5IT9W

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
129
Chain Sequence
TRTSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIADVEKWTANLLPARQFGYVILTTSAGIMDHEEAHRKHVSGKILGFVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
total genus 29
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 5it9W01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 5it9W02
4DUYH 4DV5H 1SEIA 1IBKH 4JI7H 2UXBH 2E5LH 4LF6H 4PDBA 1HNXH 4LF7H 4KHPH 4X62H 4DR3H 4B3MH 1FKAH 3J81W 4OX9H 4LFBH 3JAMW 4LF4H 4B3SH 5BR8H 5LMUH 4DR1H 4JYAH 1XNQH 4DUZH 1XNRH 1XMQH 4JI6H 3T1YH 4JI1H 4DR5H 4DV4H 4JI8H 4YHHH 4GKKH 3OTOH 4DR2H 1N36H 2VQEH 4NXMH 4JI3H 2HHHH 4DV1H 2UUBH 1N33H 1HNZH 1J5EH 4DR4H 4DV0H 4X65H 2UUCH 2ZM6H 5LMNH 4DV7H 4DV6H 2UXDH 4LFCH 4LF5H 1FJGH 4AQYH 4GKJH 3RF2A 4DR6H 4JV5H 4DV3H 2F4VH 5FLXW 1AN7A 4LF9H 4DV2H 5IWAH 4JI5H 4JI0H 1N34H 1HNWH 4X66H 4NXNH 4K0KH 4LF8H 4YY3H 4B3TH 5LL6b 1XMOH 1HR0H 4JI2H 4DR7H 2UUAH 2UU9H 2VQFH 3T1HH 1IBLH 4B3RH 2UXCH 1N32H 4X64H 4JI4H 3J7AK 1I94H 4LFAH 5IT9W 1IBMH 1I6UA 1S03G 5A2QW 3J80W
chains in the Genus database with same CATH superfamily
2R87A 1SEIA 1KJJA 5DLGA 2M8WA 2ASJA 1HNXH 1CQJB 4JUZA 2AGQA 1B04A 4BXXG 4A3LG 4FBTA 3GTQA 5J2UF 3PR4A 1AUVA 2YZGA 4RU9A 4QWDA 2CKZB 3GKUA 4DR3H 2CWHA 1XRHA 1FKAH 3J81W 5FPRA 2R8JA 4LFBH 4ED0A 3KXYT 4J9KA 4F4XA 3JRXA 3UQ8A 3QD7X 3WO0A 2DPJA 3G6XA 4XYMB 4B3SH 1E4GT 2DLNA 3K3PA 4R7RA 3KHGA 3H0GA 4FM9A 3T5LA 2OLSA 4YJ3F 5EWFA 4IRKA 2OPUA 1XNQH 4R8UA 5KX5F 2PN1A 2W7PA 2XC9A 4J9MA 3H20A 4MV7A 4EFBA 5KT5A 5DG8A 3M9NB 3OSSD 2FB9A 4I55F 1XMQH 5KKNB 5DG9A 2VPSA 2AQ4A 5DT9A 1CS0A 4XYLB 4J9SA 4A3CG 1KBLA 1JLLB 4AIMA 3QFFA 5KFLA 2BQRA 1VBGA 1WVNA 4DV4H 5HV6A 5KT3A 1KJQA 2XIGA 4RB1A 1V8CA 2HH2A 2I80A 2FPGB 2RF4A 2YRXA 4DR2H 1TUAA 5CB4F 5KFEA 4IFDG 1GYFA 4NXMH 3RAXA 1ULZA 2FK1A 3R5FA 1S0NA 3RB6A 5GONF 4Q8EA 2FK2A 4NBQA 2HHHH 2R92A 3PN1A 1V4YA 2O4CA 1HNZH 2PMZA 3I4MG 2XD4A 2NN6G 2Q2UA 1GO3E 4WBNF 3T5KA 2UVWA 1DT4A 4X65H 4MV1A 3EZJA 5KFMA 4BY7G 4E9JA 2KSWA 2B63G 3SB1A 1EYZA 2R7ZA 5LMNH 3V4ZA 1DTJA 4C5CA 2AU0A 4DV6H 5KT6A 2UXDH 1ZZIA 4DLKA 3QZ7A 3GLKA 2R85A 3RTXA 5F9NA 2C35B 2VA2A 1Y1WA 5D1PA 2IP4A 2FJZA 4O4LF 4FS1A 4ECZA 4DV3H 3NCVA 5FJ8G 3LWBA 3RB4A 1J4WA 2BQUA 1E4FT 1XDNA 1Z2IA 3RBEA 3WNZA 1K1QA 2Q2TA 5C4XG 2FMAA 4RUAA 4OD6A 3MJFA 4DV2H 1JDEA 4Y8VB 4A2AA 3PO2G 4JI5H 3RGXA 2HH3A 1N34H 4JI0H 4YQWA 5KT2A 4LF8H 3E5NA 4EEYA 4MV9A 5KFDA 1EZ1A 1VIGA 5LL6b 1Y1VA 4YAJB 3GIJA 5L9XA 4GC6A 2XGQA 2UUAH 2HGSA 3F8NA 3IG0A 2VQFH 3T1HH 1EHIA 1IBLH 1S10A 5DQHA 5KFZA 1MZBA 2C28A 2UVUA 2C2DA 3N41B 4O3NA 1N32H 4Q0YA 2J9GA 3Q8PB 1ZZJA 1Z2NX 4JV1A 1C30A 4IWYA 3GQCA 5KFFA 4O3QA 4L1KA 1BGWA 4J9PA 1S0OA 1BNCA 2CW7A 3N42B 2XCLA 3FMAA 4IR9A 4LIJA 1IBMH 3KHRA 1WCMG 3GIQA 2J6SA 1E4EB 2CTLA 2W6NA 1DGSA 4JVHA 4A3BG 5A2QW 3PR5B 2GPWA 4EGJA 5KFHA 3BJYA 2JEBI 4A3KG 4DV5H 4OO1G 1IBKH 2I8CA 1KHMA 1T94A 2V58A 4EG0A 4RNMA 3OSPA 4HR7A 4QIWA 2UVVA 2E5LH 4LF6H 4PDBA 1BXRA 2JA5A 4UCRA 5KG0A 3OHBA 4LF7H 4DL2A 3TIIA 2Z0SA 3TIGA 2CTFA 1IOVA 1ZQ7A 4FS2A 2FFMA 1WHRA 4A3FG 5KG5A 2R6FA 4OX9H 2AGOA 2FMRA 4YR3A 1KEEA 4LF4H 4DL3A 2LRRA 2YU9A 3N8DA 2YZNA 4M7EA 3Q8RB 4JYAH 4RB0A 2R8IA 4Q43A 4LH7A 4QWEA 4TQSA 2FPHX 5DG7A 3ETHA 4NLGA 1TWFA 4DUZH 4A2BA 3BQ0A 3OHAA 2CZGA 3KALA 2O03A 1BJTA 4O3OA 2BQ3A 3H0GG 4JI1H 4RB2C 4MA0A 5KFJA 3MR3A 4DL4A 5FD6A 4ECWA 1N48A 2E2HA 4G3IA 3GABA 4C5AA 4EFEA 3MFHA 4GKKH 3Q8QB 4EBCA 5LYJF 3JZIA 3PZPA 3R5HA 3RB0A 2X0SA 3OTOH 2GLTA 5KFRA 4RNOA 3R5XA 1N36H 2YQRA 2ALZA 2WB1E 2OWOA 1WE8A 1EUDB 3VPCA 3PW0A 4MV8A 4I50F 3G6VA 5J2TF 4MTEA 4ECYA 5KG3A 4Q8FA 3PW4A 2UUBH 2FLLA 4DL6A 2JA6A 3V6KA 2R8KA 5KG7A 3HXLA 3PVXA 4DR4H 5KFVA 3UFXB 5KFBA 1JXLA 3H3VH 3K5HA 4FJUA 4ETSA 4DV0H 4PWQA 4UCOA 2YCHA 3RBDA 2VA3A 3GTKA 4QMFB 4B8CD 3FDSA 3Q8SB 1IOWA 2R92G 3Q2OA 1S0MA 3OETA 2J6UA 3TINA 3TQTA 3GIMA 2ASDA 4TUYF 2CPQA 3RV3A 4F4WA 4ECTA 3N43B 1E4EA 4ED3A 1VS0A 2HJWA 3C0FB 2R7LA 2JA7A 1TWCA 2RGRA 3V6JA 4AQYH 3U9TA 2WTFA 2R7MA 3RF2A 4DR6H 3GTOA 5EWEA 4EBDA 4NZTM 2F4VH 2ZDHA 2R7ZG 1M7JA 1RK5A 1ZHQA 4ZI7F 3H4DA 2JEIA 2AXYA 4I4TF 4BBRG 1AN7A 2WAQE 2ZDQA 3EYYA 1Y1WG 2NU8B 4LF9H 4JV2A 1M6VA 5EOYA 4E4TA 4QWBA 5EDWA 3M9OB 1X4NA 2W6MA 3KHHA 1K83A 3RB3A 2W9BA 2VUMA 4LSXA 3BQ1A 5IP9G 4MV3A 1L2ZA 2NU6B 1KJIA 2FLNA 2BA0A 4B3TH 5T14A 4TQRA 1KJ9A 2UU9H 3BAAA 3BA8A 5D1OB 5KFTA 4BBSG 4AYBE 3PO3G 2OPVA 2NU9B 5DQIA 1A0IA 5C1PA 3GTJA 2W9CA 3GTMA 1ZZKA 1PK8A 4J9LA 3AEVB 4EYIB 1TA8A 1Y1VG 4JI4H 4A3EG 2G8YA 2LTMA 3MWMA 4RNNA 2ANRA 2JEFA 2CQYA 2R84A 5IT9W 4ED8A 3V6HA 2IMWP 3VKEA 4DL5A 4QJFA 1UNNC 2A1SA 3QZ8A 3HOWG 1AUXA 4C2MA 4U7CA 3MWEA 2C22A 1S03G 2CW8A 5D8DA 2DZDA 3J80W 2DIKA 4HNUA 1J5KA 4DUYH 4UCUA 1GSAA 2R93A 1Z2OX 2M6QA 2CTKA 1B6RA 3BG5A 2C2EA 1JKJB 3HKZE 3I0PA 2UXBH 2E3UA 2JEAI 2PBZA 3MR6A 2K1HA 2WE6A 5CAEB 4EBEA 1T3NA 5K2MA 4A3DG 3V4SA 1N56A 2JE6I 4G08A 3RGZA 5KFPA 2R7KA 2NVXA 2LF0A 4B3MH 4HNTA 4YR0A 2VUGA 4BWSC 3V69A 3LP8A 4FJSA 2Y3MA 4IWXA 5IYBG 2DWCA 2JA5G 3KTMA 4MA5A 5C5JA 3WO1A 2M05A 4TV9F 4IZOA 5LMUH 3GTLA 3OUZA 4BA2I 4MV4A 2ZJTA 3ORQA 5F9LA 1V9NA 2DGRA 1CE8A 5C44G 4DL7A 5KFAA 5DGAA 3HOXG 2PY9A 5IP7G 3T1YH 2NUAB 1RK6A 2YYAA 1I50A 2V4RA 4DR5H 4JI8H 4R8UB 4YHHH 4BA1I 2YRWA 4MV6A 1Y14B 4Q44A 1I7LA 2FKLA 2CPMA 5KFNA 4U6PA 2YS7A 1SYXB 3G8CA 2ASLA 2NU7B 4LMYA 3MR5A 3EPIA 4ECSA 3K3VA 1SFOA 1NXUA 2FK3A 3IN5A 4ED6A 2R8GA 2UVRA 4ECQA 4A93G 2V4QA 3N6XA 4YBZB 3OSNA 2IA6A 4JI3H 2CWFA 1GSHA 4YR2A 4DV1H 3HOYG 3FKIA 2XCAA 1WTJA 4F4ZA 3JRWA 4LSAA 1J5EH 4MTDA 5JEAG 2YZMA 1TWAA 4A3GG 2FE3A 2BL5A 2UUCH 4MAMA 3GV8B 1UC9A 2R8HA 1F0XA 1VAJA 2WB1A 3VPDA 5KFWA 4RZQA 4DV7H 2JA6G 3H4BA 5KG1A 3MR2A 4APMA 2W6PA 1S68A 4WANA 2C2RA 1TWGA 3N40P 5KFIA 1FJGH 1K1SA 1V9PA 5L1IA 2HVSA 2W70A 5C8YF 5LOVF 2VPQA 4JV5H 4J0MA 1RJPA 5I47A 2R86A 4RB3C 2V9WA 3GILA 5FLXW 3PW7A 5IYCG 4EC5A 3RIZA 3OUUA 4ECXA 3CQZA 2CTJA 2P0AA 2YS6A 4ZQIA 1ZHSA 4EEQA 3GV5B 2JA7G 2V59A 1UC8A 3VMMA 4B8TA 4FU0A 4O4HF 3GR5A 1I3QA 5IWAH 1GGOA 5C1OA 2YW2A 3L2PA 2HVRA 2RDIA 5CA0F 1HNWH 4NXNH 3H40A 2R7NA 5IYDG 4K0KH 3KAKA 3K5IA 3GV7B 4WALA 1XMOH 1HR0H 2VOBA 4DR7H 4IRDA 3JSLA 1V51A 4RAYA 2I87A 1S20A 3BABA 2UXCH 1OWTA 2JVZA 3VPBA 5FLMG 2PT7G 4ED7A 3JSNA 4YJ2F 2JZXA 4BY1G 5JH7F 3PW2A 4O3SA 2VUMG 2D9IA 2WAQA 3KDGA 4X64H 4O2BF 4J9NA 4A3IG 1ZETA 1RYSA 2FP4B 5LXTF 3G6YA 3J7AK 4ECVA 3M9MB 1I94H 1M0TA 2HVQA 3PW5A 2R82A 3BQ2A 1PQXA 3T5HA 2W8LA 1M0WA 2W57A 5JVLA 3MFIA 5KFSA 3ORRA 2CTEA 3GTGA 3HOZG 4AYBA 2QNDA 1I6UA 2ATLA 5IYZF 1KC7A 3GIDA 4A3JG 2PVPA 3MWDA 4J9OA 4JI7H 4HYKA 4O3PA 1R9TA 2FPPB 4O2AF 4KHPH 4AM3A 4ZHQF 5EZYF 1I7NA 1DIKA 2YL2A 3HOUG 4EGQA 3GIIA 2IBKA 4HNVA 4ED1A 4X62H 3HBLA 4JVYA 2R93G 5C0XG 5KFKA 4TV8F 3GIKA 2Y0SA 4A3MG 2RGVA 3JAMW 1WR2A 3RUPA 2W7OA 3CVZA 1JX4A 5BR8H 5BPHA 4DR1H 2MJHA 3KHLA 1TAEA 1DV2A 4GC7A 3HKZA 4XZ3B 3AYHB 1CQIB 2JA8G 4ME6A 1GSOA 4UCTA 5FPOA 4Q45A 4EYHB 5EWGA 5JQWA 4J9RA 2Y0SE 1XNRH 5BPFA 3GTPA 2FPIB 3FAUA 4JI6H 4O4IF 3HB9A 4O3RA 2FLPA 3DF7A 3L4KA 1DV1A 1ODHA 5JUMA 4FBUA 2PMZE 5L1LA 2W71A 4J9QA 2QK4A 5KFOA 1O75A 4UCSA 4UFZA 1RJRA 2ZDGA 1TWHA 3ETJA 2WYOA 3Q1KA 1VIHA 2VR1A 3RJ0A 4RAZA 2VQEH 3GIPA 5CA1F 1MSZA 5H80A 3SE7A 1S9FA 2DPIA 3KAJA 1WH2A 5DQGA 4GLXA 4IR1A 4IAJA 4QW8A 1WSCA 4RUCA 4ECRA 2B63A 4CC5A 4YAKB 1X4MA 1N33H 3TQ1A 5KG4A 3L4JA 2J6TA 3I4NG 4H8AA 4WD3A 1C3OA 3LMLA 3U1KA 3R23A 2W6OA 5L1KA 3NGDA 2ZQEA 2V5AA 1B6SA 2QYZA 1X0AA 3I12A 1JIHA 5LA6F 5KFGA 3T5JA 3L7ZC 3RAQA 3FKIG 4CC6A 2ZM6H 2P2RA 3UOEA 4XX0B 1P8LA 4ECUA 2CTMA 2W6ZA 4JV0A 1A9XA 4NZRM 1PX2A 2WDTA 2XGPA 5KT7A 1EUCB 4LFCH 4LF5H 2NVYA 2MCTA 1W93A 4GKJH 3KDKA 2JEJA 1W96A 3U9SA 2RDJA 1GLVA 1SCUB 1T36A 4LH6A 5KFQA 4QWAA 2LTLA 3RV4A 1FVIA 1KJ8A 5LP6F 5D1OA 1JDBB 4QW9A 4YP3A 2W6QA 2X06A 2W8KA 2OH2A 5KFYA 4M9UA 5KG6A 3M4IA 1VKZA 4X66H 1VBHA 2VQDA 5JVDF 3EPGA 4ED2A 2E2IA 5L1JA 4YY3H 5KFCA 4RZRA 2JEGA 2VKCA 1Z2PX 4JI2H 3BA9A 5BMVF 4F4YA 4F50A 4IRCA 1S97A 5KFUA 1ZTGA 4B3RH 5HBRB 5K36G 1B33N 4UCVA 3RFCA 4C5BA 1X9ZA 1X9NA 1WCMA 3HOVG 1UG8A 2PQUA 2W9AA 5DLFA 2XCPA 4ZOLF 2W9BB 4QIWE 2ANNA 5C3EG 2BR0A 2GPSA 4YB8B 1RYRA 5DGBA 3N44B 5KFXA 4IHJF 2SCUB 3SI8A 4I7HA 4HQ6A 5FD5A 5KG2A 4LFAH 4QWCA 2C00A 2W9CB 1EC6A 1K1GA 2AGPA 1VBIA 2JA9A 4OCHA 1RJQA 5KT4A
chains in the Genus database with same CATH topology
4DUYH 4DV5H 1SEIA 1IBKH 1Z2OX 4JI7H 2UXBH 2E5LH 4LF6H 4PDBA 4UCRA 1HNXH 4LF7H 4KHPH 2WE6A 1B04A 4G08A 3RGZA 4X62H 5FPRA 4DR3H 2LF0A 4B3MH 1FKAH 3J81W 4OX9H 2VUGA 4BWSC 4LFBH 3KXYT 2Y3MA 3UQ8A 3QD7X 2RGVA 3JAMW 4LF4H 4B3SH 1E4GT 4R7RA 3CVZA 4FM9A 5BR8H 4M7EA 5LMUH 4DR1H 1TAEA 4JYAH 4RB0A 1XNQH 4LH7A 2FPHX 2ZJTA 4UCTA 5FPOA 3H20A 4MV7A 4EFBA 3OSSD 4DUZH 1XNRH 1XMQH 4A2BA 3FAUA 4JI6H 3KALA 2O03A 2VPSA 1BJTA 3F8NA 5DT9A 3T1YH 3DF7A 3L4KA 4JI1H 1ODHA 4RB2C 5FD6A 4DR5H 4DV4H 4JI8H 3GABA 4EFEA 4YHHH 1O75A 4UCSA 4UFZA 4GKKH 2XIGA 4RB1A 2WYOA 1SYXB 3OTOH 3RJ0A 4DR2H 4RAZA 1N36H 2VQEH 4LMYA 3K3VA 2OWOA 1GYFA 4NXMH 3KAJA 1WH2A 4GLXA 3N6XA 4MTEA 4IAJA 3BA9A 4JI3H 2HHHH 4DV1H 4CC5A 2UUBH 3PN1A 2O4CA 1N33H 1HNZH 3L4JA 4LSAA 2Q2UA 1J5EH 3HXLA 4MTDA 4DR4H 3LMLA 4ETSA 4DV0H 4UCOA 2YCHA 4X65H 2ZQEA 2FE3A 3EZJA 2UUCH 4B8CD 4E9JA 2KSWA 1F0XA 3SB1A 4CC6A 3OETA 2ZM6H 5LMNH 4DV7H 4RZQA 5D1OB 4DV6H 2UXDH 1P8LA 4APMA 3N43B 3RTXA 4NZRM 1S68A 1VS0A 2WDTA 3C0FB 2RGRA 4LFCH 4LF5H 1FJGH 3N40P 4AQYH 1S03G 2MCTA 1V9PA 4GKJH 3RF2A 3KDKA 4DR6H 5D1PA 2HVSA 4JV5H 4J0MA 4DV3H 4RB3C 4NZTM 3NCVA 2F4VH 5FLXW 4LH6A 4EC5A 3RIZA 1ZHQA 1E4FT 1FVIA 1XDNA 4EEQA 1ZHSA 2Q2TA 1AN7A 5D1OA 3EYYA 4OD6A 3GR5A 4DV2H 5IWAH 4LF9H 4A2AA 3L2PA 4JI5H 5EOYA 3RGXA 2HVRA 4JI0H 1N34H 1HNWH 4X66H 4NXNH 3M4IA 1L2ZA 4LSXA 4K0KH 4LF8H 3KAKA 4YY3H 4MV9A 4B3TH 5LL6b 1XMOH 2VKCA 4JI2H 1HR0H 4DR7H 1Z2PX 2VOBA 2UUAH 2UU9H 2HGSA 3BA8A 2VQFH 3T1HH 3BAAA 1IBLH 4B3RH 3BABA 2UXCH 3IG0A 4UCVA 1MZBA 1X9NA 1X9ZA 2PT7G 1A0IA 3JSNA 3N41B 4RAYA 1N32H 2D9IA 4Q0YA 3KDGA 4X64H 1Z2NX 1TA8A 4JI4H 3J7AK 1BGWA 1I94H 1M0TA 2HVQA 2CW7A 3N42B 3N44B 4I7HA 5FD5A 3FMAA 4LFAH 3MWMA 1M0WA 2W57A 5IT9W 1IBMH 3JSLA 1DGSA 1I6UA 4OCHA 2CW8A 5A2QW 3J80W 4UCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUY H;  4DV5 H;  1SEI A;  1IBK H;  4JI7 H;  2UXB H;  2E5L H;  4LF6 H;  4PDB A;  1HNX H;  4LF7 H;  4KHP H;  4X62 H;  4DR3 H;  4B3M H;  1FKA H;  3J81 W;  4OX9 H;  4LFB H;  3JAM W;  4LF4 H;  4B3S H;  5BR8 H;  5LMU H;  4DR1 H;  4JYA H;  1XNQ H;  4DUZ H;  1XNR H;  1XMQ H;  4JI6 H;  3T1Y H;  4JI1 H;  4DR5 H;  4DV4 H;  4JI8 H;  4YHH H;  4GKK H;  3OTO H;  4DR2 H;  1N36 H;  2VQE H;  4NXM H;  4JI3 H;  2HHH H;  4DV1 H;  2UUB H;  1N33 H;  1HNZ H;  1J5E H;  4DR4 H;  4DV0 H;  4X65 H;  2UUC H;  2ZM6 H;  5LMN H;  4DV7 H;  4DV6 H;  2UXD H;  4LFC H;  4LF5 H;  1FJG H;  4AQY H;  4GKJ H;  3RF2 A;  4DR6 H;  4JV5 H;  4DV3 H;  2F4V H;  5FLX W;  1AN7 A;  4LF9 H;  4DV2 H;  5IWA H;  4JI5 H;  4JI0 H;  1N34 H;  1HNW H;  4X66 H;  4NXN H;  4K0K H;  4LF8 H;  4YY3 H;  4B3T H;  5LL6 b;  1XMO H;  1HR0 H;  4JI2 H;  4DR7 H;  2UUA H;  2UU9 H;  2VQF H;  3T1H H;  1IBL H;  4B3R H;  2UXC H;  1N32 H;  4X64 H;  4JI4 H;  3J7A K;  1I94 H;  4LFA H;  5IT9 W;  1IBM H;  1I6U A;  1S03 G;  5A2Q W;  3J80 W; 
#chains in the Genus database with same CATH topology
 2R87 A;  1SEI A;  1KJJ A;  5DLG A;  2M8W A;  2ASJ A;  1HNX H;  1CQJ B;  4JUZ A;  2AGQ A;  1B04 A;  4BXX G;  4A3L G;  4FBT A;  3GTQ A;  5J2U F;  3PR4 A;  1AUV A;  2YZG A;  4RU9 A;  4QWD A;  2CKZ B;  3GKU A;  4DR3 H;  2CWH A;  1XRH A;  1FKA H;  3J81 W;  5FPR A;  2R8J A;  4LFB H;  4ED0 A;  3KXY T;  4J9K A;  4F4X A;  3JRX A;  3UQ8 A;  3QD7 X;  3WO0 A;  2DPJ A;  3G6X A;  4XYM B;  4B3S H;  1E4G T;  2DLN A;  3K3P A;  4R7R A;  3KHG A;  3H0G A;  4FM9 A;  3T5L A;  2OLS A;  4YJ3 F;  5EWF A;  4IRK A;  2OPU A;  1XNQ H;  4R8U A;  5KX5 F;  2PN1 A;  2W7P A;  2XC9 A;  4J9M A;  3H20 A;  4MV7 A;  4EFB A;  5KT5 A;  5DG8 A;  3M9N B;  3OSS D;  2FB9 A;  4I55 F;  1XMQ H;  5KKN B;  5DG9 A;  2VPS A;  2AQ4 A;  5DT9 A;  1CS0 A;  4XYL B;  4J9S A;  4A3C G;  1KBL A;  1JLL B;  4AIM A;  3QFF A;  5KFL A;  2BQR A;  1VBG A;  1WVN A;  4DV4 H;  5HV6 A;  5KT3 A;  1KJQ A;  2XIG A;  4RB1 A;  1V8C A;  2HH2 A;  2I80 A;  2FPG B;  2RF4 A;  2YRX A;  4DR2 H;  1TUA A;  5CB4 F;  5KFE A;  4IFD G;  1GYF A;  4NXM H;  3RAX A;  1ULZ A;  2FK1 A;  3R5F A;  1S0N A;  3RB6 A;  5GON F;  4Q8E A;  2FK2 A;  4NBQ A;  2HHH H;  2R92 A;  3PN1 A;  1V4Y A;  2O4C A;  1HNZ H;  2PMZ A;  3I4M G;  2XD4 A;  2NN6 G;  2Q2U A;  1GO3 E;  4WBN F;  3T5K A;  2UVW A;  1DT4 A;  4X65 H;  4MV1 A;  3EZJ A;  5KFM A;  4BY7 G;  4E9J A;  2KSW A;  2B63 G;  3SB1 A;  1EYZ A;  2R7Z A;  5LMN H;  3V4Z A;  1DTJ A;  4C5C A;  2AU0 A;  4DV6 H;  5KT6 A;  2UXD H;  1ZZI A;  4DLK A;  3QZ7 A;  3GLK A;  2R85 A;  3RTX A;  5F9N A;  2C35 B;  2VA2 A;  1Y1W A;  5D1P A;  2IP4 A;  2FJZ A;  4O4L F;  4FS1 A;  4ECZ A;  4DV3 H;  3NCV A;  5FJ8 G;  3LWB A;  3RB4 A;  1J4W A;  2BQU A;  1E4F T;  1XDN A;  1Z2I A;  3RBE A;  3WNZ A;  1K1Q A;  2Q2T A;  5C4X G;  2FMA A;  4RUA A;  4OD6 A;  3MJF A;  4DV2 H;  1JDE A;  4Y8V B;  4A2A A;  3PO2 G;  4JI5 H;  3RGX A;  2HH3 A;  1N34 H;  4JI0 H;  4YQW A;  5KT2 A;  4LF8 H;  3E5N A;  4EEY A;  4MV9 A;  5KFD A;  1EZ1 A;  1VIG A;  5LL6 b;  1Y1V A;  4YAJ B;  3GIJ A;  5L9X A;  4GC6 A;  2XGQ A;  2UUA H;  2HGS A;  3F8N A;  3IG0 A;  2VQF H;  3T1H H;  1EHI A;  1IBL H;  1S10 A;  5DQH A;  5KFZ A;  1MZB A;  2C28 A;  2UVU A;  2C2D A;  3N41 B;  4O3N A;  1N32 H;  4Q0Y A;  2J9G A;  3Q8P B;  1ZZJ A;  1Z2N X;  4JV1 A;  1C30 A;  4IWY A;  3GQC A;  5KFF A;  4O3Q A;  4L1K A;  1BGW A;  4J9P A;  1S0O A;  1BNC A;  2CW7 A;  3N42 B;  2XCL A;  3FMA A;  4IR9 A;  4LIJ A;  1IBM H;  3KHR A;  1WCM G;  3GIQ A;  2J6S A;  1E4E B;  2CTL A;  2W6N A;  1DGS A;  4JVH A;  4A3B G;  5A2Q W;  3PR5 B;  2GPW A;  4EGJ A;  5KFH A;  3BJY A;  2JEB I;  4A3K G;  4DV5 H;  4OO1 G;  1IBK H;  2I8C A;  1KHM A;  1T94 A;  2V58 A;  4EG0 A;  4RNM A;  3OSP A;  4HR7 A;  4QIW A;  2UVV A;  2E5L H;  4LF6 H;  4PDB A;  1BXR A;  2JA5 A;  4UCR A;  5KG0 A;  3OHB A;  4LF7 H;  4DL2 A;  3TII A;  2Z0S A;  3TIG A;  2CTF A;  1IOV A;  1ZQ7 A;  4FS2 A;  2FFM A;  1WHR A;  4A3F G;  5KG5 A;  2R6F A;  4OX9 H;  2AGO A;  2FMR A;  4YR3 A;  1KEE A;  4LF4 H;  4DL3 A;  2LRR A;  2YU9 A;  3N8D A;  2YZN A;  4M7E A;  3Q8R B;  4JYA H;  4RB0 A;  2R8I A;  4Q43 A;  4LH7 A;  4QWE A;  4TQS A;  2FPH X;  5DG7 A;  3ETH A;  4NLG A;  1TWF A;  4DUZ H;  4A2B A;  3BQ0 A;  3OHA A;  2CZG A;  3KAL A;  2O03 A;  1BJT A;  4O3O A;  2BQ3 A;  3H0G G;  4JI1 H;  4RB2 C;  4MA0 A;  5KFJ A;  3MR3 A;  4DL4 A;  5FD6 A;  4ECW A;  1N48 A;  2E2H A;  4G3I A;  3GAB A;  4C5A A;  4EFE A;  3MFH A;  4GKK H;  3Q8Q B;  4EBC A;  5LYJ F;  3JZI A;  3PZP A;  3R5H A;  3RB0 A;  2X0S A;  3OTO H;  2GLT A;  5KFR A;  4RNO A;  3R5X A;  1N36 H;  2YQR A;  2ALZ A;  2WB1 E;  2OWO A;  1WE8 A;  1EUD B;  3VPC A;  3PW0 A;  4MV8 A;  4I50 F;  3G6V A;  5J2T F;  4MTE A;  4ECY A;  5KG3 A;  4Q8F A;  3PW4 A;  2UUB H;  2FLL A;  4DL6 A;  2JA6 A;  3V6K A;  2R8K A;  5KG7 A;  3HXL A;  3PVX A;  4DR4 H;  5KFV A;  3UFX B;  5KFB A;  1JXL A;  3H3V H;  3K5H A;  4FJU A;  4ETS A;  4DV0 H;  4PWQ A;  4UCO A;  2YCH A;  3RBD A;  2VA3 A;  3GTK A;  4QMF B;  4B8C D;  3FDS A;  3Q8S B;  1IOW A;  2R92 G;  3Q2O A;  1S0M A;  3OET A;  2J6U A;  3TIN A;  3TQT A;  3GIM A;  2ASD A;  4TUY F;  2CPQ A;  3RV3 A;  4F4W A;  4ECT A;  3N43 B;  1E4E A;  4ED3 A;  1VS0 A;  2HJW A;  3C0F B;  2R7L A;  2JA7 A;  1TWC A;  2RGR A;  3V6J A;  4AQY H;  3U9T A;  2WTF A;  2R7M A;  3RF2 A;  4DR6 H;  3GTO A;  5EWE A;  4EBD A;  4NZT M;  2F4V H;  2ZDH A;  2R7Z G;  1M7J A;  1RK5 A;  1ZHQ A;  4ZI7 F;  3H4D A;  2JEI A;  2AXY A;  4I4T F;  4BBR G;  1AN7 A;  2WAQ E;  2ZDQ A;  3EYY A;  1Y1W G;  2NU8 B;  4LF9 H;  4JV2 A;  1M6V A;  5EOY A;  4E4T A;  4QWB A;  5EDW A;  3M9O B;  1X4N A;  2W6M A;  3KHH A;  1K83 A;  3RB3 A;  2W9B A;  2VUM A;  4LSX A;  3BQ1 A;  5IP9 G;  4MV3 A;  1L2Z A;  2NU6 B;  1KJI A;  2FLN A;  2BA0 A;  4B3T H;  5T14 A;  4TQR A;  1KJ9 A;  2UU9 H;  3BAA A;  3BA8 A;  5D1O B;  5KFT A;  4BBS G;  4AYB E;  3PO3 G;  2OPV A;  2NU9 B;  5DQI A;  1A0I A;  5C1P A;  3GTJ A;  2W9C A;  3GTM A;  1ZZK A;  1PK8 A;  4J9L A;  3AEV B;  4EYI B;  1TA8 A;  1Y1V G;  4JI4 H;  4A3E G;  2G8Y A;  2LTM A;  3MWM A;  4RNN A;  2ANR A;  2JEF A;  2CQY A;  2R84 A;  5IT9 W;  4ED8 A;  3V6H A;  2IMW P;  3VKE A;  4DL5 A;  4QJF A;  1UNN C;  2A1S A;  3QZ8 A;  3HOW G;  1AUX A;  4C2M A;  4U7C A;  3MWE A;  2C22 A;  1S03 G;  2CW8 A;  5D8D A;  2DZD A;  3J80 W;  2DIK A;  4HNU A;  1J5K A;  4DUY H;  4UCU A;  1GSA A;  2R93 A;  1Z2O X;  2M6Q A;  2CTK A;  1B6R A;  3BG5 A;  2C2E A;  1JKJ B;  3HKZ E;  3I0P A;  2UXB H;  2E3U A;  2JEA I;  2PBZ A;  3MR6 A;  2K1H A;  2WE6 A;  5CAE B;  4EBE A;  1T3N A;  5K2M A;  4A3D G;  3V4S A;  1N56 A;  2JE6 I;  4G08 A;  3RGZ A;  5KFP A;  2R7K A;  2NVX A;  2LF0 A;  4B3M H;  4HNT A;  4YR0 A;  2VUG A;  4BWS C;  3V69 A;  3LP8 A;  4FJS A;  2Y3M A;  4IWX A;  5IYB G;  2DWC A;  2JA5 G;  3KTM A;  4MA5 A;  5C5J A;  3WO1 A;  2M05 A;  4TV9 F;  4IZO A;  5LMU H;  3GTL A;  3OUZ A;  4BA2 I;  4MV4 A;  2ZJT A;  3ORQ A;  5F9L A;  1V9N A;  2DGR A;  1CE8 A;  5C44 G;  4DL7 A;  5KFA A;  5DGA A;  3HOX G;  2PY9 A;  5IP7 G;  3T1Y H;  2NUA B;  1RK6 A;  2YYA A;  1I50 A;  2V4R A;  4DR5 H;  4JI8 H;  4R8U B;  4YHH H;  4BA1 I;  2YRW A;  4MV6 A;  1Y14 B;  4Q44 A;  1I7L A;  2FKL A;  2CPM A;  5KFN A;  4U6P A;  2YS7 A;  1SYX B;  3G8C A;  2ASL A;  2NU7 B;  4LMY A;  3MR5 A;  3EPI A;  4ECS A;  3K3V A;  1SFO A;  1NXU A;  2FK3 A;  3IN5 A;  4ED6 A;  2R8G A;  2UVR A;  4ECQ A;  4A93 G;  2V4Q A;  3N6X A;  4YBZ B;  3OSN A;  2IA6 A;  4JI3 H;  2CWF A;  1GSH A;  4YR2 A;  4DV1 H;  3HOY G;  3FKI A;  2XCA A;  1WTJ A;  4F4Z A;  3JRW A;  4LSA A;  1J5E H;  4MTD A;  5JEA G;  2YZM A;  1TWA A;  4A3G G;  2FE3 A;  2BL5 A;  2UUC H;  4MAM A;  3GV8 B;  1UC9 A;  2R8H A;  1F0X A;  1VAJ A;  2WB1 A;  3VPD A;  5KFW A;  4RZQ A;  4DV7 H;  2JA6 G;  3H4B A;  5KG1 A;  3MR2 A;  4APM A;  2W6P A;  1S68 A;  4WAN A;  2C2R A;  1TWG A;  3N40 P;  5KFI A;  1FJG H;  1K1S A;  1V9P A;  5L1I A;  2HVS A;  2W70 A;  5C8Y F;  5LOV F;  2VPQ A;  4JV5 H;  4J0M A;  1RJP A;  5I47 A;  2R86 A;  4RB3 C;  2V9W A;  3GIL A;  5FLX W;  3PW7 A;  5IYC G;  4EC5 A;  3RIZ A;  3OUU A;  4ECX A;  3CQZ A;  2CTJ A;  2P0A A;  2YS6 A;  4ZQI A;  1ZHS A;  4EEQ A;  3GV5 B;  2JA7 G;  2V59 A;  1UC8 A;  3VMM A;  4B8T A;  4FU0 A;  4O4H F;  3GR5 A;  1I3Q A;  5IWA H;  1GGO A;  5C1O A;  2YW2 A;  3L2P A;  2HVR A;  2RDI A;  5CA0 F;  1HNW H;  4NXN H;  3H40 A;  2R7N A;  5IYD G;  4K0K H;  3KAK A;  3K5I A;  3GV7 B;  4WAL A;  1XMO H;  1HR0 H;  2VOB A;  4DR7 H;  4IRD A;  3JSL A;  1V51 A;  4RAY A;  2I87 A;  1S20 A;  3BAB A;  2UXC H;  1OWT A;  2JVZ A;  3VPB A;  5FLM G;  2PT7 G;  4ED7 A;  3JSN A;  4YJ2 F;  2JZX A;  4BY1 G;  5JH7 F;  3PW2 A;  4O3S A;  2VUM G;  2D9I A;  2WAQ A;  3KDG A;  4X64 H;  4O2B F;  4J9N A;  4A3I G;  1ZET A;  1RYS A;  2FP4 B;  5LXT F;  3G6Y A;  3J7A K;  4ECV A;  3M9M B;  1I94 H;  1M0T A;  2HVQ A;  3PW5 A;  2R82 A;  3BQ2 A;  1PQX A;  3T5H A;  2W8L A;  1M0W A;  2W57 A;  5JVL A;  3MFI A;  5KFS A;  3ORR A;  2CTE A;  3GTG A;  3HOZ G;  4AYB A;  2QND A;  1I6U A;  2ATL A;  5IYZ F;  1KC7 A;  3GID A;  4A3J G;  2PVP A;  3MWD A;  4J9O A;  4JI7 H;  4HYK A;  4O3P A;  1R9T A;  2FPP B;  4O2A F;  4KHP H;  4AM3 A;  4ZHQ F;  5EZY F;  1I7N A;  1DIK A;  2YL2 A;  3HOU G;  4EGQ A;  3GII A;  2IBK A;  4HNV A;  4ED1 A;  4X62 H;  3HBL A;  4JVY A;  2R93 G;  5C0X G;  5KFK A;  4TV8 F;  3GIK A;  2Y0S A;  4A3M G;  2RGV A;  3JAM W;  1WR2 A;  3RUP A;  2W7O A;  3CVZ A;  1JX4 A;  5BR8 H;  5BPH A;  4DR1 H;  2MJH A;  3KHL A;  1TAE A;  1DV2 A;  4GC7 A;  3HKZ A;  4XZ3 B;  3AYH B;  1CQI B;  2JA8 G;  4ME6 A;  1GSO A;  4UCT A;  5FPO A;  4Q45 A;  4EYH B;  5EWG A;  5JQW A;  4J9R A;  2Y0S E;  1XNR H;  5BPF A;  3GTP A;  2FPI B;  3FAU A;  4JI6 H;  4O4I F;  3HB9 A;  4O3R A;  2FLP A;  3DF7 A;  3L4K A;  1DV1 A;  1ODH A;  5JUM A;  4FBU A;  2PMZ E;  5L1L A;  2W71 A;  4J9Q A;  2QK4 A;  5KFO A;  1O75 A;  4UCS A;  4UFZ A;  1RJR A;  2ZDG A;  1TWH A;  3ETJ A;  2WYO A;  3Q1K A;  1VIH A;  2VR1 A;  3RJ0 A;  4RAZ A;  2VQE H;  3GIP A;  5CA1 F;  1MSZ A;  5H80 A;  3SE7 A;  1S9F A;  2DPI A;  3KAJ A;  1WH2 A;  5DQG A;  4GLX A;  4IR1 A;  4IAJ A;  4QW8 A;  1WSC A;  4RUC A;  4ECR A;  2B63 A;  4CC5 A;  4YAK B;  1X4M A;  1N33 H;  3TQ1 A;  5KG4 A;  3L4J A;  2J6T A;  3I4N G;  4H8A A;  4WD3 A;  1C3O A;  3LML A;  3U1K A;  3R23 A;  2W6O A;  5L1K A;  3NGD A;  2ZQE A;  2V5A A;  1B6S A;  2QYZ A;  1X0A A;  3I12 A;  1JIH A;  5LA6 F;  5KFG A;  3T5J A;  3L7Z C;  3RAQ A;  3FKI G;  4CC6 A;  2ZM6 H;  2P2R A;  3UOE A;  4XX0 B;  1P8L A;  4ECU A;  2CTM A;  2W6Z A;  4JV0 A;  1A9X A;  4NZR M;  1PX2 A;  2WDT A;  2XGP A;  5KT7 A;  1EUC B;  4LFC H;  4LF5 H;  2NVY A;  2MCT A;  1W93 A;  4GKJ H;  3KDK A;  2JEJ A;  1W96 A;  3U9S A;  2RDJ A;  1GLV A;  1SCU B;  1T36 A;  4LH6 A;  5KFQ A;  4QWA A;  2LTL A;  3RV4 A;  1FVI A;  1KJ8 A;  5LP6 F;  5D1O A;  1JDB B;  4QW9 A;  4YP3 A;  2W6Q A;  2X06 A;  2W8K A;  2OH2 A;  5KFY A;  4M9U A;  5KG6 A;  3M4I A;  1VKZ A;  4X66 H;  1VBH A;  2VQD A;  5JVD F;  3EPG A;  4ED2 A;  2E2I A;  5L1J A;  4YY3 H;  5KFC A;  4RZR A;  2JEG A;  2VKC A;  1Z2P X;  4JI2 H;  3BA9 A;  5BMV F;  4F4Y A;  4F50 A;  4IRC A;  1S97 A;  5KFU A;  1ZTG A;  4B3R H;  5HBR B;  5K36 G;  1B33 N;  4UCV A;  3RFC A;  4C5B A;  1X9Z A;  1X9N A;  1WCM A;  3HOV G;  1UG8 A;  2PQU A;  2W9A A;  5DLF A;  2XCP A;  4ZOL F;  2W9B B;  4QIW E;  2ANN A;  5C3E G;  2BR0 A;  2GPS A;  4YB8 B;  1RYR A;  5DGB A;  3N44 B;  5KFX A;  4IHJ F;  2SCU B;  3SI8 A;  4I7H A;  4HQ6 A;  5FD5 A;  5KG2 A;  4LFA H;  4QWC A;  2C00 A;  2W9C B;  1EC6 A;  1K1G A;  2AGP A;  1VBI A;  2JA9 A;  4OCH A;  1RJQ A;  5KT4 A; 
#chains in the Genus database with same CATH homology
 4DUY H;  4DV5 H;  1SEI A;  1IBK H;  1Z2O X;  4JI7 H;  2UXB H;  2E5L H;  4LF6 H;  4PDB A;  4UCR A;  1HNX H;  4LF7 H;  4KHP H;  2WE6 A;  1B04 A;  4G08 A;  3RGZ A;  4X62 H;  5FPR A;  4DR3 H;  2LF0 A;  4B3M H;  1FKA H;  3J81 W;  4OX9 H;  2VUG A;  4BWS C;  4LFB H;  3KXY T;  2Y3M A;  3UQ8 A;  3QD7 X;  2RGV A;  3JAM W;  4LF4 H;  4B3S H;  1E4G T;  4R7R A;  3CVZ A;  4FM9 A;  5BR8 H;  4M7E A;  5LMU H;  4DR1 H;  1TAE A;  4JYA H;  4RB0 A;  1XNQ H;  4LH7 A;  2FPH X;  2ZJT A;  4UCT A;  5FPO A;  3H20 A;  4MV7 A;  4EFB A;  3OSS D;  4DUZ H;  1XNR H;  1XMQ H;  4A2B A;  3FAU A;  4JI6 H;  3KAL A;  2O03 A;  2VPS A;  1BJT A;  3F8N A;  5DT9 A;  3T1Y H;  3DF7 A;  3L4K A;  4JI1 H;  1ODH A;  4RB2 C;  5FD6 A;  4DR5 H;  4DV4 H;  4JI8 H;  3GAB A;  4EFE A;  4YHH H;  1O75 A;  4UCS A;  4UFZ A;  4GKK H;  2XIG A;  4RB1 A;  2WYO A;  1SYX B;  3OTO H;  3RJ0 A;  4DR2 H;  4RAZ A;  1N36 H;  2VQE H;  4LMY A;  3K3V A;  2OWO A;  1GYF A;  4NXM H;  3KAJ A;  1WH2 A;  4GLX A;  3N6X A;  4MTE A;  4IAJ A;  3BA9 A;  4JI3 H;  2HHH H;  4DV1 H;  4CC5 A;  2UUB H;  3PN1 A;  2O4C A;  1N33 H;  1HNZ H;  3L4J A;  4LSA A;  2Q2U A;  1J5E H;  3HXL A;  4MTD A;  4DR4 H;  3LML A;  4ETS A;  4DV0 H;  4UCO A;  2YCH A;  4X65 H;  2ZQE A;  2FE3 A;  3EZJ A;  2UUC H;  4B8C D;  4E9J A;  2KSW A;  1F0X A;  3SB1 A;  4CC6 A;  3OET A;  2ZM6 H;  5LMN H;  4DV7 H;  4RZQ A;  5D1O B;  4DV6 H;  2UXD H;  1P8L A;  4APM A;  3N43 B;  3RTX A;  4NZR M;  1S68 A;  1VS0 A;  2WDT A;  3C0F B;  2RGR A;  4LFC H;  4LF5 H;  1FJG H;  3N40 P;  4AQY H;  1S03 G;  2MCT A;  1V9P A;  4GKJ H;  3RF2 A;  3KDK A;  4DR6 H;  5D1P A;  2HVS A;  4JV5 H;  4J0M A;  4DV3 H;  4RB3 C;  4NZT M;  3NCV A;  2F4V H;  5FLX W;  4LH6 A;  4EC5 A;  3RIZ A;  1ZHQ A;  1E4F T;  1FVI A;  1XDN A;  4EEQ A;  1ZHS A;  2Q2T A;  1AN7 A;  5D1O A;  3EYY A;  4OD6 A;  3GR5 A;  4DV2 H;  5IWA H;  4LF9 H;  4A2A A;  3L2P A;  4JI5 H;  5EOY A;  3RGX A;  2HVR A;  4JI0 H;  1N34 H;  1HNW H;  4X66 H;  4NXN H;  3M4I A;  1L2Z A;  4LSX A;  4K0K H;  4LF8 H;  3KAK A;  4YY3 H;  4MV9 A;  4B3T H;  5LL6 b;  1XMO H;  2VKC A;  4JI2 H;  1HR0 H;  4DR7 H;  1Z2P X;  2VOB A;  2UUA H;  2UU9 H;  2HGS A;  3BA8 A;  2VQF H;  3T1H H;  3BAA A;  1IBL H;  4B3R H;  3BAB A;  2UXC H;  3IG0 A;  4UCV A;  1MZB A;  1X9N A;  1X9Z A;  2PT7 G;  1A0I A;  3JSN A;  3N41 B;  4RAY A;  1N32 H;  2D9I A;  4Q0Y A;  3KDG A;  4X64 H;  1Z2N X;  1TA8 A;  4JI4 H;  3J7A K;  1BGW A;  1I94 H;  1M0T A;  2HVQ A;  2CW7 A;  3N42 B;  3N44 B;  4I7H A;  5FD5 A;  3FMA A;  4LFA H;  3MWM A;  1M0W A;  2W57 A;  5IT9 W;  1IBM H;  3JSL A;  1DGS A;  1I6U A;  4OCH A;  2CW8 A;  5A2Q W;  3J80 W;  4UCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...