4DR7I 3WU4A 1BKNA 1IBKI 4MYUA 3LTOA 1MU5A 1FJGI 2HK3A 4Z7CA 4JYAE 5L3JA 1S16A 4JI7E 4DR2I 1KVKA 4X66E 4DV7E 4LF9I 4X65I 3PYFA 3WU5A 4FWGA 4NXMI 4JI8E 3PYEA 1I94E 4JI3E 4YY3I 4LF8I 2HK2A 4WUDA 4DR5I 4RPFA 1ZXMA 4K0KI 4P52A 3ZM7A 1ZM3A 5A2QQ 4LFCE 1N0VC 1S4EA 4JI1I 1I94I 1N36E 3OTOI 4YHHE 3B78A 4ED4A 1FKAE 1HNWE 3J80C 4NXNI 3ZKBA 4X64I 2ZITA 4X66I 1NZ0A 2HFUA 1N36I 1EI1A 1Z0GA 2F4VE 1VISA 2HKJA 2R3VA 1MG7A 4LF5I 1EA6A 2BV3A 4HY1A 1N33E 1Z0VA 4LFBE 4DPWA 3T1YE 4DV6I 4DUYE 3LNUA 1IBMI 1HNZE 2ZBKB 3J7AG 3HULA 1PVGA 4DV7I 1Z0WA 3K17A 4JI7I 4B3ME 4B3RI 4B3TI 1NHIA 1ZM4A 1B62A 1Z59A 1FI4A 1ELOA 4DV2E 1Z0TA 4JI8I 4UT4A 1D6TA 1XNQE 1ZM9A 1HNWI 2E5LE 1IBME 2GS8A 4X65E 3V5RA 1B63A 2E1RA 4LFBI 3JAMQ 2V8PA 2HKEA 4JI1E 2UXBE 5IWAE 2V2VA 4LF5E 1KKHA 4B3TE 4HACA 1QZRA 4PRXA 1N32I 5IWAI 4JI2I 2UU9E 2HHHE 2X36A 2E5LI 4Z7YA 3T1HI 1ZXNA 4DV2I 3QT6A 2V2ZA 4KQVA 4JI4E 4EMDA 1K47A 4X62I 2HFSA 3J7AM 2A2DA 1U2RA 4DR3E 4DU7A 4LF8E 4YY3E 2WW4A 1DARA 3JAMC 1Z0BA 3WU6A 4DR1I 4NXME 4DV1I 1Z5AA 3M6AA 4B3SE 1FNMA 4JI5I 4AQYI 4LF4E 3H4LA 3GONA 4JI2E 4DU8A 4OX9E 4JI0I 3J81Q 1NHHA 1N32E 5IT9C 5A2QC 1Z5BA 4DV3E 4ZVIA 4B3RE 4JYAI 2F4VI 4FWDA 2UUBI 2R42A 1KTVA 4HXZA 4DPUA 4JV5E 4LF4I 5LMUI 4PRVA 2CZ9A 4R1FA 2AJ4A 3V2UC 1Z0EA 1XMQI 2UUAE 2OI2A 4DR1E 3OTOE 2VQFI 1HNXI 4DV3I 4FWHA 5FLXQ 1H74A 4DR5E 4K0KE 1ZM2A 4KHPE 4DXLA 1XNRE 1FWLA 4JI6E 1A6FA 2Q2EB 4FN5A 4WUCA 4LFAE 2UXBI 4DR7E 1XMOI 1J5EI 4AQYE 1XMQE 5BR8E 4URLA 4DV6E 2DEIA 4YHHI 4LF6I 2UXDI 1PKPA 2J7KA 3ZZ0A 1H7UA 5GMEA 3K1JA 2BM1A 4DR3I 4JI6I 4KHPI 3B82A 4M1KA 2V2QA 3ZZUA 2UXCE 1H72C 3F0NA 2UUCE 1N0UA 4JI5E 1Z5CA 4DR6E 4B3SI 1XNQI 4GKJI 4LF7E 4P7AA 2ZM6I 1RREA 2BM0A 3PYDA 2XEXA 4USMA 4LFAI 2A2CA 4GKKE 2LJPA 1FWKA 1HNXE 2EFGA 4B3MI 4I3HA 1HR0E 5GMDA 4DUZI 3ZZTA 4DR4E 4DV4E 4DPXA 1PIEA
chains in the Genus database with same CATH superfamily
2C39A 4HACB 4OO1E 3J81C 2AE8A 5LL6R 4MU1A 3B4TA 5IT9Q 3B8HA 1H73A 3J80Q 1N34I 1HR0I 1UEKA 2UUBE 2NN6C 2UXCI 3ZKDA 3CWVA 4DV0I 2IERA 5DNXA 1IBKE 4LPFA 1UDSA 3GMEA 5DRQA 3LPSA 5JEAA 4GKJE 4OO1C 4LF7I 2GO3A 5LMNE 3T1HE 5JEAC 1H7SA 5LMUE 3WU3A 1Z0CA 2F1DA 5FLXC 4DV1E 4JG4A 3CDIA 1R6LA 2UU9I 1N33I 4DV5I 2X7IA 1RR9A 3QT7A 4IZKA 4WUBA 2CG9A 2NN6B 4OO1A 4MU0A 5DRPA 4PU9A 4DPTA 4NBQA 4OZEA 4IFDE 1HK7A 1NHJA 2CGEA 5C0XC 5JEAE 1FJGE 5C0XE 4OX9I 4X62E 3P06A 3PYGA 4J3DA 4OO1B 2NN6F 2VQFE 2VF3A 4LF6E 2UXDE 4USKA 1IBLE 4IZJA 2V34A 5BR8I 4XTJA 3QT8A 1HNZI 3P76A 2UUCI 5EKWA 3M85D 1Y5YA 4DUYI 4DUZE 4LF9E 4DR4I 4DV4I 1XMOE 1J5EE 2HHHI 2DEJA 4DR2E 4LFCI 1Y60A 1OYPA 4DV0E 1XNRI 1Y4UA 2NPFA 3D4JA 1KIJA 4UTGA 3NZKA 4N3OA 2Z5CA 1XHKA 4GKKI 3M7ND 3KRNA 3Q1QA 4FW9A 4JI4I 3QT5A 4MYTA 4JI0E 3M85G 2Z5BA 1YHCA 4DV5E 4JI3I 1N34E 2ZM6E 2VQEE 1UDQA 1MX0A 1WUUA 2UUAI 4X64E 4NXNE 4DR6I 4LCHA 4DPYA 1IBLI 1OJ4A 3UHMA 5LMNI 3T1YI 2PNZA 4HYMA 3DD6A 2VQEI 4JV5I 2JEAA 4DR7I 2Z5BB 3WU4A 1BKNA 1IBKI 4MYUA 5JEAB 3LTOA 1MU5A 1FJGI 2HK3A 3K85A 4Z7CA 4JYAE 5K36A 1XXEA 3GCMA 5ELWA 2BA1D 4IZJD 5L3JA 4AIMA 1S16A 4IZKB 4JI7E 4DR2I 1KVKA 4X66E 4DV7E 4LF9I 5DRRA 4X65I 3PYFA 2Z5CB 3WU5A 4FWGA 2Z5EA 4NXMI 4JI8E 1Y4SA 3PYEA 1I94E 4IFDA 4JI3E 4YY3I 4LF8I 2HK2A 4FW7A 5JEAF 4WUDA 4DR5I 4RPFA 1ZXMA 4K0KI 4P52A 3ZM7A 1UDNA 2JEAB 1ZM3A 5A2QQ 4LFCE 4FW3A 1N0VC 1S4EA 4JI1I 1I94I 1N36E 3OTOI 4BA1B 4YHHE 3B78A 3L7ZA 2IOQA 2PO2A 3PS1A 3HJCA 4ED4A 1FKAE 1HNWE 3J80C 4NXNI 3ZKBA 4X64I 3U1KA 1RHYA 2ZITA 4X66I 1NZ0A 1USVA 2HFUA 1R6MA 4MDTA 1N36I 1EI1A 1Z0GA 2F4VE 1VISA 2HKJA 4MU3A 3P3EA 2C38A 2R3VA 2IOPA 1MG7A 4AIDA 4LF5I 1EA6A 2BV3A 4HY1A 4GQUA 2JT2A 2WP8B 1N33E 2JEBA 1Z0VA 4LFBE 4DPWA 3T1YE 4DV6I 4DUYE 3LNUA 3Q6MA 1IBMI 5C0XD 1HNZE 2ZBKB 3J7AG 3HULA 1PVGA 4LCGA 4DV7I 1Z0WA 3K17A 2WP8A 4JI7I 3PRYA 4B3ME 4LCFA 2J65A 4B3RI 5JEAD 2JE6A 2VESA 3P3CA 4B3TI 2GO4A 3CDJA 5DNLA 2NN6A 1NHIA 1ZM4A 1B62A 1Z59A 1FI4A 1ELOA 4DV2E 1Z0TA 4JI8I 4UT4A 3P3GA 1D6TA 1XNQE 1ZM9A 1HNWI 2PO0A 2E5LE 1IBME 2GS8A 4X65E 3H1CA 1USUA 3V5RA 1B63A 2E1RA 3GLLA 4LFBI 4OO1F 3JAMQ 2V8PA 2HKEA 4JI1E 1UDOA 2WNRA 2UXBE 5IWAE 2V2VA 3L7ZB 4LF5E 1KKHA 4B3TE 2C39B 4HACA 1QZRA 2NN6E 4PRXA 2O1TA 1E3HA 1N32I 5IWAI 4JI2I 4MU4A 5DROA 2UU9E 2HHHE 2X36A 4ISAA 5C0XB 2E5LI 2JE6B 4Z7YA 3T1HI 1ZXNA 3Q6NA 4DV2I 3QT6A 2V2ZA 1Y6ZA 4KQVA 4BA2B 3HKMA 2JEBB 4IFDF 4JI4E 4EMDA 1K47A 4X62I 5C0XA 2HFSA 3J7AM 2A2DA 1U2RA 5FWKA 4DR3E 4OO1D 4DU7A 4YY3E 4LF8E 2WW4A 1DARA 3JAMC 1Z0BA 3WU6A 4DR1I 4NXME 3PS2A 4DV1I 1Z5AA 3M6AA 4B3SE 2C37A 1FNMA 1VI7A 5K36F 4JI5I 4OKGA 4AQYI 2NN6D 4LF4E 3H4LA 3GONA 4JI2E 4DU8A 4OX9E 4JI0I 2IESA 2GQ0A 3J81Q 1NHHA 1N32E 2BA1G 4AM3A 5IT9C 5A2QC 1Z5BA 4DV3E 4QNJA 3M7NG 4ZVIA 4B3RE 4JYAI 2F4VI 4FWDA 4IFDC 2UUBI 4BA2A 2R42A 1KTVA 4HXZA 4DPUA 4JV5E 4IFDB 2O1UA 5C0XF 4LF4I 4FW5A 5LMUI 4PRVA 2CZ9A 4R1FA 2AJ4A 3V2UC 1Z0EA 1XMQI 5K36D 4MQYA 2UUAE 2OI2A 2O1VA 4DR1E 4U3DA 3OTOE 2VQFI 4U3BA 1HNXI 2C37B 4DV3I 4FWHA 2BR2A 5FLXQ 1H74A 4DR5E 4IZJB 5K36C 2CVEA 4K0KE 1ZM2A 2PNZB 4KHPE 3U1YA 2BA0G 4DXLA 1XNRE 1FWLA 1YH8A 4JI6E 1A6FA 2Q2EB 4FN5A 4WUCA 4LFAE 2UXBI 4IFDD 4DR7E 1XMOI 1J5EI 4AQYE 1OYRA 1XMQE 5BR8E 4URLA 2C38B 4DV6E 2PO1A 2DEIA 4YHHI 4LF6I 2UXDI 2PNMA 1PKPA 2J7KA 3PS3A 3ZZ0A 1H7UA 5GMEA 3K1JA 2BM1A 4DR3I 4JI6I 2O1WA 4KHPI 3B82A 4IS9A 4M1KA 2V2QA 3ZZUA 2UXCE 4QNKA 1H72C 3F0NA 4FW6A 2UUCE 1N0UA 2PNLA 1P42A 2BR2B 4JI5E 1E3PA 1Z5CA 5K36B 4DR6E 4B3SI 1XNQI 5EL9A 4GKJI 1OYSA 2BA0D 4LF7E 4P7AA 2ZM6I 5K36E 1RREA 2BM0A 4BA1A 3PYDA 2O3ZA 2XEXA 4USMA 4LFAI 2A2CA 4GKKE 2LJPA 1FWKA 4FW4A 2PO2B 2PO1B 2PO0B 1HNXE 4LOMA 2EFGA 2WNRB 4B3MI 4I3HA 1HR0E 5GMDA 4DUZI 3ZZTA 4DR4E 4DV4E 4DPXA 1PIEA
chains in the Genus database with same CATH topology
4HACB 3J81C 5LL6R 5IT9Q 3B8HA 1H73A 3J80Q 1N34I 1HR0I 1UEKA 2UUBE 2UXCI 3ZKDA 3CWVA 4DV0I 1IBKE 3LPSA 4GKJE 4LF7I 5LMNE 3T1HE 1H7SA 5LMUE 3WU3A 1Z0CA 5FLXC 4DV1E 4JG4A 2UU9I 1N33I 4DV5I 2X7IA 1RR9A 3QT7A 4IZKA 4WUBA 2CG9A 4PU9A 4DPTA 1HK7A 1NHJA 2CGEA 1FJGE 4OX9I 4X62E 3P06A 3PYGA 2VQFE 2VF3A 4LF6E 2UXDE 4USKA 1IBLE 4IZJA 2V34A 5BR8I 4XTJA 3QT8A 1HNZI 2UUCI 4DUYI 4DUZE 4LF9E 4DR4I 4DV4I 1XMOE 1J5EE 2HHHI 2DEJA 4DR2E 4LFCI 4DV0E 1XNRI 1Y4UA 2NPFA 3D4JA 1KIJA 4UTGA 4N3OA 2Z5CA 1XHKA 4GKKI 3Q1QA 4FW9A 4JI4I 3QT5A 4MYTA 4JI0E 2Z5BA 4DV5E 4JI3I 1N34E 2ZM6E 2VQEE 1MX0A 1WUUA 2UUAI 4X64E 4NXNE 4DR6I 4DPYA 1IBLI 1OJ4A 5LMNI 3T1YI 4HYMA 2VQEI 4JV5I 4DR7I 2Z5BB 3WU4A 1BKNA 1IBKI 4MYUA 3LTOA 1MU5A 1FJGI 2HK3A 3K85A 4Z7CA 4JYAE 4IZJD 5L3JA 1S16A 4IZKB 4JI7E 4DR2I 1KVKA 4X66E 4DV7E 4LF9I 4X65I 3PYFA 2Z5CB 3WU5A 4FWGA 2Z5EA 4NXMI 4JI8E 1Y4SA 3PYEA 1I94E 4JI3E 4YY3I 4LF8I 2HK2A 4WUDA 4DR5I 4RPFA 1ZXMA 4K0KI 4P52A 3ZM7A 1ZM3A 5A2QQ 4LFCE 1N0VC 1S4EA 4JI1I 1I94I 1N36E 3OTOI 4YHHE 3B78A 2IOQA 3HJCA 1FKAE 4ED4A 1HNWE 3J80C 4NXNI 3ZKBA 4X64I 2ZITA 4X66I 1NZ0A 1USVA 2HFUA 1N36I 1EI1A 1Z0GA 2F4VE 1VISA 2HKJA 2R3VA 2IOPA 1MG7A 4LF5I 1EA6A 2BV3A 4HY1A 1N33E 1Z0VA 4LFBE 4DPWA 3T1YE 4DV6I 4DUYE 3LNUA 3Q6MA 1IBMI 1HNZE 2ZBKB 3J7AG 3HULA 1PVGA 4DV7I 1Z0WA 3K17A 4JI7I 3PRYA 4B3ME 4B3RI 4B3TI 1NHIA 1ZM4A 1B62A 1Z59A 1FI4A 1ELOA 4DV2E 1Z0TA 4JI8I 4UT4A 1D6TA 1XNQE 1ZM9A 1HNWI 2E5LE 1IBME 2GS8A 4X65E 1USUA 3V5RA 1B63A 2E1RA 4LFBI 3JAMQ 2V8PA 2HKEA 4JI1E 2UXBE 5IWAE 2V2VA 4LF5E 1KKHA 4B3TE 4HACA 1QZRA 4PRXA 2O1TA 1N32I 5IWAI 4JI2I 2UU9E 2HHHE 2X36A 2E5LI 4Z7YA 3T1HI 1ZXNA 3Q6NA 4DV2I 3QT6A 2V2ZA 1Y6ZA 4KQVA 4JI4E 4EMDA 1K47A 4X62I 2HFSA 3J7AM 2A2DA 1U2RA 4DR3E 4DU7A 4YY3E 4LF8E 2WW4A 1DARA 3JAMC 1Z0BA 3WU6A 4DR1I 4NXME 4DV1I 1Z5AA 3M6AA 4B3SE 1FNMA 4JI5I 4AQYI 4LF4E 3H4LA 3GONA 4JI2E 4DU8A 4OX9E 4JI0I 2GQ0A 3J81Q 1NHHA 1N32E 5IT9C 5A2QC 1Z5BA 4DV3E 4ZVIA 4B3RE 4JYAI 2F4VI 4FWDA 2UUBI 2R42A 1KTVA 4HXZA 4DPUA 4JV5E 2O1UA 4LF4I 5LMUI 4PRVA 2CZ9A 4R1FA 2AJ4A 3V2UC 1Z0EA 1XMQI 2UUAE 2OI2A 2O1VA 4DR1E 3OTOE 2VQFI 4DPXA 1HNXI 4DV3I 4FWHA 5FLXQ 1H74A 4DR5E 4IZJB 4K0KE 1ZM2A 4KHPE 4DXLA 1XNRE 1FWLA 4JI6E 1A6FA 2Q2EB 4FN5A 4WUCA 4LFAE 2UXBI 4DR7E 1XMOI 1J5EI 4AQYE 1XMQE 5BR8E 4URLA 4DV6E 2DEIA 4YHHI 4LF6I 2UXDI 2PNMA 1PKPA 2J7KA 3ZZ0A 1H7UA 5GMEA 3K1JA 2BM1A 4DR3I 4JI6I 2O1WA 4KHPI 3B82A 4M1KA 2V2QA 3ZZUA 2UXCE 1H72C 3F0NA 2UUCE 1N0UA 2PNLA 4JI5E 1Z5CA 4DR6E 4B3SI 1XNQI 4GKJI 4LF7E 4P7AA 2ZM6I 1RREA 2BM0A 3PYDA 2XEXA 4USMA 4LFAI 2A2CA 4GKKE 2LJPA 1FWKA 1HNXE 2EFGA 4B3MI 4I3HA 1HR0E 5GMDA 4DUZI 3ZZTA 4DR4E 4DV4E 5FWKA 1PIEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAC B;  3J81 C;  5LL6 R;  5IT9 Q;  3B8H A;  1H73 A;  3J80 Q;  1N34 I;  1HR0 I;  1UEK A;  2UUB E;  2UXC I;  3ZKD A;  3CWV A;  4DV0 I;  1IBK E;  3LPS A;  4GKJ E;  4LF7 I;  5LMN E;  3T1H E;  1H7S A;  5LMU E;  3WU3 A;  1Z0C A;  5FLX C;  4DV1 E;  4JG4 A;  2UU9 I;  1N33 I;  4DV5 I;  2X7I A;  1RR9 A;  3QT7 A;  4WUB A;  4PU9 A;  4DPT A;  1NHJ A;  1FJG E;  4OX9 I;  4X62 E;  3PYG A;  2VQF E;  2VF3 A;  4LF6 E;  2UXD E;  4USK A;  1IBL E;  2V34 A;  5BR8 I;  4XTJ A;  3QT8 A;  1HNZ I;  2UUC I;  4DUY I;  4DUZ E;  4LF9 E;  4DR4 I;  4DV4 I;  1XMO E;  1J5E E;  2HHH I;  2DEJ A;  4DR2 E;  4LFC I;  4DV0 E;  1XNR I;  2NPF A;  3D4J A;  1KIJ A;  4UTG A;  1XHK A;  4GKK I;  3Q1Q A;  4FW9 A;  4JI4 I;  3QT5 A;  4MYT A;  4JI0 E;  4JI3 I;  4DV5 E;  1N34 E;  2ZM6 E;  2VQE E;  1MX0 A;  1WUU A;  2UUA I;  4X64 E;  4NXN E;  4DR6 I;  4DPY A;  1IBL I;  1OJ4 A;  5LMN I;  3T1Y I;  4HYM A;  2VQE I;  4JV5 I;  4DR7 I;  3WU4 A;  1BKN A;  1IBK I;  4MYU A;  3LTO A;  1MU5 A;  1FJG I;  2HK3 A;  4Z7C A;  4JYA E;  5L3J A;  1S16 A;  4JI7 E;  4DR2 I;  1KVK A;  4X66 E;  4DV7 E;  4LF9 I;  4X65 I;  3PYF A;  3WU5 A;  4FWG A;  4NXM I;  4JI8 E;  3PYE A;  1I94 E;  4JI3 E;  4YY3 I;  4LF8 I;  2HK2 A;  4WUD A;  4DR5 I;  4RPF A;  1ZXM A;  4K0K I;  4P52 A;  3ZM7 A;  1ZM3 A;  5A2Q Q;  4LFC E;  1N0V C;  1S4E A;  4JI1 I;  1I94 I;  1N36 E;  3OTO I;  4YHH E;  3B78 A;  4ED4 A;  1FKA E;  1HNW E;  3J80 C;  4NXN I;  3ZKB A;  4X64 I;  2ZIT A;  4X66 I;  1NZ0 A;  2HFU A;  1N36 I;  1EI1 A;  1Z0G A;  2F4V E;  1VIS A;  2HKJ A;  2R3V A;  1MG7 A;  4LF5 I;  1EA6 A;  2BV3 A;  4HY1 A;  1N33 E;  1Z0V A;  4LFB E;  4DPW A;  3T1Y E;  4DV6 I;  4DUY E;  3LNU A;  1IBM I;  1HNZ E;  2ZBK B;  3J7A G;  3HUL A;  1PVG A;  4DV7 I;  1Z0W A;  3K17 A;  4JI7 I;  4B3M E;  4B3R I;  4B3T I;  1NHI A;  1ZM4 A;  1B62 A;  1Z59 A;  1FI4 A;  1ELO A;  4DV2 E;  1Z0T A;  4JI8 I;  4UT4 A;  1D6T A;  1XNQ E;  1ZM9 A;  1HNW I;  2E5L E;  1IBM E;  2GS8 A;  4X65 E;  3V5R A;  1B63 A;  2E1R A;  4LFB I;  3JAM Q;  2V8P A;  2HKE A;  4JI1 E;  2UXB E;  5IWA E;  2V2V A;  4LF5 E;  1KKH A;  4B3T E;  4HAC A;  1QZR A;  4PRX A;  1N32 I;  5IWA I;  4JI2 I;  2UU9 E;  2HHH E;  2X36 A;  2E5L I;  4Z7Y A;  3T1H I;  1ZXN A;  4DV2 I;  3QT6 A;  2V2Z A;  4KQV A;  4JI4 E;  4EMD A;  1K47 A;  4X62 I;  2HFS A;  3J7A M;  2A2D A;  1U2R A;  4DR3 E;  4DU7 A;  4LF8 E;  4YY3 E;  2WW4 A;  1DAR A;  3JAM C;  1Z0B A;  3WU6 A;  4DR1 I;  4NXM E;  4DV1 I;  1Z5A A;  3M6A A;  4B3S E;  1FNM A;  4JI5 I;  4AQY I;  4LF4 E;  3H4L A;  3GON A;  4JI2 E;  4DU8 A;  4OX9 E;  4JI0 I;  3J81 Q;  1NHH A;  1N32 E;  5IT9 C;  5A2Q C;  1Z5B A;  4DV3 E;  4ZVI A;  4B3R E;  4JYA I;  2F4V I;  4FWD A;  2UUB I;  2R42 A;  1KTV A;  4HXZ A;  4DPU A;  4JV5 E;  4LF4 I;  5LMU I;  4PRV A;  2CZ9 A;  4R1F A;  2AJ4 A;  3V2U C;  1Z0E A;  1XMQ I;  2UUA E;  2OI2 A;  4DR1 E;  3OTO E;  2VQF I;  1HNX I;  4DV3 I;  4FWH A;  5FLX Q;  1H74 A;  4DR5 E;  4K0K E;  1ZM2 A;  4KHP E;  4DXL A;  1XNR E;  1FWL A;  4JI6 E;  1A6F A;  2Q2E B;  4FN5 A;  4WUC A;  4LFA E;  2UXB I;  4DR7 E;  1XMO I;  1J5E I;  4AQY E;  1XMQ E;  5BR8 E;  4URL A;  4DV6 E;  2DEI A;  4YHH I;  4LF6 I;  2UXD I;  1PKP A;  2J7K A;  3ZZ0 A;  1H7U A;  5GME A;  3K1J A;  2BM1 A;  4DR3 I;  4JI6 I;  4KHP I;  3B82 A;  4M1K A;  2V2Q A;  3ZZU A;  2UXC E;  1H72 C;  3F0N A;  2UUC E;  1N0U A;  4JI5 E;  1Z5C A;  4DR6 E;  4B3S I;  1XNQ I;  4GKJ I;  4LF7 E;  4P7A A;  2ZM6 I;  1RRE A;  2BM0 A;  3PYD A;  2XEX A;  4USM A;  4LFA I;  2A2C A;  4GKK E;  2LJP A;  1FWK A;  1HNX E;  2EFG A;  4B3M I;  4I3H A;  1HR0 E;  5GMD A;  4DUZ I;  3ZZT A;  4DR4 E;  4DV4 E;  4DPX A;  1PIE A; 
#chains in the Genus database with same CATH topology
 2C39 A;  4HAC B;  4OO1 E;  3J81 C;  2AE8 A;  5LL6 R;  4MU1 A;  3B4T A;  5IT9 Q;  3B8H A;  1H73 A;  3J80 Q;  1N34 I;  1HR0 I;  1UEK A;  2UUB E;  2NN6 C;  2UXC I;  3ZKD A;  3CWV A;  4DV0 I;  2IER A;  5DNX A;  1IBK E;  4LPF A;  1UDS A;  3GME A;  5DRQ A;  3LPS A;  5JEA A;  4GKJ E;  4OO1 C;  4LF7 I;  2GO3 A;  5LMN E;  3T1H E;  5JEA C;  1H7S A;  5LMU E;  3WU3 A;  1Z0C A;  2F1D A;  5FLX C;  4DV1 E;  4JG4 A;  3CDI A;  1R6L A;  2UU9 I;  1N33 I;  4DV5 I;  2X7I A;  1RR9 A;  3QT7 A;  4IZK A;  4WUB A;  2CG9 A;  2NN6 B;  4OO1 A;  4MU0 A;  5DRP A;  4PU9 A;  4DPT A;  4NBQ A;  4OZE A;  4IFD E;  1HK7 A;  1NHJ A;  2CGE A;  5C0X C;  5JEA E;  1FJG E;  5C0X E;  4OX9 I;  4X62 E;  3P06 A;  3PYG A;  4J3D A;  4OO1 B;  2NN6 F;  2VQF E;  2VF3 A;  4LF6 E;  2UXD E;  4USK A;  1IBL E;  4IZJ A;  2V34 A;  5BR8 I;  4XTJ A;  3QT8 A;  1HNZ I;  3P76 A;  2UUC I;  5EKW A;  3M85 D;  1Y5Y A;  4DUY I;  4DUZ E;  4LF9 E;  4DR4 I;  4DV4 I;  1XMO E;  1J5E E;  2HHH I;  2DEJ A;  4DR2 E;  4LFC I;  1Y60 A;  1OYP A;  4DV0 E;  1XNR I;  1Y4U A;  2NPF A;  3D4J A;  1KIJ A;  4UTG A;  3NZK A;  4N3O A;  2Z5C A;  1XHK A;  4GKK I;  3M7N D;  3KRN A;  3Q1Q A;  4FW9 A;  4JI4 I;  3QT5 A;  4MYT A;  4JI0 E;  3M85 G;  2Z5B A;  1YHC A;  4DV5 E;  4JI3 I;  1N34 E;  2ZM6 E;  2VQE E;  1UDQ A;  1MX0 A;  1WUU A;  2UUA I;  4X64 E;  4NXN E;  4DR6 I;  4LCH A;  4DPY A;  1IBL I;  1OJ4 A;  3UHM A;  5LMN I;  3T1Y I;  2PNZ A;  4HYM A;  3DD6 A;  2VQE I;  4JV5 I;  2JEA A;  4DR7 I;  2Z5B B;  3WU4 A;  1BKN A;  1IBK I;  4MYU A;  5JEA B;  3LTO A;  1MU5 A;  1FJG I;  2HK3 A;  3K85 A;  4Z7C A;  4JYA E;  5K36 A;  1XXE A;  3GCM A;  5ELW A;  2BA1 D;  4IZJ D;  5L3J A;  4AIM A;  1S16 A;  4IZK B;  4JI7 E;  4DR2 I;  1KVK A;  4X66 E;  4DV7 E;  4LF9 I;  5DRR A;  4X65 I;  3PYF A;  2Z5C B;  3WU5 A;  4FWG A;  2Z5E A;  4NXM I;  4JI8 E;  1Y4S A;  3PYE A;  1I94 E;  4IFD A;  4JI3 E;  4YY3 I;  4LF8 I;  2HK2 A;  4FW7 A;  5JEA F;  4WUD A;  4DR5 I;  4RPF A;  1ZXM A;  4K0K I;  4P52 A;  3ZM7 A;  1UDN A;  2JEA B;  1ZM3 A;  5A2Q Q;  4LFC E;  4FW3 A;  1N0V C;  1S4E A;  4JI1 I;  1I94 I;  1N36 E;  3OTO I;  4BA1 B;  4YHH E;  3B78 A;  3L7Z A;  2IOQ A;  2PO2 A;  3PS1 A;  3HJC A;  4ED4 A;  1FKA E;  1HNW E;  3J80 C;  4NXN I;  3ZKB A;  4X64 I;  3U1K A;  1RHY A;  2ZIT A;  4X66 I;  1NZ0 A;  1USV A;  2HFU A;  1R6M A;  4MDT A;  1N36 I;  1EI1 A;  1Z0G A;  2F4V E;  1VIS A;  2HKJ A;  4MU3 A;  3P3E A;  2C38 A;  2R3V A;  2IOP A;  1MG7 A;  4AID A;  4LF5 I;  1EA6 A;  2BV3 A;  4HY1 A;  4GQU A;  2JT2 A;  2WP8 B;  1N33 E;  2JEB A;  1Z0V A;  4LFB E;  4DPW A;  3T1Y E;  4DV6 I;  4DUY E;  3LNU A;  3Q6M A;  1IBM I;  5C0X D;  1HNZ E;  2ZBK B;  3J7A G;  3HUL A;  1PVG A;  4LCG A;  4DV7 I;  1Z0W A;  3K17 A;  2WP8 A;  4JI7 I;  3PRY A;  4B3M E;  4LCF A;  2J65 A;  4B3R I;  5JEA D;  2JE6 A;  2VES A;  3P3C A;  4B3T I;  2GO4 A;  3CDJ A;  5DNL A;  2NN6 A;  1NHI A;  1ZM4 A;  1B62 A;  1Z59 A;  1FI4 A;  1ELO A;  4DV2 E;  1Z0T A;  4JI8 I;  4UT4 A;  3P3G A;  1D6T A;  1XNQ E;  1ZM9 A;  1HNW I;  2PO0 A;  2E5L E;  1IBM E;  2GS8 A;  4X65 E;  3H1C A;  1USU A;  3V5R A;  1B63 A;  2E1R A;  3GLL A;  4LFB I;  4OO1 F;  3JAM Q;  2V8P A;  2HKE A;  4JI1 E;  1UDO A;  2WNR A;  2UXB E;  5IWA E;  2V2V A;  3L7Z B;  4LF5 E;  1KKH A;  4B3T E;  2C39 B;  4HAC A;  1QZR A;  2NN6 E;  4PRX A;  2O1T A;  1E3H A;  1N32 I;  5IWA I;  4JI2 I;  4MU4 A;  5DRO A;  2UU9 E;  2HHH E;  2X36 A;  4ISA A;  5C0X B;  2E5L I;  2JE6 B;  4Z7Y A;  3T1H I;  1ZXN A;  3Q6N A;  4DV2 I;  3QT6 A;  2V2Z A;  1Y6Z A;  4KQV A;  4BA2 B;  3HKM A;  2JEB B;  4IFD F;  4JI4 E;  4EMD A;  1K47 A;  4X62 I;  5C0X A;  2HFS A;  3J7A M;  2A2D A;  1U2R A;  5FWK A;  4DR3 E;  4OO1 D;  4DU7 A;  4YY3 E;  4LF8 E;  2WW4 A;  1DAR A;  3JAM C;  1Z0B A;  3WU6 A;  4DR1 I;  4NXM E;  3PS2 A;  4DV1 I;  1Z5A A;  3M6A A;  4B3S E;  2C37 A;  1FNM A;  1VI7 A;  5K36 F;  4JI5 I;  4OKG A;  4AQY I;  2NN6 D;  4LF4 E;  3H4L A;  3GON A;  4JI2 E;  4DU8 A;  4OX9 E;  4JI0 I;  2IES A;  2GQ0 A;  3J81 Q;  1NHH A;  1N32 E;  2BA1 G;  4AM3 A;  5IT9 C;  5A2Q C;  1Z5B A;  4DV3 E;  4QNJ A;  3M7N G;  4ZVI A;  4B3R E;  4JYA I;  2F4V I;  4FWD A;  4IFD C;  2UUB I;  4BA2 A;  2R42 A;  1KTV A;  4HXZ A;  4DPU A;  4JV5 E;  4IFD B;  2O1U A;  5C0X F;  4LF4 I;  4FW5 A;  5LMU I;  4PRV A;  2CZ9 A;  4R1F A;  2AJ4 A;  3V2U C;  1Z0E A;  1XMQ I;  5K36 D;  4MQY A;  2UUA E;  2OI2 A;  2O1V A;  4DR1 E;  4U3D A;  3OTO E;  2VQF I;  4U3B A;  1HNX I;  2C37 B;  4DV3 I;  4FWH A;  2BR2 A;  5FLX Q;  1H74 A;  4DR5 E;  4IZJ B;  5K36 C;  2CVE A;  4K0K E;  1ZM2 A;  2PNZ B;  4KHP E;  3U1Y A;  2BA0 G;  4DXL A;  1XNR E;  1FWL A;  1YH8 A;  4JI6 E;  1A6F A;  2Q2E B;  4FN5 A;  4WUC A;  4LFA E;  2UXB I;  4IFD D;  4DR7 E;  1XMO I;  1J5E I;  4AQY E;  1OYR A;  1XMQ E;  5BR8 E;  4URL A;  2C38 B;  4DV6 E;  2PO1 A;  2DEI A;  4YHH I;  4LF6 I;  2UXD I;  2PNM A;  1PKP A;  2J7K A;  3PS3 A;  3ZZ0 A;  1H7U A;  5GME A;  3K1J A;  2BM1 A;  4DR3 I;  4JI6 I;  2O1W A;  4KHP I;  3B82 A;  4IS9 A;  4M1K A;  2V2Q A;  3ZZU A;  2UXC E;  4QNK A;  1H72 C;  3F0N A;  4FW6 A;  2UUC E;  1N0U A;  2PNL A;  1P42 A;  2BR2 B;  4JI5 E;  1E3P A;  1Z5C A;  5K36 B;  4DR6 E;  4B3S I;  1XNQ I;  5EL9 A;  4GKJ I;  1OYS A;  2BA0 D;  4LF7 E;  4P7A A;  2ZM6 I;  5K36 E;  1RRE A;  2BM0 A;  4BA1 A;  3PYD A;  2O3Z A;  2XEX A;  4USM A;  4LFA I;  2A2C A;  4GKK E;  2LJP A;  1FWK A;  4FW4 A;  2PO2 B;  2PO1 B;  2PO0 B;  1HNX E;  4LOM A;  2EFG A;  2WNR B;  4B3M I;  4I3H A;  1HR0 E;  5GMD A;  4DUZ I;  3ZZT A;  4DR4 E;  4DV4 E;  4DPX A;  1PIE A; 
#chains in the Genus database with same CATH homology
 4HAC B;  3J81 C;  5LL6 R;  5IT9 Q;  3B8H A;  1H73 A;  3J80 Q;  1N34 I;  1HR0 I;  1UEK A;  2UUB E;  2UXC I;  3ZKD A;  3CWV A;  4DV0 I;  1IBK E;  3LPS A;  4GKJ E;  4LF7 I;  5LMN E;  3T1H E;  1H7S A;  5LMU E;  3WU3 A;  1Z0C A;  5FLX C;  4DV1 E;  4JG4 A;  2UU9 I;  1N33 I;  4DV5 I;  2X7I A;  1RR9 A;  3QT7 A;  4IZK A;  4WUB A;  2CG9 A;  4PU9 A;  4DPT A;  1HK7 A;  1NHJ A;  2CGE A;  1FJG E;  4OX9 I;  4X62 E;  3P06 A;  3PYG A;  2VQF E;  2VF3 A;  4LF6 E;  2UXD E;  4USK A;  1IBL E;  4IZJ A;  2V34 A;  5BR8 I;  4XTJ A;  3QT8 A;  1HNZ I;  2UUC I;  4DUY I;  4DUZ E;  4LF9 E;  4DR4 I;  4DV4 I;  1XMO E;  1J5E E;  2HHH I;  2DEJ A;  4DR2 E;  4LFC I;  4DV0 E;  1XNR I;  1Y4U A;  2NPF A;  3D4J A;  1KIJ A;  4UTG A;  4N3O A;  2Z5C A;  1XHK A;  4GKK I;  3Q1Q A;  4FW9 A;  4JI4 I;  3QT5 A;  4MYT A;  4JI0 E;  2Z5B A;  4DV5 E;  4JI3 I;  1N34 E;  2ZM6 E;  2VQE E;  1MX0 A;  1WUU A;  2UUA I;  4X64 E;  4NXN E;  4DR6 I;  4DPY A;  1IBL I;  1OJ4 A;  5LMN I;  3T1Y I;  4HYM A;  2VQE I;  4JV5 I;  4DR7 I;  2Z5B B;  3WU4 A;  1BKN A;  1IBK I;  4MYU A;  3LTO A;  1MU5 A;  1FJG I;  2HK3 A;  3K85 A;  4Z7C A;  4JYA E;  4IZJ D;  5L3J A;  1S16 A;  4IZK B;  4JI7 E;  4DR2 I;  1KVK A;  4X66 E;  4DV7 E;  4LF9 I;  4X65 I;  3PYF A;  2Z5C B;  3WU5 A;  4FWG A;  2Z5E A;  4NXM I;  4JI8 E;  1Y4S A;  3PYE A;  1I94 E;  4JI3 E;  4YY3 I;  4LF8 I;  2HK2 A;  4WUD A;  4DR5 I;  4RPF A;  1ZXM A;  4K0K I;  4P52 A;  3ZM7 A;  1ZM3 A;  5A2Q Q;  4LFC E;  1N0V C;  1S4E A;  4JI1 I;  1I94 I;  1N36 E;  3OTO I;  4YHH E;  3B78 A;  2IOQ A;  3HJC A;  1FKA E;  4ED4 A;  1HNW E;  3J80 C;  4NXN I;  3ZKB A;  4X64 I;  2ZIT A;  4X66 I;  1NZ0 A;  1USV A;  2HFU A;  1N36 I;  1EI1 A;  1Z0G A;  2F4V E;  1VIS A;  2HKJ A;  2R3V A;  2IOP A;  1MG7 A;  4LF5 I;  1EA6 A;  2BV3 A;  4HY1 A;  1N33 E;  1Z0V A;  4LFB E;  4DPW A;  3T1Y E;  4DV6 I;  4DUY E;  3LNU A;  3Q6M A;  1IBM I;  1HNZ E;  2ZBK B;  3J7A G;  3HUL A;  1PVG A;  4DV7 I;  1Z0W A;  3K17 A;  4JI7 I;  3PRY A;  4B3M E;  4B3R I;  4B3T I;  1NHI A;  1ZM4 A;  1B62 A;  1Z59 A;  1FI4 A;  1ELO A;  4DV2 E;  1Z0T A;  4JI8 I;  4UT4 A;  1D6T A;  1XNQ E;  1ZM9 A;  1HNW I;  2E5L E;  1IBM E;  2GS8 A;  4X65 E;  1USU A;  3V5R A;  1B63 A;  2E1R A;  4LFB I;  3JAM Q;  2V8P A;  2HKE A;  4JI1 E;  2UXB E;  5IWA E;  2V2V A;  4LF5 E;  1KKH A;  4B3T E;  4HAC A;  1QZR A;  4PRX A;  2O1T A;  1N32 I;  5IWA I;  4JI2 I;  2UU9 E;  2HHH E;  2X36 A;  2E5L I;  4Z7Y A;  3T1H I;  1ZXN A;  3Q6N A;  4DV2 I;  3QT6 A;  2V2Z A;  1Y6Z A;  4KQV A;  4JI4 E;  4EMD A;  1K47 A;  4X62 I;  2HFS A;  3J7A M;  2A2D A;  1U2R A;  4DR3 E;  4DU7 A;  4YY3 E;  4LF8 E;  2WW4 A;  1DAR A;  3JAM C;  1Z0B A;  3WU6 A;  4DR1 I;  4NXM E;  4DV1 I;  1Z5A A;  3M6A A;  4B3S E;  1FNM A;  4JI5 I;  4AQY I;  4LF4 E;  3H4L A;  3GON A;  4JI2 E;  4DU8 A;  4OX9 E;  4JI0 I;  2GQ0 A;  3J81 Q;  1NHH A;  1N32 E;  5IT9 C;  5A2Q C;  1Z5B A;  4DV3 E;  4ZVI A;  4B3R E;  4JYA I;  2F4V I;  4FWD A;  2UUB I;  2R42 A;  1KTV A;  4HXZ A;  4DPU A;  4JV5 E;  2O1U A;  4LF4 I;  5LMU I;  4PRV A;  2CZ9 A;  4R1F A;  2AJ4 A;  3V2U C;  1Z0E A;  1XMQ I;  2UUA E;  2OI2 A;  2O1V A;  4DR1 E;  3OTO E;  2VQF I;  4DPX A;  1HNX I;  4DV3 I;  4FWH A;  5FLX Q;  1H74 A;  4DR5 E;  4IZJ B;  4K0K E;  1ZM2 A;  4KHP E;  4DXL A;  1XNR E;  1FWL A;  4JI6 E;  1A6F A;  2Q2E B;  4FN5 A;  4WUC A;  4LFA E;  2UXB I;  4DR7 E;  1XMO I;  1J5E I;  4AQY E;  1XMQ E;  5BR8 E;  4URL A;  4DV6 E;  2DEI A;  4YHH I;  4LF6 I;  2UXD I;  2PNM A;  1PKP A;  2J7K A;  3ZZ0 A;  1H7U A;  5GME A;  3K1J A;  2BM1 A;  4DR3 I;  4JI6 I;  2O1W A;  4KHP I;  3B82 A;  4M1K A;  2V2Q A;  3ZZU A;  2UXC E;  1H72 C;  3F0N A;  2UUC E;  1N0U A;  2PNL A;  4JI5 E;  1Z5C A;  4DR6 E;  4B3S I;  1XNQ I;  4GKJ I;  4LF7 E;  4P7A A;  2ZM6 I;  1RRE A;  2BM0 A;  3PYD A;  2XEX A;  4USM A;  4LFA I;  2A2C A;  4GKK E;  2LJP A;  1FWK A;  1HNX E;  2EFG A;  4B3M I;  4I3H A;  1HR0 E;  5GMD A;  4DUZ I;  3ZZT A;  4DR4 E;  4DV4 E;  5FWK A;  1PIE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...