5ITFB

Cetuximab fab in complex with 2-bromophenylalanine meditope variant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
220
structure length
217
Chain Sequence
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cetuximab Fab, light chain
publication title Natural and non-natural amino-acid side-chain substitutions: affinity and diffraction studies of meditope-Fab complexes.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 44
structure length 217
sequence length 220
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5itfB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5itfB01
4Y4FD 2YMXH 4J2XA 3S3PA 4UAOC 1N2RB 3EYUH 1E4WH 1JJUA 4O02H 4X5XA 2EDRA 3K3QA 3HAEB 2YN3A 2MCPH 3MGTB 4LSPL 4CVWA 1ETZB 4PJCB 1E4KC 3QIWB 4WDIA 4MSWB 1I8IA 3ARVA 3FB6B 5I2IA 4AJ0A 3FFCD 4WFED 1CT8B 4XPAL 3KPQA 4QHUB 2WW8A 1KOAA 3U7WL 1MCCA 1TJGH 5F72S 3V5HA 3GSWB 1I7ZB 4HJGB 3VDCA 5F8RC 4FQCH 5B38G 1AFVL 5DQJB 4J3XA 4OLWH 2QEJA 3RBSA 5JORB 1YNLL 4G8GE 1U8MA 3AM8C 1UZ8B 4EEEA 3O6LH 1U8IA 4OGYL 5MENE 3LSOA 4OM0H 4ODXA 3T8XA 1QLFB 3CDGB 4I2XA 4JDVB 2DICA 4HDIA 1BGXL 1HI6A 3QUXA 2EH7L 1MVFA 3L5WB 3REWA 4N8VG 4G9FB 1NMCB 4TSBH 5C92A 3IU4H 1S7TA 3JWDC 4Z7UE 3S36X 1Q9OA 2UWEB 4PJ9B 1KGCD 3BEWA 4RFEB 1JTPA 1OAUL 3NACL 5D1ZD 5HHPA 1PBYA 4JHAH 4WWKB 2FSEA 1A3RH 4ZFOB 2DBLH 2XKNA 1MCWW 1Q1JL 4GT7A 1TVDA 1MCHA 4LARL 1HH6A 1D6VH 4KXZI 4GBXC 2BVQA 3MODH 5I30H 4LAQL 5FM5M 4P46C 2X10A 1T21A 3HRZA 4HUUA 2FJGB 4PRNA 3W39A 2EDDA 12E8H 1KENH 4NT6A 1HINH 1E28A 1HWHB 4BSVA 1MAML 3R0NA 4JDTL 3WNMA 4EVNA 5IB2A 4HCRA 4ODBD 1HIML 2FEDD 3B9KB 4MB4A 4UIKH 1PY4A 4OQ1A 4L29A 5BQ7A 5LXGH 1FO0H 5B39G 4Q9QH 1A7OL 1M7DB 1D6EA 2Q3ZA 3TVMD 5IHZB 1FNGB 2CDGB 2AK1H 5C2UB 4ORZC 5C0NC 4O2EA 4R2GB 1IBGH 2I07B 1QFWM 1SJEB 3DUHA 5HGDB 4JRYE 1A6VL 3AAZB 5DRNB 2AEPH 3QJHB 5C0BE 4J6RH 2ZUTA 2D7TH 1P4IH 3TBWA 1ERNA 1T22B 1KCUL 5L9DH 1UM4H 4F9PA 4TUJA 4PJ7F 3IJYA 4Z18A 5LGJB 4X8JA 1CICC 4KFZC 1L7IH 1QSVA 4RFNC 5KSAC 5H94A 1YMME 2IC2A 2X4SA 3MX0A 4PRDB 4KXZH 2CR3A 5ADPH 3X17A 5GRJL 1J18A 3ETBF 2UVFA 4H1LB 4XVUD 1IQDB 5E4IA 5HDQL 1CE1L 3L95B 3QEGL 3VFSB 2BDNL 3QG7L 3ZDYE 4OZFH 1JGVL 4GSDL 3U7WH 3V52H 5E99H 1ZT4B 4X4ME 5L2KD 4MA3A 2E9IA 2H26B 4OZ4B 4PG9A 1AGDB 4NN7C 4OZGE 2HA1A 4PJHA 2HJFA 3BPNB 2VL5A 5F6IC 4POZC 3QULA 5JW3L 4XVTH 4E42B 3PHSA 1EFXB 1MCQA 4P5MB 1IZJA 4Y16D 2EO9A 4NNYA 3ZSSA 4ETQA 1LILA 4WJ5B 4MQ7B 1HHKB 2VMFA 2J8HA 3VWKC 2ZOKA 1IFHL 2APBA 4Z7WE 3H9SB 2EH7H 2HLFD 4LKCA 5K9KB 5C0CE 4JREB 1CE6B 3L3KB 4XTRD 3WL9A 1Q9LA 4IJ3B 1I8MB 3NACH 3MCKB 3ARTA 2JCCE 4LBEB 2LE9A 3I75B 1T1ZB 1KJMB 3HFML 3Q3GA 4HKJB 3S35L 3MLXL 5D2NE 4HCRL 2EXYD 1A7RH 3SE9L 2C5DC 5ALBH 5FUZL 1A6AB 3WUWG 1EEYB 1ACZA 1FLRL 4MCZB 4S10A 2Y07H 5IEHA 2EDJA 2HTLD 1UEMA 5DK2B 3DUUA 1NJ9B 1QEWB 1ODAA 4LRIA 3CFJB 5JXAH 3DGGB 4OCYH 4Y5YC 3L1OH 3RNKA 5C08B 2I5YL 1NUFA 3FO1B 3RWCA 5L2JA 3LEXA 4YUEL 3BZDA 5F88A 5D96B 1RU9L 1JWUA 5F9DC 5D2LB 1A7OH 2YUWA 4WO4C 2XIDA 3OJ2C 1D7FA 3I6KA 5HVWA 1HHHB 5EBGA 1CLOL 1MFCH 1KPRB 4P9ML 1LEIB 1VEMA 1PX4A 1SJHA 3MBED 1T6WA 3CAFA 1SM3H 4ZS6C 1UJ3C 3C5JA 2LTQC 4PJFE 2XWBB 4GOSA 1Y18A 1NUGA 3MQIA 1KCUH 4P5TA 3ZTJG 4ZFFA 4TPRL 3EW3B 4Y2OA 3SGKC 1IL1B 4YK4B 1Q0YH 1FPTL 4GQ9H 4FG6D 1Z9SA 4APQB 3RVXC 1FL5B 3BPLB 3NCEB 4FFZL 1CBVL 1JF5A 3ARGC 4OJFL 1JGDA 1XAUA 1TENA 4GUPA 1GAFH 1JF6A 5I15L 4XPTH 2DI7A 2IH3A 3AREB 3QEGH 4Z0XB 4GG6F 5KOVC 5IB1B 4GAFB 5JIKA 2IALA 4G43A 1JGVH 3HC3L 2JB5H 1RFDH 4WU5A 4AH2A 2JIXB 5JTWA 1FBIH 2DMCA 2CIKA 5D93C 3MV8B 4OIAA 3D39D 3FHQA 2HMIC 4CGTA 3KPSA 3D18A 4K8RL 1GVIA 4PIRF 4GRLD 1MJUH 5C0GA 2X4UB 2JJTC 3X11B 2VR9A 4OFIA 3T04D 4J12A 4PBWD 5JHDE 1QOKA 2EC9U 4MAYC 5JW3H 4MCYB 4GRWB 1UWEL 3FTGB 3GMOA 4PJIE 4QRPA 4X5WA 1X44A 3R8BB 2H32A 1AJ7H 1F6AB 4WY7L 3BSZH 3KDMB 4HUMB 4JG1L 5E6ZA 3ALXA 3MJGX 4FFVC 3ZKXB 2AI0H 5GGSA 1R24B 2ADJA 3MUJA 4XMPH 5I18H 3NCYS 5HHXL 5CWSA 3ZDYF 5FUOH 1YYML 3IDNA 3DO3A 1KLUB 3DX8A 4LSUH 2A73A 2CH8A 1FZJA 1JGUL 4F3FA 2AXGB 1RZIA 3HFMH 5H37H 4KKBC 1E0OB 3MV9D 4E41E 4NQCD 3SE9H 3SEPA 2DQEL 5CD3B 1G7QA 3C09C 4C4KO 3FB8B 4PJXA 3HE7A 5E7FA 4YBLB 4OZGF 2BVOA 4OB5H 4QWWD 2GT9B 3RDTA 5F3BA 3G9VA 1BOGA 1R3LB 1ZHKB 3A6OA 4N0RA 3KYOB 4AEHL 1PKQA 4ZPVA 3VXRE 5ACLA 1HH9B 1NH6A 1D5MB 1NC2B 5FGBA 1YZZA 3VFOA 1P7QA 5E8PB 2NX5A 4MA1B 4U6VL 3LQAL 4DZBB 4OD2B 5CIPB 2ZWLT 4Z7WF 4NRZB 2MSPA 5BO1L 4CDGC 2CRYA 2F5BL 3QHTC 1YYLH 5JQ6L 5SWZD 4HXBL 2CD0A 2JCCF 3LDBC 5GRVK 1VB9A 3ZHLA 2WBJA 4XHJC 2CUIA 1IC5H 1KJ3L 2H8PA 4G6JL 5C0AD 4MNQD 1QUNA 4YFDB 4LLQA 4F2MA 4DVBB 3BW9B 1OP3H 3KPRB 3CSYB 3G6AA 5FKPB 3N50A 5CUSH 3UTQA 1FL3A 4U1JA 1BD2B 4HWNA 3W81A 1DFBL 2DQCL 3FMGH 3MSPA 5E1AB 5MERA 2W9DH 3WHXB 3HG1E 1CBVH 4X80L 1JPFA 4PG2C 5KVDL 2MMXA 3V5DA 4R4BB 1D5IL 1B4JH 2APWA 3TPUA 5I15H 4ODTL 1JYWA 1G9NL 1QG3A 3ULUC 2VNCA 4FZ8H 1WWAX 2Y25A 3CLFH 3W2DH 5DD6A 4E5XB 1P1ZA 5JDJA 4XP4L 1D3CA 2XN9E 4CADA 4DCQA 4GKOA 1QSFD 4GW5B 2NY2C 3QFJB 5D1QA 3FZUC 3TBYB 3VMNA 2NY3D 2G5BB 2VITB 5I1KL 4RX4A 3O0RL 3FRUB 3BUTA 5I1AA 2D4FA 4YC2B 1OCWH 2LV4A 3HE6C 3FCTA 3WFBL 1DBAL 5J06A 1J9CT 3O8XB 3U83A 5GJTH 1VGEL 1UWEH 4KVNH 4ALAL 3QQ9D 5I8EB 3RUGB 3ARBA 4ZSOB 2D0GA 3UTTA 4QRSA 4LLDA 4XBGA 4WY7H 4JJ5A 3VG9B 1JZ4A 5FYLE 4OV5B 4P57B 3RKDD 1LE5A 3U2SB 2HLAA 5D5MF 2WWKT 3ZKSD 1VGKB 4DUWA 3EJYC 4YQXL 1SVZA 3QIBB 1G6RB 3H9YA 1HXMA 5HPMA 4H88L 5IVXE 1SYSB 5DR5L 1TZIA 2F53E 2PTTA 3FFDA 1OGAB 4KQ4L 1U8QB 2OTUA 4Y5XC 4PPTA 2CDEA 4M3KB 1VSCA 1J0IA 1LEGA 2QKIA 1QRND 4JN1H 2R1WA 1DQLH 1Q72L 4KZEL 3IGAB 3T0VA 4GXVH 1F3JB 2Q87A 2V5TA 4NOFA 3SKNB 3LVEA 3FQTA 4IRSA 3UYRL 4HX1A 1FSKC 1FG9C 3UJTH 2I9TA 4LQFH 1LO0H 1EAPA 1X5GA 3B9EA 4MJIA 4R90H 2ZSWA 5IFHL 1KFAH 3DSNA 4H0IA 3BQUA 5B22A 3NTCL 1T04B 3O3EA 2LU7A 2FIRT 3U4AA 1EGJA 1TCRB 2P8MA 2F5BH 4GRMB 4XBEH 32C2A 4XX1G 5JQ6H 1GCFA 3NCMA 1R6VA 4GS7B 1MFBL 2FJHA 1X6LA 3F6LA 5DJ0B 1OW0A 4P0DA 1U3HB 3RGVA 4ZAKC 2BNUA 4JQXC 5AG9A 3SQOL 5HDOA 5C07E 4G7YL 3MOQA 1CGTA 3ULVE 3GSOA 1F4XL 2WM0A 5BRZB 4PP1D 5F89A 1PX3A 5D8JH 3MO1A 3K74B 2FD6L 4MD5A 2LVEA 2BZDA 2R0KH 5FDYA 3O2VH 3E6FA 1DFBH 2DQCH 3V8OA 2AV1B 3E2HC 3PWLB 3OR6A 5JIPA 4U6XA 5L8KB 1NC4B 1MCJA 1BM3L 5ID0B 3K2MC 2XTJC 2SEBA 5HYQA 1D5IH 2D03L 4LCUA 4LEOA 4ODTH 5I1JH 3UO1L 3AY4C 4BSJA 3G5VA 4QRRD 5D71L 7FABH 1E6OH 8FABA 2PYEE 2EEAA 4M6AA 4L4VB 5GJSL 1NCAL 2OR7A 3TO4B 5IFJB 2RGSA 3HAEA 3O0RH 1DL7H 3GMRA 4HUVB 4RWYL 1NEZG 3FONB 4Y88A 4OSUL 1DANU 3I6GB 5DK3A 4YHZL 4WHDA 5GS0C 1RZ8A 2ORBL 4YEEA 1J87A 1CT8A 4C54A 3QIUB 1OAXL 3DPBA 3V8CA 5IWLC 4QHUA 4Y4FC 3MNVA 2Z9TA 1OF2B 2NTSP 1F4YH 3T4YB 1I7ZA 4HJGA 2NPLX 1H8SA 5E5RB 3RWJB 3HZMB 2EZ0D 4HIEA 3FQRA 4Z7VB 5DQJA 1WIPA 4OUUB 5I71B 3V6BR 5IHUL 2VE6A 5GGQL 4FQXB 1VA9A 4LCYB 1O7SA 2DYPD 4NO5B 2ZCHL 4FXGB 5HYSA 4N68A 5J3HD 5FA4B 1W72B 1UZ8A 5DT1H 1J0KA 1ZVHA 5DR5H 5HGHA 4O58L 1DSFH 2YD1A 5ABDE 4JDVA 5GS1A 1S8DB 1A64A 1FNEA 2RJMA 5A1AA 5IT2H 1I1FA 5DD5H 4P2RE 2Q8BH 2XTJE 1MHHA 2UWEA 2Q7YA 2V9RA 3PF2A 4FZEH 1EGJL 5DRXB 3GO1L 1ACYL 4ZFOA 4NHCH 4JKWA 4HMEA 2AJVH 3OV6A 4G6KH 2VABB 5HYJE 5HI3D 1ZLVH 1ZEAL 3ZKND 5HHVL 4OBRA 1H8NA 5IFHH 5EULV 3K1KC 1J11A 5KS9E 3SKJL 4U4BA 3IXAB 5J6GA 1CTOA 1Q9KB 2FJGA 3CH1B 3H0TA 4JY6B 5D1ZC 4WHTB 1T0NB 3KYNB 5KG9B 4OGZA 4URTB 4XPFH 5TFSL 5F7WC 1M7IB 5JOFB 1A21A 4KJWD 5DJCB 4P59L 1U8JA 5FYJL 4NFCA 2B5IB 2MQ0A 4LLMB 2CDGA 5ANMA 3CVIH 4HUKB 4K55A 3UXFA 3AS3A 1LD9B 4ISVB 3C5ZC 1YMHA 2VLJB 4R96B 4Z0BL 5DRNA 2ZUQB 2M26A 4TOYL 2FEDC 3TCLB 5DVNA 4XPGL 4F8QA 5JHLH 4KTDL 3VGFA 1INQB 3ARDB 2WUCL 5GGVL 1Q0XL 5LGJA 3TVMC 3S37L 1IC1A 5I0ZA 1AO7B 1N3NA 4DZ8A 4GXUM 1D9KA 3QDME 3G04A 5FA3B 3QXTA 5FHAH 4RWYH 1IQDA 4JY4B 2F54D 2QV2A 3LZFH 1ZLWH 1A02N 2NXYD 2YUVA 2QBWA 4JFYA 5C9KA 1C7SA 2FH8A 5FF6B 4JY5L 4AQOA 4NQSB 1JN6B 1ZT4A 3FAXA 4JFDB 1KGCE 1TXKA 5IHBA 2H26A 5I1IH 4LVHC 3G5XA 2DIAA 5EOTA 2KUTA 1AGDA 3BMWA 4G42A 4HBQA 4XVUC 4PJAA 4YO0B 5DZLA 4BFEA 3SDAD 2ZCHH 1TETL 2H2SD 4XNYL 3T65B 3MCG1 3QEQD 4ZTOL 4P5MA 3DLQR 5T3ZL 3X13A 2GCYB 4ZFOL 3CFBA 1RZKL 4MQ7A 1IM9D 1HHKA 5TF1L 1G9MH 1A1OB 4P4KB 5EU7C 2EEBA 1N8ZB 3VFWB 5F9OL 1BJ1J 4PB0H 1GZQA 1UEYA 2OL3H 4IMKC 4UT7L 4Y19D 4LASL 3VW3L 1I8MA 1B2WL 1EZVY 2X70B 3PWUA 4H25B 1ACYH 3H7BB 4J1UB 1RUPL 4MVBC 2VXUH 2ZUYA 1T1ZA 3S4SG 4HGWA 4Y16C 4YHYC 2JKXA 1A6WH 4HKJA 2R15A 3UTZB 3PGDA 1ZEAH 4N0UB 1J8KA 1BIIB 4J3OC 3CXDL 3QUYC 2NXZC 2WLZA 4JAMB 3QDGA 5F9JB 4LDLB 4WWID 4K9EL 3SDDB 2VLKD 5T33L 4P9HC 5A3ID 2W0KA 1WBZB 1LNUA 3RRQA 4M7LL 1QVOB 3SGJA 3CFJA 4NQTA 3DGGA 3U0TB 5JPMB 3V7AE 5DF0A 4PJBA 5TFSH 5C08A 3UMTA 5F1SA 3MV7A 2EXYC 5F7NC 1RUAH 4Z7UB 2J8UB 1CZ8H 1Z5LA 5MEQB 3WJJC 1DEDA 1S7XA 1RK1A 1ZGLM 2HTLC 1FC2D 2J8OA 1KPRA 1MFAH 3T0EA 4YE4H 5A2JH 4UAOB 4X7TB 1YPZE 1MHPH 3EJZC 4JQIL 4WEBH 1CXHA 1JRHL 4WTWA 4CL7A 2XWBA 5FIEA 4NDMA 4R4FL 3VFGH 2V7NB 1DBML 2A9NL 3UCRA 3RWHA 3O6KH 2E7HA 3B8SA 3B2VH 4HSQA 4WVRA 4AY0A 1ZA3B 3DV4A 4JO4L 4APQA 2OTPA 3FT4B 3CFCL 3P0VH 1F45A 1SYVA 3MBEC 5ERWB 1OY3B 2FBOJ 4L8BA 1DBBL 2DMKA 3LKSB 3MRJB 2C1PA 1M7XA 3TA3C 4Z0XA 2Z93B 3FN0H 2YD8A 4FG6C 3OQ3B 1DBJL 2QSCL 1OQXA 1JNNL 3QDHA 1MPAL 3B83A 3TH3T 2IAMD 4KTYA 3HPLA 4OLZL 4OZHE 4H26A 2CO7B 1QFWL 5TQ2L 2AQ2A 4PRIE 4LFHD 4WENB 3VDBA 3DX6A 6CGTA 2NW2B 5ISZA 1PEZA 1K6QH 1MY7A 2APTA 4BJLA 5HBBA 3FTGA 2Q20A 4ZTOH 3RAJL 3RA7L 4NCC1 3QDAA 2F74A 4XMKL 3R0MA 1ZGLB 4TUOA 1F6AA 4XNUL 5J11C 3GDBA 4NZTH 1U3YA 1QACA 1QYGH 4ODSL 1ES0B 4U6YB 4I8DA 4IS6A 2ICCA 3RX8A 4D3CH 2VZ1A 3C2AL 4GBXB 1R24A 4YHKL 5ICXB 4P46B 1EFQA 4FQJH 2BY1A 3ISWA 2CKBH 3TBVB 4JFFE 1N6QL 3D48R 4D94A 5E2TL 5CEZE 1KLUA 3KHQA 2EIDA 1GZPB 4WI5A 4XCYB 1YJDH 4K3EH 2KQMA 2OQJA 3AROA 3GSUA 4MJ2A 3RZCC 2P7TB 1RIUL 2CK2A 3BGAA 5CD3A 3RUGF 3FB8A 4JRXA 3IDYC 1PKOA 3KXFA 1FE8L 1ZHKA 4Z77B 3GBML 5AYQA 4R0LA 2A6IA 2AXFA 4BK5A 1OD9A 5T33H 3QXAB 4V1DD 3VE0B 4LPYA 2F58H 4DGIL 2DN7A 1NC2A 4KY1L 3E6HB 4XVSH 4XP5L 5GXBB 5JA9A 2FX7L 3I3EA 4DZBA 4OD2A 5CIPA 3F12A 5IFAH 5EZOL 3EO1B 4G7VH 1RZJL 3T08A 5HHOB 5CZXC 1HQRA 1CICB 1FV1A 4RFNB 5KSAB 2ZP0T 5B3JE 3CLEL 4RZCB 4JZNB 1YN7B 2FYYB 5E6ID 4H8WC 4Y7MA 4PBXA 2DQDL 1UB5B 4XHQA 5C0DB 3TF7C 1KCRH 3UTPD 1CD1A 4H1LH 3U9UA 1A6PA 2VAJA 5ESVB 1NAMA 2OR8A 4UOW1 3BW9A 2XXMB 5EIIA 3CSYA 5FKPA 4IHOB 5JW5A 1KTRL 5E1AA 3WHXA 3QXVA 1FZOA 2FR4B 2P5WB 4LGPB 1FGNH 4OFYD 4EI5D 3ZDXF 1MCSA 4N5ED 2HAZA 4OLUH 2EIEA 1DBBH 1U58A 5EUOE 1E4JA 4O5LL 4NN7B 3TYFA 4Y8DC 4E5XA 3QXDA 3E1F1 4TSCH 1BJ1H 5FXCH 4GW5A 5TQ0H 1ZT7B 4XX1E 5F6IB 4RGOL 4ZTPL 1VFBA 2G5BA 3C60C 4M6NL 2G60L 4OLZH 4M43L 5BS0E 2Y06H 4KTEH 5D7LD 3K4AA 1JWSA 1YEHL 1RMFH 1LO4H 1TZHA 1U3ZA 2VDML 3VWKB 4JJHA 3UZQA 2VISB 1NDGA 3HR5B 3SE4C 1S7SA 1ZWIB 5E2UL 4BH7A 3O8XA 2BVTA 3MV9E 3GIVB 3K4ZA 4P2YA 1IGJB 4YDJA 4RAHA 3BIKA 4QGYA 3DIFB 3LPWA 5A16B 1PVHA 2GITA 4ZSOA 1KXVC 2NY3C 3KPNA 4DGVH 3ZKQD 1EDQA 1A2YB 4C55A 4OV5A 5BMFL 5IB4A 3EYOB 3KYKH 5TDOA 3VXNB 2E7LA 3TT1H 1LK2A 1T5WB 4LMQI 1NUDA 2Q1EA 5D1XD 4LLWB 1MFEL 3WFCH 1SYSA 3D69A 2W60B 1XGRA 5I66A 1OGAA 5K9OA 3QQ9C 1U8QA 4X4YB 2VDOL 5ETUB 1WC7A 4R8WL 4LCWB 1A1MA 4Y5YB 5D1QD 5SWZE 4LHUB 5IQ9A 2R39A 2DQUL 1RIUH 3RKDC 4LRNL 2ZUSA 2DM2A 5I8KH 1I3GH 1F3JA 4BQ9A 2Y7QB 1FE8H 1Q38A 4JPIB 4WO4B 3C6LD 1NBZA 4PJDB 2B1AH 4LPVA 5C0AE 4BKLB 4X7CC 4JFOA 4MA8L 5EZLB 5I0DA 4P3DB 4K7PL 1R3JA 4TTDD 1BF2A 4UTBH 2E9WA 4LNRB 2FX7H 1UJ3B 3GMNB 4QO1A 2FCBA 2LTQB 3ARBD 1WT5C 4Y1AB 4LF3B 4CMMB 1I7RB 3V5KB 5EZOH 2NNAB 1TCRA 5IB5A 4M7LT 2OJZL 2GYSA 1TCMA 1UH3A 3QQ4B 5F1KC 1IAIM 2M2DA 1A0QH 4OLVH 5FM4A 5DJ0A 3VXSD 2ZKHL 1G84A 1QSFE 1RULL 2XPGA 1WFOA 1P5UA 5GGTA 3BDXA 1IGIL 1NCDH 5FV1L 5HHMB 4NO0B 1CLYL 4ELME 3RY5A 3VXRB 1AC6A 1AGBA 1R5WB 1EHNA 1DBKL 1A6ZA 3MLZH 2AEQH 4J3UA 5HY9A 3PQYD 3O6ML 3PGFL 2OP4L 3B6SA 5E9DB 2J4WH 3DX7A 3GMQA 5D93B 5DHXB 5IROA 5B21A 3UTSB 4L8DB 3EFFB 1UG9A 4UILL 1U92B 1QBBA 4BSWB 2CIIB 4JG0H 3KR3H 4UQ2A 3NFSL 1P4BL 4KRPD 1WZMA 2IPTH 5ID1B 1WBXB 2GI7A 3KPLB 5HGBA 1OWRM 4MAYB 1AH1A 2DLFH 2FDBP 3TO4A 4ZTPH 5IFJA 3V4PH 5T3XH 5B3JF 5DHVA 3GRWA 5DK0B 2CPCA 1ZVSB 3IDJB 1AGCA 2YEZA 4OGAD 1CFQB 1N7ML 3ILQD 4PRBB 5JOPE 4NZJA 4OF5A 1EVUA 1NMAL 1PD6A 1QRNE 4RFOL 2D0FA 4HKXA 4HXAL 3MRMA 4X98A 5SX5H 3T4YA 3QWOB 3TZVD 3T77A 2YBRB 2FHCA 3HI6H 1C5BH 4I0PD 4Z7VA 4A6YA 4YHML 1I3UA 5BMFH 1NCBH 2VLRB 1ZMYA 3FO0H 1HILA 2ESVE 3OAYK 5MP6H 5EUOF 4XNXL 4FQXA 7CGTA 4LCYA 3IVKA 3C09B 3RU8H 4RBPH 3KYAA 4KRNA 5FA4A 1W72A 4JQVA 4NP4L 4Q97A 1KXTB 2YPLA 1WEJH 2EIZB 3QHFH 3QNXB 2W9LA 1EZVX 1FCCA 5B3NA 5CBAA 4POYA 4AEIL 5AZEL 4OLEA 2X4PB 1RZFH 1K3ZA 4R8WH 4QCIA 2R4SL 1AI1H 4RA3A 1WWWX 1X5YA 3C8HA 5ITFB 4Z7NE 4ZUTA 2AJUL 1S9WB 5J89A 4KQ3H 5E5MB 5DYOB 5KZCD 5DS8B 2BNQB 3LMJH 4MA8H 3GJFH 5E8EB 5C09D 3T3MF 1QNZL 2Y1VA 1FQ9C 2FIKA 4XNQA 3LDBB 2ZUVA 1K5NB 2MNUA 3B5GA 1QHOA 5GGTL 5BV7C 1E4XI 4Y4HD 2E8YA 2F53B 4JY6A 5IB3A 3DXAB 2OJZH 3U36A 4WW2F 1T0NA 4QRRE 2OSLA 3KYNA 3T4AB 1JCKA 3SCMD 3V7MA 4P23A 4MWFA 1FORH 3G6DL 1RULH 1KN4L 2YPVL 4GAYA 2V9QA 1M7IA 5JOFA 1UACL 2HRLA 1XCQB 2XZCH 1P6AB 4CN1A 3U1SH 1ZSDA 5LCVL 4MHHI 3QUMA 4Y5VA 3PHOB 4EIGB 1LD9A 3IS0X 4ISVA 5EOCJ 2NY2B 2VLJA 4R96A 5B38B 2H2PD 4PRHA 4P48A 4F9LA 3QH3B 1N6UA 1A4JB 3GSVA 4BUGA 3GRWL 3TCLA 1YY9C 3BP7B 1R3KA 4KJWC 3OAZH 3HE6B 1INQA 3DRTB 5I1DB 4Z95H 3NFSH 1I85C 3ZYZA 2I24N 4P2OD 2D0HA 2YXFA 4L3EB 3EO9H 1C5CL 4JFZL 3PJSB 3QWQB 1KBGL 3TBTB 1TNMA 2X4OB 4OLXL 5FA3A 1KPUB 1E4XH 3OGCB 3HNSL 2XZAH 3F62A 2GSIB 1U8PB 4N8VB 1LE9B 3KPTA 4A6YL 3LH2L 1F58H 1J8HA 3EYVB 4XCCH 4YPGB 3RGHA 2VC2H 1F90H 1G6RH 1MOEA 4HWZB 3BN9C 1W72L 4F7EA 2FZ3B 4H20H 1JPSL 1JN6A 2X4QA 3NABL 2X4TA 2YC1B 1WFNA 5CJXA 4FTVB 1OP9A 3U6RA 3K46A 4Y5XB 5TH2A 1T7YA 4GKZB 1GGCL 3U4BL 1PG7H 1OTTC 3VXMD 2IANB 2D9CA 1GC1C 2NXYC 4G80A 2NY4D 4TVPL 4PTTA 4M8QA 2BRRH 4NP4H 3G6JE 1EV2E 1MHCB 3T65A 1JP5A 1FLTX 1RPQA 1G7LB 5HHNA 3U0WL 2GCYA 3WS3A 3LKOB 4IM8A 1HNFA 4D9LL 1FSKB 4F7TA 2V7HB 2EKSB 5B39B 1A1OA 4X6DB 1CL7L 2UYLA 4XRCB 3E0GA 1IC4H 4M3JA 3PDOA 2KQNA 4NJAH 3SDAC 3ZHDA 4HG4J 3BGMB 5IMMB 4BELD 1ZHNB 4HS8H 4LSSL 4HBCH 4HMCA 4ONHA 1T7VA 3H7BA 4F9PC 5EOCL 3GKZA 3UTZA 3QQ3B 1DVFD 4ODVH 4ZAKB 3QEHA 3QNYA 2VB5A 2Z8VC 3QG6B 4HK0B 3RX5A 3PHQB 2Z91B 4S1RL 2ARJQ 1I8LC 3DUSA 4OGXH 4JAMA 4OT1L 4PJ5D 5MENA 2DI9A 4DVRH 2BK8A 3QUML 2C3XA 2F5AL 4Q0XL 1P4LA 5T1DL 1GGTA 1WBZA 3CDCA 1A9BB 4UQ3A 3E2HB 1IM3B 4JKLA 1QPPA 5FGSA 3O3AB 1UACH 2XTJB 4AMKH 4Z7UA 2J8UA 3FN9A 3S5LA 3CK0L 5CEXA 4M7JL 4Z7NF 5CFHA 3MUY1 3QNZB 3P73B 3K81A 3RHWK 3EDEA 2NY1C 2F54E 5FECB 2V2TA 5DURD 3TIEA 5A3IC 4HC1A 43C9B 5HYJB 4U2ZA 2HJLB 1HHJA 4M6ML 2IQAB 1G9EA 1S3KL 4ZNEA 1MFNA 4YLQT 1JHKL 5DFTA 2UY6A 1NFIA 2OM5A 1BVLA 2V7NA 2Q6WB 3ECBA 1EXUB 2Y23A 1XR9B 5FHBH 4U6HB 2XFXA 1G6VK 5J6HB 1CL7I 3L9RB 4WCYL 2VXSH 3DBXB 5EU5B 1C5CH 3TWCH 4BM7A 4Y4FB 5CILL 1K85A 5GGUB 3QPQC 1KBGH 5FFLA 4J3SA 5FM8A 3RFZC 5ERWA 3MRCB 3ZTNL 3PNWA 5H2BB 5HYSG 43CAB 3QCVH 5TE4L 3TV3L 3MV7D 2BVYA 3CDFA 4QXTA 3GHEL 3FFCB 4QRQA 4JRYA 2P48B 4JO2L 2WIIB 5C0BA 2HFGH 5HGAA 4Y19E 4UOJA 3LEVL 3WUWB 1F4AA 1CS6A 1IEAA 4LRIC 4G6AD 1AY1L 4B53A 2H3NB 4HIXH 5ACZB 3AGVA 4TVPH 1D5ZA 1YMMA 1GYAA 5FO9A 5CEZH 2BXYA 2XZQL 1RY7B 4F57L 4B41A 3ESVF 4HUXB 1ZGLA 3Q0HA 2A6KB 1CDJA 2VLKE 4Q9BA 1ES0A 1U8OB 4OQTA 3KHOA 1OT1A 4XH2A 1CL7H 4YX2L 4GBXA 1LQSR 1I9IL 3VXTB 1GOGA 3EDFA 3KYMB 5ICXA 5FDWA 2XY2A 3ZE2F 4P46A 3SJVD 5T5NG 3HC4L 3LQAC 4LCIL 4X4MA 4A2LA 3TBVA 4HH9B 3D5OF 5IKCB 4P5TC 2YOCA 2WUBH 5D1ZB 3S36L 3CVHH 2YS4A 1GZPA 2JJSC 3BHBA 3VD7A 4OZGA 5GGRY 1UM5H 3L7FB 4ZOAA 3LS5H 2EYTB 3VRIA 1BZ7B 1CIDA 1WIUA 4LPWA 5F7LB 5B4MD 2IGFL 1J86A 2RAMA 1EO8H 4Z77A 2AJZA 2CJUH 3BJ91 1BVKB 2R0LH 3P11H 2VSDA 3KPOA 3G6JF 3D3VD 1RURL 4JPKL 1MEXL 4PGDB 3VE0A 5ISZD 4NC1C 1L9MA 2K7PA 3MREA 3RL2B 4NWUL 1B0RB 3C5ZB 3E6HA 4HC1L 5DRZA 1QSEE 1UWGH 4OF6A 2KH2B 2NZ9D 1II4E 4OM1H 3VXOA 2G75B 5CLWA 2W59A 1GH7A 3DYMA 1N59B 3BP5B 3WV0A 1QFUL 4F7PA 1S9VB 4YDIH 1O5DT 3GJEB 5DMJB 2GSGB 4M7JH 1LO3L 5HHOA 1JHLH 2JCCA 5AWNL 1EHAA 1F2XK 3TVMB 1CICA 2ERJC 4UNUA 5KSAA 2EKJA 2I60L 5D2NA 3DRQB 4MDIA 4YHLL 2HKFH 3W9DB 1JHKH 5KVGL 2G9HB 5DHYB 1UB5A 5DRWB 4NZRL 2ZCKH 4QXUH 1H0DB 2PR4L 4Q7DA 3KPMB 2P5ED 4IHOA 3FKUS 3L3DB 2FATL 1YDPB 1QFOA 5DQDH 5F96L 1R5VA 3MJ8B 3HZKB 2FR4A 4JO1H 4KI5D 3T2NL 2BSED 1UKQA 5E6IC 3OKNB 4LVHB 2VTFA 1EO7A 1HHGA 3F65A 1IGFH 5D4QA 2AQ3A 5ILTL 4AG4L 3IFOA 3IETB 2J6EH 3P77A 5KJRL 5TJWK 1ZT7A 1G7PB 1N0XL 3D2UB 4XP9L 4ZNCD 3JWDL 3HE7C 3RDTC 3TN0B 2RCSL 4PJFA 3KVQA 4YH6A 1IE5A 4JM4L 3EAKA 5L2KB 4X0KA 1NAKL 4NC1E 3GNML 4KI1A 5J4MA 2BOCA 4OQTL 2MKLC 5LGHL 5FGBC 4HLJA 1BFVL 3HR5A 3VWJD 4R7DB 1CCZA 3MMEA 4NN5C 1QBMH 3FO9A 3OXSB 3DIFA 4FQIL 5A16A 4ETYA 5K33A 1A7NL 2VAAB 4X4XB 1A2YA 2DD8L 5F7DB 4YHYB 4YBHA 3EYOA 3VXNA 3UP1A 4HLZH 4OIIL 1V05A 1TTFA 1YEJL 3QRGL 4G8EB 2C7UB 2WBJC 1CU4L 3DSFL 1AD9B 5EUKB 3QUYB 3E8UH 4DQOL 4HIJB 2NXZB 3D0VA 3CX5J 4LCIH 3K4DA 4K7FA 4NZDA 4X6CE 5IOPA 2YKLL 3MYJB 4YHPB 2ARJB 2QQKL 1DZBA 3S36H 1DDHB 5ETUA 4NKQB 4RMQA 4XC3H 3C5SB 3RI5F 3ET9F 3C08L 1KJ2H 5JHDA 4M48H 1T4KA 2V2WB 2IGFH 4XWGH 5DUML 1NGQH 4JPIA 5DSCA 4PJIA 5T1MB 5D1XC 5I8OL 2VIRB 4S2SA 3ARFD 3UTPE 4BKLA 5ACMA 4AEFA 5EZLA 3QUKB 2VXQL 1AD0B 5DI8A 4IOFD 1HOCA 1YECL 1HQ4B 3V6FB 3VRLE 3EDJA 5D1QC 2Y6SD 1UJ3A 2DI8A 3GMNA 2YWZA 4LF3A 4G6ML 2UUDH 3V5KA 5FAAA 1LO3H 4RIRB 3SGKA 3MRFB 4IMLB 4F33A 3QQ4A 5DEGA 2CLZA 3WDHA 4E41A 1L0QA 2VDNH 4TTDC 3ARGA 2ZJSL 3MBEB 3ARBC 4Z5RB 1AQKL 4NO0A 4NZRH 1UGNA 3F7RA 3TA3B 2EIBA 4P4RB 5D7LE 3VXRA 4LLUB 4Q58C 1R5WA 2ADFL 2D7OA 1X9QA 3TT3L 2FATH 1YQVH 4OTXL 3M17A 3UPCA 2GAZB 4RAUA 4EDWL 1YN6B 3QAZC 1R0AH 1ROWA 1NCCH 4L8DA 3EFFA 5I19H 3Q6GL 1U92A 2HFTA 1RIVL 3NIFE 5T5FL 2VDLH 3BI9X 3N9GL 3C9NA 5ID1A 4XCFL 5D7JD 1XGUA 4WI4A 4EBQL 4JCMA 4LAJH 2XQBH 5KW9H 3ULUF 2WZPD 1KT2A 3IF1B 3B2UD 3VMPA 4Z6AT 3SGEI 5DK0A 1ZVSA 2P43B 3IDJA 4C56D 2IFFL 3D39B 2DLTA 5J11B 4WI6A 3V6OE 1UYWL 3OZ9L 4LSTH 1H3PL 3OKOA 1QZ1A 2EXWD 3CFKA 4D9RD 1QR1B 2X9YA 3TFKD 3HG1A 1CG9B 3NFPA 4CJ1A 4KK5C 5TDPA 4YHOL 1T0MB 1V5JA 3F7PC 4WNQB 3MLYH 1A7NH 3TJEL 2VJXA 3N1MC 3ULSB 1KLGA 1BP3B 2XQYG 2VLRA 5F97E 4RA0C 3ILQC 4IRZH 3RZCB 4K94H 1DEEB 2XN9A 4OZFG 3HI1B 3IDYB 1OW0C 2CMRL 3RGVC 4DQOH 4UV4L 3KLSA 1FIGL 1QSZA 1XGYL 3QNXA 5H8DA 1RV6X 2YKLH 5EOQH 4NRXB 1AGFB 4OCWL 1B88A 3RX7A 5HDBE 4NGHH 4Y2DA 1FVCA 4ZUUB 4B7IA 5E2WL 2QHLA 2DQIL 3MV9B 4NQCB 2R8SL 3VXSE 3BKML 4HT1H 4N8CL 4FXKB 1SQ2N 5SWQB 1S9WA 2J3SA 4PRPD 2R2CA 2L7UA 5D6CB 4HFWB 4EUPA 3CH8A 1PY9A 3SGEH 1YA5A 4RQQB 4LKXB 2BNQA 4X6EA 1X7QA 2X05A 2AJXL 5EPMA 1FRGL 5BVJB 3PIQA 1WSST 1YECH 1IEBA 3PQYE 5DD0H 3BKYL 2PO6D 5DQ9B 1VPOH 3FOLA 5MHSD 5EA0L 3JUZA 3WE6B 5IVXA 1L6XA 1ZTXH 2F53A 4ZQKA 1CD0A 3SE8L 1BAFH 4HKZA 3DXAA 4X6DF 2GJ6D 1MIEL 2IBZY 3AXLA 3OB0K 5FO7B 2FH6A 3T4AA 4FMFA 4X6CF 4MA7L 1PZUB 2DLGA 5IUSA 4XAWL 1KNOB 1NEZB 2QL1A 1U8NB 1OTUC 1H3VA 2DWDB 5E2VH 2PXYD 4JPVL 4RGMC 2B4CH 4UV7H 2BSSA 1AQKH 3DO7A 4HWBA 1AR1D 2FBJH 4Y4HC 3LKPB 4MNQB 4DGYH 1RD6A 3I9GL 2VR5A 3LIZH 3TT3H 1ED3B 2WINA 4OTXH 4N0YL 3EZ8A 4UUJA 2Q86B 1T0PB 3W0WD 4NQEB 4XMLH 3C60B 1AXSB 5C7XL 3VRLF 3BP7A 1KTDA 3SKUD 2Z4QB 5I1DA 3HE6A 3DRTA 3DI3B 4QOKD 4YAQB 5E24E 5ADOH 3N9GH 1BBDL 5GS1C 4I4WB 4NNPH 4XCFH 1HDMA 4EXPX 4Z7OE 3U9PL 5IJVA 1JK8B 2GTWB 1QSFB 1RJZA 4JB9L 3ARQA 4X7SL 1PLGL 2V5MA 3LAFA 3TBTA 2AJ3A 5HVHC 2H2PC 4G8FB 2R2HB 3STLB 2NY3B 3OGCA 2A74B 3SGDI 5C07A 4R26L 4KPHH 2GSIA 3WDIA 1KIPA 5IJKA 1LGVA 3L3IB 1VFAA 1LE9A 5EU4B 1XF5B 3D0LB 2P4AB 3UZEA 1IAIL 4L1DA 4JPWL 3BP6A 2YSSB 1RZKC 1UYWH 4YPGA 3ZKMD 5LQBH 4P2OC 2IJ0C 2P8LB 4ONGH 4KRLB 4TRPL 2FZ3A 1HXYA 2BMKB 1FGVL 3VGBA 2VQTA 4L8SC 5GSVB 3OKLB 1DN0B 1WK0A 2DQHL 3QDJE 3F7VA 3EO0A 4QHMB 3TJEH 4Y5XA 5F71A 3BKJL 4GKZA 3VXUB 5C09E 3FB7A 3RWDA 4XVJH 2BNRD 1D5XA 2PYEA 3D85D 3G08A 3NIFF 4GW1A 1MHCA 2J7LA 5JIIA 1XGYH 2NY6D 5IQ7L 1UWXH 3OJDA 5HD8D 5E95B 3O3BB 1FNLA 5GZOD 1S7RA 4IOSD 2V7HA 5FYLL 3S98A 1C5DB 2W0LA 2DL9A 3RVTD 3IT8D 4HG4K 4MNGE 1CR9L 2NY4C 2PN5A 2VDKL 2PW1B 3BGMA 5IMMA 5JNYB 1KV3A 5T1KD 1IC7L 1U42A 3TYGH 3SGDH 1JVKA 3TGXA 3TLRA 1CN4A 1OAKL 1MQKH 1A22B 4OCSH 5MEPB 1K4CA 4FNLH 5JUEL 2LU3A 2R2EB 4UIMA 1X5IA 2J12B 4UOW0 4HS3B 3BKYH 4ZAKA 4HK0A 1D9KC 4LCCA 5EA0H 2DWEB 5JW4R 5INDB 1WICA 2X4NB 2D31A 4HWBL 1I1CA 3EGSA 5IGXH 5KAQF 3MCLH 4ODWB 4CRPA 2HTKD 4R4ND 4DW2H 1A9BA 3ALWA 2O5YL 3RIFF 1IM3A 3LD8C 5HDBF 1IGML 4P2RA 1Z3GH 2X4RA 1DVFC 1A1NA 1F8TL 4GLRI 4GXUN 3QUZA 4N0FA 5ICZA 4MQSB 2AABL 4DOHB 4N9GB 4BYHA 4ZFGH 3P73A 2UY7A 1IVLA 3D9AL 4HF5H 1LK3L 1XCTA 5FECA 2KZ1B 3IYLW 5HYJA 4O51A 2HJLA 2IQAA 4QYOB 5C2BL 5DJXA 2HVJA 3O2WH 1OAYL 3GMPB 5KS9A 3R4DA 1XR9A 1Z6JT 4NQDE 3ULVL 5AEAA 4KVCL 2OYPA 1OAQL 4U1HA 4U6HA 1YNTA 4JZJA 3K2UL 5C0EB 1T3FB 5D7KD 3L9RA 3DBXA 5AYUL 4S11A 3VXME 5EU5A 4G8GD 4Y4FA 3CD4A 4JB9H 5IW1B 1X5KA 4I48A 5MEND 5F6HJ 2UUDK 1MVUB 3KG5A 5CINH 4NCDA 43CAA 2OK0H 2AV7B 3KJ6L 4GKNB 2F15A 5TDNB 4EN3D 2WP3O 3I2CH 4HPYH 2PW2B 3FFCA 4FQ1H 3S4SB 1Q94B 2WIIA 3SDXE 1BQSA 4GLRH 5SX4I 2DQHH 4I3SL 3BO8B 1NBYB 1MI5E 2A0LC 1TMCB 3QWRD 1JGLL 3OKMA 5EZIL 2OS7A 1S7WB 4HWUA 4TSAL 3SGJC 2XKUA 4P2CG 5ACZA 2O5XH 4NWTH 2DL2A 4WHYH 5I1EL 5KBNC 1N5YL 4XCNB 4K71C 1F11A 2B0SH 4M1GL 2HFFA 4GAJL 4HIHB 4NJ9L 1NCWH 4Z7OF 1RUMH 4L4TB 3DYOA 2EDXA 4ZS7L 2FJFB 4RWHA 4M62H 1ZV5A 2Z31D 4S1QL 2R9HC 2OR9H 2C26A 4E0RA 1UA6L 4NQXA 3T0EC 5C0JB 2IBGA 3GK8H 4JKPL 5BV7B 4X5XB 2AK4D 4F37F 3A6BL 4NC0B 1IC7H 4HH9A 1J12A 1UXWA 1RZJC 5D1ZA 1F4WH 2AXJA 4WDIB 5IW6A 3B5TA 1CWVA 1JNLH 5F7MC 5MEOB 4JRYD 3L7FA 5JUEH 2BRQA 3W11D 4GMTH 5JXED 3KPQB 1V3MA 3LKRA 4MQXD 1BZ7A 4W6WB 3ARYA 3V5HB 3MLSL 4IDJL 1G7JA 1BVKA 9CGTA 3ULUH 4YDLC 4YNYA 5SX4H 3ZE0E 4LIQL 4AL8H 4ONOA 4PGDA 4L3AA 3MRKA 1L4IA 3WSQL 3RL2A 1B0RA 3T0WA 2O5YH 4XPBL 4D8PA 1MAJA 4EQ3A 1MCOH 1U8MB 5I8CA 1S7QA 3BP5A 5EH1A 3JSSA 2XI9A 1XIWD 4QTIH 1U8IB 1JPTH 3GJEA 3KNBA 3WFDL 5B4MC 1CQYA 3LSOB 3WXVH 2QHRL 4MNHB 4ODXB 5GS0L 4N0CD 1OAZL 3TVMA 2E8ZA 4I2XB 1FVEA 3X3FL 4HDIB 4AIOA 3REWB 1HI6B 1B90A 1UCBL 3DRQA 1A5FH 1X4YA 4P2QE 1JNJA 1OVZA 1ZXQA 2X1WL 2PUQT 2DS4A 1Q9OB 3TNMA 3BEWB 5DJ6A 1TDQA 4JHWL 3PL6A 5HHPB 4RGND 1OPGH 1C1EH 5E2JA 2FSEB 3LHPL 4M5ZL 2XKNB 1H0DA 3FQNA 4C58B 2H9GA 3KPMA 3MROA 1DUYA 2XICA 3MXWL 2BVQB 4DK3A 1A8JH 5C0RL 4NM8H 1T21B 1YEFL 3HRZB 5FB8A 3A6CL 4HUUB 4I18A 4PRNB 4OLYL 3W39B 4DUXA 2I9LB 3RY6A 1SVCP 4NT6B 1E28B 3RWEA 2W65A 2F54B 3ME0A 1LO2H 5C0CD 2NXYB 4EVNB 3MLUL 3WHE0 1KN2H 5JMRA 1YPZA 4L29B 5BQ7B 2VUYA 3X3GH 3SJVE 4R0LC 1D6EB 3VFTA 1ORQA 4KI5C 3ZL4L 3OF6D 4O2EB 3P3YA 4QRTA 1IRAY 4TSAH 2E9JA 4R7DA 5I1EH 4X6BA 1N5YH 1WLHA 4EJ1C 3FQUA 4GAJH 3OXSA 3SDAB 4NJ9H 1GIGH 4LGRB 2IPKA 3IDMB 1J1OL 4N9OB 3QEQB 4JLRB 4K2UH 4NRYA 5GIRA 4X4XA 4Y16A 4ZS7H 3D3VE 3MC0A 3IJYB 4X8JB 4OAWA 1LP9B 2ICWI 1LWRA 1SY6H 2W91A 4G8EA 1A6TB 1WAAA 5IVOA 1BX2B 3GM0A 4PR5B 4O2FA 3O4LE 4JKPH 3STZB 3CX5K 1EH9A 2XA3A 1J5OL 1GGIH 3IDXH 5DC0A 3ARPA 4OZHA 3MYJA 4YHPA 1OL0A 4Y19B 3DVGA 3SDXF 4PRAB 3MZTA 2VWEE 3S5LG 5IV2A 4FQ2L 2BHUA 1SHMA 4G9DB 1H3TA 4KUZL 1I3RB 3MLSH 4IDJH 1ZLSL 3CU7A 2K9UA 4MA3B 5T1MA 3WO4C 2M1KA 4DN4H 2YUZA 4PG9B 1KEGL 2JE8A 3GHBL 2NY1B 3QUKA 4MXVF 4X83A 3HI5H 4XI5D 5B8CC 5BZDA 1AXIB 4PJHB 2HJFB 2P5EE 1BBJB 1HQ4A 4UBDD 2VL5B 1RUQH 3B9AA 3PXJA 5EO1A 1MF2H 3GSXA 3L5HA 2AJYH 1HEZB 4UDTB 4JFFA 3UROR 4YBQD 15C8L 2XACC 1NLBH 2YRZA 4RIRA 3MRFA 1TFHA 3ARFC 2ZG1A 3AS1A 3QIWD 4I3RL 3E3QE 3V4VH 1YNKH 5BCAA 3JWOL 1YEEH 4KRMB 1NBQA 5ESAB 3MBEA 2Y6SC 3GIZL 5FUCC 2VRAA 4ERSH 3LHPH 2DM3A 3X14A 2AJSL 3Q3GB 4P3CH 4OCRH 2E7LC 5JHDD 3HCVB 2HT4C 4E9LA 1BZ9A 2JELH 5KN5A 1GGBL 3B5HA 4X8XA 5TGBB 2XTLA 5IK3B 5IEHB 4KU1A 2R0ZL 4CW1A 4WFFD 4QGTA 1CDBA 1TQCC 4FFYL 4R3SA 1BQLH 2X42A 5EORL 5DWUL 1K3IA 4ZO8A 3RWCB 5L2JB 3LEXB 1MRDH 4G9FD 1IKFL 5K9QI 4HKBA 1FFRA 5CJOH 2Y72A 1JWUB 5E08H 5FCUH 3IF1A 2P42B 4M8VA 4PJ9D 3D39A 3O2DH 4DKEL 4LDEB 2YK1L 1MIML 1WTLA 4DUVA 4E41D 1ZAGA 3EYFA 4GRLA 1B0GB 1JV5A 4YJZL 2X7LA 1S5IL 4U49A 3RPIA 1U6AL 3JZ7A 1JNHA 1Y18B 1WQVT 4WNQA 2EDLA 3VU2A 4P5TB 4P9HL 5EUOA 4ZFFB 2EDWA 3ULSA 4OZIB 3O3DB 3M8OL 1P7KA 1F02I 1FNSH 1J5OH 5LVEA 2IPUG 3O6FD 1YEGH 2EXWC 3B9KD 1FDLH 4GUPB 2J2ZA 4NRXA 2FB4L 2IH3B 2F9BT 3MRHA 2UZIL 1PSKH 1KELH 4G43B 4FQ2H 2JK5A 4KKLD 3MV9A 2Z35A 2ZUWA 4NQCA 4AH2B 5SWQA 4FXKA 2CIKB 4WV1A 3WEXB 3BDBA 3RWGB 2QR0B 1I9JH 1QD0A 4QHNB 4RQQA 1TJHL 3KPSB 3D18B 4PY8J 3PWJB 2ERJB 1OTSD 1AXTH 4V1DB 4JR9H 5BVJA 1OSZA 2WWMD 3ES6A 3MYZA 3DVFA 3BRFA 1UQSB 3WE6A 4IOIA 4QRPB 3HNVL 5TF0A 3MXVH 1F00I 2DLHA 2IBBA 15C8H 2H32B 3LEYL 2OLDA 3P9MB 1CLZL 3AUVA 3GSNB 2XN9D 5FO7A 2UVEA 1IQWH 1UADC 5SWZA 5GGSB 4JZOA 4FABH 4MXQC 2FGWL 4XWOD 1U0QA 1F3RB 3O11A 1REIA 5BOZG 2WQ8A 3UBXI 1U8NA 2DWDA 2XRAH 5CWSB 5E6IB 5EC2B 2PO6C 3WS6A 1WTGT 3IDNB 1HYSD 4Y2DD 2HWZH 4FMKA 3DX8B 1H3GA 3OJVC 5C0AA 4C56E 1KEML 2O5ZH 4F3FB 2AJSH 1RZIB 4EKXA 1AC0A 4NFBA 1FFPA 2R69L 4W4NA 2Q86A 3QCTH 3QISA 3HE7B 5E8DL 5L6YH 3DJ9A 2BVOB 4D9RE 3RDTB 4JQVC 5BVPL 4JM2F 4WU7A 4N1HB 8CGTA 2AS5M 1EFXD 1PKQB 1QLEH 5I1HH 3RVWD 5KVMC 1GGYA 4ZPVB 2C4FT 3VFMA 3K1DA 1U91A 3LKNA 3P0YH 5D7IE 4FFYH 5DD1L 1P7QB 3PWPE 5EORH 3MLRH 4NN5B 1EEZB 3H9SD 2NX5B 1QSFA 3CZJA 1CF8L 1C08A 1NFDB 3PP4H 3M45A 5IMOB 1DQMH 4ELMA 1MIMH 1KJVA 1JHTA 2YSSA 2ENYA 4FRWA 3UJJH 1AE6L 4POUB 4UT9L 2WBJB 2CGRH 3EOTH 2P8LA 4NC2B 2C3HA 4OI7A 3WIHA 3MNWA 2H8PB 4PRPE 3U46A 2KPNA 2FLBT 1DN0A 1MCPH 1H9VA 1QHPA 3WD5H 4P9HH 4ELKB 4F2MB 4WTZA 4FFWC 3BP4A 3G6AB 4Q6IC 4U1JB 5IW3A 4P23C 4PV8A 2X2YA 3LQZA 5FK9A 1NMBH 3WUZA 1IAMA 1TLKA 1WIOA 3BX7C 1MRFH 2XKSA 3V5DB 5D1XB 1XH3A 2QQLH 3KPPB 3H9ZA 4U1IB 2FB4H 4OFPA 5F1NB 3MUGA 3NA9L 1P1ZB 1L7TH 4Y5VC 3WFEL 3P4NB 1CVRA 4CADB 1C5DA 3S34H 3TIDA 1QRNA 3DI2B 4H8WL 5D1QB 4HGMA 1P84J 4F9LC 2E27L 2DTML 2X1PA 3MA9H 1RIHH 3Q48A 3QCUL 1KLFA 4XP6H 5C07D 2PW1A 5JNYA 2R1XA 2YD9A 5I1AB 3NFNB 2NY6C 1TJHH 4TQEH 5HD8C 3FCTB 4K23L 3MRLB 4PJGE 3O9WA 5D7SL 5GZOC 4PJ8D 4PP2A 4M9PA 4CJ0A 1IEHA 4HS3A 2EYSB 3RVTC 2V9TA 1EUUA 4LU5H 2V17H 3EFDH 4NQUA 4B7LA 3ARBB 4PJEB 3UTTB 4QRSB 3LEYH 3H7LA 3WIIL 4LLDB 4XBGB 3OMZA 4K3JH 5H35A 4JJ5B 4UTAL 4QOKE 3L5XL 5KSVA 2PYED 3ARED 5E8NB 4G5ZH 1JI1A 1HXMB 2P8PB 4U1NA 3QAZB 5KANI 3MRNB 2JIXD 1TPXC 1TZIB 4PY8I 4HK3J 1P6FA 5DD3L 2PTTB 4O2CA 3FFDB 3MV8D 5CJXC 1XF2A 2OTUB 1ZKAA 3DHJA 1KEMH 1LEGB 4G3YH 5BJTB 2DLEA 2NY7L 3DARA 4JDZB 2R1WB 3UPRB 4R4NC 2FL5B 3O41A 4MDJA 4WTXA 3FQTB 4NZUH 2W0PA 4TUKL 2EDTA 3L3GB 5T3XD 2APVA 4HX1B 3UC0H 3BXNA 4GG8A 4XZUB 1VKXA 5C0EA 1XZ0B 2I9TB 4QLRA 3VRJB 4QRRA 1H5BA 4YHNB 2FX9H 3PABA 2IG2H 2BNRE 4P99A 5L8JB 1I3VA 2MKWA 1U3JA 4ONFL 4CMHC 3MFGB 3WIHL 5FO8A 4PJ7E 5IW1A 5IMKA 2P8MB 2CK0H 32C2B 1T83A 1XF4B 1FHGA 2AV7A 3MOAL 2DMBA 4CKVX 2W9EH 2FJHB 3IAPA 4GQPH 3QUZD 3RGVB 3S4SA 3RJQB 3VGGA 1FYTE 2VLLA 3PG2A 3OJMB 4Z78A 3CMOH 5BZWA 1N4XL 3PV6B 1DUZA 1C16B 3BESR 1I1RA 3MO1B 4MD5B 4K3GA 4EUPG 3E6FB 1EX0A 4U6XB 1IARB 1M1SA 3SBWC 1R3IH 4EN3C 2DYPA 2ATKA 4I77H 1T1YA 2PTVA 1FZMB 2SEBB 1B3JA 5HYQB 4LEOB 3ZE1E 2NLJB 5DVMA 2IMMA 2FJFA 5TE6L 5K93A 2RBLA 2CSPA 4XCEA 3HR6A 3S88L 8FABB 3G5ZB 4JFPA 5C0JA 2E7CA 3HMXA 2E27H 1EJOH 35C8H 1FNFA 3GMRB 3MJ9H 4NKIH 2Q8AH 5KZCB 1RZ8B 4J8RB 1EJ6A 4K23H 5D72H 2P45B 5AD0A 2K7QA 5MEOA 2Y5EA 3KPRD 2CO6B 2Z31C 4WW1A 5C6WH 1BD2D 1FCGA 3BT2L 3MNVB 5EIVA 4O9HH 3BAEH 1Y0LB 3DHMA 4RGMB 3RIFK 3P9WB 3CX2A 4OKVB 1S7VA 4HIEB 4Y4HB 3HUJE 3FQRB 4YXKH 4RDQF 3RWFB 4PV9B 1CGYA 2W92A 5D7KE 2VE6B 4DTGL 3A67L 1P5VA 5HYSB 3HB3D 3QDMD 2OZ4A 3QFJD 4U31A 1J0ZA 5E0QA 4MNGB 2ZUUA 3HZVA 1U8HA 2YD3A 5HGHB 5CCKL 2F8VA 1Y6NR 3U0PA 2VDPH 3PE9A 4JGJA 4MNHA 4FQHB 5EFIB 2DKMA 1I85A 3IU3B 3K8LA 5GS1B 1XMWA 1U95B 1FNEB 4K3DL 4H0HB 1A7PL 1HHIB 1I1FB 2ZPKH 2BFVL 2RQ8A 1IT9H 4BQ8A 4PJGF 5HVHB 1MHHB 2Q7YB 4DAGH 1HKLL 1UXSA 5DEFB 4PJXE 5GRUH 1F13A 1MELA 4PJHF 1VFOA 3O45B 1EHLH 4N8PA 3ZT7A 3MLVH 5K9JH 1S9YA 3JV4A 3P40A 3U82B 4P2OB 1IGYB 5DUBA 4OD3L 4XB7A 3QIBD 4XPHL 2X1OA 4U1GC 4L8SB 4FA8A 2AXHA 1BREA 3R1GH 3BH8B 5J6GB 5F7EL 4DKFH 1OM3L 3H0TB 2I9LA 5DJZA 3QPXL 5DA4A 1E6JL 2OMBA 4RMRA 3INUL 2F54A 3SOBL 1T1XB 3NH7H 2B1HL 4RISH 2EDFA 4HPOH 2A1WH 1UH4A 1BECA 2OBGA 5GZND 5TE7H 1U8JB 2AK4E 3IFNH 5I76A 4GG6E 5L7XH 1RUKL 5C0FB 5DEZA 1KCVL 2QQNL 3W5MA 2H6PA 4ZPTA 5ANMB 1M6OA 2IH1B 1YMHB 5CHNB 4KDTC 1CXLA 2EDEA 4KKCD 2DQTH 3S96B 5BV7L 1NSNH 2NY4B 3N85H 3SDAA 3PL6D 1W2KT 3VJ6A 3IDMA 3OKEA 3QEQA 2HT2C 4JLRA 4F37K 1BJ8A 3DURB 2CUMA 1AHWA 2X44D 1LP9A 3VI3E 3MRPB 1IM9A 5INCA 4I5BB 1A6TA 5D2NC 1BX2A 4QXGL 4PR5A 1N3NB 4DZ8B 3STZA 2GQHA 2WBKA 1D9KB 3EHBD 3G04B 4V2CB 1U3HD 1I8LA 1G9MC 1KB5B 4U1SA 4LSPH 2GK0B 1MJ7L 3GMMA 1WFUA 1NLDL 4Y19A 5CSBA 3MRGB 4PRAA 4QF1B 5EBLA 4JFYB 3GGWA 1URLA 3LD8B 4KJQD 4XPAH 3L3HB 3BT2H 2C3GA 4G9DA 1DVFB 1I3RA 3H9HB 1S7UA 1YY8B 1NC4D 4X9GA 3VFVA 3O3UN 1AKJD 4AIZA 4X6FA 2QADC 1AFVH 4RGNE 3G5XB 4PJ5B 5EOTB 5F1OB 4G42B 2VLKA 4PJAB 5GS3A 3ZE1F 3IJHB 1BBJA 1V7ML 2Q76B 1YNLH 4YWGL 4KJPC 1HEZA 4L4VD 4UDTA 3RPKA 3X13B 4OGYH 3CFBB 3RWIA 5F8QC 1GSMA 3GI9L 4K3DH 1BGXH 1N26A 5DURB 4CNIB 1ZHBB 1HE7A 1CI5A 4H5SB 5ESAA 3NCBB 1GZQB 5FEBA 1OAUH 4YXLL 1EMTL 1GJIA 3N1FC 3PWUB 4PRID 3WLBA 4LLVA 1K8IB 1Q1JH 4HGWB 2A83B 3RVUD 4KAQL 1GC1L 4LARH 3PGDB 5CGTA 1QSEA 3HUJF 1CDUA 3MV01 3HCVA 1A6UL 4LAQH 3GBNL 2VQUA 5TGBA 4MJIE 3HS0A 5IK3A 2C1OA 3QDGB 5I1CL 4EDXA 2QLVB 2OX5A 3I50L 1FVDA 1MAMH 1FL6A 4JDTH 1LNUB 5CP3A 1VCAA 4BZ1L 3IXTA 4PJBB 1HIMH 3OPZL 2OXGA 4K71B 3MV7B 2ENSA 1T03L 2DBJA 4TVPD 4JFFD 1RUKH 5CEZD 2Q7NA 1Z5LB 3H8NA 1KCVH 3IFPB 2IAMA 2XWJA 3OAUL 5GS2D 3OHXA 1OHQA 1S7XB 1LHZA 2EE6A 1RK1B 3VXPA 4PJXF 3G9AB 5KSBB 3SPVA 1B0GA 3T0EB 1A6VH 4PS4L 4M1CD 1FNHA 1JF1B 4NDMB 5CGYC 3RWHB 1ADQA 1JYNA 2JJSA 4OZIA 3DV4B 3O3DA 4CN6A 5J8OA 1KCKA 1S9KC 1X5ZA 3BPCB 3WNLA 4M6OL 4TVSa 5GRJH 1SYVB 3DTXA 1X5JA 1QO3A 3FQXA 4HJJL 4L8BB 5D5ME 4YDLB 1RZ7L 2C1PB 1NLDH 5HDQH 5DO2C 1CE1H 4HEME 4BQBA 2R1YB 2Y4SA 3EKCA 2BDNH 2DJ4A 3QG7H 4PJCE 4UMGA 2YXMA 3WBDA 4NKOA 5EU6D 1Z9LA 4GSDH 2GW5A 1YJDC 3WEXA 2IMNA 3HPLB 3RWGA 2IADA 2QR0A 4H26B 3O6FC 2R29L 1G1YA 4QHNA 2WANA 3PGCB 3ARDD 5HI4D 1RVFL 3PWJA 1I7TB 3DX6B 4V1DA 5ISZB 3W82A 2HT3D 5EIQA 2IQ9L 4D0BB 1J05B 3CC5B 1JFQL 3VI3F 1I8KA 1UQSA 1AO7D 5CJQL 2F74B 2XA8L 5D70L 4PGEB 3SY0A 2I25N 3MPCA 4X6CA 3V7AG 1I4FA 3P9MA 3OG6B 4TUOB 3GSNA 5AZ2L 4WFFE 4IS6B 1IFHH 1OTSC 5E6IA 4G9FE 5EC2A 5BS0D 3P4OA 2MQ3A 4JFDD 2UWEE 1ORSA 2WWKO 4JFQB 1S78D 3S35H 2GY5A 3MLXH 1MFDL 2VZSA 4HCRH 2OQJB 3GSUB 2P5EB 4ENED 3EBAA 4TULL 4JRXB 3GBNH 5FUZH 1WCQA 3KXFB 1FLRH 4J3TA 4YXHL 4OFYA 4R0LB 4EI5A 1INEL 2A6IB 2AXFB 4OZFB 2ZSVA 1KTLA 4J7RA 2YD6A 4KK6D 1HYSC 4Y2DC 1DQJB 5LBSL 2I5YH 1EEZA 4P4KD 4YUEH 3P30L 4G8IB 3TH4T 1DP0A 4ZD3L 1RU9H 1FJ1A 1NFDA 3F12B 4NUGL 4XNMB 5DTFA 2XV6B 2FEEL 2JLLA 5IMOA 4Z7QE 3B3IB 5D7LA 1CLOH 1HQRB 1FV1B 3RVWC 4JFED 5C86A 4P9MH 5C9JB 1K9TA 2ICEB 3QZWA 3CGTA 4PTUB 4MAUL 2ZCLL 1CXKA 4OCXL 5JLZA 1CD1B 3U9UB 5SWSD 3IRPX 1NAMB 4ELKA 3MGOA 4TPRH 2UV3A 5EIIB 1FPTH 3SDDD 5IBLC 5JW5B 1WZ1L 1HWGB 2VN4A 3TEUA 4Q2ZB 3FOMB 4FFZH 4BA8A 1FZOB 5GSRA 2CXKA 4OJFH 4J4PD 1YEKL 1I75A 2VDRL 5D1XA 3WO4B 2IFGA 4P5KA 1U58B 1RZ7H 3KPPA 4U1IA 3S6CA 1J0JA 5B8CB 5F1NA 3TYFB 1ZGLP 4ORGB 4O4YL 3QXDB 5IVNA 3P4NA 1P84K 3HC3H 4YHIB 1VFBB 2LVCA 2R29H 2XWTB 3ZYOA 3NFNA 1X4ZA 1JWSB 5FYJU 3C6LA 1TZHB 4K8RH 1YEDB 3ARFB 3GSNL 4NKMA 1NDGB 3MRLA 1KIRA 4IRJD 1UVQB 1S7SB 1SEBA 2DM7A 5IR1A 4BH7B 1JFQH 4YDJB 2BHZA 1JGEA 2DDQL 3BIKB 5CEYA 2EYSA 4KGLA 1PFCA 2GITB 2JTDA 3NCJL 4PY7B 3IFLL 4PJEA 1EK3A 3KPNB 5IJKC 1MH5B 1MWAA 1Z2KA 3QFDA 1MCIA 3ULVC 1JL8A 4JG1H 3AMLA 5AZ2H 5IB4B 5TDOB 3OX8A 1LK2B 3WNNA 5E8NA 5C71A 4R97C 1CGSL 4PJ8C 1LDPL 1SJXA 2P8PA 3H9SE 3VXSA 3MRNA 3D69B 5HHXH 4PJCF 2FECL 1XGRB 5I66B 1YYMH 3WN5C 4HK3N 1CGXA 2GTZA 5JOPD 5K9OB 1JIBA 1JGUH 1WC7B 1TQCB 5BJTA 4U1KA 4YIQA 1A1MB 1MFDH 4JDZA 4AM0A 1BPVA 1CXIA 1CLCA 5IQ9B 2DQEH 4TULH 3UPRA 2FL5A 3PQYA 2DQJL 1JWMA 3VD3A 1KULA 2C4XA 1EVTC 4I9WD 4PGBA 4D0DA 3NZHL 3BRGC 1NBZB 3L3GA 4AEHH 1MJ8L 2AEIT 3H42L 5HJ3B 3GI8L 4LLYB 4JFOB 3O9WD 1SEQL 4XZUA 4PB9L 5JO5A 1A3LL 2ESVD 4X9FA 1XZ0A 5CSZA 1R3JB 1X5AA 3VRJA 4YHNA 4W70A 3QXUA 4WUUD 4U6VH 5M7QA 3LQAH 1NEUA 2ZOLA 4S1SL 4NUGH 5BO1H 4TNVK 2DRUA 4C83A 5IB5B 1UT9A 5D2LE 3L5JA 1XF4A 4HXBH 4RMSA 2UWEF 3SKOA 5EC1A 3UJIL 2XPGB 1KJ3H 4DKAA 4LCCC 1FG2A 4G6JH 4HMDA 1PJ9A 1RSFA 3PV6A 4YR6A 3CFEA 2AAVA 1C16A 3IKCB 3TZVA 1AGBB 3D25A 3BVNA 4I0PA 1A6ZB 5HY9B 5D7IB 1Z0MA 3AU1A 4UINL 3B6SB 4X80H 4HGKC 3DX7B 1BQHG 3GMQB 3RNQA 5KVDH 1FZMA 1YEKH 1NGXA 3DVNA 3FO2A 3QUZC 1MUJB 1B6UA 4LMQE 5E00B 5IF0B 1G9NH 2NLJA 4UQ2B 4KK9D 2OJEA 4O4YH 3VI4F 4XP4H 3G5ZA 3BISA 3CIQA 4TNWK 4Z7QF 2C3VB 1NBVL 5HGBB 4NIKB 1PGRB 3BZFB 4NOBA 1ZLUK 5I1KH 3PWNB 5DHVB 2H32H 1MWAL 4MD0A 1AGCB 2YEZB 3MV8E 2D7QA 3Q5OA 4LSVL 5J12C 4JZJC 4J8RA 3WFBH 1DBAH 3U7AA 3OSKA 5C09A 4ZYKB 4HKXB 2DDQH 2R4RL 3MJ7B 1VGEH 2NY5C 3MRMB 5GGRA 1Y0LA 4X98B 4ALAH 1J1XL 1ZT1A 2PO6B 4QHKJ 3T77B 4M03A 4KROD 4OKVA 4Y4HA 4LSQL 3OKKA 5T3XE 4A6YB 5MI0C 3RWFA 4PV9A 5EBWA 1HILB 3DNKA 2GJ6B 1IAOB 5HGGS 1JZ5A 4YQXH 2CQVA 3IVKB 3SCMA 1IGTA 4H88H 5GRZA 2DIBA 4POZD 2YPLB 4MNGA 4RMTA 1YUHA 5CBAB 4KQ4H 4FQHA 3OR7A 5EFIA 1YEIL 2BCKA 4QCIB 3IU3A 4GMSL 1U95A 3HPJB 3VWKD 1HHIA 1Q72H 4NKDA 4KZEH 3QHZL 3TBSA 2A6JB 4ZUTB 5F7UA 4U05A 3W0WB 2H1PL 3HB3C 5DEFA 3U79A 1MJ8H 2G5RA 3UYRH 3O45A 4EOWL 3NZ8A 2FIKB 4XNQB 3LS4L 4LSRL 4CVXB 3HC0A 4P2OA 1IGYA 5J1AA 4WTZG 1NDMA 3WIFA 3NTCH 4L8SA 2FWOA 1M71A 3BH8A 4AYFA 5IB3B 3U36B 2J5LC 1PG7W 1VDGA 4Q6IB 2OSLB 1MFBH 1T1XA 4P23B 4MWFB 3UJIH 4LOUD 2ADIA 4LHUD 4GAYB 2HH0L 1QBLL 3SQOH 5DMGD 4G7YH 5C0FA 1F4XH 3JVGC 1ZSDB 4NQDA 3ZZ1A 1XEDA 3QUMB 4HHAA 2FD6H 4Y5VB 4OCNC 2IH1A 5CHNA 3VXMA 3H3PL 1KACB 3KPRE 4PRHB 3S96A 1BM3H 3D85B 1BD2E 3GSVB 2MPAL 1KIQB 1RK0A 3KWWB 3RHWF 4Z8FL 1QKZL 4Y1AD 3VFUA 1BLNA 2D03H 2DQFA 1R3KB 5GZNC 4P3WA 3UO1H 2AQ1A 3DURA 3C6SA 4PJBF 5D71H 1JZ8A 5ICYB 1T20A 3MRPA 2ZG2A 1BZQK 5DLML 1Y6KR 4MJ4A 2NW3A 4I5BA 5GJSH 1NCAH 5D2LF 3H2WA 1MCKA 3IDGA 2HJKA 2M8XA 3QFJE 4JANA 4KKCC 1BIHA 1KB5A 5CP7A 2GK0A 3PL6C 1NQBA 5T1KB 4OSUH 1MI5A 4YHZH 3MRGA 2X9WA 5HHMD 1J8HB 3EDKA 1HZHL 4QF1A 4UT6L 2ORBH 4KJYA 1OAXH 3MRQB 5DVKA 3V0WL 5ALCL 3L3HA 3NN8B 5FCSH 4F7EB 1DVFA 1TJIL 3S9DB 3JWOC 2J1KA 3H9HA 1BJMA 1TPXB 1YY8A 2X4QB 1NGYA 5E9DD 2X4TB 5C6TL 4D0CB 4I18C 3UTSD 3U6RB 3KJ4C 5TH2B 4KHXL 4PJ5A 1E27B 3RY6C 3RUGE 1MCFA 4AENB 4XP1L 4YDKL 5I9QC 5IHUH 1J7VR 3IJHA 5GGQH 4G80B 5T1LA 3WXWL 3L7EA 2Q76A 4PTTB 4M8QB 1VEPA 4MAYD 3LQMA 3BWAA 3QXWA 5HHNB 4O58H 3WS3B 5ELIA 2D7NA 1YEIH 1JZ7A 4F7TB 3GSRA 1L9NA 1KCSL 2UYLB 5DJDA 3MRBA 3F5WA 3QHZH 4FFVD 4CNIA 4PGZA 4QEGA 1ZHBA 5KVEL 3PDOB 4CMHB 1CDIA 4H5SA 5JDSA 2E7MA 5IBTL 3ZDZE 5KSUB 1EGJH 3GO1H 5GISL 4ONHB 1DQDL 3UEZA 1K8IA 2A83A 1PG7X 4U0RC 4GRWF 1MRCL 5HHVH 2R2BA 1IKNA 3QEHB 3QNYB 1MLCA 5DC9B 2HLFC 1BFOA 4G8GB 4M5YL 3SKJH 3DUSB 1K2DA 4XTRC 2VO5A 5MENB 1F6FB 3N0PB 1P4LB 5DZOA 3ZDXE 3BZ4A 4HFUL 4KMTL 4UQ3B 2AGJL 3RVUC 5CZVL 1DLFL 4P59H 1QBLH 4Y4KD 3S5LB 5FYJH 3IFPA 5CEXB 3P0GB 2CRZA 4HAFA 1CD9B 3GFUA 2V2TB 5LWYL 5KSBA 3TIEB 5BRZE 3S7GA 4HUNB 5KVFL 4Z0BH 3BDYL 3BD3A 5CBEA 1HHJB 2DB8A 2GJJA 2MHAB 2ADGA 4XHJD 4TOYH 1JF1A 3HAEH 4Z8FH 1KB5L 1NFIB 1Z9OA 1BVLB 1BFTA 4XPGH 3ECBB 5IM7A 1O0VA 4KTDH 3EYSL 2WUCH 5GGVH 3RJDA 1Q0XH 4K3HA 2XFXB 3VMOA 4DK6A 1DLHA 3OAYH 3S37H 1QSED 3SDCD 5IBUG 2XNAB 2Z31B 3DWTA 3BPCA 5CKAA 4WHCA 3P4MB 1JZ2A 4L4VE 2AK4B 4M1CC 3SJVA 1ZVYA 3LCYA 3PNWB 3IAQA 4UT6H 2R1YA 3ULUD 1JMZA 3U7YL 3MOBL 3C87A 3VGAC 2A6DB 2P24A 4QXTB 5F7KC 4JY5H 4QRQB 4JRYB 4NCC2 4YGVB 3U4EA 3FZUD 1WBYA 5C0BB 4GW4A 4LHJB 2Y5TA 3MRDA 5HGAB 3PGCA 4KHXH 4BFIB 3D3VA 1IEAB 1I7TA 1FO0A 4D2NA 5I1GL 4Z7VE 1N6VA 4Q9RL 4D0BA 1D5ZB 1J05A 1TETH 1YMMB 1WUNT 3CC5A 1VFUA 3KS0J 1NCUA 4L3ED 4MZ2A 4XNYH 5FO9B 1XGPA 3X12B 3AVEA 5T3ZH 4N90D 4PGEA 1E4WL 1EAJA 1RZKH 4S0TD 5TF1H 2MCPL 1CDYA 3LRGA 4XH2B 4GRLC 1JRHI 5F9OH 5FDWB 1BHGA 4MJ6B 1EBAA 5C70A 1G7IA 4U1GB 4LVNC 4UT7H 4LASH 4TVPE 3VW3H 4LVEA 1B2WH 5GISH 1RUPH 4JFQA 1TJGL 4U7KA 4FTVD 3BJLA 3BHBB 4OZGB 4FQCL 1MRCH 2HP4A 2P5EA 2IAND 1ND0A 3L6FA 3VRIB 4OLWL 3OTTA 3HTLX 3CXDH 3ABZA 2LU4A 1F97A 1JI2A 2AJZB 4OZFA 3KPOB 4K9EH 1JZ6A 3ILPA 4OKDA 5F44A 3O6LL 3MREB 1DQJA 2DOCA 4M7LH 3ZT6A 4KMTH 5DRZB 4OM0L 3UDWC 4Z7WB 3QA3A 1S78C 5CZVH 1Z9MA 3VXOB 5C0CB 3GB7B 4G8IA 1VADA 3G5YB 4WV1C 4F7PB 4QWWC 4XNMA 1QFWI 4WFHE 4TSBL 3QO1A 3IU4L 2JCCB 3BUYA 3B3IA 3ZDZF 2EECA 4BFGA 2CDFB 1I7UA 2BC4A 5C9JA 1UC6A 2A38A 4JHAL 4KK6C 5D2NB 1A3RL 1I1AD 4MDIB 5EU6E 2DBLL 3VWJA 2ICEA 1NUNB 4JQIH 1JRHH 4PTUA 4QTHA 2VLJE 3THML 4R4FH 3WNPA 4WW2C 1DBMH 3MODL 2A9NH 4PYHA 1GHFL 3ORJA 4DEPC 5I30L 1P9MC 2BY2A 3I02A 4QRUA 3EIFA 2OL3B 4MD4B 1LEKB 4JO4H 2BOBA 12E8L 1DJSA 1R5VB 1KENL 2GEEA 4LDOB 1HINL 4Q2ZA 3FOMA 1F6LL 3CFCH 3LV3B 2E6QA 4UU9B 1AO7E 1BQUA 5HVGB 4U2YA 5M94B 3KLHD 3VFRB 2QADB 3SKMB 3WS6C 3VGHA 3DECA 4UIKL 1HHGB 1ZOXA 5B8CA 4ORGA 1FO0L 4Q9QL 3IFOB 3P77B 2AK1L 3FT3B 2RIKA 1DBJH 2HN7B 2QSCH 1JNNH 1SJVA 1MPAH 4YHIA 2X1QA 1QA9A 1ZA6B 3LRSB 4PJFB 4RMUA 5FM5O 1PZ5B 3SQBA 2XWTA 4X0KB 1QFWH 5TQ2H 4JFDE 4OF3A 4J6RL 1YEDA 4WEMB 3ARFA 2BOCB 2D7TL 4MS8D 1P4IL 4NPYB 1UVQA 5L9DL 1UM4L 4FXLA 3MMEB 4WI9A 2PCPB 3DMMD 3FO9B 3RAJH 4BQ6A 3RA7H 1L7IL 1OGTA 3T3ME 2P47B 4XMKH 4PY7A 3OB8A 4MB3A 5ADPL 1MH5A 1VACB 5D5MB 3V0VA 4GAGL 4W6XB 4XNUH 4ODSH 5CJBA 2KL6A 3N1GC 3C2AH 4M4RA 4YHKH 4IRJC 2QSQA 1SBSL 1T7ZA 3D0VB 4YEFA 4M4PA 3CFIC 1W8OA 4K7FB 1XR8B 1N6QH 5IOPB 5E2TH 3V52L 4NHUA 25C8L 5E99L 1S9XA 4GH7B 2X5PA 2GFBB 4JFEE 1V3JA 3A0OA 1UENA 4XC1L 5JHDB 1T4KB 5F7FA 4I13B 2GUOB 3JBG7 4N0UE 4Z7VF 4PJIB 5CZKA 3GBMH 5DSCB 4S2SB 4LFHG 1GOFA 5HJ3A 5SWSE 4LLYA 4XVTL 2WSKA 4DGIH 3NGBC 4KY1H 5DI8B 4XP5H 1HOCB 1OT2A 1NKOA 5D7JA 2WQRA 4LPCA 1W0YT 2CLVA 1NAML 1RZJH 2BSRA 3NCFB 5C0IB 2J8UE 3O4OC 4C56A 1C8PA 2K1MA 1H15A 4F33B 4IIQC 1UZ6F 3O9WC 5DEGB 3CLEH 2CLZB 4E41B 3CFDA 4MQTB 4ZUSB 1HCFX 3GMLA 2D7MA 2DQDH 3ARGB 1WZKA 3THMH 4ZNEE 1A7RL 1L0YA 5IEKA 5ALBL 1GHFH 4WEUD 1ITBB 1PDKA 3IKCA 1FFQA 1QQDA 5F3HB 2D3VA 2CKBB 2Y07L 2X89D 3KS0H 2L7JA 3NIGF 5D7IA 1NGZB 3M17B 3R8QA 3C5ZD 3PWPA 1FAIL 4RAUB 5JXAL 3QEUA 4OCYL 3Q6FB 1MUJA 3L1OL 4K94C 3O6FB 5E00A 5IF0A 4WUKL 4O5LH 5ESQB 3C9NB 4OIBA 1M05B 4JRWA 5DJ8A 3ZYIA 4PP1C 3MFFA 2C3VA 1XGUB 5FYKU 4RGOH 4GRWH 1MFCL 3BZFA 1KT2B 5BXFA 4M6NH 3PWNA 2G60H 3CNKA 2HG5A 2X1XR 4M43H 4PRPA 4G6FB 3VFPB 1SM3L 1YEHH 4WGVB 3P9LA 1BWWA 3JV6B 2VDMH 3MLWL 4KK9C 1MY5A 3OKOB 1H5BC 5E2UH 4PLKD 4ZYKA 3CFKB 3LY6A 3MJ7A 1Q0YL 3HG1B 3WKML 4GQ9L 3NFPB 5TDPB 2KDGA 2PO6A 3HN3A 3VH8G 4I9WE 3VDAA 2CRIA 4CUCA 4GAGH 1T83C 1KLGB 3QYCA 3NAAL 4JGUA 1GAFL 1MQ8A 2GJ6A 1IAOA 2XN9B 4XPTL 5LAXA 2PF6A 1KPVB 4WUUE 4Z9KB 1MFEH 5CMAA 1SBSH 3DX9A 3D2UD 4ZFZA 1F3DJ 4X5LA 3EOBA 3TN0D 2JB5L 1RFDL 3WHE1 3LN5A 25C8H 2PXYA 1FBIL 2VDOH 3CSPA 2L4OA 3AS2A 4Y2DB 2F8XC 3I6LD 4KROC 2EZ0C 3OXRA 1W0WA 1FVCB 2B4CC 3HPJA 4HV8B 2EH8L 4PJGA 2DQUH 4LRNH 4XC1H 2A6JA 3PV7A 1MJUL 5CIPH 5L0QC 3W0WA 4B5EA 4EUPB 5J3HC 3QDJD 3M1BB 3BD4A 3QZWG 4X6EB 1X7QB 5EPMB 4K7PH 4MVBD 3W9EA 3EYQD 1TTUA 4QOKA 1FFOA 3AC0A 3PIQB 3R06B 4KH2A 3H3BC 4CVXA 1AJ7L 1IEBB 3BSZL 3VFNB 5J1TC 2KKQA 3FOLB 5IVXB 3QUYD 2AI0L 2NXZD 3CJJA 1NAMH 4ZQKB 4XMPL 4HKZB 5I18L 2WBWB 3MA7A 3NIDE 5DFVD 4Q6IA 3AXLB 5FUOL 5HHOE 2ICES 4LSUL 3V95A 2ZKHH 5HI3C 2JJVA 3LKQA 3ZKNC 1IGIH 3QP3A 4CU6A 2BSSB 3DO7B 1CLYH 3Q5YA 4OB5L 4R9HA 5F21B 5EG6C 4ZDHA 1DBKH 2PTUA 2WINB 3SO5A 3O6MH 3PGFH 2N4IA 2OP4H 2RR3A 4UUJB 1FAIH 2BNRA 4YPJA 3D85A 4NO3A 3KWWA 3EJZD 1KIQA 4LOUC 4PJ7A 4UILH 1KTDB 2NYYD 5HYEA 2P5WE 4WUKH 2XY1A 4DJMA 1BOYA 5DMGC 4U1LA 1P4BH 5KAQG 5ICYA 4HJ0D 1HDMB 4Z7UF 2J8UF 5IJVB 1YYLL 1RJZB 3V4UL 3BIAX 4HQQL 2AJ3B 1FYTA 3RL1B 2Z92B 5C07B 1KIPB 2LABA 2ZNWA 1VFAB 2DM4A 5T1KA 1N7MH 2HRPL 1IC5L 3BP6B 3MLWH 3TESA 3TA3D 3ZE2E 1NMAH 4R97B 1EA9C 4RFOH 4KK8D 3MRQA 2MOVA 5I17B 1T5XA 3V6ZA 4PJ8B 3NN8A 4HXAH 4W4OC 3WKMH 5CUSL 1HXYB 2HFEA 1G7HB 3FMGL 4NQDD 3WN5B 2W9DL 3F7VB 3EO0B 4X9IA 4D0CA 5C3LD 3RY4A 1E27A 4YHMH 1A3QA 4AENA 2XG4A 3NAAH 1NGWA 1B4JL 3FB7B 3RWDB 4OF7A 3T0DA 1MREL 2ED7A 4XNXH 1D5XB 2PYEB 3G08B 4FZ8L 3CLFL 3W2DL 4GW1B 4HZAA 2ITCB 1FH5L 5F1IB 4JKMA 5K9QG 2LAGB 3OJDB 5ITBL 4AEIH 2Z8SA 3LN4B 4U3HA 5AZEH 3V9FA 5CGMA 1HK6A 1S7RB 1K4DA 2R4SH 2RFXB 2YZ1A 2EH8H 1OCWL 1U41A 4CVZB 4LCWE 2AJUH 1HN1A 2GHWB 5KSUA 4FQPA 2H2SC 1MI5D 5GJTL 3DGCR 4WI8A 2AEWA 4KVNL 2VUOA 3HUJA 1QNZH 1AHWC 4PJDE 4MMZC 1AGEB 1K4CB 4UIMB 3RZCD 5GGTH 4G8GA 4LCCB 1KG0A 2D31B 4Y1AE 3EGSB 4LLAA 4QHLB 1MHEB 4OFVA 1ZS8B 3DV6A 5T1LD 1EEQA 2PNDA 5FYKL 2D9QB 3G6DH 1CXFA 3WJLA 2YPVH 1KN4H 3JXAA 3SBWA 4EN3A 1CFNA 4P2RB 2X4RB 1A1NB 5ICZB 4JN1L 4N0FB 3QUZB 1DQLL 5HXMA 2D4DA 3LPGA 4GXVL 5HHQB 4Z76A 5LCVH 4QXWA 1XCTB 4JCLA 3KGRA 5HHME 3QWRA 5CZXD 3V79C 4O51B 2OXHA 4F80A 2MHAA 5C8JA 5DJXB 2HVJB 3UJTL 4M7ZC 4LQFL 5DHVH 5A2LH 1LO0L 3GRWH 5KS9B 4JVPA 4XXDA 1P7HL 4R90L 5E9DE 4Y4KC 1KFAL 4U1HB 1RJLA 3UTSE 5J12B 1YNTB 2EEDA 4JZJB 5GRYA 1GOHA 3GUTA 2XNAA 4XBEL 2Z31A 5I16A 4JFZH 3GJFB 2EDBA 3P2TA 3NIDF 3V4UH 1F3DH 3P4MA 3UBXG 3QBTB 4HQQH 1JMXA 4OLXH 4I48B 4PLOB 1A47A 2AK4A 1T2JA 1OSPL 3HNSH 4GG6A 3QI9A 2HRPH 3JTTA 4A6YH 3LH2H 5MI0B 3RTQD 2EDOA 3WDJA 4P2QD 2A6DA 1S5HA 5E94B 3SDCC