5IT9W

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
129
Chain Sequence
TRTSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIADVEKWTANLLPARQFGYVILTTSAGIMDHEEAHRKHVSGKILGFVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
molecule keywords Ribosomal protein uS2
total genus 29
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 5it9W01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 5it9W02
4B3MH 5IWAH 5LMNH 4PDBA 4LFCH 2UXCH 5IT9W 4KHPH 4K0KH 4B3SH 1HNZH 4JI5H 1FJGH 4YY3H 1IBMH 5BR8H 2UUAH 1S03G 1FKAH 3J7AK 2UXBH 4DV1H 1N36H 3T1HH 4B3RH 3T1YH 4X66H 4JYAH 4LF9H 2VQFH 1XNQH 4YHHH 4JI2H 1SEIA 4LF5H 4LF4H 2ZM6H 2F4VH 3J80W 1AN7A 4JI7H 4JI1H 4LFBH 5LL6b 1J5EH 4JV5H 2E5LH 4JI0H 4DUZH 4DR2H 1XMOH 4GKJH 4DV6H 1XNRH 5FLXW 4DR7H 4GKKH 4X64H 5LMUH 4DR4H 3J81W 2UXDH 2UU9H 1XMQH 4AQYH 2UUCH 1N33H 4LF6H 2VQEH 4X62H 4LF8H 4JI8H 1IBKH 1HNWH 1I94H 1I6UA 5A2QW 1HR0H 4NXMH 4DV2H 4DR1H 4DV4H 4DV3H 3JAMW 4JI4H 4JI6H 4JI3H 4DV5H 1HNXH 2HHHH 4DR5H 4LFAH 3RF2A 1N32H 4DR6H 4DV7H 4DR3H 1N34H 4NXNH 2UUBH 3OTOH 4LF7H 4OX9H 4B3TH 4DUYH 1IBLH 4X65H 4DV0H
chains in the Genus database with same CATH superfamily
4B3MH 3H20A 3GLKA 4PDBA 5JQWA 4UCRA 1GSAA 2R8KA 1BXRA 5KT7A 2UXCH 3RBDA 4IFDG 4KHPH 1Y1VA 1ZZJA 4EYIB 1Z2IA 3H0GG 1EC6A 4O2AF 4K0KH 4M7EA 4QJFA 3BG5A 5KT2A 4A3IG 3V6JA 3MWDA 1HNZH 3OUZA 4RB3C 4JI5H 1ZHSA 1WCMG 3K3PA 4AYBA 5L1IA 4CC5A 5L9XA 2UUAH 2X0SA 4EG0A 3MR6A 3NCVA 5DT9A 4Q0YA 4MA0A 5CAEB 2FLLA 2YZMA 5IP9G 4OD6A 4I55F 4TV9F 3HOVG 2HVRA 2R7LA 2JEAI 5KFAA 4EGQA 2RGRA 5D1OB 2YU9A 2YYAA 3MFIA 4EYHB 2C2DA 1VBIA 1WCMA 4B3RH 1VS0A 2NN6G 2CTKA 3LP8A 4WBNF 3TQTA 5L1JA 4JYAH 4Q43A 4H8AA 4ZQIA 1ULZA 3OHBA 4FM9A 1JKJB 2CQYA 4JVHA 1T36A 3BA8A 3KAKA 1F0XA 3LWBA 4ED1A 2R92A 1X0AA 3TIGA 1E4EA 3L4JA 2F4VH 2CWFA 5KFVA 2ZQEA 1Z2NX 5KFYA 4YQWA 2W9BB 1UG8A 5GONF 3QZ8A 2SCUB 4A3EG 4LFBH 2OH2A 4TUYF 2J6UA 4ED3A 2UVRA 2E2IA 1RJQA 4YJ2F 2IA6A 1XMOH 2WE6A 4G08A 1KBLA 3OSPA 2QYZA 5IP7G 4J9OA 1S0OA 3HKZA 5KFBA 4GC6A 1SFOA 2G8YA 4ECTA 4XYMB 5FD5A 4MV4A 1EYZA 4XX0B 3PR4A 5C0XG 2CTFA 4R7RA 4C2MA 5IYCG 1N48A 4GLXA 4A93G 4J9KA 4LIJA 1DIKA 1VAJA 4J9MA 3RFCA 4IAJA 4DR4H 4CC6A 3J81W 1B04A 3KAJA 4TV8F 2RF4A 2LTLA 2R87A 1WHRA 2LF0A 2C2RA 4O3SA 5DQHA 5DLGA 1S20A 2Z0SA 1XMQH 1EHIA 3GQCA 4FJSA 1DGSA 3I0PA 1B6RA 2JZXA 2PBZA 4J9NA 1UC8A 2PMZA 4JV2A 2E2HA 5KFLA 2VPQA 3HOXG 2ANNA 4LF8H 4JI8H 2FKLA 4RU9A 5A2QW 4YR3A 4HNUA 1B33N 4ME6A 4NXMH 2NU6B 5BMVF 2FK3A 1AUVA 4DR1H 2BQUA 3HOYG 2W57A 3DF7A 1W93A 4EEQA 4RNMA 2W8KA 5DG7A 4NBQA 2FLPA 1KJ8A 1KEEA 5KFTA 4JI4H 1V51A 2JA6G 3RV4A 2ASJA 2V4QA 4BBSG 3RTXA 5DGAA 1WE8A 4O3RA 3KDKA 3T5LA 2NU7B 2CTMA 1EUCB 4R8UA 5KFIA 5KT4A 5L1LA 1DT4A 1T3NA 2AXYA 2NVXA 1V9PA 5C5JA 4LFAH 2QNDA 3RB0A 2VA3A 4QW8A 2Y0SE 1GGOA 1XRHA 4DV7H 2ANRA 2PY9A 3BABA 3PW5A 1N34H 1M0WA 3G8CA 3JRWA 4ZHQF 2JA8G 3N40P 3V69A 3MWEA 3HBLA 4HNVA 3GTOA 4YAJB 2VQDA 4DL5A 4DL7A 5BPHA 5J2TF 1K1QA 5CA0F 1ZETA 4B8CD 4FU0A 3M9MB 3RIZA 5JUMA 3R23A 2DPIA 3EPGA 4NZRM 5IWAH 2FMRA 5LYJF 2XC9A 2W9CB 1JIHA 3MR3A 2C35B 2R93A 2V58A 3GABA 1J4WA 5IT9W 2NU8B 2W6ZA 4Q8FA 2B63A 1I3QA 3ORQA 3SB1A 4R8UB 2W6QA 5DG8A 1Z2PX 4RB0A 5KFDA 3HXLA 3UQ8A 5KG0A 1FJGH 3GIQA 2W6PA 4O3NA 1IBMH 3PW7A 2V4RA 2Q2UA 5C8YF 3GIPA 3GTKA 5CA1F 4DV1H 1RYRA 5D1PA 3VPCA 1I7NA 2I80A 4MV1A 5KFQA 2C00A 4DLKA 2CWHA 3PO2G 4U6PA 5FJ8G 5C1OA 3GTLA 3ETHA 4YBZB 3RUPA 2VQFH 3H3VH 1XNQH 5J2UF 4QWDA 4YHHH 2JA9A 4QWEA 2UVUA 1SEIA 1E4GT 1MZBA 2J6TA 1PQXA 3N43B 2O4CA 3CQZA 3WNZA 4LF4H 4UCVA 2W8LA 3RAQA 4QMFB 4RZQA 1AN7A 4JI7H 3GIKA 5KFMA 3KXYT 3L2PA 1WH2A 3I4NG 5LP6F 4C5CA 4PWQA 5LL6b 1J5EH 4ECXA 5KFOA 1B6SA 4IR1A 2X06A 4ECRA 5DQIA 3UFXB 5FPOA 1WSCA 2VR1A 4GKJH 2UVVA 1RK5A 1VBHA 3HB9A 3GIJA 4DV6H 2HGSA 3GILA 2AU0A 2C28A 3CVZA 1X4NA 3AEVB 4IZOA 1XNRH 2MCTA 2W7OA 5C3EG 1IOWA 4F4XA 2VA2A 4QIWA 4X64H 5KG4A 1K1GA 2W7PA 2V59A 3K3VA 3V4SA 4ECQA 1S0NA 1GSOA 3Q8QB 2HJWA 4RNOA 4C5BA 2YQRA 2ZDQA 1X9ZA 4QWBA 4WD3A 2ZDGA 4YP3A 1PX2A 2Q2TA 2ASLA 4OO1G 1KJJA 3GIIA 4EFBA 3G6VA 4FBUA 2RDIA 3N8DA 3OUUA 5EZYF 3PN1A 2HVSA 1Y1WA 3AYHB 3LMLA 1I6UA 2XCAA 3BJYA 1VIHA 2NUAB 3MFHA 3R5HA 3GTPA 2QK4A 3RGXA 2K1HA 3K5HA 4Q44A 3V4ZA 2AQ4A 1SYXB 4XYLB 4MAMA 5DQGA 1S0MA 1Z2OX 5H80A 4B8TA 3TQ1A 4JI6H 2CZGA 1BJTA 4M9UA 1GSHA 2PQUA 1UC9A 4LMYA 2AGPA 3UOEA 4JI3H 5JVLA 3GTMA 3R5XA 2YS7A 4A3FG 2HHHH 5LOVF 4MV6A 4EBEA 4LSXA 3RAXA 3QD7X 4EGJA 1N32H 3ETJA 2CW7A 4O4IF 3RB6A 3BA9A 4DR6H 4A3GG 4IHJF 4AYBE 2R7ZA 2CPQA 4J9LA 5EWGA 2IMWP 4BXXG 3FMAA 4NXNH 3PZPA 4LF7H 2JA7A 5KG6A 4ED8A 3I4MG 2WTFA 1R9TA 4OX9H 3M4IA 5D1OA 4DUYH 4HQ6A 1Y1VG 4DV0H 2XGPA 4MA5A 5I47A 3RV3A 4WALA 5KT3A 1O75A 3OSSD 2JEGA 2FJZA 3C0FB 5LMNH 2J9GA 5JEAG 2R6FA 4LFCH 1K1SA 4JUZA 4QW9A 1ZZKA 1A0IA 2JA7G 3L7ZC 2XD4A 1WVNA 2I8CA 4TQRA 2MJHA 4RAYA 4RB2C 2C22A 3WO0A 4LH6A 2JEBI 2W70A 4UCSA 3KDGA 4AM3A 4WANA 4B3SH 2M05A 2XGQA 2JA6A 2YW2A 2VOBA 2OWOA 4YY3H 3QFFA 5BR8H 1ODHA 1KJQA 1RJPA 2BL5A 2P2RA 4IRKA 5EWEA 3PW2A 1FKAH 3J7AK 2W6MA 1N36H 3MJFA 5L1KA 2Y3MA 3N44B 2R7NA 2PVPA 1UNNC 1DTJA 2JA5G 1GO3E 4F4WA 2R93G 2WAQE 3BQ2A 3T1YH 1ZTGA 2M8WA 3FKIG 4X66H 1TWCA 4LF9H 3WO1A 1X9NA 5C1PA 2CKZB 4U7CA 4JI2H 2W71A 4MTEA 2RGVA 5KG2A 1C30A 4A3CG 5KFGA 3GKUA 4IRCA 4E9JA 4J9PA 3KALA 2ZM6H 5K36G 2A1SA 3TINA 4RZRA 4ED6A 3BQ1A 5DG9A 2PT7G 4ECZA 3U9TA 1WTJA 2R86A 1WR2A 2DLNA 1ZZIA 5BPFA 2YZNA 2O03A 5KFUA 2B63G 5KFZA 2AGOA 1JLLB 1TAEA 1TA8A 1PK8A 2FP4B 3KHGA 3GTQA 4O3QA 2ATLA 3SE7A 5EWFA 5FLMG 3PO3G 4J9RA 4DR2H 2M6QA 3GV8B 2FK2A 5DLFA 3N6XA 4LSAA 1MSZA 2GLTA 3GTGA 5K2MA 3QZ7A 4O3PA 5FPRA 4RB1A 1V9NA 3U9SA 2R7ZG 2JE6I 4MV3A 5CB4F 4A3KG 2YRWA 5LMUH 1S9FA 2Y0SA 4YR0A 4F4ZA 4Q8EA 1JX4A 4EBCA 3HOUG 2R85A 3GTJA 1DV2A 2BA0A 4FBTA 2BQ3A 2VUGA 2HH2A 4O2BF 2WAQA 5KG7A 2WDTA 4AQYH 3T5KA 1N33H 1KHMA 4LF6H 1X4MA 2CW8A 2VQEH 2FPIB 1J5KA 1VKZA 4XZ3B 2R8IA 2FLNA 1KJIA 3KHRA 2FPHX 4FS1A 4IRDA 1IBKH 1I94H 4BA2I 4UCUA 2V5AA 4EBDA 4ED7A 4DL3A 1ZQ7A 2VKCA 4LH7A 4J9SA 3PW4A 5KFRA 2CTJA 5KFPA 4ZI7F 3G6YA 4AIMA 4C5AA 4DV4H 1CE8A 2IP4A 4DV3H 4RUCA 4APMA 1TWHA 5C44G 3Q8PB 4FS2A 3OETA 5KFFA 3ORRA 3M9OB 4ECWA 5KG5A 1TWFA 4A3DG 3NGDA 2JEJA 3IG0A 2GPWA 4DV5H 1HNXH 3E5NA 3EYYA 3Q8RB 2WYOA 4A3JG 4YR2A 2DGRA 4DL2A 3H40A 3SI8A 1NXUA 3RF2A 5KT5A 2J6SA 2JA5A 1BNCA 5F9LA 1EUDB 2V9WA 4NLGA 4QWCA 1GYFA 1A9XA 4E4TA 4HR7A 3BQ0A 3H0GA 4OCHA 2AGQA 4DR3H 2WB1E 3RB4A 3EPIA 2CPMA 4I7HA 1SCUB 1IOVA 2JEFA 3Q1KA 2R8GA 4YAKB 2WB1A 1V8CA 1AUXA 4B3TH 3K5IA 1TWAA 2VPSA 2W6NA 4UCOA 4A2AA 4X65H 2R92G 5KFXA 4MTDA 1XDNA 1CS0A 2DWCA 1TUAA 4YJ3F 2E3UA 4O4LF 2OPUA 4JVYA 4RUAA 4ECSA 2ALZA 2BR0A 2YRXA 5KG3A 1V4YA 1Y1WG 1VIGA 1ZHQA 3T5JA 3HOWG 3U1KA 3T5HA 1S97A 4O4HF 5JVDF 2W9BA 1S10A 1CQJB 2DZDA 3F8NA 5KFWA 1E4EB 3FKIA 3JZIA 3IN5A 2RDJA 4ZOLF 3PR5B 2I87A 4IR9A 3HOZG 4A3LG 4UCTA 3GV7B 1JXLA 4HYKA 3VPBA 5F9NA 4ED0A 5EOYA 2OLSA 2ASDA 2FFMA 3H4DA 4IWXA 4BA1I 1S03G 2UXBH 4J9QA 2HVQA 1I50A 3RGZA 4MV7A 3T1HH 3PW0A 5JH7F 3EZJA 1DV1A 4RAZA 3GIMA 2FK1A 4EEYA 5FD6A 3OSNA 3GV5B 3KTMA 4BWSC 2OPVA 4FJUA 2R82A 5LXTF 3Q8SB 4O3OA 3VMMA 3MR5A 4ECVA 1GLVA 4I4TF 3V6KA 4LF5H 5KFHA 2HH3A 2LTMA 3J80W 2R7KA 2CTEA 5T14A 4RNNA 5KFJA 3R5FA 4JI1H 2W6OA 1M0TA 2FPPB 4BY7G 2ZJTA 4JV5H 3I12A 3H4BA 2P0AA 5HV6A 2CTLA 2R8JA 2E5LH 4JI0H 1EZ1A 5D8DA 5KFSA 3KHLA 2XCLA 2FE3A 1I7LA 4DUZH 4QIWE 2R84A 2KSWA 3BAAA 2DIKA 1Y14B 1OWTA 2YZGA 4ED2A 4I50F 4F4YA 3RJ0A 4A2BA 5FLXW 4DR7H 3MWMA 4UFZA 5KFKA 4GKKH 2C2EA 1L2ZA 4F50A 1T94A 4ECYA 3VKEA 3PVXA 4IWYA 4G3IA 2NVYA 2D9IA 4BY1G 2FPGB 4MV8A 4EFEA 4A3MG 2PN1A 2UXDH 1KC7A 3MR2A 4YB8B 4QWAA 2UU9H 5KFNA 4L1KA 2UVWA 2JEIA 5C4XG 2BQRA 1CQIB 2UUCH 1N56A 1C3OA 2PMZE 3TIIA 5KX5F 5LA6F 3RB3A 4X62H 2R7MA 2ZDHA 3V6HA 3JSNA 3Q2OA 1HNWH 4MV9A 2YL2A 5HBRB 1HR0H 1KJ9A 5KFEA 3GIDA 4NZTM 4HNTA 1P8LA 4DV2H 2LRRA 2IBKA 3GR5A 5KG1A 1M6VA 3FAUA 3VPDA 4EC5A 2VUMA 2W9CA 1W96A 2NU9B 4DL6A 3JAMW 4Q45A 5EDWA 2GPSA 1FVIA 1E4FT 3JSLA 3N42B 4J0MA 3M9NB 3KHHA 4A3BG 4GC7A 2FB9A 3N41B 5KKNB 3JRXA 3OHAA 2R8HA 4ECUA 4DL4A 3HKZE 4JV0A 5IYBG 4DR5H 1JDEA 3G6XA 3L4KA 2XIGA 2DPJA 2VUMG 1JDBB 4JV1A 1RK6A 5KT6A 5IYDG 2XCPA 4BBRG 4ETSA 2FMAA 5DGBA 1RJRA 5KFCA 1K83A 5IYZF 2UUBH 3OTOH 2YCHA 1VBGA 1RYSA 3FDSA 2W9AA 4TQSA 1S68A 1TWGA 1M7JA 1IBLH 4Y8VB 2JVZA 3RBEA 2YS6A 1BGWA
chains in the Genus database with same CATH topology
4B8CD 4B3MH 3H20A 3RIZA 3OSSD 4NZRM 5IWAH 1O75A 3C0FB 5LMNH 4PDBA 4LFCH 4UCRA 1A0IA 1ZHQA 3GABA 2UXCH 5IT9W 4RAYA 4RB2C 4KHPH 4LH6A 3F8NA 4K0KH 4UCSA 4M7EA 3KDGA 3SB1A 4B3SH 4RB3C 1HNZH 1Z2PX 4RB0A 4JI5H 1ZHSA 3HXLA 4UCTA 3UQ8A 4CC5A 1FJGH 2VOBA 2OWOA 4YY3H 1IBMH 5BR8H 2UUAH 5EOYA 1ODHA 3NCVA 5DT9A 4Q0YA 2Q2UA 1S03G 1FKAH 3J7AK 2UXBH 4OD6A 4DV1H 1N36H 2Y3MA 3N44B 2HVRA 5D1PA 2RGRA 5D1OB 2HVQA 3RGZA 4MV7A 3T1HH 3EZJA 4B3RH 3T1YH 1VS0A 4RAZA 5FD6A 4X66H 4BWSC 4JYAH 4LF9H 4FM9A 2VQFH 3BA8A 1XNQH 1X9NA 3KAKA 4YHHH 1F0XA 4JI2H 1SEIA 1E4GT 1MZBA 4MTEA 2RGVA 3N43B 2O4CA 4LF5H 4E9JA 3L4JA 3KALA 4LF4H 2ZM6H 2F4VH 2ZQEA 1Z2NX 3J80W 4UCVA 4RZQA 1AN7A 4JI7H 2PT7G 4JI1H 3KXYT 3L2PA 1M0TA 1WH2A 4LFBH 2O03A 2ZJTA 5LL6b 1J5EH 4JV5H 1TAEA 1TA8A 2E5LH 4JI0H 2FE3A 4DUZH 4DR2H 4G08A 1XMOH 2WE6A 5FPOA 3N6XA 4GKJH 4LSAA 2KSWA 3BAAA 5FD5A 4DV6H 2HGSA 3RJ0A 3CVZA 4A2BA 5FPRA 4R7RA 4RB1A 1XNRH 5FLXW 4DR7H 2MCTA 3MWMA 4UFZA 4GLXA 4GKKH 1L2ZA 4X64H 4IAJA 5LMUH 4DR4H 4CC6A 3K3VA 3J81W 2D9IA 1B04A 3KAJA 4EFEA 2UXDH 2LF0A 1X9ZA 2UU9H 2Q2TA 2VUGA 1XMQH 4AQYH 2UUCH 1N33H 1DGSA 4LF6H 2CW8A 2WDTA 4EFBA 4X62H 2VQEH 3PN1A 4LF8H 2HVSA 4JI8H 2FPHX 3JSNA 4MV9A 1IBKH 1HNWH 1I94H 3LMLA 1I6UA 5A2QW 1HR0H 4UCUA 4NZTM 4NXMH 1P8LA 2VKCA 4LH7A 4DV2H 4DR1H 2W57A 3GR5A 3DF7A 4EEQA 3RGXA 3FAUA 4DV4H 4EC5A 4DV3H 4APMA 1SYXB 3OETA 3JAMW 1Z2OX 4JI4H 4JI6H 1BJTA 1FVIA 1E4FT 3JSLA 3N42B 4LMYA 3RTXA 4JI3H 4J0MA 3N41B 3KDKA 3IG0A 4DV5H 1HNXH 2HHHH 3EYYA 2WYOA 4LSXA 3QD7X 1V9PA 4DR5H 4LFAH 3L4KA 3RF2A 1N32H 2XIGA 2CW7A 3BA9A 4DR6H 1GYFA 4ETSA 4DV7H 4OCHA 3BABA 4DR3H 3FMAA 1N34H 4NXNH 1M0WA 2UUBH 3OTOH 4I7HA 2YCHA 4LF7H 3N40P 1S68A 4OX9H 3M4IA 4B3TH 4DUYH 1IBLH 2VPSA 4UCOA 5D1OA 4A2AA 4X65H 4MTDA 4DV0H 1XDNA 1BGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3M H;  5IWA H;  5LMN H;  4PDB A;  4LFC H;  2UXC H;  5IT9 W;  4KHP H;  4K0K H;  4B3S H;  1HNZ H;  4JI5 H;  1FJG H;  4YY3 H;  1IBM H;  5BR8 H;  2UUA H;  1S03 G;  1FKA H;  3J7A K;  2UXB H;  4DV1 H;  1N36 H;  3T1H H;  4B3R H;  3T1Y H;  4X66 H;  4JYA H;  4LF9 H;  2VQF H;  1XNQ H;  4YHH H;  4JI2 H;  1SEI A;  4LF5 H;  4LF4 H;  2ZM6 H;  2F4V H;  3J80 W;  1AN7 A;  4JI7 H;  4JI1 H;  4LFB H;  5LL6 b;  1J5E H;  4JV5 H;  2E5L H;  4JI0 H;  4DUZ H;  4DR2 H;  1XMO H;  4GKJ H;  4DV6 H;  1XNR H;  5FLX W;  4DR7 H;  4GKK H;  4X64 H;  5LMU H;  4DR4 H;  3J81 W;  2UXD H;  2UU9 H;  1XMQ H;  4AQY H;  2UUC H;  1N33 H;  4LF6 H;  2VQE H;  4X62 H;  4LF8 H;  4JI8 H;  1IBK H;  1HNW H;  1I94 H;  1I6U A;  5A2Q W;  1HR0 H;  4NXM H;  4DV2 H;  4DR1 H;  4DV4 H;  4DV3 H;  3JAM W;  4JI4 H;  4JI6 H;  4JI3 H;  4DV5 H;  1HNX H;  2HHH H;  4DR5 H;  4LFA H;  3RF2 A;  1N32 H;  4DR6 H;  4DV7 H;  4DR3 H;  1N34 H;  4NXN H;  2UUB H;  3OTO H;  4LF7 H;  4OX9 H;  4B3T H;  4DUY H;  1IBL H;  4X65 H;  4DV0 H; 
#chains in the Genus database with same CATH topology
 4B3M H;  3H20 A;  3GLK A;  4PDB A;  5JQW A;  4UCR A;  1GSA A;  2R8K A;  1BXR A;  5KT7 A;  2UXC H;  3RBD A;  4IFD G;  4KHP H;  1Y1V A;  1ZZJ A;  4EYI B;  1Z2I A;  3H0G G;  1EC6 A;  4O2A F;  4K0K H;  4M7E A;  4QJF A;  3BG5 A;  5KT2 A;  4A3I G;  3V6J A;  3MWD A;  1HNZ H;  3OUZ A;  4RB3 C;  4JI5 H;  1ZHS A;  1WCM G;  3K3P A;  4AYB A;  5L1I A;  4CC5 A;  5L9X A;  2UUA H;  2X0S A;  4EG0 A;  3MR6 A;  3NCV A;  5DT9 A;  4Q0Y A;  4MA0 A;  5CAE B;  2FLL A;  2YZM A;  5IP9 G;  4OD6 A;  4I55 F;  4TV9 F;  3HOV G;  2HVR A;  2R7L A;  2JEA I;  5KFA A;  4EGQ A;  2RGR A;  5D1O B;  2YU9 A;  2YYA A;  3MFI A;  4EYH B;  2C2D A;  1VBI A;  1WCM A;  4B3R H;  1VS0 A;  2NN6 G;  2CTK A;  3LP8 A;  4WBN F;  3TQT A;  5L1J A;  4JYA H;  4Q43 A;  4H8A A;  4ZQI A;  1ULZ A;  3OHB A;  4FM9 A;  1JKJ B;  2CQY A;  4JVH A;  1T36 A;  3BA8 A;  3KAK A;  1F0X A;  3LWB A;  4ED1 A;  2R92 A;  1X0A A;  3TIG A;  1E4E A;  3L4J A;  2F4V H;  2CWF A;  5KFV A;  2ZQE A;  1Z2N X;  5KFY A;  4YQW A;  2W9B B;  1UG8 A;  5GON F;  3QZ8 A;  2SCU B;  4A3E G;  4LFB H;  2OH2 A;  4TUY F;  2J6U A;  4ED3 A;  2UVR A;  2E2I A;  1RJQ A;  4YJ2 F;  2IA6 A;  1XMO H;  2WE6 A;  4G08 A;  1KBL A;  3OSP A;  2QYZ A;  5IP7 G;  4J9O A;  1S0O A;  3HKZ A;  5KFB A;  4GC6 A;  1SFO A;  2G8Y A;  4ECT A;  4XYM B;  5FD5 A;  4MV4 A;  1EYZ A;  4XX0 B;  3PR4 A;  5C0X G;  2CTF A;  4R7R A;  4C2M A;  5IYC G;  1N48 A;  4GLX A;  4A93 G;  4J9K A;  4LIJ A;  1DIK A;  1VAJ A;  4J9M A;  3RFC A;  4IAJ A;  4DR4 H;  4CC6 A;  3J81 W;  1B04 A;  3KAJ A;  4TV8 F;  2RF4 A;  2LTL A;  2R87 A;  1WHR A;  2LF0 A;  2C2R A;  4O3S A;  5DQH A;  5DLG A;  1S20 A;  2Z0S A;  1XMQ H;  1EHI A;  3GQC A;  4FJS A;  1DGS A;  3I0P A;  1B6R A;  2JZX A;  2PBZ A;  4J9N A;  1UC8 A;  2PMZ A;  4JV2 A;  2E2H A;  5KFL A;  2VPQ A;  3HOX G;  2ANN A;  4LF8 H;  4JI8 H;  2FKL A;  4RU9 A;  5A2Q W;  4YR3 A;  4HNU A;  1B33 N;  4ME6 A;  4NXM H;  2NU6 B;  5BMV F;  2FK3 A;  1AUV A;  4DR1 H;  2BQU A;  3HOY G;  2W57 A;  3DF7 A;  1W93 A;  4EEQ A;  4RNM A;  2W8K A;  5DG7 A;  4NBQ A;  2FLP A;  1KJ8 A;  1KEE A;  5KFT A;  4JI4 H;  1V51 A;  2JA6 G;  3RV4 A;  2ASJ A;  2V4Q A;  4BBS G;  3RTX A;  5DGA A;  1WE8 A;  4O3R A;  3KDK A;  3T5L A;  2NU7 B;  2CTM A;  1EUC B;  4R8U A;  5KFI A;  5KT4 A;  5L1L A;  1DT4 A;  1T3N A;  2AXY A;  2NVX A;  1V9P A;  5C5J A;  4LFA H;  2QND A;  3RB0 A;  2VA3 A;  4QW8 A;  2Y0S E;  1GGO A;  1XRH A;  4DV7 H;  2ANR A;  2PY9 A;  3BAB A;  3PW5 A;  1N34 H;  1M0W A;  3G8C A;  3JRW A;  4ZHQ F;  2JA8 G;  3N40 P;  3V69 A;  3MWE A;  3HBL A;  4HNV A;  3GTO A;  4YAJ B;  2VQD A;  4DL5 A;  4DL7 A;  5BPH A;  5J2T F;  1K1Q A;  5CA0 F;  1ZET A;  4B8C D;  4FU0 A;  3M9M B;  3RIZ A;  5JUM A;  3R23 A;  2DPI A;  3EPG A;  4NZR M;  5IWA H;  2FMR A;  5LYJ F;  2XC9 A;  2W9C B;  1JIH A;  3MR3 A;  2C35 B;  2R93 A;  2V58 A;  3GAB A;  1J4W A;  5IT9 W;  2NU8 B;  2W6Z A;  4Q8F A;  2B63 A;  1I3Q A;  3ORQ A;  3SB1 A;  4R8U B;  2W6Q A;  5DG8 A;  1Z2P X;  4RB0 A;  5KFD A;  3HXL A;  3UQ8 A;  5KG0 A;  1FJG H;  3GIQ A;  2W6P A;  4O3N A;  1IBM H;  3PW7 A;  2V4R A;  2Q2U A;  5C8Y F;  3GIP A;  3GTK A;  5CA1 F;  4DV1 H;  1RYR A;  5D1P A;  3VPC A;  1I7N A;  2I80 A;  4MV1 A;  5KFQ A;  2C00 A;  4DLK A;  2CWH A;  3PO2 G;  4U6P A;  5FJ8 G;  5C1O A;  3GTL A;  3ETH A;  4YBZ B;  3RUP A;  2VQF H;  3H3V H;  1XNQ H;  5J2U F;  4QWD A;  4YHH H;  2JA9 A;  4QWE A;  2UVU A;  1SEI A;  1E4G T;  1MZB A;  2J6T A;  1PQX A;  3N43 B;  2O4C A;  3CQZ A;  3WNZ A;  4LF4 H;  4UCV A;  2W8L A;  3RAQ A;  4QMF B;  4RZQ A;  1AN7 A;  4JI7 H;  3GIK A;  5KFM A;  3KXY T;  3L2P A;  1WH2 A;  3I4N G;  5LP6 F;  4C5C A;  4PWQ A;  5LL6 b;  1J5E H;  4ECX A;  5KFO A;  1B6S A;  4IR1 A;  2X06 A;  4ECR A;  5DQI A;  3UFX B;  5FPO A;  1WSC A;  2VR1 A;  4GKJ H;  2UVV A;  1RK5 A;  1VBH A;  3HB9 A;  3GIJ A;  4DV6 H;  2HGS A;  3GIL A;  2AU0 A;  2C28 A;  3CVZ A;  1X4N A;  3AEV B;  4IZO A;  1XNR H;  2MCT A;  2W7O A;  5C3E G;  1IOW A;  4F4X A;  2VA2 A;  4QIW A;  4X64 H;  5KG4 A;  1K1G A;  2W7P A;  2V59 A;  3K3V A;  3V4S A;  4ECQ A;  1S0N A;  1GSO A;  3Q8Q B;  2HJW A;  4RNO A;  4C5B A;  2YQR A;  2ZDQ A;  1X9Z A;  4QWB A;  4WD3 A;  2ZDG A;  4YP3 A;  1PX2 A;  2Q2T A;  2ASL A;  4OO1 G;  1KJJ A;  3GII A;  4EFB A;  3G6V A;  4FBU A;  2RDI A;  3N8D A;  3OUU A;  5EZY F;  3PN1 A;  2HVS A;  1Y1W A;  3AYH B;  3LML A;  1I6U A;  2XCA A;  3BJY A;  1VIH A;  2NUA B;  3MFH A;  3R5H A;  3GTP A;  2QK4 A;  3RGX A;  2K1H A;  3K5H A;  4Q44 A;  3V4Z A;  2AQ4 A;  1SYX B;  4XYL B;  4MAM A;  5DQG A;  1S0M A;  1Z2O X;  5H80 A;  4B8T A;  3TQ1 A;  4JI6 H;  2CZG A;  1BJT A;  4M9U A;  1GSH A;  2PQU A;  1UC9 A;  4LMY A;  2AGP A;  3UOE A;  4JI3 H;  5JVL A;  3GTM A;  3R5X A;  2YS7 A;  4A3F G;  2HHH H;  5LOV F;  4MV6 A;  4EBE A;  4LSX A;  3RAX A;  3QD7 X;  4EGJ A;  1N32 H;  3ETJ A;  2CW7 A;  4O4I F;  3RB6 A;  3BA9 A;  4DR6 H;  4A3G G;  4IHJ F;  4AYB E;  2R7Z A;  2CPQ A;  4J9L A;  5EWG A;  2IMW P;  4BXX G;  3FMA A;  4NXN H;  3PZP A;  4LF7 H;  2JA7 A;  5KG6 A;  4ED8 A;  3I4M G;  2WTF A;  1R9T A;  4OX9 H;  3M4I A;  5D1O A;  4DUY H;  4HQ6 A;  1Y1V G;  4DV0 H;  2XGP A;  4MA5 A;  5I47 A;  3RV3 A;  4WAL A;  5KT3 A;  1O75 A;  3OSS D;  2JEG A;  2FJZ A;  3C0F B;  5LMN H;  2J9G A;  5JEA G;  2R6F A;  4LFC H;  1K1S A;  4JUZ A;  4QW9 A;  1ZZK A;  1A0I A;  2JA7 G;  3L7Z C;  2XD4 A;  1WVN A;  2I8C A;  4TQR A;  2MJH A;  4RAY A;  4RB2 C;  2C22 A;  3WO0 A;  4LH6 A;  2JEB I;  2W70 A;  4UCS A;  3KDG A;  4AM3 A;  4WAN A;  4B3S H;  2M05 A;  2XGQ A;  2JA6 A;  2YW2 A;  2VOB A;  2OWO A;  4YY3 H;  3QFF A;  5BR8 H;  1ODH A;  1KJQ A;  1RJP A;  2BL5 A;  2P2R A;  4IRK A;  5EWE A;  3PW2 A;  1FKA H;  3J7A K;  2W6M A;  1N36 H;  3MJF A;  5L1K A;  2Y3M A;  3N44 B;  2R7N A;  2PVP A;  1UNN C;  1DTJ A;  2JA5 G;  1GO3 E;  4F4W A;  2R93 G;  2WAQ E;  3BQ2 A;  3T1Y H;  1ZTG A;  2M8W A;  3FKI G;  4X66 H;  1TWC A;  4LF9 H;  3WO1 A;  1X9N A;  5C1P A;  2CKZ B;  4U7C A;  4JI2 H;  2W71 A;  4MTE A;  2RGV A;  5KG2 A;  1C30 A;  4A3C G;  5KFG A;  3GKU A;  4IRC A;  4E9J A;  4J9P A;  3KAL A;  2ZM6 H;  5K36 G;  2A1S A;  3TIN A;  4RZR A;  4ED6 A;  3BQ1 A;  5DG9 A;  2PT7 G;  4ECZ A;  3U9T A;  1WTJ A;  2R86 A;  1WR2 A;  2DLN A;  1ZZI A;  5BPF A;  2YZN A;  2O03 A;  5KFU A;  2B63 G;  5KFZ A;  2AGO A;  1JLL B;  1TAE A;  1TA8 A;  1PK8 A;  2FP4 B;  3KHG A;  3GTQ A;  4O3Q A;  2ATL A;  3SE7 A;  5EWF A;  5FLM G;  3PO3 G;  4J9R A;  4DR2 H;  2M6Q A;  3GV8 B;  2FK2 A;  5DLF A;  3N6X A;  4LSA A;  1MSZ A;  2GLT A;  3GTG A;  5K2M A;  3QZ7 A;  4O3P A;  5FPR A;  4RB1 A;  1V9N A;  3U9S A;  2R7Z G;  2JE6 I;  4MV3 A;  5CB4 F;  4A3K G;  2YRW A;  5LMU H;  1S9F A;  2Y0S A;  4YR0 A;  4F4Z A;  4Q8E A;  1JX4 A;  4EBC A;  3HOU G;  2R85 A;  3GTJ A;  1DV2 A;  2BA0 A;  4FBT A;  2BQ3 A;  2VUG A;  2HH2 A;  4O2B F;  2WAQ A;  5KG7 A;  2WDT A;  4AQY H;  3T5K A;  1N33 H;  1KHM A;  4LF6 H;  1X4M A;  2CW8 A;  2VQE H;  2FPI B;  1J5K A;  1VKZ A;  4XZ3 B;  2R8I A;  2FLN A;  1KJI A;  3KHR A;  2FPH X;  4FS1 A;  4IRD A;  1IBK H;  1I94 H;  4BA2 I;  4UCU A;  2V5A A;  4EBD A;  4ED7 A;  4DL3 A;  1ZQ7 A;  2VKC A;  4LH7 A;  4J9S A;  3PW4 A;  5KFR A;  2CTJ A;  5KFP A;  4ZI7 F;  3G6Y A;  4AIM A;  4C5A A;  4DV4 H;  1CE8 A;  2IP4 A;  4DV3 H;  4RUC A;  4APM A;  1TWH A;  5C44 G;  3Q8P B;  4FS2 A;  3OET A;  5KFF A;  3ORR A;  3M9O B;  4ECW A;  5KG5 A;  1TWF A;  4A3D G;  3NGD A;  2JEJ A;  3IG0 A;  2GPW A;  4DV5 H;  1HNX H;  3E5N A;  3EYY A;  3Q8R B;  2WYO A;  4A3J G;  4YR2 A;  2DGR A;  4DL2 A;  3H40 A;  3SI8 A;  1NXU A;  3RF2 A;  5KT5 A;  2J6S A;  2JA5 A;  1BNC A;  5F9L A;  1EUD B;  2V9W A;  4NLG A;  4QWC A;  1GYF A;  1A9X A;  4E4T A;  4HR7 A;  3BQ0 A;  3H0G A;  4OCH A;  2AGQ A;  4DR3 H;  2WB1 E;  3RB4 A;  3EPI A;  2CPM A;  4I7H A;  1SCU B;  1IOV A;  2JEF A;  3Q1K A;  2R8G A;  4YAK B;  2WB1 A;  1V8C A;  1AUX A;  4B3T H;  3K5I A;  1TWA A;  2VPS A;  2W6N A;  4UCO A;  4A2A A;  4X65 H;  2R92 G;  5KFX A;  4MTD A;  1XDN A;  1CS0 A;  2DWC A;  1TUA A;  4YJ3 F;  2E3U A;  4O4L F;  2OPU A;  4JVY A;  4RUA A;  4ECS A;  2ALZ A;  2BR0 A;  2YRX A;  5KG3 A;  1V4Y A;  1Y1W G;  1VIG A;  1ZHQ A;  3T5J A;  3HOW G;  3U1K A;  3T5H A;  1S97 A;  4O4H F;  5JVD F;  2W9B A;  1S10 A;  1CQJ B;  2DZD A;  3F8N A;  5KFW A;  1E4E B;  3FKI A;  3JZI A;  3IN5 A;  2RDJ A;  4ZOL F;  3PR5 B;  2I87 A;  4IR9 A;  3HOZ G;  4A3L G;  4UCT A;  3GV7 B;  1JXL A;  4HYK A;  3VPB A;  5F9N A;  4ED0 A;  5EOY A;  2OLS A;  2ASD A;  2FFM A;  3H4D A;  4IWX A;  4BA1 I;  1S03 G;  2UXB H;  4J9Q A;  2HVQ A;  1I50 A;  3RGZ A;  4MV7 A;  3T1H H;  3PW0 A;  5JH7 F;  3EZJ A;  1DV1 A;  4RAZ A;  3GIM A;  2FK1 A;  4EEY A;  5FD6 A;  3OSN A;  3GV5 B;  3KTM A;  4BWS C;  2OPV A;  4FJU A;  2R82 A;  5LXT F;  3Q8S B;  4O3O A;  3VMM A;  3MR5 A;  4ECV A;  1GLV A;  4I4T F;  3V6K A;  4LF5 H;  5KFH A;  2HH3 A;  2LTM A;  3J80 W;  2R7K A;  2CTE A;  5T14 A;  4RNN A;  5KFJ A;  3R5F A;  4JI1 H;  2W6O A;  1M0T A;  2FPP B;  4BY7 G;  2ZJT A;  4JV5 H;  3I12 A;  3H4B A;  2P0A A;  5HV6 A;  2CTL A;  2R8J A;  2E5L H;  4JI0 H;  1EZ1 A;  5D8D A;  5KFS A;  3KHL A;  2XCL A;  2FE3 A;  1I7L A;  4DUZ H;  4QIW E;  2R84 A;  2KSW A;  3BAA A;  2DIK A;  1Y14 B;  1OWT A;  2YZG A;  4ED2 A;  4I50 F;  4F4Y A;  3RJ0 A;  4A2B A;  5FLX W;  4DR7 H;  3MWM A;  4UFZ A;  5KFK A;  4GKK H;  2C2E A;  1L2Z A;  4F50 A;  1T94 A;  4ECY A;  3VKE A;  3PVX A;  4IWY A;  4G3I A;  2NVY A;  2D9I A;  4BY1 G;  2FPG B;  4MV8 A;  4EFE A;  4A3M G;  2PN1 A;  2UXD H;  1KC7 A;  3MR2 A;  4YB8 B;  4QWA A;  2UU9 H;  5KFN A;  4L1K A;  2UVW A;  2JEI A;  5C4X G;  2BQR A;  1CQI B;  2UUC H;  1N56 A;  1C3O A;  2PMZ E;  3TII A;  5KX5 F;  5LA6 F;  3RB3 A;  4X62 H;  2R7M A;  2ZDH A;  3V6H A;  3JSN A;  3Q2O A;  1HNW H;  4MV9 A;  2YL2 A;  5HBR B;  1HR0 H;  1KJ9 A;  5KFE A;  3GID A;  4NZT M;  4HNT A;  1P8L A;  4DV2 H;  2LRR A;  2IBK A;  3GR5 A;  5KG1 A;  1M6V A;  3FAU A;  3VPD A;  4EC5 A;  2VUM A;  2W9C A;  1W96 A;  2NU9 B;  4DL6 A;  3JAM W;  4Q45 A;  5EDW A;  2GPS A;  1FVI A;  1E4F T;  3JSL A;  3N42 B;  4J0M A;  3M9N B;  3KHH A;  4A3B G;  4GC7 A;  2FB9 A;  3N41 B;  5KKN B;  3JRX A;  3OHA A;  2R8H A;  4ECU A;  4DL4 A;  3HKZ E;  4JV0 A;  5IYB G;  4DR5 H;  1JDE A;  3G6X A;  3L4K A;  2XIG A;  2DPJ A;  2VUM G;  1JDB B;  4JV1 A;  1RK6 A;  5KT6 A;  5IYD G;  2XCP A;  4BBR G;  4ETS A;  2FMA A;  5DGB A;  1RJR A;  5KFC A;  1K83 A;  5IYZ F;  2UUB H;  3OTO H;  2YCH A;  1VBG A;  1RYS A;  3FDS A;  2W9A A;  4TQS A;  1S68 A;  1TWG A;  1M7J A;  1IBL H;  4Y8V B;  2JVZ A;  3RBE A;  2YS6 A;  1BGW A; 
#chains in the Genus database with same CATH homology
 4B8C D;  4B3M H;  3H20 A;  3RIZ A;  3OSS D;  4NZR M;  5IWA H;  1O75 A;  3C0F B;  5LMN H;  4PDB A;  4LFC H;  4UCR A;  1A0I A;  1ZHQ A;  3GAB A;  2UXC H;  5IT9 W;  4RAY A;  4RB2 C;  4KHP H;  4LH6 A;  3F8N A;  4K0K H;  4UCS A;  4M7E A;  3KDG A;  3SB1 A;  4B3S H;  4RB3 C;  1HNZ H;  1Z2P X;  4RB0 A;  4JI5 H;  1ZHS A;  3HXL A;  4UCT A;  3UQ8 A;  4CC5 A;  1FJG H;  2VOB A;  2OWO A;  4YY3 H;  1IBM H;  5BR8 H;  2UUA H;  5EOY A;  1ODH A;  3NCV A;  5DT9 A;  4Q0Y A;  2Q2U A;  1S03 G;  1FKA H;  3J7A K;  2UXB H;  4OD6 A;  4DV1 H;  1N36 H;  2Y3M A;  3N44 B;  2HVR A;  5D1P A;  2RGR A;  5D1O B;  2HVQ A;  3RGZ A;  4MV7 A;  3T1H H;  3EZJ A;  4B3R H;  3T1Y H;  1VS0 A;  4RAZ A;  5FD6 A;  4X66 H;  4BWS C;  4JYA H;  4LF9 H;  4FM9 A;  2VQF H;  3BA8 A;  1XNQ H;  1X9N A;  3KAK A;  4YHH H;  1F0X A;  4JI2 H;  1SEI A;  1E4G T;  1MZB A;  4MTE A;  2RGV A;  3N43 B;  2O4C A;  4LF5 H;  4E9J A;  3L4J A;  3KAL A;  4LF4 H;  2ZM6 H;  2F4V H;  2ZQE A;  1Z2N X;  3J80 W;  4UCV A;  4RZQ A;  1AN7 A;  4JI7 H;  2PT7 G;  4JI1 H;  3KXY T;  3L2P A;  1M0T A;  1WH2 A;  4LFB H;  2O03 A;  2ZJT A;  5LL6 b;  1J5E H;  4JV5 H;  1TAE A;  1TA8 A;  2E5L H;  4JI0 H;  2FE3 A;  4DUZ H;  4DR2 H;  4G08 A;  1XMO H;  2WE6 A;  5FPO A;  3N6X A;  4GKJ H;  4LSA A;  2KSW A;  3BAA A;  5FD5 A;  4DV6 H;  2HGS A;  3RJ0 A;  3CVZ A;  4A2B A;  5FPR A;  4R7R A;  4RB1 A;  1XNR H;  5FLX W;  4DR7 H;  2MCT A;  3MWM A;  4UFZ A;  4GLX A;  4GKK H;  1L2Z A;  4X64 H;  4IAJ A;  5LMU H;  4DR4 H;  4CC6 A;  3K3V A;  3J81 W;  2D9I A;  1B04 A;  3KAJ A;  4EFE A;  2UXD H;  2LF0 A;  1X9Z A;  2UU9 H;  2Q2T A;  2VUG A;  1XMQ H;  4AQY H;  2UUC H;  1N33 H;  1DGS A;  4LF6 H;  2CW8 A;  2WDT A;  4EFB A;  4X62 H;  2VQE H;  3PN1 A;  4LF8 H;  2HVS A;  4JI8 H;  2FPH X;  3JSN A;  4MV9 A;  1IBK H;  1HNW H;  1I94 H;  3LML A;  1I6U A;  5A2Q W;  1HR0 H;  4UCU A;  4NZT M;  4NXM H;  1P8L A;  2VKC A;  4LH7 A;  4DV2 H;  4DR1 H;  2W57 A;  3GR5 A;  3DF7 A;  4EEQ A;  3RGX A;  3FAU A;  4DV4 H;  4EC5 A;  4DV3 H;  4APM A;  1SYX B;  3OET A;  3JAM W;  1Z2O X;  4JI4 H;  4JI6 H;  1BJT A;  1FVI A;  1E4F T;  3JSL A;  3N42 B;  4LMY A;  3RTX A;  4JI3 H;  4J0M A;  3N41 B;  3KDK A;  3IG0 A;  4DV5 H;  1HNX H;  2HHH H;  3EYY A;  2WYO A;  4LSX A;  3QD7 X;  1V9P A;  4DR5 H;  4LFA H;  3L4K A;  3RF2 A;  1N32 H;  2XIG A;  2CW7 A;  3BA9 A;  4DR6 H;  1GYF A;  4ETS A;  4DV7 H;  4OCH A;  3BAB A;  4DR3 H;  3FMA A;  1N34 H;  4NXN H;  1M0W A;  2UUB H;  3OTO H;  4I7H A;  2YCH A;  4LF7 H;  3N40 P;  1S68 A;  4OX9 H;  3M4I A;  4B3T H;  4DUY H;  1IBL H;  2VPS A;  4UCO A;  5D1O A;  4A2A A;  4X65 H;  4MTD A;  4DV0 H;  1XDN A;  1BGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...