5IT9W

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
129
Chain Sequence
b'TRTSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIADVEKWTANLLPARQFGYVILTTSAGIMDHEEAHRKHVSGKILGFVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
total genus 29
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 5it9W01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 5it9W02
4AQYH 4JI3H 4B3SH 4DV3H 4DR2H 4JI4H 4GKKH 1HR0H 4JI2H 1XMOH 1IBKH 1AN7A 4DV5H 1XMQH 4DR4H 3OTOH 4DV1H 5LMNH 2UUBH 5FLXW 4LFCH 1S03G 2E5LH 4JI8H 1SEIA 1I94H 4DUYH 2ZM6H 4B3MH 2UXDH 4DV0H 4DR6H 3T1YH 4DV6H 4DV7H 4K0KH 1N32H 2VQEH 3J7AK 1XNRH 4LFAH 1I6UA 2VQFH 2UXBH 1HNZH 3RF2A 5A2QW 4X65H 1IBMH 4LF4H 4JYAH 5LMUH 3T1HH 4B3RH 4DR5H 5IT9W 4NXNH 3J80W 4X62H 4JI1H 1FJGH 4DV2H 4YHHH 4X64H 4JI7H 1XNQH 4LF7H 5LL6b 4DR1H 4JV5H 1FKAH 3JAMW 4JI6H 1J5EH 4JI5H 4LFBH 2F4VH 5IWAH 5BR8H 3J81W 4KHPH 4JI0H 4GKJH 2HHHH 4DR7H 1HNXH 2UUAH 1N36H 4PDBA 1N34H 1N33H 4DV4H 4NXMH 4LF8H 1IBLH 4YY3H 4LF5H 4LF9H 4OX9H 4DR3H 4X66H 4LF6H 2UU9H 2UUCH 2UXCH 4DUZH 4B3TH 1HNWH
chains in the Genus database with same CATH superfamily
1I50A 5H80A 4JI3H 2ASJA 4B3SH 2XIGA 2W6ZA 2ZDHA 3BABA 5D1PA 4DV3H 5KG4A 4F50A 4ECVA 4JI4H 2SCUB 2YW2A 5KFFA 4EBCA 5FJ8G 4ED1A 1XMOH 4O4LF 1XMQH 2BQUA 4YAKB 3HOZG 4IRKA 4EEYA 4EFBA 5KG3A 4IR1A 2VUMG 4EGJA 5L1IA 2NUAB 3G6VA 5FLXW 2R8GA 1RYSA 1CQIB 4DL5A 4U6PA 2OLSA 2FK2A 1DV2A 2WB1E 4QW9A 5JVLA 2PT7G 1XRHA 3M9NB 2Y0SE 5KG7A 3HBLA 2BL5A 4IZOA 2UXDH 3TIIA 4Q8FA 1WHRA 2R87A 1RJPA 4BXXG 1RYRA 4DV7H 4FU0A 3I4NG 5DT9A 2VQEH 5L1LA 2KSWA 1TAEA 1TA8A 5HV6A 1KJJA 2CTKA 3KDKA 4YR2A 3PW2A 3V6JA 2GLTA 4AM3A 5KG6A 2DPJA 5FLMG 1Y1VG 5KFQA 2P2RA 4GC6A 1UC8A 2W7PA 1S0MA 3HOXG 4LF4H 2CW8A 4TQSA 2PQUA 2DLNA 2CTJA 5KT6A 5EDWA 3PN1A 1B04A 2YYAA 3VMMA 3T1HH 2XGPA 2XCAA 4MAMA 1E4EA 4DR5H 3H20A 4QIWE 2FFMA 3HXLA 4RNNA 4YR3A 1I7LA 4QWAA 3J80W 2WAQE 2JVZA 2PMZA 2HVQA 2RGVA 3WO1A 4AIMA 1RK6A 5KFDA 4JI1H 4RB1A 1JKJB 3KHGA 4A3MG 3H3VH 2BR0A 1M7JA 4A3BG 3OUZA 4X64H 3Q2OA 2RDJA 1ZETA 3WO0A 3HKZE 3QZ7A 4A3EG 3MWDA 1R9TA 3KTMA 1W96A 4LIJA 2ASDA 1Y1WG 2R82A 2HVRA 1KHMA 2P0AA 3KAKA 2RF4A 5KFNA 3LWBA 3HB9A 4R8UB 4RZQA 4LSAA 5EWFA 2R93A 4JVYA 2WB1A 2AGOA 4F4WA 3WNZA 3NCVA 2AXYA 2W8KA 2Y0SA 4UCVA 4IHJF 4RB0A 4LSXA 5KT3A 4EBEA 1V4YA 4Y8VB 4JI0H 4ZOLF 4GKJH 3MJFA 2K1HA 4DR7H 4F4ZA 2CKZB 3U9TA 1DIKA 3GTKA 3GTMA 3GR5A 2D9IA 3BAAA 5KFLA 4APMA 1HNXH 1ZZKA 2JEIA 1N36H 1B6SA 3TINA 1DV1A 1UC9A 3TIGA 5EOYA 1KJ8A 3JRWA 4GC7A 2R92G 4ECRA 1O75A 4ED0A 1EUDB 2AQ4A 3KAJA 4EGQA 1VBIA 2YQRA 1TWFA 1KBLA 3PVXA 2JA5A 1N48A 2CZGA 4IAJA 2FMAA 1IBLH 2NU9B 4YY3H 2R8JA 1X4MA 3EZJA 1T94A 5IYBG 4O3NA 2YRXA 3OHAA 1K83A 5DG9A 3H40A 5LP6F 2ANRA 3KHLA 3GTJA 4UCOA 1CE8A 1ZZJA 1JLLB 2DIKA 2WAQA 2MJHA 3OETA 5KFCA 4MV7A 3L7ZC 2JZXA 4FS1A 4OD6A 1DT4A 1S20A 3UQ8A 1L2ZA 1CQJB 5LA6F 3HKZA 4LH7A 4L1KA 4NZRM 4GKKH 2B63A 2Z0SA 1T36A 3PZPA 2J6TA 2JA6G 2CQYA 4FBUA 1TWGA 2Y3MA 5LXTF 4FJSA 4RUCA 1Z2OX 4ME6A 3G6XA 2O03A 2VOBA 4J9NA 5LMNH 3I12A 4DLKA 3NGDA 4RAZA 3K5HA 3BQ1A 3FAUA 1N56A 1JX4A 2R8HA 3V69A 3FKIG 2OPUA 1WCMG 1RJRA 3RAXA 2HVSA 3N40P 1P8LA 5C44G 1UG8A 2VQDA 1K1GA 2WTFA 1OWTA 4IWXA 1TUAA 1I94H 1WH2A 2ANNA 2FKLA 1M0TA 3K3PA 4YJ3F 3RBDA 4M9UA 4RNOA 5D1OA 2HH2A 4B3MH 2W70A 4DR6H 2VUMA 5KFEA 4FBTA 4AYBE 4QWBA 4RNMA 3JSLA 3QD7X 4EC5A 4DV6H 2PBZA 3MWEA 4K0KH 4QJFA 4ZI7F 1N32H 4RAYA 3KALA 2DPIA 4HNUA 3J7AK 1A0IA 5KFKA 1S68A 4JV1A 1Z2IA 1WVNA 5K36G 5L1KA 3E5NA 4MTDA 5GONF 3C0FB 2W9BB 2FE3A 1HNZH 2YZGA 4GLXA 4J9KA 2JEGA 2YU9A 3MR2A 4HNVA 5T14A 4HYKA 2M6QA 1S0OA 4A3LG 1AUXA 2DGRA 3QFFA 1MSZA 4B3RH 3RBEA 4LH6A 4A3CG 1B6RA 5D8DA 3BQ2A 2AGQA 3VKEA 3R5HA 4HR7A 4LMYA 2VR1A 2DWCA 3ETJA 1GLVA 3LMLA 4WANA 4DV2H 4MA5A 2BA0A 1A9XA 4QWCA 3GKUA 3BG5A 3BQ0A 1Y1VA 1RJQA 3H0GA 3N6XA 4MA0A 2RDIA 5F9LA 2FK3A 5EZYF 3RJ0A 2W8LA 4G08A 2NU8B 2FMRA 3RB6A 3FDSA 1X0AA 4JV5H 2E3UA 4MV9A 4ED8A 2QNDA 2JE6I 2X06A 1VIHA 2FPHX 4UCRA 1SFOA 4JI6H 5CA0F 4NBQA 4O3OA 1J5EH 2CW7A 3FMAA 4R8UA 5KT4A 4UCUA 3H0GG 4JI5H 4ZQIA 2V58A 2IBKA 1BJTA 1PX2A 3N43B 3SE7A 3OSNA 3RB4A 1VIGA 2R85A 2R7KA 2W6MA 5J2TF 5KFVA 5JQWA 4IRDA 1Y1WA 2HHHH 1BXRA 4U7CA 2I87A 3AYHB 4JV0A 2W9CB 4AYBA 3Q8SB 1WE8A 2R7LA 5C3EG 5FD6A 2A1SA 4Q0YA 3GTQA 4EYHB 2ZQEA 2UUAH 3TQTA 5I47A 1V9PA 3GV7B 2YL2A 2J6SA 3V6HA 2PVPA 1WSCA 2NVXA 4XYLB 5L9XA 1Y14B 4CC6A 1DTJA 4PDBA 1E4GT 4YBZB 3H4DA 4PWQA 1DGSA 1J4WA 4J9QA 2E2HA 2NVYA 4LF5H 2XC9A 1JDBB 5KT5A 1KJQA 4J0MA 5FPOA 3GIMA 1V9NA 2BQ3A 2R86A 3OHBA 4DR3H 5KFIA 5KFUA 4J9MA 2R7MA 2R92A 4FJUA 2FB9A 4FM9A 5KFXA 1ZQ7A 2I8CA 2MCTA 3M4IA 2LF0A 4AQYH 2CTLA 4IFDG 1GSOA 1TWAA 4WBNF 3PW5A 3M9OB 3M9MB 4YJ2F 2C28A 4EYIB 2V9WA 1JIHA 4R7RA 2CWHA 3RB0A 4JI2H 3GABA 1IBKH 4TV9F 5HBRB 4DL4A 3PO3G 4DV5H 2J6UA 4DR4H 2Q2TA 3PR4A 5K2MA 3R5FA 2YZMA 5C1OA 1E4FT 3IG0A 4BA2I 3GV8B 3V6KA 4CC5A 2XD4A 2C2EA 4F4XA 4LFCH 3T5KA 1S03G 4C5CA 2I80A 4JI8H 3BA9A 2UVVA 2FLPA 1ZHSA 3MWMA 3LP8A 2W71A 5DG8A 2AGPA 5DLGA 1E4EB 2JA6A 2ZDGA 4ED3A 2XCLA 3N41B 2GPWA 2V4QA 4YQWA 5KFPA 4B8CD 2UVUA 5KT2A 2R6FA 5KFOA 5KG0A 1WR2A 2V5AA 4EFEA 4ECWA 4DV0H 2ATLA 4EG0A 5JUMA 4DL7A 4J9SA 3FKIA 3JRXA 1WCMA 3RGZA 4C2MA 4UCSA 4DL6A 3RTXA 4I50F 3TQ1A 4QW8A 1GSHA 5KFRA 3VPCA 3MFIA 1JXLA 2C2RA 4O3RA 2WYOA 1I6UA 2VQFH 4MV4A 2PN1A 4EBDA 2W9BA 4RB2C 4O2AF 2UXBH 1K1SA 2C35B 3ORRA 4XYMB 3RV3A 4HNTA 4Q45A 1AUVA 2YCHA 3GTLA 4X65H 1RK5A 3VPBA 2FPIB 3K5IA 2IMWP 1NXUA 5LOVF 1VKZA 1M0WA 5KFWA 5KG2A 1PQXA 4JYAH 4YR0A 4RU9A 5IT9W 1VAJA 4ECTA 4NXNH 5KFTA 4A93G 3UOEA 4I4TF 1GYFA 2WE6A 1KJIA 1BGWA 1FJGH 1SCUB 3SB1A 4YHHH 1KEEA 3L4KA 4UCTA 4JI7H 3JZIA 4TV8F 5BPFA 4WD3A 4Q43A 2W6QA 5BMVF 4Q8EA 5C4XG 2FP4B 4DL2A 2R7ZG 5LL6b 2JA7G 4I7HA 4H8AA 1FKAH 5IYCG 3KHRA 3RUPA 3I4MG 3T5LA 2YS6A 4BBSG 2FLNA 2DZDA 3GTPA 4C5BA 4RUAA 5KKNB 5FD5A 1GO3E 1W93A 4LFBH 2QK4A 2F4VH 4EEQA 5C8YF 1KC7A 5BR8H 2UVRA 3J81W 3GIJA 4KHPH 3HOWG 1JDEA 3Q8RB 2VA3A 1S97A 3CQZA 3N42B 4ED7A 2W9CA 2R8KA 3EPGA 3KHHA 3L2PA 1VS0A 4FS2A 2NU6B 4A3KG 3U9SA 5JVDF 2CWFA 4O3SA 2HGSA 4TUYF 5KFYA 2Q2UA 3ETHA 2R7NA 2JA8G 4E4TA 5LYJF 4A3GG 1TWHA 2JEBI 1EHIA 5IYZF 2ASLA 1N33H 5DLFA 2GPSA 4DV4H 5KFHA 4UFZA 4NXMH 5CB4F 4LF8H 4HQ6A 4O3PA 5F9NA 3RB3A 4LF9H 2OWOA 3G8CA 1VBHA 1S0NA 4IR9A 4MV3A 5KX5F 4J9LA 3G6YA 2W57A 4JV2A 3KXYT 2VPQA 5JEAG 2UU9H 2UUCH 5D1OB 4DUZH 1EZ1A 1TWCA 2RGRA 5FPRA 3AEVB 2LTLA 4Q44A 5DGBA 2ALZA 1C3OA 2IP4A 5KT7A 1IOWA 2V4RA 2JEAI 4DR2H 2C2DA 3RV4A 3BJYA 3HOVG 3RGXA 1HR0H 5KFSA 5DGAA 2XGQA 3RAQA 2FLLA 3EPIA 3GIPA 2BQRA 1BNCA 3HOYG 2NN6G 1AN7A 4ED6A 3UFXB 3IN5A 4MV8A 2E2IA 3OTOH 3L4JA 4A3FG 3GIQA 1ODHA 2JEFA 4DV1H 5CA1F 4J9RA 2VA2A 2VKCA 3Q1KA 3MR6A 3K3VA 1EUCB 2UUBH 3V4SA 3Q8PB 5IP9G 4YB8B 2W6NA 5C1PA 2W6OA 3SI8A 3GILA 4O2BF 1GSAA 2E5LH 3ORQA 2FPPB 1VBGA 1ULZA 3GQCA 1SEIA 5KFZA 4XZ3B 1EC6A 4DUYH 1C30A 1Z2NX 4WALA 2M05A 3GIKA 2ZM6H 3Q8QB 3QZ8A 4JVHA 5J2UF 5C5JA 5KFGA 4QWEA 5JH7F 2CPMA 4NZTM 1IOVA 2FK1A 3T1YH 2ZDQA 2M8WA 4J9PA 1V8CA 4A3JG 2CTFA 2IA6A 5L1JA 5DG7A 4JUZA 4A2AA 4I55F 2R84A 1XNRH 3BA8A 3N8DA 1GGOA 2C00A 2JA9A 4LFAH 5IP7G 2PY9A 4QMFB 4TQRA 1X9ZA 2XCPA 5C0XG 4MV6A 2O4CA 3RF2A 5A2QW 4A2BA 4ETSA 1IBMH 2X0SA 5BPHA 5DQHA 4MTEA 3GIDA 4QWDA 4ED2A 5LMUH 3R23A 3PW4A 2J9GA 1T3NA 4E9JA 2OPVA 2W6PA 5KG1A 4ECUA 2CPQA 4YAJB 1M6VA 4ECQA 1S9FA 2HH3A 4X62H 2JEJA 2V59A 3PO2G 3RFCA 4BA1I 3V4ZA 3PW7A 2LRRA 1J5KA 1Z2PX 4C5AA 5CAEB 3F8NA 2R93G 1XNQH 1K1QA 4ECXA 4DL3A 3OSPA 5KFAA 4LF7H 4ECYA 2CTEA 4M7EA 4A3IG 3CVZA 2HJWA 3OUUA 4ZHQF 3GV5B 4DR1H 2LTMA 4B8TA 3JSNA 3OSSD 3JAMW 2C22A 1ZTGA 3DF7A 5KFMA 3GLKA 2CTMA 2ZJTA 4MV1A 4BY7G 2W9AA 1V51A 3PW0A 1MZBA 1I3QA 2WDTA 1F0XA 3RIZA 1SYXB 4BBRG 2R8IA 1WTJA 1FVIA 3H4BA 2YRWA 3U1KA 4NLGA 4BWSC 4QIWA 3HOUG 3T5HA 5KFBA 4OO1G 5IWAH 4OCHA 2YZNA 2NU7B 1PK8A 3PR5B 2R7ZA 3I0PA 1CS0A 5IYDG 4O3QA 1X9NA 2JA5G 2JA7A 1X4NA 5KFJA 3EYYA 1S10A 4G3IA 2UVWA 4J9OA 4O4IF 2G8YA 2QYZA 4RB3C 2W7OA 2OH2A 4XX0B 3T5JA 4IRCA 2VUGA 5DQGA 4A3DG 1EYZA 1XDNA 2FPGB 4ECSA 1ZHQA 4BY1G 3MR5A 1N34H 3R5XA 5DQIA 4IWYA 3GTGA 1B33N 1I7NA 3GTOA 1ZZIA 5KG5A 3KDGA 4RZRA 2B63G 4O4HF 4OX9H 3VPDA 4F4YA 4ECZA 1UNNC 3MFHA 3GIIA 3N44B 1KJ9A 5EWEA 4X66H 4LF6H 2VPSA 3MR3A 2UXCH 4YP3A 4B3TH 2AU0A 1HNWH 5EWGA 2FJZA 2PMZE 2YS7A
chains in the Genus database with same CATH topology
2LF0A 4AQYH 4JI3H 4B3SH 2XIGA 3BABA 4LH7A 5D1PA 4DV3H 4NZRM 4DR2H 4JI4H 4GKKH 3RGXA 1HR0H 4R7RA 4JI2H 3GABA 1XMOH 1IBKH 2Y3MA 1AN7A 4DV5H 1XMQH 1Z2OX 4DR4H 3OTOH 3L4JA 2Q2TA 2O03A 1ODHA 2VOBA 4DV1H 5LMNH 1E4FT 3IG0A 2VKCA 4RAZA 4EFBA 3FAUA 3K3VA 4CC5A 2UUBH 5FLXW 4LFCH 2HVSA 1S03G 3N40P 1P8LA 2E5LH 4JI8H 3BA9A 1ZHSA 2PT7G 3MWMA 1SEIA 1I94H 1WH2A 1M0TA 3N41B 1Z2NX 4DUYH 4B8CD 5D1OA 2ZM6H 4B3MH 2UXDH 4EFEA 4DV0H 4DR6H 4NZTM 3RGZA 3JSLA 3T1YH 3QD7X 4EC5A 4DV6H 4UCSA 3RTXA 4DV7H 4K0KH 1N32H 4RAYA 3KALA 5DT9A 2VQEH 3J7AK 4A2AA 1A0IA 1TAEA 1S68A 1TA8A 1XNRH 2KSWA 3BA8A 3KDKA 2WYOA 4LFAH 1I6UA 2VQFH 4MTDA 3C0FB 4RB2C 1X9ZA 2UXBH 2FE3A 1HNZH 4GLXA 2YCHA 2O4CA 3RF2A 5A2QW 4X65H 4A2BA 1IBMH 4ETSA 4LF4H 2CW8A 4MTEA 1M0WA 3PN1A 1B04A 4JYAH 5LMUH 3T1HH 4B3RH 4E9JA 4DR5H 5IT9W 3H20A 3HXLA 4LH6A 4NXNH 3J80W 4X62H 2RGVA 2HVQA 4LMYA 4RB1A 2WE6A 4JI1H 1Z2PX 1BGWA 1FJGH 3LMLA 4DV2H 3SB1A 4YHHH 1L2ZA 3L4KA 4X64H 3F8NA 3N6XA 4JI7H 1XNQH 4UCTA 3RJ0A 4LF7H 4G08A 4M7EA 3CVZA 5LL6b 4DR1H 4JV5H 3JSNA 4MV9A 3OSSD 1FKAH 3JAMW 4I7HA 3DF7A 2FPHX 4UCRA 2HVRA 4JI6H 2ZJTA 3KAKA 1MZBA 1J5EH 2CW7A 2WDTA 3FMAA 1F0XA 3UQ8A 1SYXB 4RZQA 4UCUA 3RIZA 4LSAA 4JI5H 5FD5A 1BJTA 1FVIA 3N43B 4LFBH 3NCVA 4BWSC 2F4VH 4EEQA 4UCVA 4LSXA 4RB0A 5IWAH 4OCHA 5BR8H 3J81W 4KHPH 4JI0H 4GKJH 1X9NA 2HHHH 4DR7H 3N42B 3EYYA 3GR5A 2D9IA 1VS0A 3BAAA 4APMA 5FD6A 3L2PA 1HNXH 4Q0YA 1GYFA 2ZQEA 2HGSA 4RB3C 2UUAH 1N36H 2Q2UA 1V9PA 2VUGA 5EOYA 4CC6A 1O75A 1XDNA 4PDBA 1E4GT 1ZHQA 3KAJA 1N34H 1N33H 4DV4H 1DGSA 4UFZA 4NXMH 4LF8H 4IAJA 1IBLH 4YY3H 3KDGA 4LF5H 4LF9H 3EZJA 2OWOA 4OX9H 4J0MA 5FPOA 2W57A 4UCOA 4DR3H 3N44B 4X66H 3KXYT 4LF6H 4FM9A 2VPSA 3OETA 2UU9H 4MV7A 2UUCH 2UXCH 4OD6A 5D1OB 4DUZH 4B3TH 2RGRA 1HNWH 5FPRA 3M4IA 2MCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY H;  4JI3 H;  4B3S H;  4DV3 H;  4DR2 H;  4JI4 H;  4GKK H;  1HR0 H;  4JI2 H;  1XMO H;  1IBK H;  1AN7 A;  4DV5 H;  1XMQ H;  4DR4 H;  3OTO H;  4DV1 H;  5LMN H;  2UUB H;  5FLX W;  4LFC H;  1S03 G;  2E5L H;  4JI8 H;  1SEI A;  1I94 H;  4DUY H;  2ZM6 H;  4B3M H;  2UXD H;  4DV0 H;  4DR6 H;  3T1Y H;  4DV6 H;  4DV7 H;  4K0K H;  1N32 H;  2VQE H;  3J7A K;  1XNR H;  4LFA H;  1I6U A;  2VQF H;  2UXB H;  1HNZ H;  3RF2 A;  5A2Q W;  4X65 H;  1IBM H;  4LF4 H;  4JYA H;  5LMU H;  3T1H H;  4B3R H;  4DR5 H;  5IT9 W;  4NXN H;  3J80 W;  4X62 H;  4JI1 H;  1FJG H;  4DV2 H;  4YHH H;  4X64 H;  4JI7 H;  1XNQ H;  4LF7 H;  5LL6 b;  4DR1 H;  4JV5 H;  1FKA H;  3JAM W;  4JI6 H;  1J5E H;  4JI5 H;  4LFB H;  2F4V H;  5IWA H;  5BR8 H;  3J81 W;  4KHP H;  4JI0 H;  4GKJ H;  2HHH H;  4DR7 H;  1HNX H;  2UUA H;  1N36 H;  4PDB A;  1N34 H;  1N33 H;  4DV4 H;  4NXM H;  4LF8 H;  1IBL H;  4YY3 H;  4LF5 H;  4LF9 H;  4OX9 H;  4DR3 H;  4X66 H;  4LF6 H;  2UU9 H;  2UUC H;  2UXC H;  4DUZ H;  4B3T H;  1HNW H; 
#chains in the Genus database with same CATH topology
 1I50 A;  5H80 A;  4JI3 H;  2ASJ A;  4B3S H;  2XIG A;  2W6Z A;  2ZDH A;  3BAB A;  5D1P A;  4DV3 H;  5KG4 A;  4F50 A;  4ECV A;  4JI4 H;  2SCU B;  2YW2 A;  5KFF A;  4EBC A;  5FJ8 G;  4ED1 A;  1XMO H;  4O4L F;  1XMQ H;  2BQU A;  4YAK B;  3HOZ G;  4IRK A;  4EEY A;  4EFB A;  5KG3 A;  4IR1 A;  2VUM G;  4EGJ A;  5L1I A;  2NUA B;  3G6V A;  5FLX W;  2R8G A;  1RYS A;  1CQI B;  4DL5 A;  4U6P A;  2OLS A;  2FK2 A;  1DV2 A;  2WB1 E;  4QW9 A;  5JVL A;  2PT7 G;  1XRH A;  3M9N B;  2Y0S E;  5KG7 A;  3HBL A;  2BL5 A;  4IZO A;  2UXD H;  3TII A;  4Q8F A;  1WHR A;  2R87 A;  1RJP A;  4BXX G;  1RYR A;  4DV7 H;  4FU0 A;  3I4N G;  5DT9 A;  2VQE H;  5L1L A;  2KSW A;  1TAE A;  1TA8 A;  5HV6 A;  1KJJ A;  2CTK A;  3KDK A;  4YR2 A;  3PW2 A;  3V6J A;  2GLT A;  4AM3 A;  5KG6 A;  2DPJ A;  5FLM G;  1Y1V G;  5KFQ A;  2P2R A;  4GC6 A;  1UC8 A;  2W7P A;  1S0M A;  3HOX G;  4LF4 H;  2CW8 A;  4TQS A;  2PQU A;  2DLN A;  2CTJ A;  5KT6 A;  5EDW A;  3PN1 A;  1B04 A;  2YYA A;  3VMM A;  3T1H H;  2XGP A;  2XCA A;  4MAM A;  1E4E A;  4DR5 H;  3H20 A;  4QIW E;  2FFM A;  3HXL A;  4RNN A;  4YR3 A;  1I7L A;  4QWA A;  3J80 W;  2WAQ E;  2JVZ A;  2PMZ A;  2HVQ A;  2RGV A;  3WO1 A;  4AIM A;  1RK6 A;  5KFD A;  4JI1 H;  4RB1 A;  1JKJ B;  3KHG A;  4A3M G;  3H3V H;  2BR0 A;  1M7J A;  4A3B G;  3OUZ A;  4X64 H;  3Q2O A;  2RDJ A;  1ZET A;  3WO0 A;  3HKZ E;  3QZ7 A;  4A3E G;  3MWD A;  1R9T A;  3KTM A;  1W96 A;  4LIJ A;  2ASD A;  1Y1W G;  2R82 A;  2HVR A;  1KHM A;  2P0A A;  3KAK A;  2RF4 A;  5KFN A;  3LWB A;  3HB9 A;  4R8U B;  4RZQ A;  4LSA A;  5EWF A;  2R93 A;  4JVY A;  2WB1 A;  2AGO A;  4F4W A;  3WNZ A;  3NCV A;  2AXY A;  2W8K A;  2Y0S A;  4UCV A;  4IHJ F;  4RB0 A;  4LSX A;  5KT3 A;  4EBE A;  1V4Y A;  4Y8V B;  4JI0 H;  4ZOL F;  4GKJ H;  3MJF A;  2K1H A;  4DR7 H;  4F4Z A;  2CKZ B;  3U9T A;  1DIK A;  3GTK A;  3GTM A;  3GR5 A;  2D9I A;  3BAA A;  5KFL A;  4APM A;  1HNX H;  1ZZK A;  2JEI A;  1N36 H;  1B6S A;  3TIN A;  1DV1 A;  1UC9 A;  3TIG A;  5EOY A;  1KJ8 A;  3JRW A;  4GC7 A;  2R92 G;  4ECR A;  1O75 A;  4ED0 A;  1EUD B;  2AQ4 A;  3KAJ A;  4EGQ A;  1VBI A;  2YQR A;  1TWF A;  1KBL A;  3PVX A;  2JA5 A;  1N48 A;  2CZG A;  4IAJ A;  2FMA A;  1IBL H;  2NU9 B;  4YY3 H;  2R8J A;  1X4M A;  3EZJ A;  1T94 A;  5IYB G;  4O3N A;  2YRX A;  3OHA A;  1K83 A;  5DG9 A;  3H40 A;  5LP6 F;  2ANR A;  3KHL A;  3GTJ A;  4UCO A;  1CE8 A;  1ZZJ A;  1JLL B;  2DIK A;  2WAQ A;  2MJH A;  3OET A;  5KFC A;  4MV7 A;  3L7Z C;  2JZX A;  4FS1 A;  4OD6 A;  1DT4 A;  1S20 A;  3UQ8 A;  1L2Z A;  1CQJ B;  5LA6 F;  3HKZ A;  4LH7 A;  4L1K A;  4NZR M;  4GKK H;  2B63 A;  2Z0S A;  1T36 A;  3PZP A;  2J6T A;  2JA6 G;  2CQY A;  4FBU A;  1TWG A;  2Y3M A;  5LXT F;  4FJS A;  4RUC A;  1Z2O X;  4ME6 A;  3G6X A;  2O03 A;  2VOB A;  4J9N A;  5LMN H;  3I12 A;  4DLK A;  3NGD A;  4RAZ A;  3K5H A;  3BQ1 A;  3FAU A;  1N56 A;  1JX4 A;  2R8H A;  3V69 A;  3FKI G;  2OPU A;  1WCM G;  1RJR A;  3RAX A;  2HVS A;  3N40 P;  1P8L A;  5C44 G;  1UG8 A;  2VQD A;  1K1G A;  2WTF A;  1OWT A;  4IWX A;  1TUA A;  1I94 H;  1WH2 A;  2ANN A;  2FKL A;  1M0T A;  3K3P A;  4YJ3 F;  3RBD A;  4M9U A;  4RNO A;  5D1O A;  2HH2 A;  4B3M H;  2W70 A;  4DR6 H;  2VUM A;  5KFE A;  4FBT A;  4AYB E;  4QWB A;  4RNM A;  3JSL A;  3QD7 X;  4EC5 A;  4DV6 H;  2PBZ A;  3MWE A;  4K0K H;  4QJF A;  4ZI7 F;  1N32 H;  4RAY A;  3KAL A;  2DPI A;  4HNU A;  3J7A K;  1A0I A;  5KFK A;  1S68 A;  4JV1 A;  1Z2I A;  1WVN A;  5K36 G;  5L1K A;  3E5N A;  4MTD A;  5GON F;  3C0F B;  2W9B B;  2FE3 A;  1HNZ H;  2YZG A;  4GLX A;  4J9K A;  2JEG A;  2YU9 A;  3MR2 A;  4HNV A;  5T14 A;  4HYK A;  2M6Q A;  1S0O A;  4A3L G;  1AUX A;  2DGR A;  3QFF A;  1MSZ A;  4B3R H;  3RBE A;  4LH6 A;  4A3C G;  1B6R A;  5D8D A;  3BQ2 A;  2AGQ A;  3VKE A;  3R5H A;  4HR7 A;  4LMY A;  2VR1 A;  2DWC A;  3ETJ A;  1GLV A;  3LML A;  4WAN A;  4DV2 H;  4MA5 A;  2BA0 A;  1A9X A;  4QWC A;  3GKU A;  3BG5 A;  3BQ0 A;  1Y1V A;  1RJQ A;  3H0G A;  3N6X A;  4MA0 A;  2RDI A;  5F9L A;  2FK3 A;  5EZY F;  3RJ0 A;  2W8L A;  4G08 A;  2NU8 B;  2FMR A;  3RB6 A;  3FDS A;  1X0A A;  4JV5 H;  2E3U A;  4MV9 A;  4ED8 A;  2QND A;  2JE6 I;  2X06 A;  1VIH A;  2FPH X;  4UCR A;  1SFO A;  4JI6 H;  5CA0 F;  4NBQ A;  4O3O A;  1J5E H;  2CW7 A;  3FMA A;  4R8U A;  5KT4 A;  4UCU A;  3H0G G;  4JI5 H;  4ZQI A;  2V58 A;  2IBK A;  1BJT A;  1PX2 A;  3N43 B;  3SE7 A;  3OSN A;  3RB4 A;  1VIG A;  2R85 A;  2R7K A;  2W6M A;  5J2T F;  5KFV A;  5JQW A;  4IRD A;  1Y1W A;  2HHH H;  1BXR A;  4U7C A;  2I87 A;  3AYH B;  4JV0 A;  2W9C B;  4AYB A;  3Q8S B;  1WE8 A;  2R7L A;  5C3E G;  5FD6 A;  2A1S A;  4Q0Y A;  3GTQ A;  4EYH B;  2ZQE A;  2UUA H;  3TQT A;  5I47 A;  1V9P A;  3GV7 B;  2YL2 A;  2J6S A;  3V6H A;  2PVP A;  1WSC A;  2NVX A;  4XYL B;  5L9X A;  1Y14 B;  4CC6 A;  1DTJ A;  4PDB A;  1E4G T;  4YBZ B;  3H4D A;  4PWQ A;  1DGS A;  1J4W A;  4J9Q A;  2E2H A;  2NVY A;  4LF5 H;  2XC9 A;  1JDB B;  5KT5 A;  1KJQ A;  4J0M A;  5FPO A;  3GIM A;  1V9N A;  2BQ3 A;  2R86 A;  3OHB A;  4DR3 H;  5KFI A;  5KFU A;  4J9M A;  2R7M A;  2R92 A;  4FJU A;  2FB9 A;  4FM9 A;  5KFX A;  1ZQ7 A;  2I8C A;  2MCT A;  3M4I A;  2LF0 A;  4AQY H;  2CTL A;  4IFD G;  1GSO A;  1TWA A;  4WBN F;  3PW5 A;  3M9O B;  3M9M B;  4YJ2 F;  2C28 A;  4EYI B;  2V9W A;  1JIH A;  4R7R A;  2CWH A;  3RB0 A;  4JI2 H;  3GAB A;  1IBK H;  4TV9 F;  5HBR B;  4DL4 A;  3PO3 G;  4DV5 H;  2J6U A;  4DR4 H;  2Q2T A;  3PR4 A;  5K2M A;  3R5F A;  2YZM A;  5C1O A;  1E4F T;  3IG0 A;  4BA2 I;  3GV8 B;  3V6K A;  4CC5 A;  2XD4 A;  2C2E A;  4F4X A;  4LFC H;  3T5K A;  1S03 G;  4C5C A;  2I80 A;  4JI8 H;  3BA9 A;  2UVV A;  2FLP A;  1ZHS A;  3MWM A;  3LP8 A;  2W71 A;  5DG8 A;  2AGP A;  5DLG A;  1E4E B;  2JA6 A;  2ZDG A;  4ED3 A;  2XCL A;  3N41 B;  2GPW A;  2V4Q A;  4YQW A;  5KFP A;  4B8C D;  2UVU A;  5KT2 A;  2R6F A;  5KFO A;  5KG0 A;  1WR2 A;  2V5A A;  4EFE A;  4ECW A;  4DV0 H;  2ATL A;  4EG0 A;  5JUM A;  4DL7 A;  4J9S A;  3FKI A;  3JRX A;  1WCM A;  3RGZ A;  4C2M A;  4UCS A;  4DL6 A;  3RTX A;  4I50 F;  3TQ1 A;  4QW8 A;  1GSH A;  5KFR A;  3VPC A;  3MFI A;  1JXL A;  2C2R A;  4O3R A;  2WYO A;  1I6U A;  2VQF H;  4MV4 A;  2PN1 A;  4EBD A;  2W9B A;  4RB2 C;  4O2A F;  2UXB H;  1K1S A;  2C35 B;  3ORR A;  4XYM B;  3RV3 A;  4HNT A;  4Q45 A;  1AUV A;  2YCH A;  3GTL A;  4X65 H;  1RK5 A;  3VPB A;  2FPI B;  3K5I A;  2IMW P;  1NXU A;  5LOV F;  1VKZ A;  1M0W A;  5KFW A;  5KG2 A;  1PQX A;  4JYA H;  4YR0 A;  4RU9 A;  5IT9 W;  1VAJ A;  4ECT A;  4NXN H;  5KFT A;  4A93 G;  3UOE A;  4I4T F;  1GYF A;  2WE6 A;  1KJI A;  1BGW A;  1FJG H;  1SCU B;  3SB1 A;  4YHH H;  1KEE A;  3L4K A;  4UCT A;  4JI7 H;  3JZI A;  4TV8 F;  5BPF A;  4WD3 A;  4Q43 A;  2W6Q A;  5BMV F;  4Q8E A;  5C4X G;  2FP4 B;  4DL2 A;  2R7Z G;  5LL6 b;  2JA7 G;  4I7H A;  4H8A A;  1FKA H;  5IYC G;  3KHR A;  3RUP A;  3I4M G;  3T5L A;  2YS6 A;  4BBS G;  2FLN A;  2DZD A;  3GTP A;  4C5B A;  4RUA A;  5KKN B;  5FD5 A;  1GO3 E;  1W93 A;  4LFB H;  2QK4 A;  2F4V H;  4EEQ A;  5C8Y F;  1KC7 A;  5BR8 H;  2UVR A;  3J81 W;  3GIJ A;  4KHP H;  3HOW G;  1JDE A;  3Q8R B;  2VA3 A;  1S97 A;  3CQZ A;  3N42 B;  4ED7 A;  2W9C A;  2R8K A;  3EPG A;  3KHH A;  3L2P A;  1VS0 A;  4FS2 A;  2NU6 B;  4A3K G;  3U9S A;  5JVD F;  2CWF A;  4O3S A;  2HGS A;  4TUY F;  5KFY A;  2Q2U A;  3ETH A;  2R7N A;  2JA8 G;  4E4T A;  5LYJ F;  4A3G G;  1TWH A;  2JEB I;  1EHI A;  5IYZ F;  2ASL A;  1N33 H;  5DLF A;  2GPS A;  4DV4 H;  5KFH A;  4UFZ A;  4NXM H;  5CB4 F;  4LF8 H;  4HQ6 A;  4O3P A;  5F9N A;  3RB3 A;  4LF9 H;  2OWO A;  3G8C A;  1VBH A;  1S0N A;  4IR9 A;  4MV3 A;  5KX5 F;  4J9L A;  3G6Y A;  2W57 A;  4JV2 A;  3KXY T;  2VPQ A;  5JEA G;  2UU9 H;  2UUC H;  5D1O B;  4DUZ H;  1EZ1 A;  1TWC A;  2RGR A;  5FPR A;  3AEV B;  2LTL A;  4Q44 A;  5DGB A;  2ALZ A;  1C3O A;  2IP4 A;  5KT7 A;  1IOW A;  2V4R A;  2JEA I;  4DR2 H;  2C2D A;  3RV4 A;  3BJY A;  3HOV G;  3RGX A;  1HR0 H;  5KFS A;  5DGA A;  2XGQ A;  3RAQ A;  2FLL A;  3EPI A;  3GIP A;  2BQR A;  1BNC A;  3HOY G;  2NN6 G;  1AN7 A;  4ED6 A;  3UFX B;  3IN5 A;  4MV8 A;  2E2I A;  3OTO H;  3L4J A;  4A3F G;  3GIQ A;  1ODH A;  2JEF A;  4DV1 H;  5CA1 F;  4J9R A;  2VA2 A;  2VKC A;  3Q1K A;  3MR6 A;  3K3V A;  1EUC B;  2UUB H;  3V4S A;  3Q8P B;  5IP9 G;  4YB8 B;  2W6N A;  5C1P A;  2W6O A;  3SI8 A;  3GIL A;  4O2B F;  1GSA A;  2E5L H;  3ORQ A;  2FPP B;  1VBG A;  1ULZ A;  3GQC A;  1SEI A;  5KFZ A;  4XZ3 B;  1EC6 A;  4DUY H;  1C30 A;  1Z2N X;  4WAL A;  2M05 A;  3GIK A;  2ZM6 H;  3Q8Q B;  3QZ8 A;  4JVH A;  5J2U F;  5C5J A;  5KFG A;  4QWE A;  5JH7 F;  2CPM A;  4NZT M;  1IOV A;  2FK1 A;  3T1Y H;  2ZDQ A;  2M8W A;  4J9P A;  1V8C A;  4A3J G;  2CTF A;  2IA6 A;  5L1J A;  5DG7 A;  4JUZ A;  4A2A A;  4I55 F;  2R84 A;  1XNR H;  3BA8 A;  3N8D A;  1GGO A;  2C00 A;  2JA9 A;  4LFA H;  5IP7 G;  2PY9 A;  4QMF B;  4TQR A;  1X9Z A;  2XCP A;  5C0X G;  4MV6 A;  2O4C A;  3RF2 A;  5A2Q W;  4A2B A;  4ETS A;  1IBM H;  2X0S A;  5BPH A;  5DQH A;  4MTE A;  3GID A;  4QWD A;  4ED2 A;  5LMU H;  3R23 A;  3PW4 A;  2J9G A;  1T3N A;  4E9J A;  2OPV A;  2W6P A;  5KG1 A;  4ECU A;  2CPQ A;  4YAJ B;  1M6V A;  4ECQ A;  1S9F A;  2HH3 A;  4X62 H;  2JEJ A;  2V59 A;  3PO2 G;  3RFC A;  4BA1 I;  3V4Z A;  3PW7 A;  2LRR A;  1J5K A;  1Z2P X;  4C5A A;  5CAE B;  3F8N A;  2R93 G;  1XNQ H;  1K1Q A;  4ECX A;  4DL3 A;  3OSP A;  5KFA A;  4LF7 H;  4ECY A;  2CTE A;  4M7E A;  4A3I G;  3CVZ A;  2HJW A;  3OUU A;  4ZHQ F;  3GV5 B;  4DR1 H;  2LTM A;  4B8T A;  3JSN A;  3OSS D;  3JAM W;  2C22 A;  1ZTG A;  3DF7 A;  5KFM A;  3GLK A;  2CTM A;  2ZJT A;  4MV1 A;  4BY7 G;  2W9A A;  1V51 A;  3PW0 A;  1MZB A;  1I3Q A;  2WDT A;  1F0X A;  3RIZ A;  1SYX B;  4BBR G;  2R8I A;  1WTJ A;  1FVI A;  3H4B A;  2YRW A;  3U1K A;  4NLG A;  4BWS C;  4QIW A;  3HOU G;  3T5H A;  5KFB A;  4OO1 G;  5IWA H;  4OCH A;  2YZN A;  2NU7 B;  1PK8 A;  3PR5 B;  2R7Z A;  3I0P A;  1CS0 A;  5IYD G;  4O3Q A;  1X9N A;  2JA5 G;  2JA7 A;  1X4N A;  5KFJ A;  3EYY A;  1S10 A;  4G3I A;  2UVW A;  4J9O A;  4O4I F;  2G8Y A;  2QYZ A;  4RB3 C;  2W7O A;  2OH2 A;  4XX0 B;  3T5J A;  4IRC A;  2VUG A;  5DQG A;  4A3D G;  1EYZ A;  1XDN A;  2FPG B;  4ECS A;  1ZHQ A;  4BY1 G;  3MR5 A;  1N34 H;  3R5X A;  5DQI A;  4IWY A;  3GTG A;  1B33 N;  1I7N A;  3GTO A;  1ZZI A;  5KG5 A;  3KDG A;  4RZR A;  2B63 G;  4O4H F;  4OX9 H;  3VPD A;  4F4Y A;  4ECZ A;  1UNN C;  3MFH A;  3GII A;  3N44 B;  1KJ9 A;  5EWE A;  4X66 H;  4LF6 H;  2VPS A;  3MR3 A;  2UXC H;  4YP3 A;  4B3T H;  2AU0 A;  1HNW H;  5EWG A;  2FJZ A;  2PMZ E;  2YS7 A; 
#chains in the Genus database with same CATH homology
 2LF0 A;  4AQY H;  4JI3 H;  4B3S H;  2XIG A;  3BAB A;  4LH7 A;  5D1P A;  4DV3 H;  4NZR M;  4DR2 H;  4JI4 H;  4GKK H;  3RGX A;  1HR0 H;  4R7R A;  4JI2 H;  3GAB A;  1XMO H;  1IBK H;  2Y3M A;  1AN7 A;  4DV5 H;  1XMQ H;  1Z2O X;  4DR4 H;  3OTO H;  3L4J A;  2Q2T A;  2O03 A;  1ODH A;  2VOB A;  4DV1 H;  5LMN H;  1E4F T;  3IG0 A;  2VKC A;  4RAZ A;  4EFB A;  3FAU A;  3K3V A;  4CC5 A;  2UUB H;  5FLX W;  4LFC H;  2HVS A;  1S03 G;  3N40 P;  1P8L A;  2E5L H;  4JI8 H;  3BA9 A;  1ZHS A;  2PT7 G;  3MWM A;  1SEI A;  1I94 H;  1WH2 A;  1M0T A;  3N41 B;  1Z2N X;  4DUY H;  4B8C D;  5D1O A;  2ZM6 H;  4B3M H;  2UXD H;  4EFE A;  4DV0 H;  4DR6 H;  4NZT M;  3RGZ A;  3JSL A;  3T1Y H;  3QD7 X;  4EC5 A;  4DV6 H;  4UCS A;  3RTX A;  4DV7 H;  4K0K H;  1N32 H;  4RAY A;  3KAL A;  5DT9 A;  2VQE H;  3J7A K;  4A2A A;  1A0I A;  1TAE A;  1S68 A;  1TA8 A;  1XNR H;  2KSW A;  3BA8 A;  3KDK A;  2WYO A;  4LFA H;  1I6U A;  2VQF H;  4MTD A;  3C0F B;  4RB2 C;  1X9Z A;  2UXB H;  2FE3 A;  1HNZ H;  4GLX A;  2YCH A;  2O4C A;  3RF2 A;  5A2Q W;  4X65 H;  4A2B A;  1IBM H;  4ETS A;  4LF4 H;  2CW8 A;  4MTE A;  1M0W A;  3PN1 A;  1B04 A;  4JYA H;  5LMU H;  3T1H H;  4B3R H;  4E9J A;  4DR5 H;  5IT9 W;  3H20 A;  3HXL A;  4LH6 A;  4NXN H;  3J80 W;  4X62 H;  2RGV A;  2HVQ A;  4LMY A;  4RB1 A;  2WE6 A;  4JI1 H;  1Z2P X;  1BGW A;  1FJG H;  3LML A;  4DV2 H;  3SB1 A;  4YHH H;  1L2Z A;  3L4K A;  4X64 H;  3F8N A;  3N6X A;  4JI7 H;  1XNQ H;  4UCT A;  3RJ0 A;  4LF7 H;  4G08 A;  4M7E A;  3CVZ A;  5LL6 b;  4DR1 H;  4JV5 H;  3JSN A;  4MV9 A;  3OSS D;  1FKA H;  3JAM W;  4I7H A;  3DF7 A;  2FPH X;  4UCR A;  2HVR A;  4JI6 H;  2ZJT A;  3KAK A;  1MZB A;  1J5E H;  2CW7 A;  2WDT A;  3FMA A;  1F0X A;  3UQ8 A;  1SYX B;  4RZQ A;  4UCU A;  3RIZ A;  4LSA A;  4JI5 H;  5FD5 A;  1BJT A;  1FVI A;  3N43 B;  4LFB H;  3NCV A;  4BWS C;  2F4V H;  4EEQ A;  4UCV A;  4LSX A;  4RB0 A;  5IWA H;  4OCH A;  5BR8 H;  3J81 W;  4KHP H;  4JI0 H;  4GKJ H;  1X9N A;  2HHH H;  4DR7 H;  3N42 B;  3EYY A;  3GR5 A;  2D9I A;  1VS0 A;  3BAA A;  4APM A;  5FD6 A;  3L2P A;  1HNX H;  4Q0Y A;  1GYF A;  2ZQE A;  2HGS A;  4RB3 C;  2UUA H;  1N36 H;  2Q2U A;  1V9P A;  2VUG A;  5EOY A;  4CC6 A;  1O75 A;  1XDN A;  4PDB A;  1E4G T;  1ZHQ A;  3KAJ A;  1N34 H;  1N33 H;  4DV4 H;  1DGS A;  4UFZ A;  4NXM H;  4LF8 H;  4IAJ A;  1IBL H;  4YY3 H;  3KDG A;  4LF5 H;  4LF9 H;  3EZJ A;  2OWO A;  4OX9 H;  4J0M A;  5FPO A;  2W57 A;  4UCO A;  4DR3 H;  3N44 B;  4X66 H;  3KXY T;  4LF6 H;  4FM9 A;  2VPS A;  3OET A;  2UU9 H;  4MV7 A;  2UUC H;  2UXC H;  4OD6 A;  5D1O B;  4DUZ H;  4B3T H;  2RGR A;  1HNW H;  5FPR A;  3M4I A;  2MCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...