5ITWA

Crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
255
structure length
255
Chain Sequence
MIMNLTDKTVLITGGASGIGYAAVQAFLGQQANVVVADIDEAQGEAMVRKENNDRLHFVQTDITDEAACQHAVESAVHTFGGLDVLINNAGIEIVAPIHEMELSDWNKVLQVNLTGMFLMSKHALKHMLAAGKGNIINTCSVGGLVAWPDIPAYNASKGGVLQLTKSMAVDYAKHQIRVNCVCPGIIDTPLNEKSFLENNEGTLEEIKKEKAKVNPLLRLGKPEEIANVMLFLASDLSSYMTGSAITADGGYTAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroanticapsin 7-dehydrogenase
publication title Probing the influence of non-covalent contact networks identified by charge density analysis on the oxidoreductase BacC.
pubmed doi rcsb
source organism Bacillus subtilis (strain 168)
molecule tags Oxidoreductase
total genus 98
structure length 255
sequence length 255
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.385: Dihydroanticapsin 7-dehydrogenase.
pdb deposition date 2016-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5itwA00
1WXDA 2HK7A 5G0SA 4YT2A 4FGWA 1DRWA 1UUFA 1E1MA 4PZCA 1TVEA 2B4QA 4E2YA 3WTCA 1DLJA 1LSJA 3HSKA 5GZ3A 4KUGA 5HM8A 3LF1A 3RU7A 3Q2IA 4ZRMA 3TPCA 1KOLA 2B5VA 1P33A 1PJ4A 1DPGA 1Q0LA 2BH9A 2OO5A 3H3JA 3V2HA 4BO8A 3SC6A 4CQMD 3GLQA 1NQTA 1U7TA 1I0ZA 1JU9A 1F12A 4UULA 1MGOA 2O7QA 1B16A 1NFQA 2AA3A 4JROA 2BI7A 4TRJA 4GX1A 3PHIA 2E4AA 2PR2A 1GTMA 3O8QB 3GNTA 4PLGA 1YL6A 3AI3A 4WJZA 3CUKA 5H83A 5J23A 5TX7A 3JQEA 4J6FA 3D3EA 3ONEA 4NI5A 1GUFA 3DOCA 1SAYA 4PLVA 3SX2A 3AFNA 3K9QO 2HDHA 2Y1GA 2NLOA 2RHRA 3QVOA 4OOFA 3OHSX 4JBGA 4D3FA 3U4DA 4JCOA 1W6UA 1CEQA 3QIVA 1X7GA 3CE6A 4MO2A 3U9LA 1E7MA 1K2WA 4HUJA 1Z82A 3W4IA 2Y0EA 2XXBA 4J4HA 1J5PA 1ZBQA 1DIAA 3E6AA 1LSOA 5F3RA 3RKRA 3C7AA 3RQSA 1RYDA 2H9IA 2YHIA 2VZ8A 4CMEA 3H6KA 3OICA 3QVXA 3Q9NA 4PIVA 3DOJA 3GEMA 4OM8A 3E03A 4P38A 4ALLA 4AJNA 3JV7A 3KO8A 3OQBA 1PIWA 1UDBA 1YL5A 3QWAA 4PZDA 1NASA 2IZ0A 4AJOA 1R0LA 4GGOA 4M1QA 4FFMA 3E5RA 4D44A 4B4VA 4N5NA 1PJLA 1U2GA 4OAQA 1Z7BA 3IUPA 5AXCA 3DMTC 1K6XA 3WQSB 4DC0A 1XEAA 1XR3A 3L0DA 1BXGB 3DZGA 5CDUA 5KJCA 5EQFA 1NTOA 4RORA 1WLYA 4BO4A 4MOWA 5AVOA 3HG7A 5BT9A 2YDYA 3A9WA 3E9NA 3GN1A 1L7DA 4R9SA 4RPLA 5HBRA 4AJKA 4BL5A 4O0LA 5K9ZA 1V9LA 2PTGA 2C2XA 3DBHB 5BSHA 1HE4A 4WASA 4JX8A 3FWNA 1I01A 4Y6PA 2Y1CA 3ENNA 1ONOA 2TMDA 3FTPA 2CD9A 5A3JA 1KBZA 4O59O 4CLXA 1B7GO 2I5PO 3ICPA 3BMQA 3P5SA 4FS3A 1AN9A 3KLMX 5GMOA 4CQLB 4MVJP 2CUKA 3EK2A 5A9SB 4Z6KA 1IOLA 3QVWA 4IM7A 2AQKA 3KOUA 1XGKA 3O9ZA 3OQ6A 4IMRA 4XGKA 2JL1A 4IGEA 5KVCA 2WWRA 3H4VA 4ZJUA 1Y7TA 1MLDA 4GLLA 3MJEA 4JP3A 1T1RA 2DFVA 4GLOA 1VKOA 2ZB8A 1QYCA 2Q99A 3KYDB 2AG8A 4RVGA 4YJGA 2CVZA 4U8GA 4A26A 4CLRB 4EUHA 3G0OA 1B3RA 1H5QA 5A1TA 3RUHA 2O4CA 4FFLA 1GAEO 1K89A 2I65A 2B0JA 2ZK7A 3EMKA 4UREA 5AYVA 3QWHA 2Y05A 2JAHA 3H3FA 3GNQA 4HBGA 2I67A 3ZZNA 4FC6A 2Q1TA 3JD4A 4CM7A 2ZATA 3KXDA 3PYXA 3GG9A 4ALJA 1VJ0A 2ZYGA 1IZ9A 3I83A 4AVYA 2WD8A 1PSDA 4CLHA 2GERA 2CY0A 2DLDA 3C8MA 3PGXA 3OSUA 1BHSA 4II2A 4BNVA 4BQRA 3JYPA 2P9CA 4CMKA 2I6TA 3AOEA 4MDHA 4XB1A 4EITA 1M6HA 3DQPA 2HJRA 3L9XA 3ZWOA 3BZUA 4R41A 3EAGA 3W8DA 1WPQA 3LLVA 3ROQA 5ENVA 3WXBA 5BNFA 2C5AA 1PS0A 1HYGA 4CMGA 4UUNA 4BOYA 1CERA 3EUWA 1XG5A 3ST7A 2D4AA 3PYMA 2JJYA 4GMGA 4ROSA 1XU7A 4EJMA 1PJCA 1CF2O 4IDFA 3ITDA 4B7UA 4G65A 3FHLA 1YL7A 3FTNA 4XWYA 3G1UA 1J49A 1PZHA 4MVJG 3JYNA 4I9NA 4M89A 5TF4A 4YAGA 1HLDA 3TWOA 4WLOA 3ZNQA 3H5NA 3ZCXA 3TL3A 3MJ4A 1R6DA 1HYEA 3DDNA 3ONDA 4HKTA 4IZHA 3AU9A 1JQBA 2DM6A 3P19A 1OC2A 1E1LA 4DLBA 4AG3A 4DVJA 3JD3A 3GUCA 2GN4A 3R3JA 4EZBA 3KEQA 2DTXA 3CH6A 4Z9YA 2X4GA 4CMJA 4AJPA 1SMKA 4R3NA 1DEHA 3KVOA 2E48A 3JYLA 4FR5A 3OQ1A 3PQDA 1HZJA 3VTFA 1LTHR 4I9HA 4WLUA 3KZVA 3WQRA 3OFSA 4IQ8A 3AUSA 1WMAA 2NUAA 3GFBA 3JQBA 3PWSA 1EQ2A 2NV6A 1B3BA 5TRTA 3DHNA 4OXYA 1Z7EA 3VDRA 5L53A 1NR7A 3GDOA 4BNYA 4RJTA 1F8GA 1E6UA 2H63A 1JTVA 5EJ2A 1LEHA 4DREA 2E49A 2GZ1A 4J7UA 1FF9A 5A03A 3DZFA 4QEDA 3SC4A 3JQ7A 4TVBA 4XA8A 4I8XA 4XIYA 4I5GA 3D4NA 3LQFA 4DPKA 3QE3A 3E9MA 1PGJA 2BFMA 3HZZA 4O1MA 2DVMA 3MTGA 1LSSA 1U3VA 1GYPA 3AUAA 1OFGA 5COQA 1PJ3A 4CM8B 4CM6A 1XIVA 1Y81A 5BQFA 1MXFA 2DTEA 2JHFA 1EUZA 3HDYA 3DAPA 4JGBA 4KDFA 4TQGA 4CM5A 4XYLA 4K6CA 5JXWA 1K0UA 1JAXA 2WJPA 1NQ5A 2OUIA 5IDYA 3LVFO 1NPYA 1TT5B 2ZB4A 1O89A 3PHLA 4XZ3A 5U9CA 2PZMA 1VC2A 3HUDA 2VOJA 3FNEA 4J4TA 1SOWA 3B20A 5IZCA 3ZN2A 4BGVA 1PX0A 4B7CA 4UAGA 4NK4A 3FNHA 1C0KA 2C5EA 5JW6A 4NBWA 3JQ6A 4FDAA 4W82A 1BRMA 1R4MB 2O23A 5ENDA 2VN8A 2ZTVA 3VPGA 4E5MA 3DR3A 4RVSA 2GR9A 4XQEA 3U5TA 2PNFA 5G0UA 1Y8QB 6LDHA 5U4QA 1Z75A 1PS8A 3VZRA 1DRVA 3AM4A 4DMLA 2YFHA 3KUXA 1C1XB 4FGSA 4NBUA 3HDHA 2OHXA 3AU8A 2E6UX 3HNPA 3IKTA 2PD4A 1P45A 3Q1LA 3F5QA 4J91A 4FFRA 1D7OA 4BNNA 3RC1A 2EP5A 2HMUA 5ER6A 3VKVA 3C1AA 5TS3A 4E32A 4IIUA 1JW9B 5I8WA 4Z9FA 3UF0A 2UUPA 4RV9A 2WD7B 4AFNA 3AOGA 4J16A 3T7EA 2FPPA 3VVCA 4UUOA 5DCWA 3O03A 1VSVA 3JYOA 1V3TA 3JTMA 3TZQA 2P5UA 3RD5A 2P2SA 5DDIP 4CUJA 4GWKA 2Q3EA 4GSLA 2X0RA 3H2SA 1A4IA 3I9LA 1UXJA 2JFHA 1DRUA 5JCXA 5L7TA 1NFFA 5B4VA 1GQYA 2RBEA 2AEMA 4OMUA 2X6TA 1UP7A 4HV4A 4E4YA 5LCXA 2VYND 5JAZA 1IE3A 2HJSA 5G2OA 1W8DA 1M2WA 1UJMA 4D41A 2GN9A 2OP0A 3EYWA 3M2TA 1GZ3A 1TA4A 3RUCA 4BB6A 4CMEC 2HU2A 2WDZA 3PFWO 1DBVO 4Q3CA 3ZI0A 3NKLA 1EK6A 3QA9A 4IXTA 1ZH8A 3B1JA 2VT3A 1QG6A 3DZJA 4TSKA 4YR9A 2FMUA 1YXMA 4FFNA 2PA3A 3QWFA 4I5EA 3TOXA 1H9BA 4BO1A 3W4KA 4WNCA 4NFYA 4RZHA 3WB9A 4GBJA 4RLSA 1IY8A 4G5HA 1AHHA 2ZQYA 4IBOA 2V6MA 2BKAA 1WZIA 3GEDA 2NU7A 1GV0A 4A2CA 3DZIA 4GWGA 4IDAA 2I99A 1QLHA 3UXYA 1ZJZA 2NSDA 4AJHA 1EK5A 2A92A 4QO7A 4ZQFA 2DUUA 3RC7A 5IFLA 4LN1A 4R9RA 1YKFA 5DOZA 4XYEA 2VWGA 3KYDA 3JQFA 2P4HX 4XQ9A 4CLRA 3KSZO 1HWYA 2GGSA 4HX5A 3Q9UA 1P0FA 1LLDA 2VZ0A 3GHYA 3SJUA 3UOGA 4AJIA 3RFXA 4MIEA 3JQ9A 3DMTA 4NG5A 4BIIA 4NQZA 3UKOA 4UVHA 1UAYA 3ETDA 2HK9A 4J1TA 4K28A 4ZU3A 5ER9A 3RAJA 1BTOA 3U62A 1I3NA 4NU6A 1KS9A 3OA0A 5THKA 5JY1A 4BNXA 4A7PA 4NNJA 5JYDA 1I8TA 3GZ4A 1H2BA 2W2LD 3NX4A 1FXSA 5ES3A 1W73A 1O6ZA 1ISIA 3N58A 4K1LA 4QFDA 1JKJA 1EQUA 3W8EA 2PZKA 4A5OA 4D42A 5KJ1A 4MVJA 1IULA 4F6CA 1HL3A 1B2LA 4OOEA 3QW2A 3U09A 1DB3A 1FDTA 4GVLA 5LC1A 3F46A 2XXJA 1UXKA 3ETEA 4YRDA 4J49A 3O38A 4WOJA 3Q3CA 1AGNA 4YBZA 2VHXA 3BA1A 3PJEA 2X86A 3D0OA 4FN4A 4GGPA 2O4UX 1CWUA 4CM4B 5IN5A 2DPHA 1IHYA 1VL0A 1HSOA 1X1TA 1XQ1A 2NVUA 4J2OA 4YEDA 1LLCA 2DAPA 3FR8A 3I6QA 1GEGA 3AY7A 3OBBA 4IIVA 1IB6A 5KVVA 1QYXA 2V6FA 4YJHB 4WLFA 3EZYA 2O3SA 2VRBA 4B4OA 1VPDA 4BNJA 1U3TA 3AY3A 1A9ZA 1T2AA 3ULKA 1PGQA 1GR0A 2GF2A 4M86A 4B8WA 4J2HA 2NTJA 2PGJA 4KOAA 8LDHA 2D8AA 3KYCB 1I36A 3Q0EA 3SJ7A 3G79A 4OHUA 1PL7A 2Y1OA 3WYCA 3IAHA 4O6VA 2BI8A 2BHLA 3JYQA 5F5NA 1YJQA 4D46A 1D1SA 1N92A 4L73A 3JQGA 2WEKA 2G1UA 3OIGA 4AJ2A 2O3UA 2VYVA 1YB4A 1RWBA 1E3JA 3EHEA 1EDZA 3HJAA 4R1NA 1ZNQO 4E0BA 2JD2A 4B79A 4L4RA 5B1YA 1N2SA 2ILTA 4QQRA 4RVDA 2V6BA 4K9DA 3BMCA 4WE3A 1X13A 4CV3A 2VRCA 4BMSA 4CUKA 2X23A 3KYBA 3IKVA 3N7UA 4FCCA 4I08A 4RVUA 4FJ0A 4E5KA 3WGOA 5LDHA 1HDRA 3FBTA 3DWFA 4BKRA 4NFSA 2I3GA 1B15A 4J3FA 3TFQA 4P4LA 3PDJA 1KC1A 4P8RA 3UGKA 3WNVA 2EHDA 4FOOA 3UAGA 2HMSA 2ZKLA 3AW9A 3F4LA 5CEEA 4NJOA 3PDUA 3JQBC 2VTDA 3F1KA 1SNYA 1EDOA 1G0OA 4Z9XA 2EERA 3CXRA 2J8ZA 2DBVO 3AUUA 3KETA 4NH4A 3JD2A 3L4SO 1EVYA 4ND5A 4GKBA 4II3A 4E2WA 1FK8A 3CMCO 5G4KB 1BSVA 1HE2A 4Z0PA 3KTDA 4IJUA 4ALMA 3ANNA 4WLEA 3PLRA 3DBRA 4GH5A 2EW8A 3WIEA 3LT2A 2C2YA 3C7DB 2FY8A 4W4TA 4O63O 1ZIDA 4R01A 2W90A 3W4JA 2OXIA 4E30A 3DONA 4FC7A 1I32A 2NU6A 2PGDA 1E5LA 3GPDG 2X0NA 1T26A 4BKUA 4FIZA 1PZEA 3ORFA 4FFPA 4TKMA 2D3TA 3M6IA 5IG2A 4D43A 5IJZA 1YBAA 1E3IA 1OBFO 3GZNB 1PEDA 1LQTA 1XWFA 4XDYA 3IUSA 5IZCC 3FSRA 3UICA 1M75A 4NU5A 3WJ7A 3NRCA 1T2FA 2FN7A 1E7RA 4Z0TA 4ZVVA 1NYTA 4RPHA 4E2ZA 2V65A 3E9QA 2FOIA 1LI4A 3B6ZA 4E3ZA 4MKRA 3F9IA 3GUYA 3CKYA 3RFTA 1A71A 1GYQA 4BVAA 1XSEA 4Y98A 2Q45A 4BMNA 1JKFA 1PJSA 3PFFA 2CDAA 3CPSA 1ARZA 4YAJA 4GSKA 2DT5A 2Q2VA 2O3QA 2Q4EA 4D3DA 5L51A 3K92A 1TB4A 4DBVO 1NWCA 1A7AA 2NU9A 1HTBA 4OH1A 1SCUA 4L4XA 2PH3A 3ONFA 4EGFA 2ZYAA 3S2FA 3B1KA 4E12A 3I5MA 3PJGA 4ZHSA 1ML3A 2X0IA 3D1LA 4C7JA 2AMFA 2UDPA 1PL8A 3MJTA 2AE1A 1H93A 4MVJI 1SO8A 3I3OA 2GPTA 4GPD1 4I9UA 1YQGA 5G4LA 4FD3A 5I9MA 4WK6A 3K31A 3WG9A 3RVDA 1U2DA 1KC3A 1QSGA 2WSBA 4TKLA 5EL0A 3OF2A 2AHRA 1N7GA 3NT4A 2WE7A 2GZ2A 4IY1A 5A9TA 5I9NA 4MKXA 1Q2XA 2NU8A 1CDOA 2X5KO 3DBLA 2G76A 3LZ6A 5DF1A 3VKUA 4PG8A 4F6LA 2NVBA 2DBQA 3Q6IA 1IL0A 5KIAA 4FPXA 1VRWA 1GZ6A 3V8BA 3WFIA 2X5OA 4HY3A 4ZD6A 1BW9A 6ADHA 3BHIA 1RM4A 2IEDA 1KEVA 1KERA 1JKIA 2RH8A 1NQAO 3GOHA 4U5QA 3GK3A 4RVHA 2DKNA 1IPFA 4BNUA 4PG5A 5DCYA 2X8LA 2O2YA 5K0ZA 2B5WA 4NBVA 2IYOA 2Z1MA 3JD0A 1YJ8A 2W98A 4W6ZA 4W7HA 4CQMA 5C3MA 1DHRA 4B3IA 5EMHA 2O3TA 2YV1A 4IS2A 1R37A 4L74A 2X9NA 3EVTA 1FDWA 1OZAA 3ZNNA 1WDKA 4XCVA 3ANLA 2WYVA 4Q39A 1ONNA 1HSZA 3D7LA 4MVJE 2D0IA 1J4AA 5CPFA 5TQVA 2D5CA 3T4XA 1WDLA 1GUZA 2AW5A 4GX0A 3BHMA 3WYEA 3ZU3A 2J3HA 3ZHBA 3HDJA 4HNHA 5EPOA 1TLTA 1U3UA 3I52A 2YQ4A 2BD0A 4B4UA 1IZ0A 2PWZA 3K30A 2EG9A 3OJ0A 2CF5A 4LCJA 3JQFC 4LVUA 1PJ2A 1UR5A 3G3EA 4INAA 3WJAA 4QX6A 1X7DA 3BYZA 4OXKA 5TJHA 3HFGA 2DTDA 4QECA 4E6PA 1I5RA 4TMFA 1ZVMA 3W6ZA 3FPLA 1CQIA 3GEGA 3JQ9C 3AI1A 3FI9A 3O4RA 3WMWA 1N5DA 1JLLA 5CG1A 1ISJA 2GCGA 3RIHA 3TF5A 4BO7A 3OEYA 2QRJA 1N9GB 1PR3A 2C54A 4CL3A 3NYWA 1ENPA 1YOVA 5L4LA 4JJFA 3BXXA 1KEPA 2B35A 4FFOA 1P1RA 1E6WA 5JFOA 3S8MA 2NTNA 2AQIA 1DC6A 3FNGA 3CIFA 7ADHA 2C07A 3DZBA 3UW3A 4IDDA 3TNLA 2B69A 2R00A 4FB5A 3WWZA 4IDEA 2GYYA 3I6IA 3GNSA 4YRBA 1MFPA 1BVRA 1R0SA 4DC1A 4ZICA 1TEHA 3HN2A 3CZRA 2EGHA 4J9VA 4L4SA 3I1JA 3WGHA 5FI5A 4BNLA 1DSSG 3OEWA 1BMDA 3F1LA 4CMAA 4H3VA 5ITWA 3NUGA 4TZKA 3AK4A 5KJEA 4C7KA 1PTJA 3V2UA 1HDZA 1MC4A 3RASA 4HFMA 2CDBA 5EERA 5B12A 3V1YA 5KNLA 3H9EO 3WIDA 3AFMA 2UAGA 5G0TA 2HQ1A 2NNLD 1JAYA 2F00A 3R0IA 1X15A 2FPIA 4WECA 4I5FA 4BNFA 1DIBA 2VZ9A 4YJDA 2FR8A 3G1TA 1H9AA 1YDWA 4YCAA 3GAFA 4MVJM 1K5HA 3GRPA 3U4CA 3HQ4O 4CV1A 1BXKA 1E6EA 4FSHA 4DLLA 4Q9NA 1BXZA 3MCVA 2EXXA 2EF1A 2I3AA 1O8CA 2YHUA 1R0KA 3PZBA 3Q2KA 4RF3A 8ADHA 1LBEA 1OC4A 4JBHA 5I7VA 5TT1A 2RH4A 4FJ1A 1RM3A 1VL6A 2DPGA 3L9WA 1QORA 9LDTA 1GDHA 4LCEA 4A27A 1XELA 2VCYA 1PWXA 4PLPA 2X1HA 3PIDA 3H7AA 1N1GA 2Q1SA 4OSPA 4E5NA 2A4KA 1C14A 3GC6A 2CVOA 4ZQEA 1B8UA 4Z0HO 3ZV3A 2P9EA 4H16A 3DTYA 4WCDA 4DYDA 4RF2A 1SEPA 3LSYA 4LK3A 4EW6A 1ZK3A 3MJVA 4LVCA 1B0AA 4PVCA 3ROMA 4CMCA 4DWVA 2AEJA 4RDHA 4XGNA 2QG4A 4HWKA 1V3UA 2CZCA 3E8XA 2XPCA 3VC7A 5GZ1A 1YBMA 4ZN6A 1YQXA 1Z6ZA 3GGGA 1ADGA 5G0VA 2PD6A 3T4EA 4YYZA 2IE0A 3JD1A 4YPOA 2CNBA 1CRWG 1MA0A 1V35A 5HS6A 5BSEA 1B8PA 2W2KB 3QLJA 1NR1A 3PHGA 5AQ1A 2EEZA 2Q1WA 1LDEA 3MOGA 2OOSA 3LLSA 2P9GA 2GDZA 3DBVO 4BNZA 1MFZA 2J5RA 3ZHXA 4CM9A 3DO5A 4R1SA 2LDBA 1GQ2A 4WCFA 1PL6A 4D45A 1ZMTA 1EUDA 5CDGA 1ZO8A 4E2XA 3L6OO 3PZRA 3OETA 3I9JA 1R12A 4UVEA 3V1TC 5KTKA 3K5PA 1D4FA 2OGUA 3H65A 4FBGA 3K73O 4ILKA 3WBBA 5C7OO 4JJIA 3C7CB 4YT4A 5I7FA 2Y1EA 2OBYA 4NDNE 3WGZA 4DL9A 1P74A 4UEKA 3IP3A 4Y6RA 5JDIA 1UZMA 3GN2A 4L75A 1O95A 4BGIA 2EKQA 4DIBA 4BKOA 2Q1UA 3ZDFA 4WLNA 3VZSA 3ZWNA 5KJ6A 5ILGA 4YDRA 5KVQA 3KHUA 4LSWA 1W4ZA 2QRKA 4BO3A 1GFSA 1QRRA 3GVCA 1YH3A 3K8ZA 1Q0HA 1QV6A 4BNTA 3GA0A 2C7VA 4HFNA 5T5QA 1K6JA 3S55A 4CJXA 4KUEA 3GPIA 5DZSA 5EQDA 2PFGA 4UUPA 3GGPA 3V1UA 1A27A 1HDXA 1RYEA 2Q50A 4LISA 4PLCA 1S7CA 1E3WB 3L07A 2BGKA 3GVXA 3NDIA 4N5MA 4E13A 4B4WA 4TVOA 2BGLA 2ZYDA 3QJ5A 4YAKA 3GH3A 4HFRA 5U1PA 4YVFA 3L77A 1U4OA 1VI2A 1ZK0A 3O8QA 2EKPA 3WDSA 1T24A 1PS9A 2NADA 4UVGA 5TC4A 3WGTA 4GI2A 5EN4A 3CINA 1O94A 4DLAA 1E7WA 4NJMB 5F1OA 2O3RA 2EJWA 2XAAA 2Y1FA 1QXSA 5JCJD 5CPBA 4R69A 1UH5A 3JQAD 1ADBA 3BTSA 3BTVA 3NEPX 4DQUA 5FWNA 4A73A 3OP4A 1X14A 1ZSNA 3WMXA 3BMOB 4RPJA 3IJPA 2O7SA 3TQHA 1DOHA 2OL4A 3E48A 2GSDA 2HO5A 3IIEA 1LJ8A 3RFVA 2YW9A 3ROPA 1U5CA 2PV7A 5JMWA 4LW8A 3KSDO 4W99A 2BMAA 5IDWA 1SZJG 1AUPA 4ND4A 4XR4A 3S2GA 3VH4A 4BNHA 4OO3A 3LYLA 4WLVA 4CM3A 4EJ6A 3PRJA 1WMBA 3PLNA 3TZKA 3F3SA 1H6DA 4D79A 4YAEA 3K96A 2WMDA 2EJVA 2VWHA 1U5AA 2WYUA 2ZTLA 3ZV4A 2HLPA 4A03A 3CTMA 4KTTE 5JPIA 4B8ZA 1BXGA 2JCXA 4JNKA 4OIMA 2FRDA 3DAFA 3NTQA 2E82A 3PWKA 2Y66A 2B4RO 4LGVA 3SXPA 2WYWA 2RCYA 1U28A 1PQUA 1F17A 1Y9EA 7MDHA 4R16A 5KCZA 2CMDA 1P1FA 3ITKA 3MJCA 4I1IA 3RUEA 3IJRA 2HCTA 3ZWVA 5DP1A 4BQPA 2VTEA 3B70A 3RUIA 3SEFA 3DBHA 4AL4A 1KYQA 2QRLA 2EW2A 5JSFA 1UP6A 2O2SA 1BWSA 4YJFB 4ESOA 2BFAA 5B4TA 4XX0A 3ICCA 2ET6A 2B83A 4FJ2A 2G0TA 5EINA 5JY6A 2O3JA 3EGOA 1C1DB 3LU1A 4J4BA 3SLKA 1E1NA 1I24A 1T4DA 3VZQA 4IS3A 3QWBA 4F3YA 4GL4A 1Z45A 1YE3A 4YB8A 2LDXA 5DCUA 3LT0A 4BGUA 4CQLA 1UDAA 5A9SA 3HHPA 2C0CA 5JC1A 1ZEMA 3INGA 5L4SA 1E3LA 1E3EA 2VUTA 2J5QA 4PG6A 3ADPA 3NTRA 4GAEA 4B3HA 3DMYA 4IDBA 3C85A 4E5PA 4EYEA 5DBIA 4IUYA 1EEHA 4XYGA 4J1NA 3VPHA 3ZWPA 3HFSA 3VH3A 3M2PA 4PLTA 4WGGA 1IUKA 3QRWA 1SB8A 4CLOB 1ONPA 4XJTA 2FZEA 4BO0A 4J0EA 2R00C 4EBFA 2BLLA 2EIHA 2NM0A 5EESA 4K6FA 2D59A 3NDRA 1QYWA 2G17A 3C1TA 5F1KA 2DC1A 4CV2A 4OKIA 4YA6A 1DFGA 2P91A 4G81A 3GF4A 3HB4X 1UZNA 2RHCA 1QP8A 5L95A 4P4NA 3R1IA 1U4SA 1PR9A 3PJDA 4J1SA 1MP0A 4UEOA 1I30A 4PGFA 3E1KA 1VKNA 5L9AA 1NWHA 2J3JA 4QUKA 4HFJA 3WBFA 4JQCA 4IMPA 4ALNA 3KEOA 4J1QA 5HWSA 3A28A 4TRMA 1MG5A 2NACA 3RWBA 4YTEA 2W2LA 1DIHA 2X22A 1LDGA 2YHIB 4RZIA 4CLEA 2VHZA 1YGYA 3ZWMA 5COAA 2QYSA 3U0BA 3COSA 1ENYA 3GVHA 4UVDA 1MB4A 5IDXA 4TZTA 3ABIA 5CG2A 1HLPA 1XA0A 2FR1A 3L6EA 3VZPA 3MZ0A 2JD1A 4GX5A 1L7EA 4NBRA 4QSMA 2BGMA 3QVTA 4M54A 1HRDA 5CHEA 1F14A 1T1SA 2Z5LA 1T2CA 1GPDG 4Q3EA 3LC7O 3RSHA 4Q3AA 1DDOA 4YACA 3TRIA 4EI2A 1LDMA 2R2GA 1R16A 5DP2A 4LMPA 4OJNA 4KDEA 1PGPA 4KUHA 2FSVA 2P68A 3H5RA 4NHEA 1XYGA 2B37A 1EUCA 1P0CA 2X58A 2GO1A 4ZGWA 1I3MA 5JC8A 3VH2A 5T6BA 3S2EA 3OMLA 2VHVA 2V7PA 2D1YA 1X1EA 4CMHA 2VRCD 1CJCA 3WTBA 3BMQB 1Q0QA 1TI7A 1GU7A 1NPTO 3DC2A 2TMGA 2YV2A 1PZFA 1SBYA 4CUZA 4L9RA 4PLWA 4W7IA 1ORRA 3MTJA 1KEUA 2JD0A 2HRBA 5AXBA 1PZGA 4MJLA 1PQWA 3A06A 1HDOA 4CM8A 4DGSA 3DHYA 2G5CA 3GDFA 1OMOA 4WCFC 4IPTA 3HWRA 2A94A 1A5ZA 3OH8A 1AXEA 4ND1A 3C24A 1HDCA 1TT5A 4IJWA 5HS4A 2NQTA 2VHWA 3H9JA 3HADA 4IQ0A 4R1UA 1LQUA 5CAEA 3GGOA 4BS9A 5KWEA 1H94A 4PLYA 3TDKA 2QHXA 3GVPA 3OECA 5HTOA 1Y9AA 3DL2A 5JDIC 4IJKA 1SB9A 4UUMA 3VTZA 3GT0A 1EBUA 3SBOA 1VJTA 1W0CA 1R4MA 3DEYX 1XQ6A 4OYRA 1ZFNA 3NT5A 4Q3DA 2HKIA 1YQDA 3WSVA 1Y8QA 4NJMA 1GZ4A 3PWZA 4IINA 3VPFA 3VHRA 5A9RA 3AY6A 1NP3A 1O9BA 4FOSA 1C1XA 1E77A 1I3LA 1HEUA 3DOOA 5KKCA 1JDJA 2BFOA 1LRJA 3SLGA 2HMTA 4WKGA 1FDUA 1DC4A 3VH1A 1ENOA 4ZRNA 1R15A 1ZMOA 1NQOA 1O5IA 1DIRA 3STHA 4L8VA 2WD7A 3I4FA 4MKZA 5IN4A 5DN9A 5B4UA 3WGIA 1M6WA 5A5EA 1XLTA 1K3TA 5IZ4A 3DTTA 3MWEB 1KVTA 4N18A 5ITVA 3UVEA 2I66A 4MVJF 2QQ5A 3TZHA 4CR7A 5CDYA 4UVIA 4DA9A 1LDYA 5AXAA 1PWZA 1ENZA 1R4NB 2OP1A 3EVNA 3UCEA 5A05A 1LXCA 4KWHA 3PXXA 2O50A 2UV8A 1UXIA 5THQA 2HAEA 3U4IA 3DZKA 3DZHA 3IOYA 1V3VA 2PY6A 3F4BA 3RROA 2IODA 3AUTA 3JCZA 4D3SA 5G0WA 4WOKA 3RJ5A 1GV1A 2ZCUA 4M8SA 1X0XA 4DPLA 1U8XX 2GNAA 3CZMA 3GY0A 3DFUA 3ENKA 1MG0A 4NR0A 1HDGO 2BFPA 1J6UA 4CODB 3IQDB 1Y8RB 1G0NA 1EZ4A 1LC0A 1LU9A 2D2IA 3PVZA 4RPKA 4HNGA 2DU8A 3FWZA 3I9OA 3RBVA 2VUSA 2Y68A 3H9QA 1EVZA 3NGXA 3GG2A 4EUEA 1SC6A 3RI3A 4TRRA 3AM3A 2IXAA 3NGLA 1RM0A 3ZV6A 1AE1A 4J7CA 3P2YA 2AE2A 1DC3A 2B36A 3JQ7B 2DFDA 4J9UE 1VSUA 2GD1O 4H15A 4PFJA 4I5DA 1HXHA 1ZK1A 2VNAA 4PRKA 2JCYA 3GVIA 4AJ1A 3QV1A 3WS7A 5KOIA 3L4BA 4LRTB 1U9JA 3T7CA 1A72A 1BDMA 3HDQA 5JE8A 9LDBA 2Y0CA 2GASA 3A4VA 3ZWYA 4ND2A 1I33A 3WSWA 1V8BA 5AOVA 4H7PA 1PQPA 3WGQA 4XD2A 4CLOA 3FCOA 3RCBA 2QW8A 2H6EA 1GQQA 3KLPX 1VM6A 4QO8A 4BO2A 4XEHA 4F46A 1LRLA 3F6YA 4RGBA 5T8KA 1XU9A 1Y5RA 3IP1A 4XYBA 3LF2A 4Z3KA 3U49A 3TSCA 3QVSA 4BB5A 2AQ8A 4ONEA 4MP8A 5DBGA 1JA9A 5JAMA 2HMWA 3JQAB 3ZWAA 4R54A 1RM5A 2ZTMA 3HE3A 2NQ8A 1PJBA 3ASUA 3DFZA 3EY4A 1DLIA 5A06A 4DPMA 5JLAA 3P7MA 1PJQA 4IZIA 4CM4A 1KVQA 2VOEA 4N5LA 1Z74A 2DUWA 3DXFA 4BNWA 3VVBA 5DBFA 4MP3A 2BELA 3NDJA 3I9MA 2GRAA 1H2HA 2X0JA 4DXHA 4A10A 2WM3A 5AXDA 4RL6A 1NVMB 2YJZA 2ZJ1A 3INRA 2YDXA 5BNTA 1EE2A 2D5AA 1DFHA 3QQPA 4YJHA 1ISMA 2C20A 2ZIZA 4P22A 4RCVA 4FW8A 5COBA 1EE9A 1XKQA 2VUUA 3LT4A 4MIOA 4ZA2A 1NX6A 1OOEA 1UZLA 1V6AA 2BRUA 3KYCA 2FHSA 1SOVA 5FYDA 4C4OA 1NFRA 1QLJA 1VL8A 5FF9A 4QT0A 1QV7A 2CDCA 1YBVA 1X7HA 4OGWA 4BO5A 4CR8A 4AJEA 2AG5A 3JQCA 3E5MA 4TWRA 4UEJA 4NZ9A 5JDCA 4EUFA 5A5FA 2SCUA 2DBRA 3KM0A 1H0KA 2GN8A 1DHTA 4Z3DA 2VT2A 2JHGA 4CV0A 5BNIA 4OQYA 5IAAA 3GAZA 1CIVA 3FRJA 4MVJH 2POQX 4YWJA 4DUPA 3JQ8B 3KV3O 3P2OA 4JIGA 3WYBA 1N8KA 2Q46A 2PLAA 1T25A 1BDBA 1NVTA 5GY7A 4AJ4A 3IDSA 5ADHA 3D5QA 2CFCA 1YB5A 2QZ9A 4J43A 2WE8A 1MUUA 1MV8A 4TROA 4MP6A 2X9VA 4DQVA 4D0RA 5KVSA 3GHHA 1YO6A 1YVEI 3ZNOA 2EWMA 3OM9A 3MEQA 4ZQBA 3W6UA 1K6IA 1C0PA 1OAAA 4FQ8A 3ZHYA 1P1IA 3U4HA 4NBTA 3FR7A 1R66A 3ZWXA 1OI7A 1P31A 4AJLA 1F8FA 4BV9A 4RPGA 1YB1A 1C0LA 1FJHA 5T57A 3BMNB 1E0DA 4D0SA 4WPGA 3RC9A 4PG7A 2ZB3A 4PG4A 4YT5A 5IDQA 3VAZA 2J3IA 4M49A 4BMVA 5G4KA 4E5YA 4XQCA 1U7HA 3FF4A 4JLWA 3QHAA 3RJ9A 1B8VA 1ULUA 3Q11A 2J3KA 1G1AA 3ZNPA 4BGEA 1TXGA 1XCBA 4YQYA 3NAQA 2BF7A 1JWAB 4PRLA 3RBXA 1E7QA 1EFLA 4R3WA 3VPSA 4M55A 2PGLA 3LC2O 4OL9A 3AM5A 4XRRA 4EJ0A 4IDCA 4ALIA 1FMCA 4GVXA 4Y6SA 5LDGA 1EVJA 4GQAA 3I4CA 3V2GA 1M67A 3LK7A 3RU9A 3H2ZA 1M76A 3H5AA 1N1EA 3GRKA 4RDIA 3QSGA 1DXYA 3ZV5A 3H9UA 4W9NA 5L7WA 1RKXA 1VJ1A 4G2NA 1FDVA 5L40A 1Q1NA 3LC1O 2EKLA 3GZNA 1Q7GA 1P1JA 4U6QA 1WVGA 2UVDA 2VWPA 2NVUB 4JN6B 2VWQA 1DC5A 1I10A 3BTOA 2Q49A 1ID1A 3TZCA 3CEAA 3V5NA 3RUAA 4R5MA 4BO9A 3G17A 4XJSA 1EMDA 2YUTA 1ZK2A 5CDSA 3PGJA 1YWGO 3ASVA 3PQEA 1ZSVA 5DULA 4J90A 2YZ7A 4CM9D 3O26A 4YAIA 1R4NA 1GPJA 5C37A 4XIJA 5I7SA 1VE9A 2CF6A 3ZWBA 3WGYA 1EFKA 5B37A 4CL8A 1I2CA 1GL3A 1Y5MA 1P9LA 3NJ8A 3FD8A 4PCVA 1Q7BA 2VQ3A 5JMPA 2OZPA 5BR7A 2FP4A 3WLEA 2PK3A 1ZCJA 4KQXA 4XYMA 3ANMA 1RJWA 2FWMX 2PZJA 5I9LA 2JAPA 3JQGB 3OJFA 1Y8RA 3BHJA 5GZ6A 1D8AA 3PQFA 2FPGA 4OQZA 1DO8A 4U0JA 1PGNA 5C7LO 4N7RA 2YY7A 1YDEA 3E18A 5CP8A 3I23A 3X2FA 1P1HA 2UYYA 3OJOA 4BNGA 2F1KA 4YT8A 3MWDB 1YONA 3B1FA 1BGVA 3TJRA 3BMCB 2GZ3A 1CYDA 3FBGA 5H81A 1I2BA 3A14A 2CVQA 1NBOA 4CMIB 4QXMA 1CQJA 3WGGA 1HF3A 5CDTA 1MX3A 4BV8A 5KKAA 4OXNA 4Y9DA 1NHWA 1E3SA 4ZQHA 2HK8A 4DRYA 3WLFA 2P5YA 1ULSA 5JNLA 3WICA 1NXQA 2RIRA 4ND3A 3VOSA 4ZQGA 1AHIA 1BVUA 1WZEA 4B3JA 2Z1NA 1D3AA 3D4PA 2O48X 1RPNA 4HXYA 3ROKA 3UUWA 2C7GA 4J7XA 3OJEA 4KZPA 3PP8A 3KB6A 4U0KA 2PH5A 4RLHA 4YRAA 3ADOA 3QY9A 5DOVA 5I7EA 2QZZA 3RBZA 4PLZA 3VDQA 4LMRA 5T67A 1Y1PA 1LUAA 2YQ5A 3DBRB 1P44A 3BIOA 1DAOA 3EDMA 2IYPA 1JVSA 1H6BA 1C0IA 3U3XA 5BSGA 4ID9A 1A4UA 4K26A 1NAHA 2G82A 5L45A 3FNFA 1GEEA 5JCJA 2QYTA 3L4BC 1DFIA 1E7YA 3JQAA 3ZU4A 1QKIA 5A3VA 5CEJA 1IHXA 2WTBA 4EDFA 1FDSA 2IDZA 1XDWA 1BG6A 1LDNA 4E31A 2JCVA 3WR5A 1ISGA 1HT0A 3NT2A 2Y67A 3AJRA 3D64A 4KP7A 1H6CA 1PGOA 1WNTA 4O5OA 2ZB7A 3EW7A 3WX0A 1B26A 5KJFA 2A35A 1HE5A 3PIIA 5MGBA 1PJTA 3ZH2A 5MDHA 4QTZA 5C5IA 4OKNA 1HE3A 1N9GA 1LLQA 3K2EA 5K6AA 4MIYA 5BSFA 2OFPA 1E5QA 1ZUD1 4KMSA 4Q3NA 3WFJA 1LX6A 4S1VA 3RUDA 2Y99A 1D1TA 2W4QA 4R51A 4WNIA 5T8KC 4AICA 5F1PA 4XB2A 3HB5X 1LDBA 3OJLA 2ZTUA 5H82A 4EEZA 1U1IA 3ZGYA 4DBZA 2W8ZA 3C1OA 5FFFA 1ZEJA 3LDHA 1P3DA 1UAGA 4WUVA 1UDCA 3GMDA 3WQQA 2C59A 3I9NA 5JAIA 3TFOA 2VYNA 5EIOA 4BKPA 1G6KA 1LNQA 4KQWA 3UH1A 3PHHA 1GYRA 1C3VA 4IQGA 3I9KA 2AQHA 1MXHA 5JS6A 4JK3A 5ICSA 4Y67A 3VPXA 1GD1O 1F06A 1LRKA 3R3SA 5I8ZA 2FR0A 1U3WA 4BUCA 4DMMA 1KY5A 1DAPA 3D3WB 2AEFA 4U7WA 5TIIA 1GCOA 2IRWA 3JQ8A 4DYVA 5C7IO 3M1AA 5T64A 4P4GA 5FEUA 1DJQA 1HKUA 2J6IA 1P77A 1I3KA 2QIOA 4LRSB 2NWQA 2PZLA 4NIMA 4XQGA 1ZSYA 5JBIA 1T2EA 4IGFA 1GCUA 2Q2QA 5HRUA 2I76A 3DBLB 2H5LA 5ILOA 3JSAA 1YS4A 4XDZA 1A7KA 3UN1A 2JFGA 3K2BA 4BNMA 4EEXA 4S3MA 3F47A 2IXBA 5TSDA 1BW9B 4JBIA 4M87A 1QYDA 4GKVA 4U6SA 5JDCC 2V6GA 1AXGA 3DAGA 3DHEA 2EP7A 5L7YA 1QYVA 1H6AA 4AJJA 1IYZA 2Y0DA 4NFHA 1E7SA 3BMNA 5TGDA 2NVWA 4IDGA 3TOZA 3PEFA 1I2ZA 3WWYA 4CQMB 3IMFA 1HZZA 4MVJD 4F45A 1YRLA 3ZU5A 1SEVA 2X9GA 2NTVA 1UP4A 2GLXA 1DJNA 1EVIA 3MOIA 1GY8A 4URFA 3WNQA 1WAMA 1TT7A 2HMVA 3AI2A 4RQTA 1WWKA 5TLSA 2IZ1A 5IXSA 3PYLA 3F5SA 2DBZA 3W1VA 1NVGA 2ZCVA 1M66A 3W8FA 4JXKA 1CETA 4CM1A 2P4QA 3E82A 1ZJYA 3GFGA 3SVTA 3QP9A 2IZZA 4CR6A 3NJ4A 4BO6A 4CLDA 4JJGA 2ZQZA 1F0YA 4R4JA 1ISHA 5TJ9A 4E21A 3GQVA 1NM5A 1SPXA 2B4TO 4XR9A 3KRTA 3KSUA 2E37A 3UCFA 2UUOA 1EBFA 2Q4BA 1LSUA 1WDMA 2JFFA 2OMEA 2A9FA 3KBOA 3PHJA 2YYYA 2C29D 2GUGA 2W2KA 4GX2A 4IJVA 4E33A 4CPDA 3GR6A 3H9GA 3AWDA 1Y6JA 5IF3A 1O0SA 3IS3A 1HYHA 1YOVB 4JP2A 4NK5A 3K6JA 2IEBA 4R68A 1B14A 2FSSA 2Q2WA 5CFZA 4CMBA 5JYEA 4OSOA 2ZJ0A 3IL2A 2VYVD 3AOEC 4DTIA 1NNUA 2VHYA 3D4OA 5JAQA 5A02A 2EV9A 3NTOA 4TRNA 1KVSA 4W9NC 3PJFA 2JKVA 2XF8A 2DQ4A 1L1FA 5L3ZA 4QFCA 2XOXA 4NMHA 4BNIA 1E1KA 4RF4A 2PD3A 3L6DA 2H1SA 3PK0A 4RF5A 5TNXA 3A1NA 4A0SA 3PPIA 4DIFA 3GDGA 5HA5A 1JWBB 4R5HA 1PU2A 2AXQA 2FZWA 5DT9A 3ZU2A 2OORA 4XGIA 3LT1A 5IXYA 4PLFA 4XRGA 3MJSA 4YJGB 1E92A 5FI3A 4X54A 3ZWCA 1NPDA 4DQXA 4ALKA 1ZXBA 1JN0A 3S2IA 3ZWWA 3HN7A 4CMIA 4MINA 3CMMA 5F21A 1J0XO 1E3WA 3OIFA 3FN4A 1XHLA 4HADA 3ZW9A 1ZK4A 2R6JA 3M1LA 2Z95A 4PLHA 3NV9A 3G49A 1UXGA 3S1LA 1HDYA 4MPDA 3RKUA 3UFXA 5A04A 3TN7A 3N74A 3ZW8A 1GUYA 2EGGA 2YV3A 3WOHA 4L0QA 1LA2A 4YQZA 1ISFA 4WEQA 3INTA 2C82A 2CSUA 1NHGA 3GMSA 1WP4A 4J0FA 4N54A 2HUNA 4BNKA 4BHTA 1MC5A 3BMOA 1JVBA 4PZEA 1LC3A 4GMFA 1KIFA 4ITUA 5F5LA 1KY4A 2GN6A 4KTVE 1T4BA 5CEFA 2VNSA 3BAZA 1N7HA 3TL2A 2Y1DA 1T2DA 3ON5A 2J5KA 1KEWA 1IPEA 3ETGA 5TT0A 5ICMA 3IC5A 4YXFA 3RC2A 3UCXA 3R6DA 3JQDA 1LLUA 4Y8VA 2PKQO 1Z73A 4RVFA 5DNAA 4HP8A 1ZXLA 1ADFA 3ZHZA 1DIGA 1KVUA 1ZW1A 2I9PA 3RUFA 2X5JO 1A9YA 3PI7A 3PTZA 1ZKMA 4NPCA 4B7XA 2QX7A 3H8VA 4DIOA 2RAFA 1GADO 2HSDA 1ZZEA 1VLLA 4RQUA 1KETA 5JO0A 1NAIA 4D7AA 4R1TA 1S6YA 4WCFB 3DB2A 4BKQA 3FPCA 2PKRA 1V0JA 2X7HA 3D5TA 2PKQP 3EC7A 4PN3A 5JO9A 1QR6A 4WEOA 4LSMA 4YJFA 3UHAA 3BTUA 5L4NA 1X0VA 3EZLA 3TZ6A 4L76A 4IXWA 3CSDA 1UXHA 1HETA 4RO0A 1P1KA 1C1DA 3QWIA 3X2EA 2Y93A 4PVDA 1ADCA 3C3XA 4XKJA 2HRZA 1WW8A 2OBNA 1KVRA 1U8FO 1QMGA 5K6AC 1Q7CA 3D3WA 2YFQA 3OA2A 4Q3BA 4KWIA 5A4DA 3OIDA
chains in the Genus database with same CATH superfamily
1WXDA 2JGFA 2WWXA 3PUKA 4FGWA 1CY1A 1DRWA 4PZCA 3PC8C 1TVEA 3VSAA 3EQ8A 1B6RA 1LSJA 2AB0A 1T9KA 1YTUA 3N2YA 4GT1A 5G1PA 4HGNA 4KUGA 5CM9C 4YRQA 4LHYA 3ZE8A 3RU7A 1AVTA 3TPCA 1RRVA 4OYYA 4QIHA 2LKCA 1KOLA 1Q0ZA 3GROA 4WACA 4F21A 1N2XA 3QYJA 3W9YA 5FIUA 4ZREA 5AW6A 4LPKA 1DPGA 3RIEA 3H3JA 3PR1A 4RESA 3MHTA 3LBNA 3SC6A 2NP6A 4KPGA 4FT4A 1H8ED 4BMOB 1U7TA 5K0CA 4E51A 4XW2A 2EP8A 4I1UA 4M8LA 4M9UA 4EENA 4EF6A 4BBZA 3C70A 5FI1B 4UULA 1MGOA 2QVYX 1MQ9A 1MNQA 3MS4A 3QVGA 1NLZA 4KK3A 1B16A 4KPUA 2JFBA 4OJMX 2BI7A 4TRJA 4YFYA 3FPBA 3PQ3A 2E4AA 1VA5A 4XEUA 4WA8A 2W2OA 2ZUUA 2O8NA 3ZDBA 2BM0A 2GARA 1TTHA 2ZJ3A 2YIMA 3GT4A 3NOOA 1FZTA 4H7DA 3CUKA 5H83A 1FRNA 1TKCA 1CZRA 1XO1A 1SG9A 1T91A 3LQKA 3EGEA 3JQEA 4HI0E 4N0EA 3ONEA 5TX7A 1GUFA 2IXFA 2HCBA 3W7AA 1SFRA 1S2GA 2E87A 4GOKA 4DAEA 5K0EA 3FOCA 2FEWB 3M6AA 2QRUA 5CA1B 1UBTS 1W5FA 4HS9A 4C5BA 1NG9A 4TV8B 3HB9A 5LPNA 2JI8A 4JCOA 1A3CA 2ZYWX 1X7GA 3M4YA 3U9LA 3H6GA 2XGSA 5IPFA 4B82A 1WVIA 4BVGA 3UO8B 3TTXA 3WV4A 3VR2D 3D0RA 3EA4A 4J4HA 1J5PA 2DY0A 2IP2A 1CRPA 5H59A 3BCSA 2YRXA 1IN1A 4XWOA 1V43A 3OTIA 3UJHA 1RYDA 2VZ8A 1PR2A 4CMEA 1MV5A 1I2DA 2I34A 4PIVA 4ETWA 4EW2A 4I6GA 1Q7EA 3RADC 1AKVA 3HLTA 4ZOLB 5F2NA 4ZVTA 2BFBA 4KNWA 1FW6A 3U9SA 4PC1A 3UZUA 1PIWA 3GDWA 4ZMRA 4OX9B 4ZVUA 3EZGA 2IU0A 1M6YA 1PZMA 3DKKA 1R0LA 2Y71A 5DGIA 3NTVA 3L46A 1XJQA 3E5RA 1J20A 1G4HA 2VPPA 3IILA 4EUSA 2DFNA 4D44A 4NJEB 2AG0A 3A9VA 4ZVSA 1Z7BA 2ARKA 3RHSA 1TU3A 2H1CA 4Q15A 2H2IA 1K6XA 4DC0A 1U63A 1KEEA 1UMDA 3NM5A 1YUNA 2QU7A 1B41A 4RHCA 1XR3A 2HCJB 3CO5A 3HZHA 1Y98A 2H9AA 3L0DA 4LS3A 1XZHA 4NF2A 4CNBA 5BR8B 3TVYA 3CR3C 3O8OA 2QUIA 4D3YA 4W5NA 1S3FA 1XEWY 2Y4OA 3A9SA 2QB5A 2VLBA 2BHRA 5E4JA 4CW7A 4CGZA 1X74A 5CA0F 2QMZA 2CB9A 2Z2YA 2XHEA 3D0QA 3FMVA 5CCEA 4RTNA 4R9SA 2YHSA 2DR0A 1GARA 4XWTA 3EEIA 3CUUA 3C15C 5K9ZA 3ABSB 3FYUB 2ZRMA 1Y4DE 4ESVA 2ZI6A 4PCAA 2I7CA 3VC1A 1FFBA 1D2NA 5BSHA 2QTVA 1HE4A 1Y1SA 4JJ4A 4B3GA 2I7TA 4JX8A 1COWA 2GTHA 2YRWA 2Y1CA 3L7IA 3ENNA 3LRTA 3LDGA 1YQQA 3NVAA 1ONOA 4Z9AA 4CEJA 5A3JA 2DERA 3OCJA 3VU0A 1S2DA 1XEWX 3ZUGA 1GPKA 5KMGB 4O59O 4URHA 3NHYA 4I50A 1CU1A 2YN2A 5AM5A 3AVVA 2WU8A 3PDHA 3KLMX 2P9JA 3IVGA 2QR3A 3OLZA 4B0PA 5IUJC 4PNZA 1OWPA 2JC3A 2DP4E 5AVWA 2ORIA 4Z6KA 1IOLA 3KHTA 3QVWA 4IM7A 1IZYA 1GNSA 1PV2A 3OQ6A 4LI3X 2FPLA 4WI1A 1I7LA 2DCUA 5DO9A 5EE1A 2PKEA 3UBMA 2WWRA 3H4VA 4B2YA 4ZJUA 5KHOC 1MLDA 1R0XA 2CHGA 1DWPA 3FXAA 3TE6A 3EVBA 3KYDB 2AG8A 4Q00A 4U8GA 2C58A 2GCNA 1NYRA 3G0OA 4MARA 3FCUB 1H5QA 2H4FA 3R5SA 5ALZA 1KDYA 4DLRA 1Q91A 4KHPB 1B0PA 1AQIA 4J75A 1L4UA 4KXWA 5HUHA 2IXTA 2P35A 3IEUA 2M2IA 3CPJB 2C61A 3EMKA 3QWHA 4UREA 2Y05A 4LHSA 3AG6A 2JGKA 4LC9A 2WQ6A 3GNQA 4F1JA 4DMRA 1C50A 2Q1TA 4U2DA 1KI3A 2AFIA 5F33A 2ZI9A 2ENWA 3U0VA 5E2IA 1Q6ZA 3RWOA 3KXDA 3GRVA 4ALJA 4MJ7A 1CR4A 3TMAA 3M9WA 2ZYGA 3ILSA 2GNOA 2WD8A 1PSDA 4CLHA 1GA1A 2BONA 2JJMA 3OSUA 1BHSA 3GLHE 2F3SA 2OORC 4G9BA 5HKBA 2ZU6A 3KPWA 4MDHA 2CCJA 3DQPA 4RSGA 4RULA 1M5UA 4PN7A 3NJRA 2BM1A 2XYHA 1RKBA 1WPQA 2Y1KA 2GB4A 1P7VA 3LLVA 5FLXA 3IEMA 2C5AA 3QBDA 2NT4A 1HYGA 5JJKA 3UNXA 1QBKC 4UTOA 3UW1A 1RWKA 1VL5A 4JITA 4LYAA 1S3GA 4UUNA 4WXEA 4MI6A 3UAZA 5KTNA 2VG8A 4E1VA 2NO4A 1T0IA 4O2BF 2JJYA 4GMGA 3R3YA 3IE0A 4LJLA 1GQOA 1PJCA 3ZD7A 4MRAA 1LPNA 2FZLA 4H4CA 4MQ6A 4CWAA 5K03A 3HA5A 4KQMA 3DKRA 2QP4A 4AS1A 2C8LA 1MRZA 1NDQA 2NOAA 1NVDA 3JYNA 2VF5X 4AP6A 1C7JA 3H5NA 1D03A 3JU3A 3TL3A 1HYEA 3DDNA 5CJJA 4RVOA 4B87A 1TTTA 2AFHE 5JJIA 4NMMA 3ZY2A 3G2KA 1LB1B 1XYYA 1L8AA 1JE1A 4JP8A 4DLBA 1TRKA 1ZL0A 4FVTA 3G2IA 1OGIA 1O6CA 3JD3A 3NETA 3W04A 2XB2A 2F3UA 5FL7A 2P3SA 3KEQA 5HF8A 5H3LA 3A1DA 1W9HA 3EF3A 2X4GA 4CMJA 3IEXA 2D0OB 2QN3A 3TQFA 5JCJD 3KVOA 3JYLA 1ORWA 2BDUA 4FR5A 4JB8A 3F9CA 3FUUA 5DXJA 2Q7DA 4H08A 3PQDA 3EULA 4R40A 3U7EB 2CD7A 2OKCA 5LU9A 2PMCA 2R1TB 4M7PA 1VPEA 3M34A 1IFXA 1QFZA 3H5LA 4IQ8A 3AUSA 1UM9A 1WMAA 2NUAA 3RRNA 2GEFA 5AVQA 3A0RB 1RLMA 4QOSA 3AB7A 4BNDA 4F91B 4I2NA 4OXYA 3SAJA 1MAUA 3CWZA 1RRMA 3QYAA 1OF1A 1X9HA 4RIGA 2FNAA 3ID6C 2PANA 3STUA 4OPMA 3QE4A 4JC0A 2GBLA 4OHBA 1JTVA 5EJ2A 2HFKA 2RHHA 4WNYA 4PZZA 3VFDA 1T35A 4MUBA 1PDOA 4J7UA 1A88A 2FSIA 1R88A 3EVEA 5T4EA 5TQ0B 3KSAC 1RAHA 3B9PA 4XA8A 4IKPA 5EHGA 1US8B 2FZCA 4XIYA 5HKKD 1GP2A 1UC5B 2W5UA 4TKVB 2RAPA 2XLCA 2J6HA 3D4NA 4ROTA 1Z0SA 3T1VA 5ABPA 3FHTA 1PGJA 1QZUA 1RWOA 3U48A 5AI6A 3B6MA 2C96A 2OHHA 3UWDA 3FPAA 1IXKA 2CW5A 2WK1A 3AUAA 1LVUA 1BYIA 3BF8A 3F7NA 1PJ3A 4CDMA 1RWXA 2OILA 3TMKA 4JNCA 1FX1A 2XUQA 4CM6A 1CW2B 5ESXA 1PVOA 2DTEA 3HDYA 4NNPA 2CXPA 4XYLA 1W96A 4KR6A 2RBGA 1JAXA 1PWYE 1RI2A 2FW7A 2WJPA 2ZJ8A 4M9RA 5IBQA 4ASUA 3LVFO 5BYAA 2ZB4A 3AF0A 4LVOA 3UUFA 3DT6A 3L7OA 1SXHA 3P45A 2PZMA 2Y0BA 4PINA 3LUDA 3ZHUA 3IIKA 3ZN2A 4LOJA 4X64B 5IKPA 4JT4A 1WXGA 3E4CA 3N0RA 3M4NA 4B7CA 5KDDA 5BYJA 2RC6A 3L0OA 5JW6A 1C1HA 4JYCA 3ROXA 3JQ6A 2O23A 3C1UA 4LFCB 4E5MA 4Q3KA 1EK2A 1R8YA 3DR3A 3EZ6A 4P53A 4QDXA 4TS4A 4EG6A 2AJBA 3ENQA 2N42A 1DKOA 3JWHA 1T8SA 4KJXA 3VZRA 3NATA 2YFHA 1JQLB 1PV1A 1WE2A 4OLJA 1C1XB 4P7GA 1T1IA 2JFNA 5EE0A 4HZIA 3HDHA 4EY6A 3DPUA 1Y7LA 1I80A 1QUFA 3NXSA 1M2FA 4LYFA 5CX1A 5HFNA 1P45A 3E58A 4J91A 3JVDA 2OCKA 3P9PA 4FFRA 1NMZA 4LJ9A 3JZFA 5GQSA 2X7JA 4DXAA 4F2GA 5FOQA 1I4OA 1PYDA 3QXXA 2EP5A 2BDEA 1ONBA 4HAWA 3D7RA 5KX5A 2FSPA 5DIFA 1BOFA 1QGDA 3P9QA 2WD7B 3UF0A 4GMHA 5BVGA 3AOGA 3B82A 2V8BA 4IDNA 3IE1A 2HU7A 4HAYA 2FDXA 3VVCA 3N2KB 2LR0A 4ME6A 5CA0B 1NBEA 3QF7A 5KEIA 1BC5A 2ZIAA 1KI6B 4A1FA 3QG5A 3T3MB 2QAGA 2J9FA 4FE4A 4GWKA 4CUJA 3Q15C 2X0RA 4QZVA 1A4IA 4DA8A 3I9LA 1JHAA 3P9YA 5FTMA 4EB0A 4EKDA 4BJ3A 5JCXA 2Z6AA 2PGIA 1NXWA 5GGYA 1A8HA 1RC8A 2IP4A 4X5OA 2X6TA 4R84A 2VRNA 4HV4A 3ICOA 1DT3A 2CKDA 1QDUA 2WZCA 3KQMA 4IH1A 4Y0VA 2EIXA 3H1AA 5L3SB 3AESB 2BEWA 1QH1A 1L7QA 3BH7A 5G2OA 2ECFA 3C3CA 3THWB 4HLCA 3TNJA 4ND7A 3OU7A 3M49A 1HA3A 1TA4A 2WSMA 1CB7A 5HNKA 3I61A 2HU2A 2OYCA 4RK1A 1CQXA 3KZXA 3FPHA 4PTYA 3RC3A 2BHSA 3LW8A 1CIJA 2DPXA 3NKLA 4Q3CA 4AQDA 2MYTA 4PTLA 3P97A 2D2EA 3QFRA 5I9TA 3I5YA 1ZH8A 3HY4A 2VT3A 1V5GA 1GG5A 3AKDA 3Q98A 5TF0A 3DZJA 1VHJA 2CLOB 4IZ6A 2XT9A 1PYGA 1GGNA 1FS6A 2E4VA 4I4IA 1Q7RA 5GJBA 1H9BA 2IU4A 1LWOA 3L4KA 1F60A 2FRVA 4KFSA 4GBJA 4Z4CA 4RLSA 4S12A 5LNK6 2H1OA 2CN1A 1AHHA 3KQPA 2AX4A 5KQPA 2NU7A 1M8PA 1ZCBA 3KAPA 1XMVA 2VT7A 1NOJA 2J4CA 1K9VF 3KE9A 5B2ZA 1NQUA 1EK5A 2A92A 4COKA 3RAEC 3E7XA 1MU0A 2P0EA 4Y2GA 3RC7A 4GLFA 5IFLA 5JRDS 1AKYA 4R9RA 1YKFA 2FDRA 4ZARA 5BV2P 5EYPB 3HN6A 3TVTA 3LVBA 2P4HX 4KQ2A 4XQ9A 5KYGA 1WABA 2QMYA 1Q50A 2AFIE 2Q6VA 1CUBA 1KR5A 2W6ZA 3AQIA 4PNHA 3LECA 3OY7A 5SV2A 1RXSA 4JOCA 1J1ZA 3GHYA 1LLDA 4Q1CA 3DPIA 4F5YA 2XZPA 3AHHA 3JQ9A 4BIIA 2REQB 3IHTA 2NO7A 2XCUA 3O3NB 5ALIA 3L1KA 3O1JC 2H31A 4J1TA 2HK9A 4ZU3A 1UFQA 5JYCA 1BTOA 1I3NA 1VE3A 4G85A 5EA2A 4YJ3A 3OM0A 5K0NA 2L18A 5THKA 2C3PA 1GAWA 3OQIB 1UJ2A 3LPCA 4O2BB 4PM4A 2ZVQX 3TSWA 1MORA 2W2LD 2ZRHA 4NYJR 2JLZA 4GZ5A 3MD0A 4I1VA 2X3FA 1KJ9A 2Q6LA 1FDIA 1XRSB 2QRVB 3GUHA 4UBLA 4XGRA 1OI3A 4AURA 3ZHSA 5LFAA 4L7VA 2PUBA 1O6ZA 2GETA 1MVLA 2AG6A 2PLRA 3UB3A 1EQUA 3CC8A 1U7WA 4D42A 1OXKB 9ABPA 1IULA 3BRWD 1JR3A 2IPMA 3RT7A 4HRVA 2ZR0A 4OOEA 2NZVG 3QW2A 1CR2A 4K5QA 4PIPA 5KWVA 3K4PA 5ALJA 3H87A 2H2WA 2WPNA 1JLHA 4J49A 3O38A 3N75A 4AZTA 4YBZA 3W7VA 1SCQA 4H7IA 4U3JA 3JVVA 4GGPA 3SHVA 3U40A 1H2EA 3AHCA 1VL0A 1CUCA 2FR8C 2EBUA 2MSNA 2ZUCA 3TJZA 4YEDA 3AWIA 3AR2A 1LLCA 3A05A 5GVSA 1X2EA 1A0OA 4MEJA 3AY7A 4L4UA 5K99A 1JG3A 5FTLA 5IKOA 2X8JB 2ZITA 4Q1BA 3O2QB 1E2EA 2O2GA 2ZU0C 3EZYA 2D7CA 3O4JA 3DO8A 3PEYA 1QX3A 1TJPB 1PT9A 1VPDA 2NSHA 2PWYA 4B3SB 3CH7A 2JG3A 3GJ4A 4OHRA 3GW8A 3ULKA 5CLHA 5CU7A 5C5DA 3FMPB 3OJWA 8LDHA 1ZW6A 3AZQA 3VSDA 1KZ6A 2J87A 4C22A 4EFNA 1QQTA 4R2WA 4AN1A 1SXIA 2M6RA 4EECA 4H0CA 4QOFA 4O6VA 1ZM9A 2R5WA 3GIWA 3RTEA 3ORRA 5NLLA 1XPOA 3D6FA 2SKEA 1PHRA 3JYQA 2XZDA 1YJQA 2G1AA 3MGKA 4QLOA 1MABB 3C41J 5F5NA 5TPWB 4BYMA 3MILA 4L73A 1P17A 2OQVA 4CKWA 3NP9A 4BFLA 5JRZA 4QOHA 1AUOA 2R65A 4AJ2A 2CVHA 1J7JA 3HKDA 2WVJA 2WM9B 3LGAA 2FMKA 3KR1A 4ZMBA 2FEPA 1H4QA 3HMKA 3JASB 2BYTA 2CV0A 3KQYA 4L4RA 5B1YA 2CK3A 1L7MA 1CFJA 1RYYA 2PX4A 2ROQA 5ALEA 4K9DA 3HJCA 4WE3A 1GTJ1 5C8YA 1MB0A 4CV3A 4HJRA 4O02B 4XI9A 3QU2A 5DWQA 3RS4A 4FCCA 4A6PA 4GKKB 1FXWF 3P26A 4FJ0A 1IQPA 1JBEA 3PE4A 2G1KA 4H0FA 1PI3A 3PB3A 4EBBA 3A6HA 1AQNA 4JA0A 2I3GA 4K3VA 2FQYA 2QDKA 1JPUA 4P4LA 2BMJA 3KSBC 1CY7A 2ZIGA 4M1TA 5JATA 5EKTA 3WNVA 3F4KA 4FOOA 1KAQA 2HMSA 3DQZA 1W87A 2ZKLA 2HJWA 3F4LA 2BFFA 3PNBA 1SQSA 2VO1A 3TTUA 4N76A 3Q3VA 3PDUA 2VTDA 3F1KA 1EDOA 4MW2A 2P9ZA 2J8ZA 3IRUA 4R9VA 3EX7C 2R79A 4J76A 4AO7A 5I6DA 2CLHB 3JAKB 4P0QB 5BOVA 4UTZA 4J29A 1WZUA 4POAA 2DEUA 3RHTA 4QASA 1LFDB 4MCIA 1L4GA 1Q17A 4Q7MB 3VGJA 4W5TA 1BSVA 1A8UA 3BULA 2JIZA 3KTDA 3EXFB 5L3RA 4KI7A 5M3BA 4E94A 4DUGD 3T99A 4LV6A 1V6SA 5C5EA 1BHQ1 4G0UA 2NPOA 3OE7D 4GH5A 4YQFA 5JJCA 4GI1A 5FHQA 2XWJI 2XTAA 4PZ9A 4UBMA 5EHQA 3NLLA 1Z4KA 2YUIA 3N1UA 3ONWA 1SBTA 4BWVA 1ACLA 4U02A 3O7WA 4TLLB 4UBNA 2QN1A 1A8SA 3OEEA 3DONA 4FC7A 4BU0A 1EJ2A 1M2JA 4DGQA 2ECQA 4YCNA 4GM0A 2CT8A 4AMGA 1M2GA 1BEEA 2XITA 2NYUA 2IK8A 4M76B 3OZBA 2VDMB 5F7ZA 3UANA 1ZRSA 5AI4A 3KQTA 5EMKA 4FMDF 5PNTA 1I1HA 2GFHA 2WV9A 3FIUA 4IHQA 4D43A 4EGSA 5IBCA 3PITA 4JH0A 4LXTA 4EG1A 4H1HA 5HKLA 2IIPA 4WX2B 4MYUA 1E3IA 4NDAA 1DKUA 4C05A 1XWFA 5HFJA 3IUSA 1WW2A 4LTDA 2BMWA 4CEHA 4MR8A 5FOSA 5ELLA 2FN7A 1UMCB 4Z0TA 1NYTA 1KJQA 4R8LA 5ALUA 2GMWA 1N1DA 1N4DA 5A4JA 4QOJA 3M83A 1LI4A 3NXKA 4CCWA 4X20B 4E3ZA 1I1OA 3CKYA 5CVEA 2IWHA 3TIVA 3RFTA 2PMDA 5B6IA 4LDQA 1XSEA 4Y98A 2Q45A 3DVAA 3LBFA 4PYOA 3V00A 4DRXA 1JKFA 4IV0A 3C4JA 3CPSA 4CN8A 2PBFA 3G82C 3CX6A 3QVMA 4D3DA 3WZMA 1UPCA 5KTYA 5L51A 1PBNA 1S4MA 4INJA 5BOSA 1RJGA 3BDVA 4RNCA 2Z43A 1TZJA 1QFXA 2EX4A 2JZOA 4EGFA 3AF3A 4KNVA 2FP4B 3B1KA 3OMWA 3S2FA 2R7LA 4HAOA 2FH5B 1T5TA 4D8TA 2QT1A 4D6YA 3T9EA 2AMFA 4QYSA 3L7KA 4RV5A 5E6RA 4AKGA 2Q5EA 3E3LA 3K2QA 2GPTA 5GM2A 1GGHA 3CA8A 5G4LA 3WK5A 2KX7A 2ZIFA 4Q82A 5AVUA 3VOAA 3RVDA 3N8HA 4F38A 3UXMA 2DXIA 4W1RA 2XUDA 3C87A 4PC6A 5E2AA 4M53A 2HNBA 3OF2A 5EP1A 2WE7A 1N6PA 2ZKIA 4OG2A 5A9TA 5KNCD 5LD2B 4BLPA 2G72A 4AYXA 1XMSA 4B3TB 3K3PA 2X5KO 3DBLA 3TW0A 4PG8A 3VKUA 4AO6A 5I48A 1VMIA 4D0NA 1CQJB 1SKAA 4XSVA 1KJZA 2EJBA 1UWLA 3E23A 4HXEB 4ARCA 1IL0A 1E18A 2IOFK 1VRWA 2VJAA 3N87A 1DO0A 1GZ6A 3PQCA 3UMCA 3KKZA 2IHTA 3V8BA 2GQ0A 4HY3A 4ZD6A 3WNCA 5CB8A 2XE7A 6ADHA 1DXQA 1ZY2A 4Y3UA 5DPMA 2EW1A 1T8PA 2IEDA 2BWJA 5GIOE 1KEVA 2C03A 3HWWA 1PJAA 3LE8A 1ZIXA 5JD5A 1M72A 3GBSA 1SG0A 3Q7PA 1T6BY 2DKNA 3Q12A 2PMEA 3WYNA 5K0ZA 3DD5A 2B5WA 3UMJA 1U3DA 2NUPA 3E61A 4FEYA 2XKAA 5CFNA 2CB0A 3NU1A 4XWGA 3TQSA 3JD0A 3F0TA 2FZVA 1IOWA 3O47A 4CQMA 5C3MA 1MJNA 1DHRA 4B3IA 5EMHA 2O3TA 1FDWA 1OZAA 2QL5A 3IAUA 1Y9JA 1XMIA 4L5CA 3OIUA 1WEKA 1D09A 2QLFA 2BKXA 1HSZA 2D0IA 1JB1A 4URXR 5CPFA 4PYRA 5KC8A 2FW0A 2WWWA 2D5CA 5TQVA 1IUPA 3D8TA 4J8PA 4GM4A 4F11A 1MHTA 1S5PA 3ICWA 5I5GA 2J3HA 4O4LA 3ZHBA 3MMPA 1TLTA 1U3UA 4AYTA 2YQ4A 1RBYA 3D3QA 4QAJA 3SQOA 3F3MA 3H2GA 4MLCA 4MWDA 3FETA 3N7TA 2RK4A 3HLKA 4B46A 1PJ2A 4LDJA 2C4NA 3G3EA 3WJAA 1HGXA 3O4HA 4OXKA 3Q6NA 4QJBA 5DM2A 3HFGA 1THZA 4QECA 2IBSA 1XAJA 2XMSA 4B4DA 4DIMA 3DYVA 5K05A 1F0KA 2NXEA 3BMXA 1ML4A 4EYKA 3WGUA 1QE3A 4MWTA 2AYXA 2BJHA 3O4RA 3LZDA 3DYBA 3NTLA 2V3CC 4CTNA 1ISJA 1XCOA 5CG1A 4ACAA 4RVNA 5D5HA 4BO7A 1ODSA 3TF5A 4CIXA 4Q9JA 1WTAA 2C54A 4JB0A 4EB6B 4XSHA 4PF1A 3GLIA 3NYWA 1I6KA 3AHIA 2Q3HA 5L4LA 2ZDHA 3CV3A 3GMIA 4ZHQA 2WKSA 2XNCA 2YX1A 2HLDD 3CVOA 1W8IA 3GD7A 2NZJA 4D92A 3L8ZA 1V16B 2FZ5A 2Q5OA 2NTNA 5LM3A 1QJCA 3F96A 3KT0A 4K9LA 5MFPA 1KARA 4GLJA 3C3JA 4J2TA 3FNGA 1MB9A 1AKRA 3QFCA 2GD0A 3ICQB 1W49A 3DZBA 4JEHA 3UW3A 3RSGA 3TNLA 2R00A 3PPXA 4FB5A 2VKTA 1LCIA 1OZHA 2RG7A 4AKSA 1RC1A 3KPYA 4MQFB 3RTBA 4ARAA 4LQ4A 1IN4A 1RAGA 4HT3B 4YRBA 1BVRA 4ZICA 3HA2A 2BM9A 3EQ6A 4Z4QA 1TEHA 3QE9Y 1T2VA 2AZXA 2EGHA 4J9VA 4RHYA 3C7TA 2YZNA 3OEWA 1R0ZA 4PQRA 4H3VA 3NUGA 1G4AE 3V2UA 1CUXA 4INOA 4Q66C 2HSWA 1R8JA 1J0EA 1OFUX 3SGLA 3ZPXA 5FTKA 2Z9CA 2A86A 2G9NA 5KNLA 5EI5A 4OLHA 3H9EO 1QAMA 3AFMA 4OUDB 2UAGA 4QNNA 4OHMA 1GRNA 5DTJA 2IIBA 2FPIA 1DXHA 3OCCA 3Q0IA 4WECA 4Q4DA 5DYYA 4ER5A 3NEJA 2B2XA 1NVXQ 4BNFA 3KHKA 1FCJA 2VZ9A 3G1TA 2CNWD 1K7SN 2QGFA 2ZI7A 1YDWA 3B2EA 4Q9KA 4YCAA 1KHTA 3KC2A 3ND7A 4YCLA 1KGSA 4Q7KA 1VYHA 2UZ4A 4TUYA 3AZOA 4WN9A 4X7MA 4FSHA 2GKOA 3HKCA 5A6SA 3U7RA 1BXZA 4L9SA 2EF1A 2YHUA 1O8CA 2RH5A 1M6VA 1R0KA 2GM9A 1E99A 3RU2A 4JBHA 4BVKA 1VLMA 1N5JA 4LCBA 4PYMA 4YPVA 2DULA 3OSZA 2HXYA 2IPLA 4MWGA 4QTUB 3QXHA 1EP3B 3L9WA 1PW7A 2PJRA 3WAGA 1GDHA 4LCEA 3F8SA 1W7AA 3JYHA 1FZQA 4CG1A 4PLPA 3A2KA 3MGBA 2XTZA 2ZUFA 1PUXA 4FMDB 4HN9A 4E5NA 2GCOB 2QSJA 3KPUA 2X7XA 3FFBA 4Z4FA 1AX9A 1QWOA 1JE0A 1VRVA 2CVOA 3E84A 3ZG6A 1B8UA 2WQ7A 1NSFA 1KZ4A 2BFCB 1B8OA 3L7AA 2ZJYA 1P2DA 2QUKA 4EI7A 4MPPA 4PVCA 3STTA 1G38A 1BAPA 5KKNB 4WTOA 3CSSA 4DLVA 1ZJ4A 5IBPA 4C07A 3MMXA 4QUEA 3EXG1 3HP4A 4ENQA 4ZN6A 1YQXA 4KVZA 4GYJA 1NUAA 1P72A 3OZRA 4M2LA 2XT0A 3BEOA 4V03A 2ZDQA 4L3VA 3RIYA 3TOCA 3VR3D 4BY9E 2R3SA 2Q2OA 5BYKA 3K7EA 1GNQA 4NVRA 2E9SA 1E1RD 3T4EA 2VRWA 5G53C 2WD9A 2IE0A 2VXYA 2IEGA 2ZSIA 2CNBA 4YGXB 1E89A 1CRWG 1P9NA 4UTRA 3O31A 2XJ9A 1ZD9A 5HS6A 1D1QA 4UU0A 3QOFA 1YUBA 3ADBA 1Z5VA 1HO3A 2OK7A 4WJKB 2JAQA 2EEZA 1UIRA 1LDEA 3MOGA 3ITNA 3HYTA 4MH0R 4BWFB 5F7OA 1VJGA 3LLSA 1YI8A 3Q8WA 4DNXA 3I9V6 1MFZA 2P41A 4MYRA 5EJEA 2J5RA 3JARA 4OU4A 1FP6A 4RLQA 2OWEA 3QKRA 3UKJA 4X6YA 4W8HA 3P9ZA 1JG2A 2MYNA 3IR6A 1GQ2A 4R1SA 1PL6A 4WCFA 2YTZA 3AMVA 2PL5A 1FDOA 2CXHA 2IOHA 1G8GA 1QAQA 2RJNA 3SZOA 5AUPB 4E2XA 1W5TA 2VQDA 2AC7A 5BRNA 3LSTA 3OETA 3UAXA 1R12A 2B3DA 1XJWA 3S5JA 1YQWA 1CUZA 3F78A 1INLA 1PK7A 4FQ5A 1UMBB 4WOPA 4QUDA 1Z08A 1KEKA 1BCSB 4LDZA 3LPDA 4JJIA 2F4VB 4NDNE 1ZIYA 5K51A 5BWBA 3WGZA 2FSFA 1T5BA 1WP9A 1GT6A 3KT8A 4B85A 3IP3A 1DTEA 3V9PA 1KH2A 5JDIA 4KFUA 4RKEA 3GN2A 3GYBA 3NP7A 3RF6A 3F6BX 1GU1A 4DBLC 1NOIA 2EKQA 3DR5A 4OF4A 5FQOA 4BKOA 5JPDA 1CEEA 2J33A 3OMXA 5L3QB 1KF0A 3OLVA 1BFKA 3ZWNA 1CPYA 5KJ6A 3SM9A 2ZXFA 3JZIA 3KHUA 2DR2A 2IUSA 4BO3A 2IF2A 3L1VA 3VI3B 2R62A 5TQ2B 4C06A 1J33A 1Q0HA 4A8PA 1QV6A 4BNTA 2BFNA 3A8TA 3KD2A 4BRUA 4A23A 5T5QA 3I2JA 3I62A 4JVMA 5I7WA 2G9ZA 3F2IA 1IVYA 4KUEA 4Z5XA 1P81A 3EZXA 4R0VA 1WCIB 4A82A 2O8CB 4UUPA 2Q5LA 4MDYA 3R4VA 1R8XA 4G0MA 4OFZA 1GL6A 5E9JA 3VGPA 3GUZA 2RHBA 1J97A 2LIPA 1CYEA 1S7CA 4DG5A 3K0AB 1E3WB 4PQYA 1YKSA 3L07A 4S1NA 1C4OA 3NAGA 3DGFC 5F78A 2GYWA 5ALNA 2PUVA 3ZH9B 5EWLA 4QODA 3QJ5A 4OQQA 2VPWA 2AZMA 1SQGA 3V3TA 2N75A 3VNAA 4HFRA 1EIWA 4LECA 1LX7A 1VI2A 5INTA 2EKPA 2G8LA 2ZANA 5TC4A 4FDTA 4J3JA 4UVGA 3N05A 2WJ3A 2CXNA 4XIGS 3U3DA 5LIPA 2R1VB 4C3VA 1E7WA 4OQXA 3CLUC 1JH8A 1GSIA 5F1OA 2CBXA 1U2DC 1C41A 2O3RA 2Y1FA 2XAAA 4OYLA 1KYIA 4P4SB 4QPPA 4TMTA 5HG0A 3Q8MA 2DLCX 3BG5A 1C7EA 3BKWA 3V48A 4P35A 4RJJA 2Q4DA 3AUKA 2ZRGA 3MWJA 2GTPA 3BTVA 4HGPA 2XB4A 4NZMA 4TV8A 5JWHA 1QF9A 4DY4A 5FWNA 1X14A 3H4MA 1Y3DE 3OWXA 5EMJA 4HEQA 3WE7A 2B1QA 3BE8A 4IIHA 3Q85A 3WMXA 2IYQA 5ADWA 1DOHA 2XHZA 1EB8A 3HJTA 4RD6A 2XYPA 3UHPA 2GSDA 3ZS9A 4DLPA 2ZG6A 1O5TA 2WUWE 2YW9A 1YMVA 1ZH4A 2PV7A 4OB6A 4YDSA 4C08A 2QJFA 2DMRA 2QLBA 2ZW9A 4ZOLA 3R5HA 2CJXA 1QRSA 3KDAA 1GG9A 4DV4B 4GPIB 4IDHA 4QOEA 3S2GA 4ZP1A 3VH4A 2JJ1A 1U7ZA 4BNHA 1FYVA 1YRYE 1VE1A 1YQTA 2WJVA 3S68A 4X61A 3VC2A 4CTMA 1S7GA 2QJOA 1YCFA 3PRJA 4NE9A 1UBLS 1YGPA 1A9SA 3PLNA 1NIPA 1EFRD 2AIRA 3JAWB 4N8EA 1AF4A 4NJEA 4QU5A 4F2PA 4L22A 4KFTA 4F9GA 1JT2A 1RT9A 2PTHA 2VWHA 3MTBA 4J0IA 1F1JA 5H7XA 4HDRB 4RSMA 3U3MA 1XN4A 3CTMA 3P0IA 3WLOA 4F04A 3KG2A 5JPIA 5AVSA 3ZCRA 2QNIA 2R6AA 1ZLXA 3DAFA 1RI1A 3GLKA 1L1RA 5FWYB 1VMDA 2ZM6B 4RQBA 2J0SA 3ZHRA 1POXA 2ZJZA 3WP1B 3SXPA 4L51A 3NG1A 2EATA 1PQUA 1F17A 4NBLA 4GQBA 5KCZA 2CMDA 3ITKA 3QKSB 2PN1A 3N8IA 3IJRA 3L4EA 3FYUA 1U04A 2DSNA 2VTEA 4RWEA 5DP1A 3KEFA 5AM1A 3ZIDA 2PXXA 2E5LB 4UC0A 2QRLA 5EZSA 3ZKWB 2PL9A 3B5IA 3E15A 5F98A 2FWIA 1LNSA 5HRCA 4OGKA 1JXAA 3KDSE 2GPYA 2FUEA 5KMGA 5EINA 2AT1A 4YYEA 1OE0A 1W30A 5K8JB 5IS2A 1I4EB 1K3FA 2PRIA 3CKMA 3KVRA 3LU1A 4K9OA 4NP6A 1T8UA 4AMZA 2BKVA 1I5OA 1R8QA 2JFQA 4NYMQ 4XVRA 4YALA 4YB8A 2F59A 5CNJA 4YPFA 3EHDA 4TXLA 2CMKA 5DCUA 1UDAA 5AOAA 5CFMA 1VCIA 3HHPA 2RI1A 3KJXA 4LXXA 3EAFA 4Z51A 1SC1A 1E3EA 3DCNA 4FU0A 2ZOSA 5U4XA 2EBHX 3F6RA 1IK6A 4K9PA 2H2GA 1MAWA 1R10A 3NTRA 2W6IA 4GAEA 5C51B 3DMYA 2GFIA 2PLNA 1QRAA 3A37A 4YRZA 4KFCA 3Q88A 4LY9A 4NOKA 3H84A 2Q8QA 4RK6A 4J07A 1LI7A 1YIAA 1M2HA 2PX8A 3HFSA 4NBKA 1I3OA 3VH3A 1GTSA 3DE1X 4X63A 4YMTA 3BGOS 1IUKA 3RYHB 3T34A 4XJTA 3BD8A 4BO0A 3DMRA 1RLJA 2A1IA 2MYPA 4ZZ1A 3OUUA 1V7CA 1VB5A 4MKGA 4WVFA 2NM0A 5EESA 4QRDA 5AJXA 4IKOA 4EO9A 3SY8A 2G17A 1XMXA 3AHGA 3C1TA 4GE3A 5F1KA 2XUHA 3ROEA 2QTLA 2OXEA 1L6RA 4WKOA 1XE3A 1HORA 1AY0A 2ZJ2A 4B3HA 5HDBB 2QRZA 2RH9B 3HB4X 3IRVA 1UZNA 1JNYA 2RHCA 3TBFA 1QP8A 3A36A 4KIJA 1U4SA 4LJ5A 3DAYA 3IPLA 1WF6A 2QK4A 4J1SA 4QTXA 4G0YA 2AV6A 3HBFA 2H0QA 4AI6A 4UEOA 3L82B 3GELA 4X9XA 3A2NA 3BFKA 2ZUWA 4C4PA 3VKWA 2A9OA 2J3JA 2I1VB 3K0HA 1YA6A 4NE2A 3KEOA 4J1QA 5F1YA 2NSYA 3A28A 1RP1A 2LBPA 1D8TA 2GK4A 2FDCA 1Z68A 2GZHA 2A33A 2UU9B 3HKEA 3KOOA 3R3UA 4KLAA 2OWDA 2BR4A 2GKGA 2ODEA 1X1DA 2YHIB 5ELMA 4DCTA 4CL2A 4JKIA 4JJ7A 4BXOB 2VHZA 3NGMA 5H80A 2DQYA 1YGYA 3TSYA 1EDBA 1A8QA 4GMDA 3IQGX 5EC8A 4IIFA 2QYSA 3O3CA 1EWQA 5CX4A 3K5IA 3U0BA 5IUNC 3L6BA 2BLNA 3COSA 1EXWA 1NVVR 1IJBA 3GVHA 3PE3A 4EHBA 3DEHA 1MB4A 3BDIA 5IDXA 1VP3A 4HB0A 5DM4A 4ZEWA 4M1EA 1MOZA 2Q28A 2WWVD 1IG3A 5CG2A 3UPTA 1YVUA 3T9BA 1Y48E 2FWPA 2WU1A 2IY9A 3EPPA 2Q6TA 1XF1A 4M54A 1HRDA 2IS4A 4PGHA 3X3HA 4D9MA 1T2CA 3OQVA 1T1EA 4C4TA 3F8TA 5HW0A 4QHYA 4BEJA 2O14A 3DXYA 3WL5A 2RFLA 3ZX4A 4B6OA 4DNFA 5JADA 2SCUB 1IHPA 1KGDA 2R1TA 2VJPA 3EIEA 3L8CA 4I1YA 4LMPA 2CLMB 4OJNA 4UQLA 1ECFA 2F7SA 4PSCA 4NHEA 1XYGA 4N5IX 4DMUB 3NCHA 2B37A 1P0CA 2OV6A 2ZJ7A 5DNYB 2ZBPA 3N6RA 1XD2B 5IHXA 2JVKA 2JGMA 4JOSA 4MNTA 4P1ZA 2H0RA 5LZ5A 3VH2A 3GLGB 1XHEA 4ZAYA 3TG2A 1UBHS 1SXGA 2XDWA 5CFPA 1U7XA 3B1WA 4DT1A 2ZJ4A 3TVDA 4CMHA 1BN7A 1NL3A 2VRCD 2GCIA 1W1IA 5TQ0A 1TI7A 1FSFA 1GU7A 2ZUDA 1US8A 3EQ9A 4O0MA 4EX6A 2EKZA 2ZPUA 1VG1A 2X1MA 4HBZA 4OFBA 2MIIA 2TMGA 2YJNA 1QFSA 1PZFA 2YV2A 4JJEA 4CUZA 5K20A 4PLWA 4HSEA 3KOYA 1UKYA 3MTJA 4MGKR 3LTEA 4TN5A 2AN9A 4RH1A 4M1YA 4MJLA 2DX7A 3B60A 3PGVA 1W88A 4CCSA 5GOTA 4K87A 2QRMA 2NXJA 1G3UA 4OYHA 3ZLVA 3OZFA 4RIFA 3R20A 4RM2A 4F2HA 1PG2A 3WL7A 3J81A 2V9PA 2DG2A 2X0FA 2AOTB 1T6NA 3GQBB 4TV9A 2VFAA 2VF8A 1WB6A 1U65A 4R1UA 2YL2A 3KX2A 4G5SA 2FEOA 3GGOA 5FA5A 2A5YB 3G9TA 4B1FA 3M4XA 2OCGA 4PLYA 3GVPA 5LQRA 3GLRA 1LI5A 1P4GA 4FYXA 3OECA 2GXQA 2HRCA 4R6WA 1CDZA 4IJKA 4UUMA 1RD4A 2JIDA 1OILA 1O95C 4Q9AA 1ZGHA 2A9RA 3SBOA 3PPWA 3WA6A 1SXPA 2GAAA 1KI1A 1NXOA 1H0HA 4FDLA 1C30A 4KACA 1NF2A 3Q7SA 4OYRA 2HTFA 1ZFNA 4Q02A 3I01M 3P71T 1QDLB 1YMUA 1GZ4A 1XEXB 3PWZA 1RHKA 4QXQA 3IELA 3VHRA 3WGMA 3IUBA 4KMRA 1NP3A 1O9BA 1OIWA 1GM5A 3DZ8A 1TO1E 1C1XA 1IY9A 1I3LA 2FFRA 3L49A 1OHHA 3MVEA 5JUWA 2NGRA 1DQPA 1UPAA 4B0OA 5KYYB 2GYVA 1YK1A 2JI4A 2V5AA 2ZVPX 3SLGA 1E62A 4F5DA 4ND8B 1KFBB 3I37X 1ENOA 4ZJZA 3FDZB 5BVHA 1O5IA 1RWNA 1DIRA 3UAGA 3AJDA 4L5JA 2WD7A 4NCXA 4AP9A 1YZFA 3I4FA 5IN4A 4PPGA 5DN9A 2GBPA 5A5EA 5K3OA 3EFHA 4N18A 1KOGA 5CA0A 1JLMA 1NKVA 4K46A 4PBSA 1W47A 2HXSA 5EMMA 2JIBA 5LQSA 1KI6A 4M7WA 3TZHA 4LWQA 3ZBUA 1OYOA 2CHUA 3VPCA 3OZIA 4FBLA