5IT9W

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
129
Chain Sequence
TRTSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIADVEKWTANLLPARQFGYVILTTSAGIMDHEEAHRKHVSGKILGFVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
molecule keywords Ribosomal protein uS2
total genus 29
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 5it9W01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 5it9W02
2UXCH 4PDBA 4JI2H 1N36H 4DV3H 4LF5H 4KHPH 4LF6H 5IT9W 4NXMH 4LF4H 1XMQH 1J5EH 1I94H 4DV7H 4X66H 2UXBH 4YY3H 4AQYH 4DR7H 4X62H 4JI3H 4LFCH 1HNWH 3JAMW 4GKKH 3RF2A 4LFBH 2VQFH 4GKJH 3T1HH 1N34H 5A2QW 5LMUH 1XNRH 4DUZH 4JV5H 4JI0H 1N33H 4DV6H 4DR6H 5IWAH 4DR3H 1FJGH 4DR4H 4X64H 4JI8H 4JYAH 4B3TH 2F4VH 1SEIA 5FLXW 4DUYH 4LFAH 4JI5H 4JI6H 4LF8H 1HNZH 1XMOH 4OX9H 1IBKH 4B3SH 5BR8H 4JI4H 4B3RH 4LF7H 5LMNH 2UXDH 2UUAH 1I6UA 4DV1H 3J81W 4K0KH 4JI1H 2VQEH 1AN7A 4DV2H 1S03G 3J7AK 3J80W 4NXNH 5LL6b 1XNQH 1IBLH 4DV4H 4LF9H 3T1YH 1N32H 1HNXH 2UU9H 4DV0H 2UUCH 2E5LH 1IBMH 4X65H 2ZM6H 4DR5H 4DR1H 1HR0H 1FKAH 3OTOH 4YHHH 4DR2H 4JI7H 2HHHH 4DV5H 2UUBH 4B3MH
chains in the Genus database with same CATH superfamily
3KHLA 3NGDA 4IHJF 3V69A 1EHIA 5KFCA 4JI2H 2UVWA 5D1PA 1RJQA 1JXLA 4O3SA 4WD3A 2R8IA 4LF5H 2CPMA 3T5JA 2BR0A 1DIKA 3VPBA 4LF6H 1BXRA 2W7PA 5J2UF 1V8CA 2PBZA 1AUVA 2AU0A 1J5EH 5LOVF 4U7CA 3U9TA 1RYRA 2WB1A 1I94H 4DV7H 3WO0A 4TV8F 2JEGA 2IP4A 1DTJA 3BQ2A 2XD4A 2V9WA 3RAQA 3OUUA 1HNWH 3JAMW 4GKKH 3RF2A 2PMZE 2R87A 5JH7F 2VQFH 4GKJH 1N34H 4NZRM 5KG5A 2CTFA 4MTDA 3UQ8A 3N44B 3TINA 3MFHA 4ED6A 4I55F 1XNRH 2W9CA 5LYJF 2DLNA 2NN6G 1KJ8A 5KFBA 4MV8A 4Q44A 4MA0A 5C5JA 2CTLA 2FKLA 3L4KA 1KC7A 4DLKA 1FJGH 1BNCA 2WE6A 5L1KA 2C00A 5KFRA 4EC5A 2W57A 5GONF 4R8UB 4UCSA 4IRKA 1T36A 4RB3C 3ORRA 5JVDF 3JSLA 3MWMA 4LH7A 3VKEA 5CB4F 5C1PA 4QWDA 1A9XA 1T3NA 1DV1A 5FPOA 1SEIA 1S0OA 3EPIA 5HBRB 2LTLA 2YRXA 5D8DA 2HJWA 2VUGA 3MWEA 2PN1A 4RAYA 2DWCA 4G08A 1VAJA 2WAQA 4YJ2F 2AQ4A 4DUYH 4ED1A 1S68A 2PVPA 2W8KA 1KJIA 4Q8EA 2G8YA 1XMOH 2VKCA 4OX9H 4J9RA 4GLXA 3E5NA 2C2RA 2AGPA 3GTPA 2FLPA 1S10A 4Q8FA 1KJJA 3MR3A 2PT7G 3JRWA 5I47A 1GSAA 4UCOA 3F8NA 5KFTA 5KFOA 2OH2A 2XIGA 5H80A 5KFIA 5KT6A 4MV7A 4EBDA 3BAAA 2FMRA 2UXDH 4IWXA 1BJTA 5LP6F 2M8WA 3GTMA 1I6UA 2FK1A 4QW8A 5F9NA 2JEAI 1N56A 5IYCG 4IR9A 2XGQA 2CTJA 2LTMA 3BA8A 4YR2A 4ED0A 2YS7A 1AN7A 3J7AK 5IP9G 4Q45A 3J80W 2JVZA 1VKZA 4RB1A 3Q8SB 1SCUB 2W6NA 1XNQH 1AUXA 4HR7A 1KBLA 1ZHQA 2W6ZA 1RJRA 3RTXA 2BL5A 2W71A 4RUAA 3N41B 4O2BF 3N40P 1N32H 2FPIB 1X0AA 1HNXH 2HVQA 5KFXA 2UUCH 2W7OA 4EYIB 3SB1A 5IYDG 4X65H 4A2BA 5KFWA 3WO1A 3MFIA 1HR0H 3H0GG 5LXTF 4C2MA 1V9PA 2DPJA 2FLNA 4DR2H 1C3OA 2R8GA 2HHHH 4AYBE 2HVSA 4TV9F 4TQSA 2FP4B 2UUBH 1WHRA 4NZTM 2PQUA 2C2EA 2R7KA 3GTGA 1PX2A 4ETSA 3M9MB 2IBKA 4C5BA 1WE8A 1N36H 4MV4A 4DV3H 2SCUB 4ECZA 2JA5A 4M9UA 3DF7A 1SYXB 5KFAA 5DQHA 1VIHA 2MCTA 3KXYT 4NXMH 3I4NG 4EFEA 4LIJA 2R7MA 2CKZB 4GC6A 4J9MA 5KG2A 2B63G 2JA7G 4B8TA 4BBSG 2R86A 1SFOA 1WVNA 2Q2TA 3V4SA 3T5KA 1CS0A 5D1OA 2QNDA 3PW5A 3HOUG 4DR7H 5JEAG 3N6XA 1KJQA 4A93G 2I87A 3KDGA 2C28A 2YZNA 2R8HA 1E4EB 2WDTA 5KKNB 4WALA 3T1HH 4IR1A 1TWCA 1X4NA 3EYYA 5C44G 4A3EG 4LMYA 5LMUH 3T5LA 5L1JA 4DL4A 1N33H 4C5CA 3K3VA 4DR6H 2ZJTA 4DR3H 4YB8B 4EYHB 1JIHA 2NU6B 4ZQIA 4NLGA 3R5HA 2XCAA 4AYBA 3BQ0A 3QZ7A 5C8YF 1JKJB 5IP7G 3K5IA 1S97A 5D1OB 5CA0F 2NU7B 5KFVA 3Q2OA 1N48A 2R7ZA 3OHBA 4O2AF 4ED7A 3TIGA 3RBEA 3LWBA 1GSHA 5KT5A 4IZOA 5J2TF 5L1LA 2R8JA 5BPFA 4RUCA 2E2IA 4DL2A 2F4VH 5DQIA 3R23A 2P0AA 1CQJB 3GV8B 4HYKA 4GC7A 3V6JA 1ZQ7A 5JUMA 1Y1WA 3H40A 2R7ZG 4YAKB 1DGSA 1RK6A 3K5HA 2JEJA 3GQCA 2W6MA 3HB9A 5BPHA 4F4XA 1WCMG 2DPIA 2RF4A 4IAJA 3KHRA 4LF8H 3G6YA 5KFYA 3H4BA 1S20A 2W6PA 1TUAA 1IBKH 3U1KA 2VPSA 5EWGA 4RB0A 4JV1A 3KDKA 1I7LA 5BR8H 4WANA 5KFUA 2CWFA 4JVYA 3Q1KA 2DGRA 4XYMB 4O3RA 2B63A 2OWOA 4B3RH 2MJHA 3GTKA 4RNOA 1WCMA 4EBCA 3R5XA 2VUMG 1X4MA 1Z2OX 2CTEA 2UUAH 2QK4A 1K83A 2R93G 3BA9A 2YQRA 2X0SA 3BABA 1GSOA 3GR5A 4DV1H 3KAJA 3HKZA 2V4RA 4EEQA 5DQGA 3J81W 2XCPA 4JI1H 2WYOA 3NCVA 2YYAA 1K1GA 4UCRA 5KG7A 2CZGA 3C0FB 1ZZKA 4HNTA 2VA3A 4IFDG 1K1QA 1RK5A 1ULZA 3UFXB 1JLLB 4FM9A 1IBLH 2FFMA 1DT4A 3FKIA 4RNMA 3GIIA 4MV1A 3RV4A 2CTMA 5HV6A 3RJ0A 5KFMA 4IRDA 3PO3G 5KT7A 4QWEA 4J0MA 3I12A 3PR5B 2UVVA 5KT4A 4BXXG 1IBMH 2NU8B 3OSSD 3BQ1A 2O03A 5BMVF 4RAZA 2CW8A 2AXYA 3Q8RB 4DR1H 1FKAH 4J9LA 4ZOLF 1C30A 2DIKA 4YHHH 1OWTA 3H0GA 3N42B 3MWDA 2YU9A 4J9QA 4HNVA 4I7HA 2NU9B 2P2RA 2ZDHA 4I50F 4A3DG 4FU0A 3FAUA 1FVIA 2FB9A 2VQDA 4ECXA 2W9CB 3PZPA 2W6OA 4A3MG 1UC8A 3ETJA 2GPWA 4NBQA 4PDBA 1T94A 4TUYF 1WR2A 4RZRA 2ASJA 3AYHB 3V6HA 3GIDA 4M7EA 4Q0YA 4YJ3F 4QIWA 1KHMA 4E9JA 3ETHA 3FDSA 4CC5A 4ECWA 4A3CG 3GKUA 3BG5A 5IT9W 5DG7A 4Q43A 2C35B 1K1SA 4A3LG 2PY9A 5DGBA 4O3NA 1MSZA 1XMQH 4LF4H 3FMAA 2BA0A 2JE6I 1TWFA 3G8CA 3AEVB 4ECUA 3GIJA 1UC9A 2HH2A 4BBRG 1NXUA 4YY3H 4BY7G 2ZQEA 1X9NA 4JI3H 4UCTA 2RDIA 5KT3A 4ED8A 4A3IG 1ZHSA 4LFCH 4ECSA 4RB2C 2AGQA 2K1HA 1B6SA 2Y0SA 1IOVA 2XC9A 3SE7A 3I0PA 3HBLA 3VMMA 2R8KA 4HNUA 4EGQA 3RUPA 2GPSA 3H20A 3QZ8A 1ZETA 4XZ3B 3ORQA 2W9BA 2UVUA 3HOXG 1M6VA 2I8CA 3HOZG 4IWYA 5KFNA 3R5FA 5IWAH 4QMFB 1V4YA 2CW7A 5KFSA 1W93A 4F4ZA 3QD7X 3GTJA 1GGOA 4R8UA 3H4DA 4DR4H 1M0TA 3M4IA 4X64H 4F4WA 1ODHA 5DG9A 4UCUA 1O75A 2OPUA 5DGAA 2M05A 3OSNA 3PW4A 1CE8A 3I4MG 5DLFA 2JZXA 4B3TH 1E4GT 2R82A 2FLLA 4IRCA 2QYZA 4MV9A 3SI8A 2CWHA 3TQ1A 4DL3A 2BQRA 1Y1WG 1V51A 2RGRA 5DG8A 2W9BB 3LMLA 1Y14B 5FD5A 5K2MA 2VA2A 4UFZA 3RGZA 4ECVA 2JEFA 5FLXW 4QWCA 2W70A 3PW0A 4LFAH 4JI5H 4O4IF 4WBNF 5JQWA 1WSCA 5KFDA 4YQWA 3GV7B 2BQ3A 2OLSA 2JA6G 1L2ZA 1V9NA 2IA6A 1HNZH 3V6KA 1B6RA 2R84A 4B3SH 3HOYG 5IYBG 3LP8A 2BQUA 1F0XA 2PMZA 1I50A 1EYZA 4JI4H 4O3PA 4C5AA 4MTEA 3MR6A 2C22A 4J9KA 1PQXA 5CAEB 1JX4A 1GYFA 3MR2A 3IN5A 4LF7H 5FLMG 3GIQA 2JEIA 1X9ZA 4XYLB 4B8CD 3PVXA 4DL7A 2KSWA 4O3OA 4QW9A 1TWGA 4ECRA 4AIMA 1EUCB 4RZQA 2YW2A 4Y8VB 5KG3A 4K0KH 2FE3A 2V58A 2C2DA 4QWBA 3G6VA 4ME6A 2VQEH 1UNNC 4LH6A 1S03G 4DV2H 3KTMA 4FBUA 4YP3A 2Z0SA 4J9OA 3Q8PB 5KFZA 4JVHA 3G6XA 3RB0A 4NXNH 5C1OA 5LL6b 2JA8G 2R6FA 3PN1A 4I4TF 4OO1G 4LF9H 4F4YA 1VBIA 5CA1F 4AM3A 3T1YH 1A0IA 3Q8QB 2J6UA 3PW7A 3VPCA 3OHAA 2JEBI 4EEYA 2UU9H 1MZBA 3GTOA 4DV0H 4ED2A 5IYZF 2RDJA 1BGWA 3T5HA 1S0NA 4FJUA 1ZTGA 2WAQE 4CC6A 1I7NA 5KFLA 3L2PA 1KJ9A 4R7RA 1Y1VG 1B04A 5KX5F 4A3GG 2ANNA 2R92A 1VIGA 4DR5H 4OCHA 3FKIG 3OUZA 3KHGA 5T14A 4YR3A 3KHHA 1J4WA 5KFFA 1VBGA 2W8LA 4J9SA 2LRRA 5EZYF 2Q2UA 3H3VH 3GV5B 3MR5A 2HVRA 4FJSA 2AGOA 2CTKA 4O3QA 3V4ZA 5C3EG 3TIIA 2IMWP 1TWHA 4JV0A 3RB4A 1Z2IA 3RFCA 4B3MH 4EGJA 4EG0A 5KFEA 2XGPA 2UXCH 3GLKA 4EBEA 2VUMA 2ZDGA 4JV2A 2LF0A 3IG0A 5KFHA 3N8DA 1J5KA 5EWFA 4KHPH 1DV2A 3GIMA 3U9SA 3WNZA 1EC6A 2GLTA 2W6QA 2NUAB 1TWAA 1KEEA 3EPGA 2E2HA 1RYSA 5KG0A 3HOWG 4ZI7F 3GABA 1B33N 1GO3E 2J6TA 4X66H 2UXBH 4AQYH 4ECQA 4O4HF 2I80A 4X62H 2NVYA 3TQTA 4A3KG 1XDNA 5KG4A 2CPQA 1E4EA 1CQIB 3CQZA 4A3BG 3PR4A 1I3QA 4LFBH 1R9TA 5A2QW 3RAXA 1ZZIA 4BA2I 2E3UA 2YZGA 4DUZH 3CVZA 4JV5H 4EFBA 5KFGA 1Z2NX 4L1KA 3EZJA 4JI0H 4J9PA 3L7ZC 5KG1A 3QFFA 2R7NA 2YL2A 4DV6H 2FPHX 4F50A 3RB6A 2J6SA 1TAEA 4FS1A 4FS2A 3KAKA 2O4CA 5C4XG 2VOBA 1ZZJA 2FMAA 3RV3A 2OPVA 4YAJB 2HH3A 3JRXA 5KFQA 5L1IA 4J9NA 1M0WA 4BY1G 2R92G 2YRWA 4YBZB 4HQ6A 4JI8H 4JYAH 2V59A 4RNNA 2R85A 4QJFA 3M9OB 5EOYA 3RGXA 3RB3A 2UVRA 3GTLA 2A1SA 2WTFA 2V5AA 2HGSA 4DL5A 2M6QA 1UG8A 2VPQA 2NVXA 2Y3MA 1M7JA 1JDEA 3OSPA 3OETA 1EUDB 1RJPA 4A3JG 5F9LA 2WB1E 4JI6H 1IOWA 2CQYA 1S0MA 2FPGB 4G3IA 5DT9A 2FJZA 4LSXA 3GIPA 1Z2PX 4ECTA 3N43B 4MV3A 5FPRA 4A2AA 2DZDA 4H8AA 4JUZA 4LSAA 3RBDA 3L4JA 1JDBB 1P8LA 4XX0B 3GIKA 5KFPA 2FK3A 5LMNH 1WTJA 2X06A 4A3FG 3JSNA 2R93A 1E4FT 4UCVA 1VS0A 4QIWE 3K3PA 4FBTA 2ASLA 4PWQA 3RIZA 4APMA 4ED3A 4U6PA 3GTQA 2JA7A 2W9AA 4O4LF 2XCLA 3UOEA 4MAMA 5EDWA 1PK8A 4BA1I 2VR1A 1VBHA 3JZIA 3VPDA 2V4QA 4DV4H 5C0XG 3KALA 5LA6F 5KT2A 4ECYA 5KFJA 2FK2A 5KFKA 2ASDA 3PO2G 2D9IA 3HKZE 1S9FA 2J9GA 4BWSC 5JVLA 2Y0SE 2YCHA 4DL6A 2YS6A 4QWAA 1XRHA 2E5LH 2ZDQA 2ALZA 2YZMA 4MV6A 2R7LA 4TQRA 2ZM6H 1W96A 3MJFA 4E4TA 3M9NB 5L9XA 2ANRA 3GILA 3PW2A 2ATLA 3HXLA 1EZ1A 3OTOH 4RU9A 5K36G 4ZHQF 5EWEA 3HOVG 1TA8A 5DLGA 4JI7H 1WH2A 3BJYA 1GLVA 4DV5H 2FPPB 2JA5G 5KG6A 4MA5A 4OD6A 4YR0A 2RGVA 5FD6A 1Y1VA 2JA6A 2JA9A 5FJ8G
chains in the Genus database with same CATH topology
2UXCH 4PDBA 2LF0A 4JI2H 1N36H 3IG0A 4DV3H 4Q0YA 5D1PA 4M7EA 4LF5H 4E9JA 4KHPH 1SYXB 3DF7A 4CC5A 4LF6H 2MCTA 5IT9W 4NXMH 3KXYT 4EFEA 4LF4H 1XMQH 3FMAA 1J5EH 2Q2TA 1I94H 3GABA 4DV7H 4X66H 5D1OA 2UXBH 4YY3H 4AQYH 4DR7H 3N6XA 2ZQEA 4X62H 4JI3H 1X9NA 4UCTA 1XDNA 3KDGA 1ZHSA 4LFCH 4RB2C 1HNWH 3JAMW 4GKKH 3RF2A 2WDTA 4LFBH 2VQFH 4GKJH 3T1HH 4NZRM 1N34H 4MTDA 3UQ8A 3N44B 5A2QW 3EYYA 4LMYA 5LMUH 1XNRH 4EFBA 3CVZA 4DUZH 4JV5H 1Z2NX 3H20A 3EZJA 4JI0H 3L4KA 1N33H 4DV6H 2FPHX 4DR6H 2ZJTA 5IWAH 4DR3H 1FJGH 1TAEA 2CW7A 2WE6A 2O4CA 3KAKA 4EC5A 2W57A 3QD7X 4UCSA 4RB3C 2VOBA 4DR4H 3JSLA 5D1OB 1M0TA 3M4IA 3MWMA 4X64H 1M0WA 4LH7A 1ODHA 4UCUA 1O75A 4JI8H 4JYAH 5FPOA 5EOYA 4B3TH 2F4VH 1E4GT 1SEIA 3RGXA 4MV9A 2HGSA 2VUGA 2RGRA 4RAYA 3LMLA 5FD5A 2Y3MA 1DGSA 4G08A 4UFZA 3RGZA 3OETA 5FLXW 4DUYH 4LFAH 4JI5H 1L2ZA 1S68A 3K3VA 4JI6H 4IAJA 4LF8H 1HNZH 1XMOH 5DT9A 2VKCA 4OX9H 4LSXA 4GLXA 1Z2PX 1IBKH 2VPSA 4B3SH 3N43B 4RB0A 5FPRA 3KDKA 1F0XA 5BR8H 4A2AA 2PT7G 4JI4H 4LSAA 4MTEA 4UCOA 3L4JA 3F8NA 1GYFA 2OWOA 1P8LA 4B3RH 2XIGA 4LF7H 4MV7A 5LMNH 3BAAA 1X9ZA 2UXDH 4B8CD 1Z2OX 3JSNA 2UUAH 1BJTA 1E4FT 2KSWA 1I6UA 1VS0A 3BABA 3BA9A 4UCVA 3KAJA 3GR5A 4DV1H 4RZQA 4EEQA 3RIZA 3J81W 4APMA 4K0KH 2FE3A 4JI1H 2WYOA 3NCVA 3BA8A 2VQEH 4LH6A 3C0FB 4UCRA 1AN7A 4DV2H 1S03G 3J7AK 3J80W 4RB1A 4NXNH 5LL6b 1XNQH 3PN1A 1IBLH 4FM9A 1ZHQA 4DV4H 4LF9H 3KALA 3RTXA 3T1YH 1A0IA 3RJ0A 2D9IA 3N41B 3N40P 4BWSC 4J0MA 1N32H 2YCHA 2HVQA 1HNXH 2UU9H 1MZBA 4DV0H 2UUCH 2E5LH 1IBMH 3SB1A 3OSSD 4X65H 1BGWA 4A2BA 4CC6A 3L2PA 2ZM6H 2O03A 4RAZA 2CW8A 4R7RA 1B04A 4DR5H 3HXLA 4OCHA 4DR1H 1FKAH 1HR0H 3OTOH 2Q2UA 1V9PA 4YHHH 1TA8A 4DR2H 3N42B 4JI7H 1WH2A 2HVRA 2HHHH 4DV5H 2HVSA 4I7HA 4OD6A 2RGVA 5FD6A 2UUBH 3FAUA 4NZTM 1FVIA 4B3MH 4ETSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC H;  4PDB A;  4JI2 H;  1N36 H;  4DV3 H;  4LF5 H;  4KHP H;  4LF6 H;  5IT9 W;  4NXM H;  4LF4 H;  1XMQ H;  1J5E H;  1I94 H;  4DV7 H;  4X66 H;  2UXB H;  4YY3 H;  4AQY H;  4DR7 H;  4X62 H;  4JI3 H;  4LFC H;  1HNW H;  3JAM W;  4GKK H;  3RF2 A;  4LFB H;  2VQF H;  4GKJ H;  3T1H H;  1N34 H;  5A2Q W;  5LMU H;  1XNR H;  4DUZ H;  4JV5 H;  4JI0 H;  1N33 H;  4DV6 H;  4DR6 H;  5IWA H;  4DR3 H;  1FJG H;  4DR4 H;  4X64 H;  4JI8 H;  4JYA H;  4B3T H;  2F4V H;  1SEI A;  5FLX W;  4DUY H;  4LFA H;  4JI5 H;  4JI6 H;  4LF8 H;  1HNZ H;  1XMO H;  4OX9 H;  1IBK H;  4B3S H;  5BR8 H;  4JI4 H;  4B3R H;  4LF7 H;  5LMN H;  2UXD H;  2UUA H;  1I6U A;  4DV1 H;  3J81 W;  4K0K H;  4JI1 H;  2VQE H;  1AN7 A;  4DV2 H;  1S03 G;  3J7A K;  3J80 W;  4NXN H;  5LL6 b;  1XNQ H;  1IBL H;  4DV4 H;  4LF9 H;  3T1Y H;  1N32 H;  1HNX H;  2UU9 H;  4DV0 H;  2UUC H;  2E5L H;  1IBM H;  4X65 H;  2ZM6 H;  4DR5 H;  4DR1 H;  1HR0 H;  1FKA H;  3OTO H;  4YHH H;  4DR2 H;  4JI7 H;  2HHH H;  4DV5 H;  2UUB H;  4B3M H; 
#chains in the Genus database with same CATH topology
 3KHL A;  3NGD A;  4IHJ F;  3V69 A;  1EHI A;  5KFC A;  4JI2 H;  2UVW A;  5D1P A;  1RJQ A;  1JXL A;  4O3S A;  4WD3 A;  2R8I A;  4LF5 H;  2CPM A;  3T5J A;  2BR0 A;  1DIK A;  3VPB A;  4LF6 H;  1BXR A;  2W7P A;  5J2U F;  1V8C A;  2PBZ A;  1AUV A;  2AU0 A;  1J5E H;  5LOV F;  4U7C A;  3U9T A;  1RYR A;  2WB1 A;  1I94 H;  4DV7 H;  3WO0 A;  4TV8 F;  2JEG A;  2IP4 A;  1DTJ A;  3BQ2 A;  2XD4 A;  2V9W A;  3RAQ A;  3OUU A;  1HNW H;  3JAM W;  4GKK H;  3RF2 A;  2PMZ E;  2R87 A;  5JH7 F;  2VQF H;  4GKJ H;  1N34 H;  4NZR M;  5KG5 A;  2CTF A;  4MTD A;  3UQ8 A;  3N44 B;  3TIN A;  3MFH A;  4ED6 A;  4I55 F;  1XNR H;  2W9C A;  5LYJ F;  2DLN A;  2NN6 G;  1KJ8 A;  5KFB A;  4MV8 A;  4Q44 A;  4MA0 A;  5C5J A;  2CTL A;  2FKL A;  3L4K A;  1KC7 A;  4DLK A;  1FJG H;  1BNC A;  2WE6 A;  5L1K A;  2C00 A;  5KFR A;  4EC5 A;  2W57 A;  5GON F;  4R8U B;  4UCS A;  4IRK A;  1T36 A;  4RB3 C;  3ORR A;  5JVD F;  3JSL A;  3MWM A;  4LH7 A;  3VKE A;  5CB4 F;  5C1P A;  4QWD A;  1A9X A;  1T3N A;  1DV1 A;  5FPO A;  1SEI A;  1S0O A;  3EPI A;  5HBR B;  2LTL A;  2YRX A;  5D8D A;  2HJW A;  2VUG A;  3MWE A;  2PN1 A;  4RAY A;  2DWC A;  4G08 A;  1VAJ A;  2WAQ A;  4YJ2 F;  2AQ4 A;  4DUY H;  4ED1 A;  1S68 A;  2PVP A;  2W8K A;  1KJI A;  4Q8E A;  2G8Y A;  1XMO H;  2VKC A;  4OX9 H;  4J9R A;  4GLX A;  3E5N A;  2C2R A;  2AGP A;  3GTP A;  2FLP A;  1S10 A;  4Q8F A;  1KJJ A;  3MR3 A;  2PT7 G;  3JRW A;  5I47 A;  1GSA A;  4UCO A;  3F8N A;  5KFT A;  5KFO A;  2OH2 A;  2XIG A;  5H80 A;  5KFI A;  5KT6 A;  4MV7 A;  4EBD A;  3BAA A;  2FMR A;  2UXD H;  4IWX A;  1BJT A;  5LP6 F;  2M8W A;  3GTM A;  1I6U A;  2FK1 A;  4QW8 A;  5F9N A;  2JEA I;  1N56 A;  5IYC G;  4IR9 A;  2XGQ A;  2CTJ A;  2LTM A;  3BA8 A;  4YR2 A;  4ED0 A;  2YS7 A;  1AN7 A;  3J7A K;  5IP9 G;  4Q45 A;  3J80 W;  2JVZ A;  1VKZ A;  4RB1 A;  3Q8S B;  1SCU B;  2W6N A;  1XNQ H;  1AUX A;  4HR7 A;  1KBL A;  1ZHQ A;  2W6Z A;  1RJR A;  3RTX A;  2BL5 A;  2W71 A;  4RUA A;  3N41 B;  4O2B F;  3N40 P;  1N32 H;  2FPI B;  1X0A A;  1HNX H;  2HVQ A;  5KFX A;  2UUC H;  2W7O A;  4EYI B;  3SB1 A;  5IYD G;  4X65 H;  4A2B A;  5KFW A;  3WO1 A;  3MFI A;  1HR0 H;  3H0G G;  5LXT F;  4C2M A;  1V9P A;  2DPJ A;  2FLN A;  4DR2 H;  1C3O A;  2R8G A;  2HHH H;  4AYB E;  2HVS A;  4TV9 F;  4TQS A;  2FP4 B;  2UUB H;  1WHR A;  4NZT M;  2PQU A;  2C2E A;  2R7K A;  3GTG A;  1PX2 A;  4ETS A;  3M9M B;  2IBK A;  4C5B A;  1WE8 A;  1N36 H;  4MV4 A;  4DV3 H;  2SCU B;  4ECZ A;  2JA5 A;  4M9U A;  3DF7 A;  1SYX B;  5KFA A;  5DQH A;  1VIH A;  2MCT A;  3KXY T;  4NXM H;  3I4N G;  4EFE A;  4LIJ A;  2R7M A;  2CKZ B;  4GC6 A;  4J9M A;  5KG2 A;  2B63 G;  2JA7 G;  4B8T A;  4BBS G;  2R86 A;  1SFO A;  1WVN A;  2Q2T A;  3V4S A;  3T5K A;  1CS0 A;  5D1O A;  2QND A;  3PW5 A;  3HOU G;  4DR7 H;  5JEA G;  3N6X A;  1KJQ A;  4A93 G;  2I87 A;  3KDG A;  2C28 A;  2YZN A;  2R8H A;  1E4E B;  2WDT A;  5KKN B;  4WAL A;  3T1H H;  4IR1 A;  1TWC A;  1X4N A;  3EYY A;  5C44 G;  4A3E G;  4LMY A;  5LMU H;  3T5L A;  5L1J A;  4DL4 A;  1N33 H;  4C5C A;  3K3V A;  4DR6 H;  2ZJT A;  4DR3 H;  4YB8 B;  4EYH B;  1JIH A;  2NU6 B;  4ZQI A;  4NLG A;  3R5H A;  2XCA A;  4AYB A;  3BQ0 A;  3QZ7 A;  5C8Y F;  1JKJ B;  5IP7 G;  3K5I A;  1S97 A;  5D1O B;  5CA0 F;  2NU7 B;  5KFV A;  3Q2O A;  1N48 A;  2R7Z A;  3OHB A;  4O2A F;  4ED7 A;  3TIG A;  3RBE A;  3LWB A;  1GSH A;  5KT5 A;  4IZO A;  5J2T F;  5L1L A;  2R8J A;  5BPF A;  4RUC A;  2E2I A;  4DL2 A;  2F4V H;  5DQI A;  3R23 A;  2P0A A;  1CQJ B;  3GV8 B;  4HYK A;  4GC7 A;  3V6J A;  1ZQ7 A;  5JUM A;  1Y1W A;  3H40 A;  2R7Z G;  4YAK B;  1DGS A;  1RK6 A;  3K5H A;  2JEJ A;  3GQC A;  2W6M A;  3HB9 A;  5BPH A;  4F4X A;  1WCM G;  2DPI A;  2RF4 A;  4IAJ A;  3KHR A;  4LF8 H;  3G6Y A;  5KFY A;  3H4B A;  1S20 A;  2W6P A;  1TUA A;  1IBK H;  3U1K A;  2VPS A;  5EWG A;  4RB0 A;  4JV1 A;  3KDK A;  1I7L A;  5BR8 H;  4WAN A;  5KFU A;  2CWF A;  4JVY A;  3Q1K A;  2DGR A;  4XYM B;  4O3R A;  2B63 A;  2OWO A;  4B3R H;  2MJH A;  3GTK A;  4RNO A;  1WCM A;  4EBC A;  3R5X A;  2VUM G;  1X4M A;  1Z2O X;  2CTE A;  2UUA H;  2QK4 A;  1K83 A;  2R93 G;  3BA9 A;  2YQR A;  2X0S A;  3BAB A;  1GSO A;  3GR5 A;  4DV1 H;  3KAJ A;  3HKZ A;  2V4R A;  4EEQ A;  5DQG A;  3J81 W;  2XCP A;  4JI1 H;  2WYO A;  3NCV A;  2YYA A;  1K1G A;  4UCR A;  5KG7 A;  2CZG A;  3C0F B;  1ZZK A;  4HNT A;  2VA3 A;  4IFD G;  1K1Q A;  1RK5 A;  1ULZ A;  3UFX B;  1JLL B;  4FM9 A;  1IBL H;  2FFM A;  1DT4 A;  3FKI A;  4RNM A;  3GII A;  4MV1 A;  3RV4 A;  2CTM A;  5HV6 A;  3RJ0 A;  5KFM A;  4IRD A;  3PO3 G;  5KT7 A;  4QWE A;  4J0M A;  3I12 A;  3PR5 B;  2UVV A;  5KT4 A;  4BXX G;  1IBM H;  2NU8 B;  3OSS D;  3BQ1 A;  2O03 A;  5BMV F;  4RAZ A;  2CW8 A;  2AXY A;  3Q8R B;  4DR1 H;  1FKA H;  4J9L A;  4ZOL F;  1C30 A;  2DIK A;  4YHH H;  1OWT A;  3H0G A;  3N42 B;  3MWD A;  2YU9 A;  4J9Q A;  4HNV A;  4I7H A;  2NU9 B;  2P2R A;  2ZDH A;  4I50 F;  4A3D G;  4FU0 A;  3FAU A;  1FVI A;  2FB9 A;  2VQD A;  4ECX A;  2W9C B;  3PZP A;  2W6O A;  4A3M G;  1UC8 A;  3ETJ A;  2GPW A;  4NBQ A;  4PDB A;  1T94 A;  4TUY F;  1WR2 A;  4RZR A;  2ASJ A;  3AYH B;  3V6H A;  3GID A;  4M7E A;  4Q0Y A;  4YJ3 F;  4QIW A;  1KHM A;  4E9J A;  3ETH A;  3FDS A;  4CC5 A;  4ECW A;  4A3C G;  3GKU A;  3BG5 A;  5IT9 W;  5DG7 A;  4Q43 A;  2C35 B;  1K1S A;  4A3L G;  2PY9 A;  5DGB A;  4O3N A;  1MSZ A;  1XMQ H;  4LF4 H;  3FMA A;  2BA0 A;  2JE6 I;  1TWF A;  3G8C A;  3AEV B;  4ECU A;  3GIJ A;  1UC9 A;  2HH2 A;  4BBR G;  1NXU A;  4YY3 H;  4BY7 G;  2ZQE A;  1X9N A;  4JI3 H;  4UCT A;  2RDI A;  5KT3 A;  4ED8 A;  4A3I G;  1ZHS A;  4LFC H;  4ECS A;  4RB2 C;  2AGQ A;  2K1H A;  1B6S A;  2Y0S A;  1IOV A;  2XC9 A;  3SE7 A;  3I0P A;  3HBL A;  3VMM A;  2R8K A;  4HNU A;  4EGQ A;  3RUP A;  2GPS A;  3H20 A;  3QZ8 A;  1ZET A;  4XZ3 B;  3ORQ A;  2W9B A;  2UVU A;  3HOX G;  1M6V A;  2I8C A;  3HOZ G;  4IWY A;  5KFN A;  3R5F A;  5IWA H;  4QMF B;  1V4Y A;  2CW7 A;  5KFS A;  1W93 A;  4F4Z A;  3QD7 X;  3GTJ A;  1GGO A;  4R8U A;  3H4D A;  4DR4 H;  1M0T A;  3M4I A;  4X64 H;  4F4W A;  1ODH A;  5DG9 A;  4UCU A;  1O75 A;  2OPU A;  5DGA A;  2M05 A;  3OSN A;  3PW4 A;  1CE8 A;  3I4M G;  5DLF A;  2JZX A;  4B3T H;  1E4G T;  2R82 A;  2FLL A;  4IRC A;  2QYZ A;  4MV9 A;  3SI8 A;  2CWH A;  3TQ1 A;  4DL3 A;  2BQR A;  1Y1W G;  1V51 A;  2RGR A;  5DG8 A;  2W9B B;  3LML A;  1Y14 B;  5FD5 A;  5K2M A;  2VA2 A;  4UFZ A;  3RGZ A;  4ECV A;  2JEF A;  5FLX W;  4QWC A;  2W70 A;  3PW0 A;  4LFA H;  4JI5 H;  4O4I F;  4WBN F;  5JQW A;  1WSC A;  5KFD A;  4YQW A;  3GV7 B;  2BQ3 A;  2OLS A;  2JA6 G;  1L2Z A;  1V9N A;  2IA6 A;  1HNZ H;  3V6K A;  1B6R A;  2R84 A;  4B3S H;  3HOY G;  5IYB G;  3LP8 A;  2BQU A;  1F0X A;  2PMZ A;  1I50 A;  1EYZ A;  4JI4 H;  4O3P A;  4C5A A;  4MTE A;  3MR6 A;  2C22 A;  4J9K A;  1PQX A;  5CAE B;  1JX4 A;  1GYF A;  3MR2 A;  3IN5 A;  4LF7 H;  5FLM G;  3GIQ A;  2JEI A;  1X9Z A;  4XYL B;  4B8C D;  3PVX A;  4DL7 A;  2KSW A;  4O3O A;  4QW9 A;  1TWG A;  4ECR A;  4AIM A;  1EUC B;  4RZQ A;  2YW2 A;  4Y8V B;  5KG3 A;  4K0K H;  2FE3 A;  2V58 A;  2C2D A;  4QWB A;  3G6V A;  4ME6 A;  2VQE H;  1UNN C;  4LH6 A;  1S03 G;  4DV2 H;  3KTM A;  4FBU A;  4YP3 A;  2Z0S A;  4J9O A;  3Q8P B;  5KFZ A;  4JVH A;  3G6X A;  3RB0 A;  4NXN H;  5C1O A;  5LL6 b;  2JA8 G;  2R6F A;  3PN1 A;  4I4T F;  4OO1 G;  4LF9 H;  4F4Y A;  1VBI A;  5CA1 F;  4AM3 A;  3T1Y H;  1A0I A;  3Q8Q B;  2J6U A;  3PW7 A;  3VPC A;  3OHA A;  2JEB I;  4EEY A;  2UU9 H;  1MZB A;  3GTO A;  4DV0 H;  4ED2 A;  5IYZ F;  2RDJ A;  1BGW A;  3T5H A;  1S0N A;  4FJU A;  1ZTG A;  2WAQ E;  4CC6 A;  1I7N A;  5KFL A;  3L2P A;  1KJ9 A;  4R7R A;  1Y1V G;  1B04 A;  5KX5 F;  4A3G G;  2ANN A;  2R92 A;  1VIG A;  4DR5 H;  4OCH A;  3FKI G;  3OUZ A;  3KHG A;  5T14 A;  4YR3 A;  3KHH A;  1J4W A;  5KFF A;  1VBG A;  2W8L A;  4J9S A;  2LRR A;  5EZY F;  2Q2U A;  3H3V H;  3GV5 B;  3MR5 A;  2HVR A;  4FJS A;  2AGO A;  2CTK A;  4O3Q A;  3V4Z A;  5C3E G;  3TII A;  2IMW P;  1TWH A;  4JV0 A;  3RB4 A;  1Z2I A;  3RFC A;  4B3M H;  4EGJ A;  4EG0 A;  5KFE A;  2XGP A;  2UXC H;  3GLK A;  4EBE A;  2VUM A;  2ZDG A;  4JV2 A;  2LF0 A;  3IG0 A;  5KFH A;  3N8D A;  1J5K A;  5EWF A;  4KHP H;  1DV2 A;  3GIM A;  3U9S A;  3WNZ A;  1EC6 A;  2GLT A;  2W6Q A;  2NUA B;  1TWA A;  1KEE A;  3EPG A;  2E2H A;  1RYS A;  5KG0 A;  3HOW G;  4ZI7 F;  3GAB A;  1B33 N;  1GO3 E;  2J6T A;  4X66 H;  2UXB H;  4AQY H;  4ECQ A;  4O4H F;  2I80 A;  4X62 H;  2NVY A;  3TQT A;  4A3K G;  1XDN A;  5KG4 A;  2CPQ A;  1E4E A;  1CQI B;  3CQZ A;  4A3B G;  3PR4 A;  1I3Q A;  4LFB H;  1R9T A;  5A2Q W;  3RAX A;  1ZZI A;  4BA2 I;  2E3U A;  2YZG A;  4DUZ H;  3CVZ A;  4JV5 H;  4EFB A;  5KFG A;  1Z2N X;  4L1K A;  3EZJ A;  4JI0 H;  4J9P A;  3L7Z C;  5KG1 A;  3QFF A;  2R7N A;  2YL2 A;  4DV6 H;  2FPH X;  4F50 A;  3RB6 A;  2J6S A;  1TAE A;  4FS1 A;  4FS2 A;  3KAK A;  2O4C A;  5C4X G;  2VOB A;  1ZZJ A;  2FMA A;  3RV3 A;  2OPV A;  4YAJ B;  2HH3 A;  3JRX A;  5KFQ A;  5L1I A;  4J9N A;  1M0W A;  4BY1 G;  2R92 G;  2YRW A;  4YBZ B;  4HQ6 A;  4JI8 H;  4JYA H;  2V59 A;  4RNN A;  2R85 A;  4QJF A;  3M9O B;  5EOY A;  3RGX A;  3RB3 A;  2UVR A;  3GTL A;  2A1S A;  2WTF A;  2V5A A;  2HGS A;  4DL5 A;  2M6Q A;  1UG8 A;  2VPQ A;  2NVX A;  2Y3M A;  1M7J A;  1JDE A;  3OSP A;  3OET A;  1EUD B;  1RJP A;  4A3J G;  5F9L A;  2WB1 E;  4JI6 H;  1IOW A;  2CQY A;  1S0M A;  2FPG B;  4G3I A;  5DT9 A;  2FJZ A;  4LSX A;  3GIP A;  1Z2P X;  4ECT A;  3N43 B;  4MV3 A;  5FPR A;  4A2A A;  2DZD A;  4H8A A;  4JUZ A;  4LSA A;  3RBD A;  3L4J A;  1JDB B;  1P8L A;  4XX0 B;  3GIK A;  5KFP A;  2FK3 A;  5LMN H;  1WTJ A;  2X06 A;  4A3F G;  3JSN A;  2R93 A;  1E4F T;  4UCV A;  1VS0 A;  4QIW E;  3K3P A;  4FBT A;  2ASL A;  4PWQ A;  3RIZ A;  4APM A;  4ED3 A;  4U6P A;  3GTQ A;  2JA7 A;  2W9A A;  4O4L F;  2XCL A;  3UOE A;  4MAM A;  5EDW A;  1PK8 A;  4BA1 I;  2VR1 A;  1VBH A;  3JZI A;  3VPD A;  2V4Q A;  4DV4 H;  5C0X G;  3KAL A;  5LA6 F;  5KT2 A;  4ECY A;  5KFJ A;  2FK2 A;  5KFK A;  2ASD A;  3PO2 G;  2D9I A;  3HKZ E;  1S9F A;  2J9G A;  4BWS C;  5JVL A;  2Y0S E;  2YCH A;  4DL6 A;  2YS6 A;  4QWA A;  1XRH A;  2E5L H;  2ZDQ A;  2ALZ A;  2YZM A;  4MV6 A;  2R7L A;  4TQR A;  2ZM6 H;  1W96 A;  3MJF A;  4E4T A;  3M9N B;  5L9X A;  2ANR A;  3GIL A;  3PW2 A;  2ATL A;  3HXL A;  1EZ1 A;  3OTO H;  4RU9 A;  5K36 G;  4ZHQ F;  5EWE A;  3HOV G;  1TA8 A;  5DLG A;  4JI7 H;  1WH2 A;  3BJY A;  1GLV A;  4DV5 H;  2FPP B;  2JA5 G;  5KG6 A;  4MA5 A;  4OD6 A;  4YR0 A;  2RGV A;  5FD6 A;  1Y1V A;  2JA6 A;  2JA9 A;  5FJ8 G; 
#chains in the Genus database with same CATH homology
 2UXC H;  4PDB A;  2LF0 A;  4JI2 H;  1N36 H;  3IG0 A;  4DV3 H;  4Q0Y A;  5D1P A;  4M7E A;  4LF5 H;  4E9J A;  4KHP H;  1SYX B;  3DF7 A;  4CC5 A;  4LF6 H;  2MCT A;  5IT9 W;  4NXM H;  3KXY T;  4EFE A;  4LF4 H;  1XMQ H;  3FMA A;  1J5E H;  2Q2T A;  1I94 H;  3GAB A;  4DV7 H;  4X66 H;  5D1O A;  2UXB H;  4YY3 H;  4AQY H;  4DR7 H;  3N6X A;  2ZQE A;  4X62 H;  4JI3 H;  1X9N A;  4UCT A;  1XDN A;  3KDG A;  1ZHS A;  4LFC H;  4RB2 C;  1HNW H;  3JAM W;  4GKK H;  3RF2 A;  2WDT A;  4LFB H;  2VQF H;  4GKJ H;  3T1H H;  4NZR M;  1N34 H;  4MTD A;  3UQ8 A;  3N44 B;  5A2Q W;  3EYY A;  4LMY A;  5LMU H;  1XNR H;  4EFB A;  3CVZ A;  4DUZ H;  4JV5 H;  1Z2N X;  3H20 A;  3EZJ A;  4JI0 H;  3L4K A;  1N33 H;  4DV6 H;  2FPH X;  4DR6 H;  2ZJT A;  5IWA H;  4DR3 H;  1FJG H;  1TAE A;  2CW7 A;  2WE6 A;  2O4C A;  3KAK A;  4EC5 A;  2W57 A;  3QD7 X;  4UCS A;  4RB3 C;  2VOB A;  4DR4 H;  3JSL A;  5D1O B;  1M0T A;  3M4I A;  3MWM A;  4X64 H;  1M0W A;  4LH7 A;  1ODH A;  4UCU A;  1O75 A;  4JI8 H;  4JYA H;  5FPO A;  5EOY A;  4B3T H;  2F4V H;  1E4G T;  1SEI A;  3RGX A;  4MV9 A;  2HGS A;  2VUG A;  2RGR A;  4RAY A;  3LML A;  5FD5 A;  2Y3M A;  1DGS A;  4G08 A;  4UFZ A;  3RGZ A;  3OET A;  5FLX W;  4DUY H;  4LFA H;  4JI5 H;  1L2Z A;  1S68 A;  3K3V A;  4JI6 H;  4IAJ A;  4LF8 H;  1HNZ H;  1XMO H;  5DT9 A;  2VKC A;  4OX9 H;  4LSX A;  4GLX A;  1Z2P X;  1IBK H;  2VPS A;  4B3S H;  3N43 B;  4RB0 A;  5FPR A;  3KDK A;  1F0X A;  5BR8 H;  4A2A A;  2PT7 G;  4JI4 H;  4LSA A;  4MTE A;  4UCO A;  3L4J A;  3F8N A;  1GYF A;  2OWO A;  1P8L A;  4B3R H;  2XIG A;  4LF7 H;  4MV7 A;  5LMN H;  3BAA A;  1X9Z A;  2UXD H;  4B8C D;  1Z2O X;  3JSN A;  2UUA H;  1BJT A;  1E4F T;  2KSW A;  1I6U A;  1VS0 A;  3BAB A;  3BA9 A;  4UCV A;  3KAJ A;  3GR5 A;  4DV1 H;  4RZQ A;  4EEQ A;  3RIZ A;  3J81 W;  4APM A;  4K0K H;  2FE3 A;  4JI1 H;  2WYO A;  3NCV A;  3BA8 A;  2VQE H;  4LH6 A;  3C0F B;  4UCR A;  1AN7 A;  4DV2 H;  1S03 G;  3J7A K;  3J80 W;  4RB1 A;  4NXN H;  5LL6 b;  1XNQ H;  3PN1 A;  1IBL H;  4FM9 A;  1ZHQ A;  4DV4 H;  4LF9 H;  3KAL A;  3RTX A;  3T1Y H;  1A0I A;  3RJ0 A;  2D9I A;  3N41 B;  3N40 P;  4BWS C;  4J0M A;  1N32 H;  2YCH A;  2HVQ A;  1HNX H;  2UU9 H;  1MZB A;  4DV0 H;  2UUC H;  2E5L H;  1IBM H;  3SB1 A;  3OSS D;  4X65 H;  1BGW A;  4A2B A;  4CC6 A;  3L2P A;  2ZM6 H;  2O03 A;  4RAZ A;  2CW8 A;  4R7R A;  1B04 A;  4DR5 H;  3HXL A;  4OCH A;  4DR1 H;  1FKA H;  1HR0 H;  3OTO H;  2Q2U A;  1V9P A;  4YHH H;  1TA8 A;  4DR2 H;  3N42 B;  4JI7 H;  1WH2 A;  2HVR A;  2HHH H;  4DV5 H;  2HVS A;  4I7H A;  4OD6 A;  2RGV A;  5FD6 A;  2UUB H;  3FAU A;  4NZT M;  1FVI A;  4B3M H;  4ETS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...