5IT9R

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
129
structure length
129
Chain Sequence
GRVRTKTVKRASKALIEKYYPKLTMDFQTNKRLCDEIATIQSKRLRNKIAGYTTHLMKRIQKGPVRGISFKLQEEERERKDQYVPDVSALDLSHSNDVLNVDTQTAELVNSLGLKLPLSVSSVSAVRDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
total genus 26
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2016-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.60.20 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Ribosomal protein S17e-like 5it9R01
5FLXR 3JAMR 5IT9R 3J7AW 5A2QR 3J81R 3J80R 1RQ6A
chains in the Genus database with same CATH superfamily
5FLXR 2F5EA 2H09A 2P0TA 1DDNA 2MVTA 1G3YA 5A2QR 3J81R 2MUNA 2EV6A 1XCVA 3R60A 3J80R 1G3SA 4HV6A 2QQ9A 3JAMR 2QQBA 1F5TA 1BI3A 4HV5A 3GLXA 2ISZA 1BI1A 4HX4A 2MZ4A 1ON1A 2HYGD 3R61A 2EV5A 1U8RA 1BI2A 4O5VA 3J7AW 2F5FA 1G3TA 1DPRA 2HYFA 4O6JA 4HX8A 1B1BA 1C0WA 2X98A 2F5CA 1ON2A 2TDXA 2QQAA 2DTRA 1BI0A 1RQ6A 1G3WA 2M35A 1P92A 5IT9R 1FWZA 4HX7A 2F5DA 3A52A 2EV0A 1FX7A
chains in the Genus database with same CATH topology
5FLXR 3JAMR 5IT9R 3J7AW 5A2QR 3J81R 3J80R 1RQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX R;  3JAM R;  5IT9 R;  3J7A W;  5A2Q R;  3J81 R;  3J80 R;  1RQ6 A; 
#chains in the Genus database with same CATH topology
 5FLX R;  2F5E A;  2H09 A;  2P0T A;  1DDN A;  2MVT A;  1G3Y A;  5A2Q R;  3J81 R;  2MUN A;  2EV6 A;  1XCV A;  3R60 A;  3J80 R;  1G3S A;  4HV6 A;  2QQ9 A;  3JAM R;  2QQB A;  1F5T A;  1BI3 A;  4HV5 A;  3GLX A;  2ISZ A;  1BI1 A;  4HX4 A;  2MZ4 A;  1ON1 A;  2HYG D;  3R61 A;  2EV5 A;  1U8R A;  1BI2 A;  4O5V A;  3J7A W;  2F5F A;  1G3T A;  1DPR A;  2HYF A;  4O6J A;  4HX8 A;  1B1B A;  1C0W A;  2X98 A;  2F5C A;  1ON2 A;  2TDX A;  2QQA A;  2DTR A;  1BI0 A;  1RQ6 A;  1G3W A;  2M35 A;  1P92 A;  5IT9 R;  1FWZ A;  4HX7 A;  2F5D A;  3A52 A;  2EV0 A;  1FX7 A; 
#chains in the Genus database with same CATH homology
 5FLX R;  3JAM R;  5IT9 R;  3J7A W;  5A2Q R;  3J81 R;  3J80 R;  1RQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...