5IT9Q

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
141
structure length
141
Chain Sequence
TVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVQPEILRFKVYEPLLLVGLDKFANIDIRVKVTGGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKFGGRGARSRFQKSYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
total genus 35
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5it9Q00
4DV5E 4X62E 1FWKA 1FJGI 2E5LE 3QT7A 4JI0I 4DPTA 4MYUA 1Z5AA 5LMNE 2UUBE 1PIEA 4JI2E 3PYFA 4DR4I 4ED4A 1XMQE 1J5EE 5A2QC 1KTVA 2A2CA 4UT4A 4X66E 5L3JA 4DR6E 4WUCA 2NPFA 3J81Q 4GKJI 1DARA 4LFBE 3ZZUA 2UU9I 2BM0A 1KIJA 4GKKE 2UXCI 1KKHA 3T1HI 3V5RA 4NXMI 4DR3I 4WUBA 4FN5A 1VISA 4LF9I 3ZZTA 4FWHA 4DUZE 1ZXMA 4DV7E 3ZM7A 2R42A 4JI1I 2V2VA 4XTJA 1XNRI 5IWAI 3T1YI 4DR7E 1I94I 4M1KA 2HKEA 3V2UC 4FWDA 4HY1A 4HACA 4B3RE 4I3HA 3JAMC 2UUCE 1H7UA 2X7IA 2BV3A 2F4VI 1N33I 4DU8A 4JI3I 1ELOA 3PYDA 4K0KI 4DPUA 2ZM6I 2UXBE 4DR5I 2UUAE 5IT9C 1RR9A 4LFAE 4B3SE 4DV3E 2A2DA 2VQFI 4LFCI 4DR2I 3D4JA 4JI0E 4DXLA 4LF8I 4P52A 2HKJA 3QT6A 4RPFA 4JI4I 3ZKBA 4JYAE 5LMUI 2EFGA 3PYGA 5BR8I 2UXDI 4DR1E 3J80C 3F0NA 1N34E 4LF4I 1XMOI 1FI4A 1N0UA 3ZZ0A 1NZ0A 4B3MI 4X64I 3OTOE 4DV2E 1HNXE 1B63A 3J80Q 4DUYE 4JI5E 4EMDA 4PU9A 2VQEI 4LF7I 3LTOA 1N32I 2GS8A 1Z0EA 1XNQE 4WUDA 1FNMA 4AQYI 4NXNE 1UEKA 1HR0I 3T1HE 4USMA 4LF6I 1Z5BA 2HHHE 4OX9I 1IBME 3J81C 4DV4E 4B3TE 1HNZE 1IBKI 2V8PA 4JI7I 1PVGA 1S16A 4FW9A 1Z0WA 2HFUA 1EI1A 4JI8I 2XEXA 2VF3A 4DV5I 4X65E 4KHPI 2E5LI 4LF5E 3B8HA 3WU4A 1K47A 3B78A 2J7KA 4DU7A 3B82A 5LMNI 2UUBI 4DR5E 1MX0A 1H73A 4YY3E 4DV1E 1XMQI 2E1RA 2BM1A 4JG4A 1ZM3A 4ZVIA 1IBLE 1MU5A 4X66I 1ZM2A 1H7SA 4R1FA 4DV6E 3J7AM 4DR6I 5GMEA 4JV5E 4UTGA 4DV0E 4B3ME 4LFBI 1Z0VA 1QZRA 4JI6I 3H4LA 1FJGE 1FKAE 3HULA 2ZITA 4LF7E 1ZM4A 4USKA 3J7AG 4DUZI 4DV7I 4DR4E 3K17A 3LNUA 1NHIA 4DR7I 1ZM9A 1S4EA 4B3RI 1HNWI 4URLA 1PKPA 1WUUA 4HYMA 4FWGA 2HK2A 1NHJA 4GKJE 1RREA 4Z7CA 2UXBI 1FWLA 2UU9E 4JI8E 2UUAI 5GMDA 2UXCE 4LFAI 2WW4A 4DV3I 4B3SI 4DPYA 1ZXNA 4KHPE 4YHHI 4NXME 4DR3E 2DEIA 4LF9E 1N36I 1U2RA 1OJ4A 1A6FA 4JYAI 2V2ZA 4Z7YA 4JI1E 1XNRE 5IWAE 4DR1I 3T1YE 1N0VC 1I94E 1N34I 3LPSA 2ZBKB 3OTOI 4DV2I 1HNXI 4X62I 4PRXA 4PRVA 5LL6R 4DUYI 4JI5I 5A2QQ 2F4VE 1N33E 4JI3E 4K0KE 2ZM6E 3WU6A 4JI2I 2OI2A 1XNQI 2HFSA 2VQFE 4JI6E 4LFCE 4DR2E 4NXNI 1J5EI 4LF8E 2V34A 3K1JA 2HHHI 3M6AA 4JI4E 1B62A 1IBMI 3WU3A 5LMUE 4DV4I 3Q1QA 4B3TI 1HNZI 5BR8E 2HK3A 1D6TA 2UXDE 4MYTA 3CWVA 4LF4E 1XMOE 2X36A 3QT8A 2V2QA 4HXZA 4X64E 3PYEA 1BKNA 4GKKI 1HNWE 1MG7A 4HACB 4X65I 1Z0GA 3ZKDA 1Z59A 4DPXA 1NHHA 4LF5I 1XHKA 1Z0CA 2VQEE 1N32E 2R3VA 3JAMQ 4AQYE 4YY3I 1Z0TA 1HR0E 4DV1I 4P7AA 1H72C 2Q2EB 4YHHE 4LF6E 2DEJA 2CZ9A 1Z0BA 3GONA 1N36E 4OX9E 1H74A 4KQVA 3QT5A 5IT9Q 1IBLI 3WU5A 2AJ4A 4DPWA 5FLXC 2UUCI 1IBKE 4JI7E 4DV6I 2LJPA 5FLXQ 4JV5I 1EA6A 4DV0I 1Z5CA 1KVKA
chains in the Genus database with same CATH superfamily
4DV5E 4AIDA 2BA0D 1P42A 5DRPA 3P76A 4U3DA 4X62E 1FWKA 1FJGI 2E5LE 2NN6B 3QT7A 4JI0I 5C0XB 4DPTA 4NBQA 4MYUA 4ISAA 4LOMA 1Z5AA 5LMNE 3KRNA 2UUBE 1PIEA 4JI2E 3PYFA 4AIMA 2IOPA 2O1UA 4DR4I 4ED4A 2PNMA 1XMQE 1J5EE 2F1DA 5A2QC 1KTVA 3L7ZA 2A2CA 4UT4A 4X66E 5L3JA 4FW4A 2BA1D 1USUA 2BA1G 4DR6E 2O1TA 4WUCA 2NPFA 2C37B 3J81Q 2WNRA 1Y6ZA 1DARA 4GKJI 4LCFA 4LFBE 3ZZUA 2UU9I 1KIJA 2BM0A 2WNRB 4IFDE 4GKKE 4OO1E 2UXCI 3PRYA 1KKHA 3T1HI 3V5RA 5EL9A 2JEAA 3U1KA 4NXMI 4DR3I 4WUBA 4FN5A 1VISA 2O3ZA 4MQYA 4LF9I 2IERA 3CDJA 3ZZTA 4FWHA 4DUZE 1ZXMA 4DV7E 3ZM7A 3M7NG 4IFDA 2R42A 4JI1I 2V2VA 4XTJA 1XNRI 5IWAI 3T1YI 2C38A 4OO1A 4DR7E 1I94I 4M1KA 2HKEA 3V2UC 4MU0A 2CVEA 4FWDA 4HY1A 4HACA 1R6MA 4B3RE 4I3HA 3JAMC 4J3DA 4QNJA 2UUCE 2JEBA 1H7UA 1RHYA 1E3PA 2X7IA 2BV3A 2JEBB 2F4VI 4AM3A 1Y4SA 1N33I 4MDTA 4DU8A 4JI3I 1ELOA 3PYDA 4K0KI 4DPUA 2Z5BA 2ZM6I 2UXBE 4DR5I 5K36A 2UUAE 5IT9C 1RR9A 4LFAE 4DV3E 2A2DA 4B3SE 2VQFI 3UHMA 4LFCI 4DR2I 3D4JA 4JI0E 2O1VA 4DXLA 4LF8I 4P52A 2GO4A 2HKJA 2NN6E 3QT6A 2VESA 4RPFA 5C0XE 4JI4I 3ZKBA 4JYAE 4MU4A 5LMUI 2EFGA 5JEAE 3PYGA 5BR8I 2UXDI 2IESA 4DR1E 3J80C 1UDNA 3F0NA 3DD6A 1N34E 4LPFA 5FWKA 4LF4I 1XMOI 1FI4A 1N0UA 5DRQA 3ZZ0A 1NZ0A 4B3MI 2NN6A 4X64I 5C0XA 3OTOE 4DV2E 1HNXE 2BA0G 1B63A 2PO2A 3J80Q 4DUYE 4JI5E 3M85D 4EMDA 2PO2B 5JEAA 4IFDF 5JEAB 4PU9A 2VQEI 4LF7I 3LTOA 1N32I 4OO1F 2GS8A 1YHCA 3GLLA 4IFDC 1Z0EA 1XNQE 4QNKA 4WUDA 1FNMA 4OO1C 4AQYI 1VI7A 4NXNE 1UEKA 4N3OA 1HR0I 3T1HE 4USMA 4LF6I 1Z5BA 2PNLA 4MU1A 2HHHE 3P3EA 4OX9I 1IBME 3J81C 1OYRA 4DV4E 4B3TE 3U1YA 1HNZE 1IBKI 2V8PA 4IS9A 4JI7I 2C37A 5K36F 5DNXA 5K36C 1PVGA 1S16A 4FW9A 3P3GA 4BA2A 1Z0WA 2HFUA 1EI1A 4FW7A 4JI8I 2C39B 4BA2B 2JE6A 2VF3A 2XEXA 4DV5I 3GMEA 4X65E 4KHPI 2JE6B 2E5LI 4LF5E 3B8HA 3WU4A 1K47A 3B78A 2J7KA 4DU7A 2O1WA 3B82A 5LMNI 4IFDD 5DRRA 2WP8B 2UUBI 4OO1D 4DR5E 4MU3A 1MX0A 1H73A 4YY3E 5EKWA 2NN6F 4DV1E 5C0XF 1XMQI 2NN6C 5C0XC 2E1RA 2BM1A 4JG4A 1ZM3A 4ZVIA 5JEAF 1IBLE 1MU5A 4X66I 1ZM2A 5JEAC 1H7SA 3CDIA 5ELWA 4R1FA 4DV6E 1OYSA 3J7AM 5K36D 4DR6I 3P3CA 2BR2A 5GMEA 4JV5E 2PNZA 2BR2B 4UTGA 4GQUA 1Y4UA 4DV0E 4B3ME 4LFBI 2Z5EA 2PNZB 1Z0VA 1QZRA 4JI6I 4IZJA 3H4LA 1FJGE 1FKAE 4IZJB 4FW6A 3HULA 1E3HA 2ZITA 4LF7E 1ZM4A 4USKA 3J7AG 4DUZI 4DV7I 4DR4E 3K17A 3LNUA 2NN6D 5C0XD 1UDSA 1NHIA 4DR7I 1ZM9A 5JEAD 1S4EA 4B3RI 3H1CA 1HNWI 4URLA 3M85G 1PKPA 1WUUA 4HYMA 4FWGA 2HK2A 2J65A 1NHJA 4BA1B 4GKJE 1RREA 2PO0A 4Z7CA 2UXBI 1FWLA 2UU9E 4JI8E 2UUAI 5GMDA 2PO0B 2UXCE 2CG9A 2WW4A 4DV3I 4B3SI 4DPYA 4LFAI 4FW5A 1ZXNA 4KHPE 4YHHI 4NXME 4DR3E 2GO3A 2DEIA 4LF9E 1N36I 1U2RA 2PO1A 1OJ4A 3Q6MA 1A6FA 4JYAI 2V2ZA 1HK7A 4Z7YA 2PO1B 3K85A 3PS3A 4JI1E 1XNRE 5IWAE 4DR1I 3T1YE 1N0VC 2C39A 1I94E 1N34I 3LPSA 2ZBKB 3GCMA 2GQ0A 3OTOI 4DV2I 1HNXI 3L7ZB 4X62I 4PRXA 4PRVA 5LL6R 4DUYI 4JI5I 1UDQA 5A2QQ 2F4VE 2WP8A 3PS1A 1N33E 4JI3E 4K0KE 1Y5YA 3Q6NA 2ZM6E 3WU6A 4JI2I 2OI2A 4U3BA 1XNQI 2CGEA 2HFSA 2VQFE 3NZKA 4JI6E 4LFCE 4DR2E 4NXNI 3PS2A 1XXEA 1J5EI 1Y60A 4LF8E 1R6LA 2V34A 3K1JA 3P06A 2HHHI 2AE8A 3M6AA 4JI4E 4LCHA 1B62A 2JEAB 1IBMI 1UDOA 3WU3A 5LMUE 4DV4I 3Q1QA 4B3TI 1HNZI 5DNLA 5BR8E 2HK3A 3M7ND 1D6TA 2UXDE 4MYTA 3CWVA 4OKGA 1YH8A 4IZJD 5DROA 3B4TA 4LF4E 1XMOE 2X36A 3QT8A 4IFDB 2V2QA 5K36E 4HXZA 2C38B 4OO1B 4X64E 3PYEA 1BKNA 4GKKI 1HNWE 1MG7A 4HACB 4X65I 1Z0GA 3ZKDA 1Z59A 4DPXA 1NHHA 4LF5I 1XHKA 1Z0CA 2VQEE 1N32E 2R3VA 3JAMQ 4FW3A 1OYPA 2Z5CA 4AQYE 2Z5BB 4IZKA 4YY3I 2Z5CB 1Z0TA 5K36B 1HR0E 4DV1I 4P7AA 1H72C 2Q2EB 4IZKB 4YHHE 4LF6E 2DEJA 2CZ9A 1Z0BA 3GONA 1N36E 4OX9E 1H74A 4KQVA 3QT5A 5IT9Q 2JT2A 1IBLI 3WU5A 2AJ4A 4DPWA 3HJCA 5FLXC 2UUCI 1IBKE 4JI7E 4DV6I 2IOQA 4BA1A 1USVA 3HKMA 4LCGA 2LJPA 5FLXQ 4JV5I 1EA6A 4OZEA 4DV0I 1Z5CA 1KVKA
chains in the Genus database with same CATH topology
4DV5E 4X62E 1FWKA 1FJGI 2E5LE 3QT7A 4JI0I 4DPTA 4MYUA 1Z5AA 5LMNE 2UUBE 1PIEA 4JI2E 3PYFA 2IOPA 2O1UA 4DR4I 4ED4A 2PNMA 1XMQE 1J5EE 5A2QC 1KTVA 2A2CA 4UT4A 4X66E 5L3JA 1USUA 4DR6E 2O1TA 4WUCA 2NPFA 3J81Q 1Y6ZA 1DARA 4GKJI 4LFBE 3ZZUA 2UU9I 2BM0A 1KIJA 4GKKE 2UXCI 3PRYA 1KKHA 3T1HI 3V5RA 4NXMI 4DR3I 4WUBA 4FN5A 1VISA 4LF9I 3ZZTA 4FWHA 4DUZE 1ZXMA 4DV7E 3ZM7A 2R42A 4JI1I 2V2VA 4XTJA 1XNRI 5IWAI 3T1YI 4DR7E 1I94I 4M1KA 2HKEA 3V2UC 4FWDA 4HY1A 4HACA 4B3RE 4I3HA 3JAMC 2UUCE 1H7UA 2X7IA 2BV3A 2F4VI 1Y4SA 1N33I 4DU8A 4JI3I 1ELOA 3PYDA 4K0KI 4DPUA 2Z5BA 2ZM6I 2UXBE 4DR5I 2UUAE 5IT9C 1RR9A 4LFAE 4DV3E 2A2DA 4B3SE 2VQFI 4LFCI 4DR2I 3D4JA 4JI0E 2O1VA 4DXLA 4LF8I 4P52A 2HKJA 3QT6A 4RPFA 4JI4I 3ZKBA 4JYAE 5LMUI 2EFGA 3PYGA 5BR8I 2UXDI 4DR1E 3J80C 3F0NA 1N34E 5FWKA 4LF4I 1XMOI 1FI4A 1N0UA 3ZZ0A 1NZ0A 4B3MI 4X64I 3OTOE 4DV2E 1HNXE 1B63A 3J80Q 4DUYE 4JI5E 4EMDA 4PU9A 2VQEI 4LF7I 3LTOA 1N32I 2GS8A 1Z0EA 1XNQE 4WUDA 1FNMA 4AQYI 4NXNE 1UEKA 4N3OA 1HR0I 3T1HE 4USMA 4LF6I 1Z5BA 2PNLA 2HHHE 4OX9I 1IBME 3J81C 4DV4E 4B3TE 1HNZE 1IBKI 2V8PA 4JI7I 1PVGA 1S16A 4FW9A 1Z0WA 2HFUA 1EI1A 4JI8I 2XEXA 2VF3A 4DV5I 4X65E 4KHPI 2E5LI 4LF5E 3B8HA 3WU4A 1K47A 3B78A 2J7KA 4DU7A 2O1WA 3B82A 5LMNI 2UUBI 4DR5E 1MX0A 1H73A 4YY3E 4DV1E 1XMQI 2E1RA 2BM1A 4JG4A 1ZM3A 4ZVIA 1IBLE 1MU5A 4X66I 1ZM2A 1H7SA 4R1FA 4DV6E 3J7AM 4DR6I 5GMEA 4JV5E 4UTGA 1Y4UA 4DV0E 4B3ME 4LFBI 2Z5EA 1Z0VA 1QZRA 4JI6I 4IZJA 3H4LA 1FJGE 1FKAE 4IZJB 3HULA 2ZITA 4LF7E 1ZM4A 4USKA 3J7AG 4DUZI 4DV7I 4DR4E 3K17A 3LNUA 1NHIA 4DR7I 1ZM9A 1S4EA 4B3RI 1HNWI 4URLA 1PKPA 1WUUA 4HYMA 4FWGA 2HK2A 1NHJA 4GKJE 1RREA 4Z7CA 2UXBI 1FWLA 2UU9E 4JI8E 2UUAI 5GMDA 2UXCE 2CG9A 2WW4A 4DV3I 4B3SI 4DPYA 4LFAI 1ZXNA 4KHPE 4YHHI 4NXME 4DR3E 2DEIA 4LF9E 1N36I 1U2RA 1OJ4A 3Q6MA 1A6FA 4JYAI 2V2ZA 1HK7A 4Z7YA 3K85A 4JI1E 1XNRE 5IWAE 4DR1I 3T1YE 1N0VC 1I94E 1N34I 3LPSA 2ZBKB 2GQ0A 3OTOI 4DV2I 1HNXI 4X62I 4PRXA 4PRVA 5LL6R 4DUYI 4JI5I 5A2QQ 2F4VE 1N33E 4JI3E 4K0KE 3Q6NA 2ZM6E 3WU6A 4JI2I 2OI2A 1XNQI 2CGEA 2HFSA 2VQFE 4JI6E 4LFCE 4DR2E 4NXNI 1J5EI 4LF8E 2V34A 3K1JA 3P06A 2HHHI 3M6AA 4JI4E 1B62A 1IBMI 3WU3A 5LMUE 4DV4I 3Q1QA 4B3TI 1HNZI 5BR8E 2HK3A 1D6TA 2UXDE 4MYTA 3CWVA 4IZJD 4LF4E 1XMOE 2X36A 3QT8A 2V2QA 4HXZA 4X64E 3PYEA 1BKNA 4GKKI 1HNWE 1MG7A 4HACB 4X65I 1Z0GA 3ZKDA 1Z59A 4DPXA 1NHHA 4LF5I 1XHKA 1Z0CA 2VQEE 1N32E 2R3VA 3JAMQ 2Z5CA 4AQYE 2Z5BB 4IZKA 4YY3I 2Z5CB 1Z0TA 1HR0E 4DV1I 4P7AA 1H72C 2Q2EB 4IZKB 4YHHE 4LF6E 2DEJA 2CZ9A 1Z0BA 3GONA 1N36E 4OX9E 1H74A 4KQVA 3QT5A 5IT9Q 1IBLI 3WU5A 2AJ4A 4DPWA 3HJCA 5FLXC 2UUCI 1IBKE 4JI7E 4DV6I 2IOQA 1USVA 2LJPA 5FLXQ 4JV5I 1EA6A 4DV0I 1Z5CA 1KVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 E;  4X62 E;  1FWK A;  1FJG I;  2E5L E;  3QT7 A;  4JI0 I;  4DPT A;  4MYU A;  1Z5A A;  5LMN E;  2UUB E;  1PIE A;  4JI2 E;  3PYF A;  4DR4 I;  4ED4 A;  1XMQ E;  1J5E E;  5A2Q C;  1KTV A;  2A2C A;  4UT4 A;  4X66 E;  5L3J A;  4DR6 E;  4WUC A;  2NPF A;  3J81 Q;  4GKJ I;  1DAR A;  4LFB E;  3ZZU A;  2UU9 I;  2BM0 A;  1KIJ A;  4GKK E;  2UXC I;  1KKH A;  3T1H I;  3V5R A;  4NXM I;  4DR3 I;  4WUB A;  4FN5 A;  1VIS A;  4LF9 I;  3ZZT A;  4FWH A;  4DUZ E;  1ZXM A;  4DV7 E;  3ZM7 A;  2R42 A;  4JI1 I;  2V2V A;  4XTJ A;  1XNR I;  5IWA I;  3T1Y I;  4DR7 E;  1I94 I;  4M1K A;  2HKE A;  3V2U C;  4FWD A;  4HY1 A;  4HAC A;  4B3R E;  4I3H A;  3JAM C;  2UUC E;  1H7U A;  2X7I A;  2BV3 A;  2F4V I;  1N33 I;  4DU8 A;  4JI3 I;  1ELO A;  3PYD A;  4K0K I;  4DPU A;  2ZM6 I;  2UXB E;  4DR5 I;  2UUA E;  5IT9 C;  1RR9 A;  4LFA E;  4B3S E;  4DV3 E;  2A2D A;  2VQF I;  4LFC I;  4DR2 I;  3D4J A;  4JI0 E;  4DXL A;  4LF8 I;  4P52 A;  2HKJ A;  3QT6 A;  4RPF A;  4JI4 I;  3ZKB A;  4JYA E;  5LMU I;  2EFG A;  3PYG A;  5BR8 I;  2UXD I;  4DR1 E;  3J80 C;  3F0N A;  1N34 E;  4LF4 I;  1XMO I;  1FI4 A;  1N0U A;  3ZZ0 A;  1NZ0 A;  4B3M I;  4X64 I;  3OTO E;  4DV2 E;  1HNX E;  1B63 A;  3J80 Q;  4DUY E;  4JI5 E;  4EMD A;  4PU9 A;  2VQE I;  4LF7 I;  3LTO A;  1N32 I;  2GS8 A;  1Z0E A;  1XNQ E;  4WUD A;  1FNM A;  4AQY I;  4NXN E;  1UEK A;  1HR0 I;  3T1H E;  4USM A;  4LF6 I;  1Z5B A;  2HHH E;  4OX9 I;  1IBM E;  3J81 C;  4DV4 E;  4B3T E;  1HNZ E;  1IBK I;  2V8P A;  4JI7 I;  1PVG A;  1S16 A;  4FW9 A;  1Z0W A;  2HFU A;  1EI1 A;  4JI8 I;  2XEX A;  2VF3 A;  4DV5 I;  4X65 E;  4KHP I;  2E5L I;  4LF5 E;  3B8H A;  3WU4 A;  1K47 A;  3B78 A;  2J7K A;  4DU7 A;  3B82 A;  5LMN I;  2UUB I;  4DR5 E;  1MX0 A;  1H73 A;  4YY3 E;  4DV1 E;  1XMQ I;  2E1R A;  2BM1 A;  4JG4 A;  1ZM3 A;  4ZVI A;  1IBL E;  1MU5 A;  4X66 I;  1ZM2 A;  1H7S A;  4R1F A;  4DV6 E;  3J7A M;  4DR6 I;  5GME A;  4JV5 E;  4UTG A;  4DV0 E;  4B3M E;  4LFB I;  1Z0V A;  1QZR A;  4JI6 I;  3H4L A;  1FJG E;  1FKA E;  3HUL A;  2ZIT A;  4LF7 E;  1ZM4 A;  4USK A;  3J7A G;  4DUZ I;  4DV7 I;  4DR4 E;  3K17 A;  3LNU A;  1NHI A;  4DR7 I;  1ZM9 A;  1S4E A;  4B3R I;  1HNW I;  4URL A;  1PKP A;  1WUU A;  4HYM A;  4FWG A;  2HK2 A;  1NHJ A;  4GKJ E;  1RRE A;  4Z7C A;  2UXB I;  1FWL A;  2UU9 E;  4JI8 E;  2UUA I;  5GMD A;  2UXC E;  4LFA I;  2WW4 A;  4DV3 I;  4B3S I;  4DPY A;  1ZXN A;  4KHP E;  4YHH I;  4NXM E;  4DR3 E;  2DEI A;  4LF9 E;  1N36 I;  1U2R A;  1OJ4 A;  1A6F A;  4JYA I;  2V2Z A;  4Z7Y A;  4JI1 E;  1XNR E;  5IWA E;  4DR1 I;  3T1Y E;  1N0V C;  1I94 E;  1N34 I;  3LPS A;  2ZBK B;  3OTO I;  4DV2 I;  1HNX I;  4X62 I;  4PRX A;  4PRV A;  5LL6 R;  4DUY I;  4JI5 I;  5A2Q Q;  2F4V E;  1N33 E;  4JI3 E;  4K0K E;  2ZM6 E;  3WU6 A;  4JI2 I;  2OI2 A;  1XNQ I;  2HFS A;  2VQF E;  4JI6 E;  4LFC E;  4DR2 E;  4NXN I;  1J5E I;  4LF8 E;  2V34 A;  3K1J A;  2HHH I;  3M6A A;  4JI4 E;  1B62 A;  1IBM I;  3WU3 A;  5LMU E;  4DV4 I;  3Q1Q A;  4B3T I;  1HNZ I;  5BR8 E;  2HK3 A;  1D6T A;  2UXD E;  4MYT A;  3CWV A;  4LF4 E;  1XMO E;  2X36 A;  3QT8 A;  2V2Q A;  4HXZ A;  4X64 E;  3PYE A;  1BKN A;  4GKK I;  1HNW E;  1MG7 A;  4HAC B;  4X65 I;  1Z0G A;  3ZKD A;  1Z59 A;  4DPX A;  1NHH A;  4LF5 I;  1XHK A;  1Z0C A;  2VQE E;  1N32 E;  2R3V A;  3JAM Q;  4AQY E;  4YY3 I;  1Z0T A;  1HR0 E;  4DV1 I;  4P7A A;  1H72 C;  2Q2E B;  4YHH E;  4LF6 E;  2DEJ A;  2CZ9 A;  1Z0B A;  3GON A;  1N36 E;  4OX9 E;  1H74 A;  4KQV A;  3QT5 A;  5IT9 Q;  1IBL I;  3WU5 A;  2AJ4 A;  4DPW A;  5FLX C;  2UUC I;  1IBK E;  4JI7 E;  4DV6 I;  2LJP A;  5FLX Q;  4JV5 I;  1EA6 A;  4DV0 I;  1Z5C A;  1KVK A; 
#chains in the Genus database with same CATH topology
 4DV5 E;  4AID A;  2BA0 D;  1P42 A;  5DRP A;  3P76 A;  4U3D A;  4X62 E;  1FWK A;  1FJG I;  2E5L E;  2NN6 B;  3QT7 A;  4JI0 I;  5C0X B;  4DPT A;  4NBQ A;  4MYU A;  4ISA A;  4LOM A;  1Z5A A;  5LMN E;  3KRN A;  2UUB E;  1PIE A;  4JI2 E;  3PYF A;  4AIM A;  2IOP A;  2O1U A;  4DR4 I;  4ED4 A;  2PNM A;  1XMQ E;  1J5E E;  2F1D A;  5A2Q C;  1KTV A;  3L7Z A;  2A2C A;  4UT4 A;  4X66 E;  5L3J A;  4FW4 A;  2BA1 D;  1USU A;  2BA1 G;  4DR6 E;  2O1T A;  4WUC A;  2NPF A;  2C37 B;  3J81 Q;  2WNR A;  1Y6Z A;  1DAR A;  4GKJ I;  4LCF A;  4LFB E;  3ZZU A;  2UU9 I;  1KIJ A;  2BM0 A;  2WNR B;  4IFD E;  4GKK E;  4OO1 E;  2UXC I;  3PRY A;  1KKH A;  3T1H I;  3V5R A;  5EL9 A;  2JEA A;  3U1K A;  4NXM I;  4DR3 I;  4WUB A;  4FN5 A;  1VIS A;  2O3Z A;  4MQY A;  4LF9 I;  2IER A;  3CDJ A;  3ZZT A;  4FWH A;  4DUZ E;  1ZXM A;  4DV7 E;  3ZM7 A;  3M7N G;  4IFD A;  2R42 A;  4JI1 I;  2V2V A;  4XTJ A;  1XNR I;  5IWA I;  3T1Y I;  2C38 A;  4OO1 A;  4DR7 E;  1I94 I;  4M1K A;  2HKE A;  3V2U C;  4MU0 A;  2CVE A;  4FWD A;  4HY1 A;  4HAC A;  1R6M A;  4B3R E;  4I3H A;  3JAM C;  4J3D A;  4QNJ A;  2UUC E;  2JEB A;  1H7U A;  1RHY A;  1E3P A;  2X7I A;  2BV3 A;  2JEB B;  2F4V I;  4AM3 A;  1Y4S A;  1N33 I;  4MDT A;  4DU8 A;  4JI3 I;  1ELO A;  3PYD A;  4K0K I;  4DPU A;  2Z5B A;  2ZM6 I;  2UXB E;  4DR5 I;  5K36 A;  2UUA E;  5IT9 C;  1RR9 A;  4LFA E;  4DV3 E;  2A2D A;  4B3S E;  2VQF I;  3UHM A;  4LFC I;  4DR2 I;  3D4J A;  4JI0 E;  2O1V A;  4DXL A;  4LF8 I;  4P52 A;  2GO4 A;  2HKJ A;  2NN6 E;  3QT6 A;  2VES A;  4RPF A;  5C0X E;  4JI4 I;  3ZKB A;  4JYA E;  4MU4 A;  5LMU I;  2EFG A;  5JEA E;  3PYG A;  5BR8 I;  2UXD I;  2IES A;  4DR1 E;  3J80 C;  1UDN A;  3F0N A;  3DD6 A;  1N34 E;  4LPF A;  5FWK A;  4LF4 I;  1XMO I;  1FI4 A;  1N0U A;  5DRQ A;  3ZZ0 A;  1NZ0 A;  4B3M I;  2NN6 A;  4X64 I;  5C0X A;  3OTO E;  4DV2 E;  1HNX E;  2BA0 G;  1B63 A;  2PO2 A;  3J80 Q;  4DUY E;  4JI5 E;  3M85 D;  4EMD A;  2PO2 B;  5JEA A;  4IFD F;  5JEA B;  4PU9 A;  2VQE I;  4LF7 I;  3LTO A;  1N32 I;  4OO1 F;  2GS8 A;  1YHC A;  3GLL A;  4IFD C;  1Z0E A;  1XNQ E;  4QNK A;  4WUD A;  1FNM A;  4OO1 C;  4AQY I;  1VI7 A;  4NXN E;  1UEK A;  4N3O A;  1HR0 I;  3T1H E;  4USM A;  4LF6 I;  1Z5B A;  2PNL A;  4MU1 A;  2HHH E;  3P3E A;  4OX9 I;  1IBM E;  3J81 C;  1OYR A;  4DV4 E;  4B3T E;  3U1Y A;  1HNZ E;  1IBK I;  2V8P A;  4IS9 A;  4JI7 I;  2C37 A;  5K36 F;  5DNX A;  5K36 C;  1PVG A;  1S16 A;  4FW9 A;  3P3G A;  4BA2 A;  1Z0W A;  2HFU A;  1EI1 A;  4FW7 A;  4JI8 I;  2C39 B;  4BA2 B;  2JE6 A;  2VF3 A;  2XEX A;  4DV5 I;  3GME A;  4X65 E;  4KHP I;  2JE6 B;  2E5L I;  4LF5 E;  3B8H A;  3WU4 A;  1K47 A;  3B78 A;  2J7K A;  4DU7 A;  2O1W A;  3B82 A;  5LMN I;  4IFD D;  5DRR A;  2WP8 B;  2UUB I;  4OO1 D;  4DR5 E;  4MU3 A;  1MX0 A;  1H73 A;  4YY3 E;  5EKW A;  2NN6 F;  4DV1 E;  5C0X F;  1XMQ I;  2NN6 C;  5C0X C;  2E1R A;  2BM1 A;  4JG4 A;  1ZM3 A;  4ZVI A;  5JEA F;  1IBL E;  1MU5 A;  4X66 I;  1ZM2 A;  5JEA C;  1H7S A;  3CDI A;  5ELW A;  4R1F A;  4DV6 E;  1OYS A;  3J7A M;  5K36 D;  4DR6 I;  3P3C A;  2BR2 A;  5GME A;  4JV5 E;  2PNZ A;  2BR2 B;  4UTG A;  4GQU A;  1Y4U A;  4DV0 E;  4B3M E;  4LFB I;  2Z5E A;  2PNZ B;  1Z0V A;  1QZR A;  4JI6 I;  4IZJ A;  3H4L A;  1FJG E;  1FKA E;  4IZJ B;  4FW6 A;  3HUL A;  1E3H A;  2ZIT A;  4LF7 E;  1ZM4 A;  4USK A;  3J7A G;  4DUZ I;  4DV7 I;  4DR4 E;  3K17 A;  3LNU A;  2NN6 D;  5C0X D;  1UDS A;  1NHI A;  4DR7 I;  1ZM9 A;  5JEA D;  1S4E A;  4B3R I;  3H1C A;  1HNW I;  4URL A;  3M85 G;  1PKP A;  1WUU A;  4HYM A;  4FWG A;  2HK2 A;  2J65 A;  1NHJ A;  4BA1 B;  4GKJ E;  1RRE A;  2PO0 A;  4Z7C A;  2UXB I;  1FWL A;  2UU9 E;  4JI8 E;  2UUA I;  5GMD A;  2PO0 B;  2UXC E;  2CG9 A;  2WW4 A;  4DV3 I;  4B3S I;  4DPY A;  4LFA I;  4FW5 A;  1ZXN A;  4KHP E;  4YHH I;  4NXM E;  4DR3 E;  2GO3 A;  2DEI A;  4LF9 E;  1N36 I;  1U2R A;  2PO1 A;  1OJ4 A;  3Q6M A;  1A6F A;  4JYA I;  2V2Z A;  1HK7 A;  4Z7Y A;  2PO1 B;  3K85 A;  3PS3 A;  4JI1 E;  1XNR E;  5IWA E;  4DR1 I;  3T1Y E;  1N0V C;  2C39 A;  1I94 E;  1N34 I;  3LPS A;  2ZBK B;  3GCM A;  2GQ0 A;  3OTO I;  4DV2 I;  1HNX I;  3L7Z B;  4X62 I;  4PRX A;  4PRV A;  5LL6 R;  4DUY I;  4JI5 I;  1UDQ A;  5A2Q Q;  2F4V E;  2WP8 A;  3PS1 A;  1N33 E;  4JI3 E;  4K0K E;  1Y5Y A;  3Q6N A;  2ZM6 E;  3WU6 A;  4JI2 I;  2OI2 A;  4U3B A;  1XNQ I;  2CGE A;  2HFS A;  2VQF E;  3NZK A;  4JI6 E;  4LFC E;  4DR2 E;  4NXN I;  3PS2 A;  1XXE A;  1J5E I;  1Y60 A;  4LF8 E;  1R6L A;  2V34 A;  3K1J A;  3P06 A;  2HHH I;  2AE8 A;  3M6A A;  4JI4 E;  4LCH A;  1B62 A;  2JEA B;  1IBM I;  1UDO A;  3WU3 A;  5LMU E;  4DV4 I;  3Q1Q A;  4B3T I;  1HNZ I;  5DNL A;  5BR8 E;  2HK3 A;  3M7N D;  1D6T A;  2UXD E;  4MYT A;  3CWV A;  4OKG A;  1YH8 A;  4IZJ D;  5DRO A;  3B4T A;  4LF4 E;  1XMO E;  2X36 A;  3QT8 A;  4IFD B;  2V2Q A;  5K36 E;  4HXZ A;  2C38 B;  4OO1 B;  4X64 E;  3PYE A;  1BKN A;  4GKK I;  1HNW E;  1MG7 A;  4HAC B;  4X65 I;  1Z0G A;  3ZKD A;  1Z59 A;  4DPX A;  1NHH A;  4LF5 I;  1XHK A;  1Z0C A;  2VQE E;  1N32 E;  2R3V A;  3JAM Q;  4FW3 A;  1OYP A;  2Z5C A;  4AQY E;  2Z5B B;  4IZK A;  4YY3 I;  2Z5C B;  1Z0T A;  5K36 B;  1HR0 E;  4DV1 I;  4P7A A;  1H72 C;  2Q2E B;  4IZK B;  4YHH E;  4LF6 E;  2DEJ A;  2CZ9 A;  1Z0B A;  3GON A;  1N36 E;  4OX9 E;  1H74 A;  4KQV A;  3QT5 A;  5IT9 Q;  2JT2 A;  1IBL I;  3WU5 A;  2AJ4 A;  4DPW A;  3HJC A;  5FLX C;  2UUC I;  1IBK E;  4JI7 E;  4DV6 I;  2IOQ A;  4BA1 A;  1USV A;  3HKM A;  4LCG A;  2LJP A;  5FLX Q;  4JV5 I;  1EA6 A;  4OZE A;  4DV0 I;  1Z5C A;  1KVK A; 
#chains in the Genus database with same CATH homology
 4DV5 E;  4X62 E;  1FWK A;  1FJG I;  2E5L E;  3QT7 A;  4JI0 I;  4DPT A;  4MYU A;  1Z5A A;  5LMN E;  2UUB E;  1PIE A;  4JI2 E;  3PYF A;  2IOP A;  2O1U A;  4DR4 I;  4ED4 A;  2PNM A;  1XMQ E;  1J5E E;  5A2Q C;  1KTV A;  2A2C A;  4UT4 A;  4X66 E;  5L3J A;  1USU A;  4DR6 E;  2O1T A;  4WUC A;  2NPF A;  3J81 Q;  1Y6Z A;  1DAR A;  4GKJ I;  4LFB E;  3ZZU A;  2UU9 I;  2BM0 A;  1KIJ A;  4GKK E;  2UXC I;  3PRY A;  1KKH A;  3T1H I;  3V5R A;  4NXM I;  4DR3 I;  4WUB A;  4FN5 A;  1VIS A;  4LF9 I;  3ZZT A;  4FWH A;  4DUZ E;  1ZXM A;  4DV7 E;  3ZM7 A;  2R42 A;  4JI1 I;  2V2V A;  4XTJ A;  1XNR I;  5IWA I;  3T1Y I;  4DR7 E;  1I94 I;  4M1K A;  2HKE A;  3V2U C;  4FWD A;  4HY1 A;  4HAC A;  4B3R E;  4I3H A;  3JAM C;  2UUC E;  1H7U A;  2X7I A;  2BV3 A;  2F4V I;  1Y4S A;  1N33 I;  4DU8 A;  4JI3 I;  1ELO A;  3PYD A;  4K0K I;  4DPU A;  2Z5B A;  2ZM6 I;  2UXB E;  4DR5 I;  2UUA E;  5IT9 C;  1RR9 A;  4LFA E;  4DV3 E;  2A2D A;  4B3S E;  2VQF I;  4LFC I;  4DR2 I;  3D4J A;  4JI0 E;  2O1V A;  4DXL A;  4LF8 I;  4P52 A;  2HKJ A;  3QT6 A;  4RPF A;  4JI4 I;  3ZKB A;  4JYA E;  5LMU I;  2EFG A;  3PYG A;  5BR8 I;  2UXD I;  4DR1 E;  3J80 C;  3F0N A;  1N34 E;  5FWK A;  4LF4 I;  1XMO I;  1FI4 A;  1N0U A;  3ZZ0 A;  1NZ0 A;  4B3M I;  4X64 I;  3OTO E;  4DV2 E;  1HNX E;  1B63 A;  3J80 Q;  4DUY E;  4JI5 E;  4EMD A;  4PU9 A;  2VQE I;  4LF7 I;  3LTO A;  1N32 I;  2GS8 A;  1Z0E A;  1XNQ E;  4WUD A;  1FNM A;  4AQY I;  4NXN E;  1UEK A;  4N3O A;  1HR0 I;  3T1H E;  4USM A;  4LF6 I;  1Z5B A;  2PNL A;  2HHH E;  4OX9 I;  1IBM E;  3J81 C;  4DV4 E;  4B3T E;  1HNZ E;  1IBK I;  2V8P A;  4JI7 I;  1PVG A;  1S16 A;  4FW9 A;  1Z0W A;  2HFU A;  1EI1 A;  4JI8 I;  2XEX A;  2VF3 A;  4DV5 I;  4X65 E;  4KHP I;  2E5L I;  4LF5 E;  3B8H A;  3WU4 A;  1K47 A;  3B78 A;  2J7K A;  4DU7 A;  2O1W A;  3B82 A;  5LMN I;  2UUB I;  4DR5 E;  1MX0 A;  1H73 A;  4YY3 E;  4DV1 E;  1XMQ I;  2E1R A;  2BM1 A;  4JG4 A;  1ZM3 A;  4ZVI A;  1IBL E;  1MU5 A;  4X66 I;  1ZM2 A;  1H7S A;  4R1F A;  4DV6 E;  3J7A M;  4DR6 I;  5GME A;  4JV5 E;  4UTG A;  1Y4U A;  4DV0 E;  4B3M E;  4LFB I;  2Z5E A;  1Z0V A;  1QZR A;  4JI6 I;  4IZJ A;  3H4L A;  1FJG E;  1FKA E;  4IZJ B;  3HUL A;  2ZIT A;  4LF7 E;  1ZM4 A;  4USK A;  3J7A G;  4DUZ I;  4DV7 I;  4DR4 E;  3K17 A;  3LNU A;  1NHI A;  4DR7 I;  1ZM9 A;  1S4E A;  4B3R I;  1HNW I;  4URL A;  1PKP A;  1WUU A;  4HYM A;  4FWG A;  2HK2 A;  1NHJ A;  4GKJ E;  1RRE A;  4Z7C A;  2UXB I;  1FWL A;  2UU9 E;  4JI8 E;  2UUA I;  5GMD A;  2UXC E;  2CG9 A;  2WW4 A;  4DV3 I;  4B3S I;  4DPY A;  4LFA I;  1ZXN A;  4KHP E;  4YHH I;  4NXM E;  4DR3 E;  2DEI A;  4LF9 E;  1N36 I;  1U2R A;  1OJ4 A;  3Q6M A;  1A6F A;  4JYA I;  2V2Z A;  1HK7 A;  4Z7Y A;  3K85 A;  4JI1 E;  1XNR E;  5IWA E;  4DR1 I;  3T1Y E;  1N0V C;  1I94 E;  1N34 I;  3LPS A;  2ZBK B;  2GQ0 A;  3OTO I;  4DV2 I;  1HNX I;  4X62 I;  4PRX A;  4PRV A;  5LL6 R;  4DUY I;  4JI5 I;  5A2Q Q;  2F4V E;  1N33 E;  4JI3 E;  4K0K E;  3Q6N A;  2ZM6 E;  3WU6 A;  4JI2 I;  2OI2 A;  1XNQ I;  2CGE A;  2HFS A;  2VQF E;  4JI6 E;  4LFC E;  4DR2 E;  4NXN I;  1J5E I;  4LF8 E;  2V34 A;  3K1J A;  3P06 A;  2HHH I;  3M6A A;  4JI4 E;  1B62 A;  1IBM I;  3WU3 A;  5LMU E;  4DV4 I;  3Q1Q A;  4B3T I;  1HNZ I;  5BR8 E;  2HK3 A;  1D6T A;  2UXD E;  4MYT A;  3CWV A;  4IZJ D;  4LF4 E;  1XMO E;  2X36 A;  3QT8 A;  2V2Q A;  4HXZ A;  4X64 E;  3PYE A;  1BKN A;  4GKK I;  1HNW E;  1MG7 A;  4HAC B;  4X65 I;  1Z0G A;  3ZKD A;  1Z59 A;  4DPX A;  1NHH A;  4LF5 I;  1XHK A;  1Z0C A;  2VQE E;  1N32 E;  2R3V A;  3JAM Q;  2Z5C A;  4AQY E;  2Z5B B;  4IZK A;  4YY3 I;  2Z5C B;  1Z0T A;  1HR0 E;  4DV1 I;  4P7A A;  1H72 C;  2Q2E B;  4IZK B;  4YHH E;  4LF6 E;  2DEJ A;  2CZ9 A;  1Z0B A;  3GON A;  1N36 E;  4OX9 E;  1H74 A;  4KQV A;  3QT5 A;  5IT9 Q;  1IBL I;  3WU5 A;  2AJ4 A;  4DPW A;  3HJC A;  5FLX C;  2UUC I;  1IBK E;  4JI7 E;  4DV6 I;  2IOQ A;  1USV A;  2LJP A;  5FLX Q;  4JV5 I;  1EA6 A;  4DV0 I;  1Z5C A;  1KVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...