5ITWA

Crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
255
structure length
255
Chain Sequence
MIMNLTDKTVLITGGASGIGYAAVQAFLGQQANVVVADIDEAQGEAMVRKENNDRLHFVQTDITDEAACQHAVESAVHTFGGLDVLINNAGIEIVAPIHEMELSDWNKVLQVNLTGMFLMSKHALKHMLAAGKGNIINTCSVGGLVAWPDIPAYNASKGGVLQLTKSMAVDYAKHQIRVNCVCPGIIDTPLNEKSFLENNEGTLEEIKKEKAKVNPLLRLGKPEEIANVMLFLASDLSSYMTGSAITADGGYTAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the influence of non-covalent contact networks identified by charge density analysis on the oxidoreductase BacC.
pubmed doi rcsb
source organism Bacillus subtilis (strain 168)
molecule tags Oxidoreductase
molecule keywords Dihydroanticapsin 7-dehydrogenase
total genus 98
structure length 255
sequence length 255
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.385: Dihydroanticapsin 7-dehydrogenase.
pdb deposition date 2016-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5itwA00
3DMTA 3DAPA 4OQYA 2JAPA 2WYVA 3FWZA 2VOJA 2GZ2A 2WE8A 4CM8A 3GGGA 5JC1A 3EHEA 4CMEC 2OP1A 1X13A 3GN1A 3JQEA 2PLAA 4ZN6A 3WGIA 4ALKA 1ZNQO 3GOHA 4ID9A 4TKLA 5A9TA 3K73O 5HA5A 1T25A 4XCVA 3MCVA 5IF3A 4M8SA 4MINA 1TT5A 4YJGB 3VZQA 4M89A 3QWHA 2VZ0A 5DDIP 1HSZA 2FHSA 3AM3A 1N8KA 2DFDA 2YUTA 3ETEA 1DPGA 3K5PA 1CRWG 3WBFA 1QV6A 1SPXA 1U28A 1P33A 2PH3A 3SC4A 4BKRA 3ADOA 3WFIA 5KCZA 4TVOA 2R00A 5IG2A 1ADCA 3L07A 4GKVA 1YS4A 2E49A 4OSPA 3HDQA 3LF2A 4XIJA 3R3JA 3HJAA 4NU6A 4FBGA 2I65A 3KSUA 5L95A 1I30A 4YB8A 5GMOA 2FZEA 1R0KA 3TZ6A 4NJMA 5GZ1A 1IYZA 3JQFA 3VHRA 2CZCA 3BMOA 1PX0A 2NUAA 3SLGA 3KTDA 3NDRA 3C7CB 4BGUA 2ZB8A 5DBFA 4KP7A 5EQFA 1NVGA 2PZJA 2D8AA 4J91A 1VPDA 2HK7A 1BW9A 1DRVA 2NVUA 2HSDA 1U8FO 1PS9A 5JLAA 1E1LA 4ZRNA 3H2SA 4IY1A 1DIRA 4HKTA 3UCEA 2G5CA 4GX2A 5CAEA 5JAZA 1R0LA 4F46A 5BR7A 2GO1A 5FI3A 1GEEA 1I32A 3LSYA 3RUEA 4KOAA 1CDOA 2C2XA 5L7YA 2GR9A 2Q45A 4LN1A 3K6JA 3QHAA 1C0LA 1E7WA 2ZTUA 3DB2A 4EYEA 4PLVA 1KVUA 1E5QA 3RUAA 3QIVA 4GX0A 4D3SA 3ZDFA 4OL9A 5F1OA 1VL8A 4IDCA 4KWIA 4Z6KA 4P22A 5G2OA 2UYYA 3K96A 4I8XA 1B16A 4UUPA 2DBZA 3FNEA 2ZYDA 4OOEA 4TZKA 4BO2A 1EBFA 4DMMA 1VJ1A 2IYOA 3IQDB 1ZW1A 3L9WA 2GLXA 2AQ8A 4DLBA 4RVUA 4B7CA 5IZCA 4A2CA 5G4KB 1F8FA 1P9LA 3OJ0A 1XGKA 4K9DA 3K2EA 1T2AA 4N5MA 3Q3CA 1QXSA 3S55A 3E48A 4KUGA 4IDAA 2DM6A 2X7HA 4O6VA 4PG6A 4E31A 1CF2O 3NJ8A 3F4LA 1IZ0A 4K26A 3VOSA 1FK8A 4GAEA 4D0SA 1YKFA 3C85A 4N5LA 1ENPA 2O3JA 3HUDA 2DQ4A 4FSHA 2BKAA 1XU7A 3PQDA 1EK5A 1HL3A 5L40A 1C3VA 2VUUA 4XB2A 3EAGA 4BV8A 5IDYA 3ZV6A 2OZPA 2NQTA 3KHUA 2B69A 1TI7A 4CM6A 1U7HA 4B4OA 1PQUA 1GU7A 2R2GA 2W98A 3GUCA 2ZCVA 3DXFA 2FSSA 1P77A 3GFBA 1WDLA 5BNTA 4FPXA 4WJZA 4DPLA 4FDAA 1KC3A 4NPCA 3FD8A 1H6DA 1RKXA 5JO9A 3FBGA 1XSEA 1PJBA 2Y0DA 4BKOA 2WM3A 3JQ6A 3E18A 4UVDA 5ES3A 3QP9A 2X1HA 5TSDA 4RF2A 3T7CA 3VPGA 1FDVA 1RM4A 3C3XA 4B3JA 4IIUA 1QV7A 2G1UA 3D7LA 3CTMA 1HZZA 3M1AA 4NMHA 4DQXA 1LJ8A 3H9UA 3BMCA 5C7LO 5A03A 3WIEA 4CUKA 1UH5A 3IP1A 3QVOA 3T7EA 2EG9A 3IKTA 1P1FA 2C59A 1MUUA 1EEHA 1GY8A 1NFQA 3PYMA 4Z0PA 1TT7A 5U9CA 2BFOA 2DT5A 4MVJI 3D4NA 2WYUA 3P19A 4IGFA 1PS8A 4E2XA 4I9HA 3ZV4A 2G17A 4IDDA 3GDOA 5B37A 1ONPA 3GFGA 1SB8A 1OI7A 1IL0A 2RH4A 3PHIA 4MVJP 3I6IA 4B7UA 4YAJA 3Q11A 3UGKA 1VKNA 3MJVA 2WE7A 1H94A 1ZJZA 4RCVA 5CDSA 2OBYA 4B7XA 1PGQA 2Q1WA 3PYXA 3L4SO 2ZTMA 4AJOA 3WGZA 3O26A 5BSHA 2VHWA 1EK6A 4FIZA 3W6ZA 1BVUA 2HMVA 3IUPA 4XDYA 2V6GA 4XYBA 1E92A 1O89A 2ZTLA 4OIMA 3WOHA 5JXWA 1O8CA 1D4FA 2AHRA 5L4LA 3E8XA 2AG8A 1VSVA 1O95A 2X58A 1NVTA 4I9UA 2C2YA 3BYZA 4TRMA 2ZQYA 1X7DA 4CR8A 3NEPX 2FOIA 2P5YA 2QG4A 4BHTA 4RLSA 4I5FA 3UN1A 2BFAA 5CEEA 3IAHA 3G1TA 1Y9AA 3FN4A 4YJHB 4JNKA 5KIAA 2IXAA 3NTRA 1QYVA 4YAKA 8LDHA 5G0WA 1CIVA 1A7KA 1QLHA 1DO8A 1S7CA 1YB5A 2B35A 2H63A 4JJFA 3DZBA 3NT2A 3JYNA 1DDOA 1N2SA 1XYGA 3W4JA 3S2EA 1LU9A 2VYVA 3CINA 5AOVA 3PZBA 4A73A 4JROA 2HRBA 3M2PA 3C1TA 4U8GA 3SX2A 3TQHA 1ONNA 1OBFO 3PP8A 4GH5A 4MIOA 2B5WA 3WIDA 3JQ8B 1X1TA 5JW6A 2VRCA 2VUTA 3MTGA 3ZWOA 4BMSA 1ENYA 1RM0A 3RFTA 4U0KA 1ADGA 4PRLA 4E30A 2OHXA 1E1MA 1YXMA 1UZLA 3ZWCA 1WDMA 3E03A 1QYCA 3ZHYA 4QXMA 4KWHA 3ROPA 3H3JA 3EK2A 2WEKA 3EVNA 3WSVA 5TF4A 4P4GA 7MDHA 1TA4A 2DBQA 3PJGA 1ZXBA 2OBNA 2PGLA 2WDZA 4MP8A 4E33A 4R16A 3VDQA 4DRYA 4LSMA 3L4BC 1OOEA 5JNLA 1Y9EA 3QWFA 1IB6A 1HDCA 1P1JA 1G6KA 2P4QA 2ZKLA 1PIWA 1E7RA 2YJZA 3JSAA 5BSEA 1A72A 1PGOA 4BNZA 2O48X 4RQUA 3G49A 3FHLA 1E6UA 1RPNA 1B8VA 1NX6A 3AOGA 1MFZA 3OJEA 3QWIA 1R4MA 2JFFA 2AW5A 1KVRA 3RUFA 1VSUA 4Q3CA 3R1IA 1DIBA 1WVGA 4YRDA 3E5MA 1ONOA 3NT4A 4W4TA 3ZN2A 4ZICA 2BMAA 4GWGA 3AY3A 3PQEA 4ZQEA 2BHLA 1IULA 2J3KA 2O2SA 3DDNA 1NQOA 4R41A 2IZZA 4DREA 5ENDA 4PLTA 2DPGA 1I0ZA 1MFPA 1VJTA 2YV3A 4WNCA 4R68A 2B4TO 3W6UA 1KYQA 1B3BA 1ZEJA 1KERA 4IJKA 5LC1A 1DAPA 4Q3EA 3GA0A 1T1RA 2D4AA 4RVGA 1KEPA 4IDEA 1EUDA 4A7PA 4CM9D 1PQPA 1QORA 3LC7O 5EQDA 2VYND 2JFGA 5DOVA 4DIBA 2X9GA 2CSUA 2WD7B 2C5EA 2JD0A 3KYDA 2Q1TA 4BMNA 4CODB 3WTBA 1TB4A 3AUAA 1GQ2A 4RZIA 2RHCA 1ZSNA 1T2DA 5TGDA 5JO0A 4L4XA 1UXGA 4WK6A 2F1KA 5TJHA 3GEMA 3Q0EA 4CM7A 1IHYA 1GCOA 3GH3A 5KVVA 3KOUA 4AJHA 1G1AA 1T1SA 3KYBA 2NTJA 1RWBA 4WPGA 1KOLA 3RC2A 3I3OA 1NBOA 1YH3A 1EBUA 4E12A 2D5AA 3FSRA 1AE1A 5JYEA 1LRKA 1MGOA 5FWNA 3DBLA 2PH5A 1FDSA 4XGIA 4XEHA 1HDXA 3KSZO 3JD2A 1QSGA 4XZ3A 1SO8A 4D46A 4EUFA 1NPDA 3OIFA 3DHNA 2UUOA 3I83A 2HCTA 3U4DA 2HO5A 4EEXA 1R4MB 5DCUA 4P8RA 2B83A 4M87A 5EERA 4GX1A 1EVYA 5I9LA 4G81A 4QUKA 4HFMA 4E4YA 4AJNA 2JCXA 2Q4BA 2EF1A 3D4PA 3EZLA 4XQGA 3U4CA 1EUCA 5KVQA 5L53A 2LDBA 4NBVA 3ANNA 1SCUA 4Y98A 3ZHXA 1EQUA 1PJ4A 1BHSA 3RBVA 4OYRA 1TLTA 2DUWA 4RV9A 3JQFC 1ZK4A 5JAQA 3WSWA 4LCEA 1LLQA 4WLEA 1I33A 3JQBC 5THKA 3ZWYA 3DOCA 3KRTA 1CQJA 3DR3A 3RU7A 2VZ9A 3BMOB 4I08A 1H0KA 1BXGB 4YTEA 3NTOA 3C24A 3HDHA 1PJCA 4RPGA 5G4LA 4NK4A 5ILGA 5KVSA 4BO4A 3E1KA 3I9JA 1KY5A 1U3TA 4GX5A 3ORFA 2V6MA 1Z75A 2YDXA 3INTA 4UVGA 5IFLA 4XDZA 1U1IA 2I3GA 3JQCA 2WWRA 4GLOA 4Q3BA 4LRTB 1U8XX 2YHUA 4W82A 2RHRA 3I5MA 4HXYA 1GEGA 4NH4A 3VDRA 5JDIA 1V9LA 3OJLA 2BI8A 2DLDA 1E77A 5GZ6A 3HE3A 3WTCA 3U4IA 5TT0A 3BTOA 4XR4A 3EY4A 4Q3NA 2IZ1A 3DO5A 2I67A 4BQPA 3RI3A 2PWZA 4DQVA 1HKUA 1KETA 4IJUA 1JVSA 1YOVA 4BB5A 3KYCB 4XJSA 1UJMA 2G0TA 2GRAA 2EERA 4DGSA 2Q50A 2Y0CA 1LQUA 5A02A 1YGYA 1WXDA 2BGKA 4XRGA 1YOVB 3PJEA 1K6XA 3UUWA 3UHAA 4EBFA 3CH6A 1HRDA 5ADHA 1DLIA 1ZMTA 4PZCA 2O3TA 1LLCA 2FRDA 2IRWA 3B20A 2A35A 4CLOB 1AXGA 2JCYA 4KTTE 1W4ZA 2B4RO 3DZKA 1DFIA 5ITVA 1J6UA 5I7EA 3GUYA 4BV9A 1E0DA 4W9NA 4C7KA 2C20A 5IZ4A 1PZHA 2DAPA 4MVJM 5DZSA 1FJHA 1P1RA 4L4SA 4EUEA 4MVJA 4W9NC 4YQZA 4IS3A 2D5CA 1D1TA 3ADPA 2X4GA 1Z45A 4CM1A 3CEAA 1GYRA 1NPYA 2FPPA 2ZYGA 3GPDG 4CLRA 1PR3A 2B37A 2YDYA 3C7DB 1UP4A 3WYBA 1I2CA 1O6ZA 4BKUA 2Q46A 3MEQA 4FOOA 3ASUA 2Q1SA 2VHVA 1DHTA 2LDXA 3D3EA 4JP3A 3WS7A 4AJKA 3ZWPA 4C7JA 1OFGA 4YT8A 3RFXA 1C1XB 1G0NA 4MVJE 1GTMA 1UDAA 2DBVO 4J43A 1UXJA 1ISFA 1U3VA 4NDNE 3P2OA 4WLVA 2BFPA 2NQ8A 1KEVA 4AVYA 3JV7A 1UAYA 4HADA 4Z9XA 5T64A 3WQSB 1E7QA 2B0JA 3RD5A 4OH1A 1UR5A 3IMFA 1W73A 1Y81A 2WSBA 5KJEA 5BSFA 4GI2A 2PGDA 2YHIA 4BOYA 1NXQA 3GNSA 1IOLA 1EVIA 2NTVA 5L45A 1Q1NA 3ZNQA 2DBRA 4FFRA 1SBYA 4H3VA 1MV8A 1HE5A 4XGNA 1N1EA 2WD7A 4FOSA 1LI4A 1ZBQA 1R4NB 1BMDA 1C1DA 1HYHA 2HMSA 3LLSA 3TZCA 4I9NA 5EL0A 1YBMA 3AI1A 4PG8A 2DFVA 4PZDA 1E3WA 3ZWNA 3AI2A 4J0EA 1JKJA 3G1UA 3OF2A 1YL6A 3OQ6A 4PFJA 4R01A 4UREA 4CLEA 3NDIA 2WD8A 1C0PA 3I23A 3OA2A 1GQYA 5ER6A 1WAMA 2CD9A 1B8UA 4BUCA 1PWZA 3BXXA 3H6KA 4LISA 3W4KA 4DPMA 1R6DA 2EIHA 1Z74A 3WGYA 4L0QA 1ISMA 2AEJA 1YRLA 1U7TA 4DVJA 1PTJA 2R6JA 5I7SA 4J4TA 4CMJA 4LMPA 1XEAA 5BT9A 2I76A 4WLUA 3H65A 2O23A 1DC4A 1NAIA 1HTBA 2RBEA 2R00C 4OXYA 1L1FA 1JDJA 1GR0A 3MWDB 1PGPA 3PVZA 3I52A 4DYDA 3AOEA 4K28A 1EE2A 2QRJA 3WXBA 2EV9A 2HLPA 1QRRA 1T24A 4J90A 4PLFA 1ENOA 2EJVA 1RYDA 3AUTA 2Q1UA 3WG9A 1EVZA 3B1JA 3RASA 2WYWA 5A06A 4NI5A 3GRKA 5TLSA 1L7DA 1MC4A 1XIVA 1Y5RA 2AXQA 3ASVA 2UAGA 3DC2A 3QA9A 4HP8A 1OC4A 3QWBA 3JQDA 1O9BA 1X15A 2CUKA 3ITDA 2EWMA 4OQZA 3DTTA 5IAAA 5IDXA 1LLUA 3V1YA 1DB3A 5K0ZA 2IYPA 3KVOA 4Z0TA 1NHWA 1NVMB 1PS0A 1VE9A 2QW8A 3K8ZA 4EW6A 3H2ZA 2Y0EA 4XGKA 4PN3A 2BI7A 4BKPA 1BXZA 3FR8A 5I8ZA 5A04A 4TQGA 3UFXA 3RUDA 1ISGA 2GN8A 5AXAA 2EP5A 5AXDA 1PJTA 3LQFA 5CPBA 2DTDA 2ZJ1A 3ZI0A 2X9VA 3GY0A 4YAEA 1YB4A 1RM3A 2FZWA 5A3JA 4RPLA 5FEUA 2I99A 2P68A 3D5QA 3O38A 3OMLA 5KJ1A 4PIVA 3C1AA 3GK3A 3WYCA 1V0JA 2PR2A 1ZO8A 5JFOA 2FMUA 5TQVA 3LLVA 3MJSA 3B6ZA 2JFHA 3TOZA 1H2BA 2EW2A 2VHYA 4YWJA 2JL1A 4IQ8A 1BDBA 4NK5A 4UEJA 5T67A 2VNAA 2O7SA 2Q49A 4AICA 2OOSA 2PZLA 4IIVA 4ESOA 4PLZA 4I1IA 1HZJA 1PJ2A 5LDHA 1UDCA 3DZFA 2JKVA 4PLCA 4IDGA 1VC2A 3GVCA 4Q39A 4CV0A 1NNUA 5JCJA 1NTOA 1WWKA 2GN4A 1D3AA 1CWUA 2CF5A 3RBXA 1T2CA 3H3FA 4CQLA 3UAGA 3CE6A 2RCYA 1N92A 1V3UA 4NFSA 4BO9A 4CM3A 1CQIA 4II3A 1O94A 4OOFA 1X0VA 1ZIDA 3JQGB 2VT3A 4PGFA 3DBHA 4L76A 1HLDA 4DQUA 4RDHA 1E7YA 1I3MA 2O7QA 4L8VA 1PL6A 3HZZA 5JDCA 4MPDA 1UDBA 5J23A 3KYDB 1L7EA 4QSMA 3F1KA 5I8WA 2IODA 4IMRA 1K89A 3WBBA 3GZNB 4BGIA 2IEBA 3GAFA 2C7GA 2EP7A 2E6UX 4WOJA 2C5AA 4QX6A 4RLHA 5H82A 2Q2VA 2V6BA 2PNFA 5L51A 1TT5B 4RVHA 4YJGA 2O4UX 4DIOA 1I2BA 3KBOA 3JTMA 5ENVA 1DC3A 2PA3A 3OFSA 4EEZA 3LC2O 1CJCA 2Y99A 1A7AA 1CEQA 1F12A 5KJCA 3JD3A 3I9MA 4GGOA 4RVDA 4YQYA 4DXHA 4E5MA 1XLTA 3QLJA 4X54A 4YVFA 3BA1A 4DWVA 3OM9A 3IP3A 3UOGA 5TX7A 2P91A 2GSDA 2JD1A 3I4CA 3KYCA 4BNIA 1ML3A 5CHEA 2W2KA 1UZNA 4I5GA 3TFQA 4CMGA 4UULA 3A1NA 4FGWA 3V2UA 1MP0A 5FFFA 3ZGYA 4CM4A 2DC1A 2O3UA 3AM4A 4CV1A 2C54A 4OM8A 4C4OA 1H6BA 1DLJA 1E5LA 5EN4A 2SCUA 1B14A 1XHLA 2OORA 5DN9A 1Z73A 2Z5LA 4MVJH 4GPD1 2V65A 4R1SA 5JY6A 1MXHA 2BGLA 4NBRA 1DIGA 3A14A 3MJEA 2QYTA 1B26A 1I24A 4H16A 5HRUA 4HBGA 1EZ4A 1EMDA 3NJ4A 2C29D 5AXBA 3DFUA 3WFJA 3P5SA 3FNGA 4R1TA 5TC4A 3ZWVA 1J49A 5ITWA 2CMDA 2VHXA 3AY7A 1TXGA 5EMHA 3NDJA 5JAMA 5IDQA 2GASA 4QTZA 4RQTA 3K30A 3L0DA 2ZJ0A 4NU5A 3OQBA 3O03A 3I9LA 3CIFA 3TJRA 2W90A 3VPFA 1W8DA 4CMHA 4IS2A 3HDJA 4WECA 1R15A 4FD3A 5JY1A 1XQ1A 1D7OA 1DC5A 1MA0A 5A9RA 5G0VA 2FR0A 3F46A 4IDFA 5G0TA 5JPIA 2YQ4A 1H5QA 2C07A 1T4BA 3ZU2A 4CMIB 3WGGA 3GZNA 3AI3A 1B7GO 1AHHA 1NR1A 5LDGA 4IZIA 4YT4A 5EPOA 3GG9A 1EFLA 4HV4A 4YJFA 3GR6A 2CDCA 1Y5MA 2PKRA 3QJ5A 1U3UA 3M2TA 4FFMA 2J3HA 3GQVA 2HDHA 3EMKA 4RORA 1U5AA 3DOJA 1JQBA 3OSUA 4Y6PA 1SEPA 4PVCA 1LDEA 3L6DA 5CPFA 1LDGA 2J5RA 3HNPA 4CMAA 4YCAA 4DLAA 4Y6RA 3HN2A 2Y68A 3KM0A 3LDHA 4MKRA 4QFCA 4LCJA 2X0IA 2P9EA 5I7VA 4ALIA 4RPHA 2AQKA 4M86A 1KC1A 3JQAA 4WCFA 1GD1O 1PEDA 3DONA 2JAHA 3MTJA 3HDYA 4N7RA 4NBWA 1QLJA 4WCFC 2A4KA 4GMFA 1A5ZA 1GUFA 3IJRA 3HSKA 4BVAA 1YDWA 1ADFA 1DHRA 4U0JA 1IPFA 4WLNA 3JCZA 3VAZA 2BRUA 4BGEA 1M6HA 2FWMX 2YZ7A 3BZUA 4JN6B 3U3XA 1EDZA 4PCVA 1XDWA 4Z0HO 2FPGA 4GVLA 3VTZA 4ZVVA 3KV3O 3R3SA 2GN6A 5DT9A 2X0NA 3DMYA 3FR7A 4L74A 1Y1PA 3NUGA 5MDHA 3WWYA 2X0JA 1XG5A 4JP2A 1PL8A 1Q7GA 1E1NA 1C1DB 3LF1A 3IKVA 4IJWA 1PZFA 4TRRA 5KJFA 3A28A 5GY7A 1EQ2A 4AJ2A 1N7HA 4NIMA 5A5EA 4YDRA 4DC0A 1LEHA 3MZ0A 2J5KA 4FS3A 3LVFO 2CFCA 1R37A 3I9OA 2ZCUA 2VNSA 4DC1A 1S6YA 3PHJA 4P38A 3PLNA 1XKQA 2OXIA 4R69A 2E82A 2AEFA 2NV6A 4JJIA 4MKZA 2QIOA 1LSOA 5AXCA 4CMKA 1ISHA 5DCYA 1SB9A 1YO6A 2FPIA 4URFA 2X6TA 1PJLA 1W0CA 3DWFA 3FBTA 4MVJG 4KUHA 2XOXA 4WEOA 2DTXA 2ZB4A 4ZRMA 3HHPA 1LTHR 2J6IA 2B4QA 5A9SA 4N18A 1IY8A 1DXYA 3H7AA 3JYPA 1V3VA 3QVXA 4JXKA 8ADHA 3GF4A 3ZU5A 3K92A 1E3SA 2D0IA 5B1YA 2DKNA 4YBZA 4IGEA 3RSHA 3W1VA 2HMUA 3WLEA 1LC3A 2Y1GA 4XR9A 5G4KA 3VVCA 1PZEA 3OETA 1Q7CA 2QRLA 1PJ3A 3ZHBA 1U2DA 2IXBA 3WMXA 4XJTA 4BO5A 1WPQA 4DMLA 3GDFA 4EGFA 2HK8A 1TEHA 5C37A 3UICA 3RC1A 4CMCA 1RM5A 1ZSYA 3MOIA 4A26A 1T26A 4KQXA 2HKIA 1DFGA 5DP1A 4PG5A 1C14A 1I3KA 1QG6A 4NQZA 2G76A 4EDFA 5C7IO 2QZ9A 3Q6IA 1Y8RA 4CR6A 4E5KA 1F06A 1HDRA 3F1LA 3JQAD 4XKJA 4BNHA 1Q7BA 4E5YA 3S1LA 4O59O 4YT2A 9LDBA 2QRKA 5IXSA 1GUYA 2FSVA 4D79A 1NP3A 1LLDA 2Q4EA 3NKLA 1DRUA 1DAOA 3MJ4A 4HNGA 1JTVA 4XA8A 4J1TA 2YFQA 5KWEA 4Y8VA 3FTPA 1EE9A 3ROQA 4J7CA 2RAFA 5HS4A 3K31A 4HY3A 4B79A 4OSOA 4JGBA 3U9LA 6ADHA 4W7IA 1JN0A 1GV0A 4OKNA 1A4IA 2IZ0A 3C1OA 3TL3A 3H8VA 4D41A 5BNIA 3DAFA 3Q1LA 4D43A 3EDMA 5T6BA 1H9BA 1O5IA 2BLLA 4YA6A 4JBHA 4NBUA 5B4UA 3VVBA 1BRMA 3BMNA 1I36A 2GERA 3BIOA 1UXHA 2D2IA 3VKVA 4BO3A 4F6CA 2YFHA 4YAGA 3CSDA 4RZHA 4CM8B 3O9ZA 1QP8A 3DBRA 3JYLA 1M2WA 1SEVA 2RH8A 3BHMA 3KEOA 4E5PA 2EGHA 4CM4B 3UKOA 1MLDA 2Q2WA 4J2HA 4AJ1A 2FP4A 1ZSVA 3ANLA 3ICPA 3VPSA 3D3WB 4CQMA 1C1XA 3N7UA 2X5OA 1FF9A 3GHYA 2DPHA 1D1SA 5K6AA 3RUHA 1EFKA 2Y1EA 3UXYA 3RUCA 1SOWA 4CLOA 4DBVO 3PQFA 3ZWAA 1LSUA 4R5MA 4BO6A 2GCGA 3QRWA 5F1PA 1P0CA 3GEDA 4JLWA 4J3FA 5COQA 4ND3A 2VWGA 1KBZA 3PPIA 2O3QA 5T5QA 1NHGA 3G3EA 4TMFA 4BNLA 1W6UA 1DSSG 2AE2A 2HK9A 3D5TA 3O4RA 3PHLA 3QY9A 4WE3A 4CUJA 1NYTA 2O3SA 2ZB3A 1ZK0A 3DZIA 4J7XA 3GVPA 3OBBA 3FWNA 3HG7A 5EINA 5TJ9A 3VPHA 3SVTA 3W8EA 1RJWA 3UVEA 4P4LA 3O8QA 4WNIA 4KZPA 4P4NA 1ZK2A 1JKFA 2NVWA 3DL2A 5DULA 4E3ZA 2GNAA 2PD6A 3BTSA 3A4VA 4Q3AA 1QYXA 4IJVA 2NM0A 1ZK3A 3ZWXA 5K6AC 1R66A 4YXFA 4NBTA 3ONFA 3EZYA 2JHGA 3C7AA 3AFNA 1Q0LA 4A10A 1R16A 1X14A 3DFZA 4J9UE 1Z7BA 1KVTA 3CXRA 2O50A 4WOKA 2NWQA 4ALMA 3R6DA 4Z3KA 3NRCA 4LW8A 4QFDA 1B2LA 1V8BA 1XELA 3UH1A 3W8FA 5KKAA 4FFOA 1E6EA 4G5HA 4XIYA 5JDIC 2PGJA 4QEDA 4AJIA 2PZMA 4YR9A 3RCBA 1KY4A 3OH8A 5ICSA 1XA0A 2I66A 2ZK7A 5EIOA 1IPEA 1X0XA 4FCCA 4AJPA 3LT1A 3Q2KA 2EXXA 1JLLA 3OQ1A 1U3WA 4CM5A 4D44A 3PTZA 5H83A 3G17A 1XWFA 3FNHA 3PGXA 4I5EA 4Q3DA 1T4DA 1AHIA 4WASA 3F47A 1ISIA 4F45A 3WB9A 3Q9UA 3KETA 2Q99A 1AGNA 1HE3A 1R4NA 1E6WA 2W2LD 3DTYA 1I10A 4E6PA 4FQ8A 1X1EA 2CDBA 2CNBA 4PLHA 3F6YA 1SAYA 3DQPA 4J7UA 3WYEA 1WZIA 3B1KA 5DF1A 2FR1A 1DFHA 1WP4A 3FPLA 3OEWA 3PEFA 4B4UA 5JYDA 1I8TA 2CF6A 4OKIA 3VTFA 3FPCA 3PLRA 3E9MA 1GYPA 3ZCXA 4ITUA 1ULUA 4OJNA 1LXCA 3ZZNA 2H1SA 5ILOA 3MOGA 1G0OA 4OMUA 3WICA 2BELA 4JK3A 4NNJA 4PZEA 4BQRA 4UUNA 3V8BA 1PR9A 5AVOA 4L75A 2CY0A 4CM9A 4MOWA 2JCVA 3AFMA 2VWHA 3WMWA 3SLKA 2VOEA 1SNYA 2EEZA 4YACA 2A94A 2BFMA 3GMSA 4B8WA 2NNLD 2W2LA 4E2WA 2Z1NA 7ADHA 1LA2A 2EKQA 5K9ZA 1A27A 5I9MA 2HU2A 4L4RA 1I5RA 4JBIA 1K2WA 4FFPA 4U7WA 4TSKA 2I6TA 3C8MA 1UXKA 1GZ3A 1JU9A 4NJMB 5G0UA 4BKQA 4DLLA 2X9NA 1MXFA 4GQAA 4CLHA 4O63O 5JCJD 3N74A 1NPTO 2W8ZA 2GN9A 1Y8QB 4HFRA 2Y93A 1I01A 1UXIA 2QHXA 3KO8A 4G2NA 3ANMA 5HTOA 1HYEA 1GQQA 2I5PO 4BNGA 3AM5A 1HDOA 2XXJA 2VTDA 3JQ8A 1BW9B 1A71A 1P74A 1WDKA 1V35A 1NWHA 3AOEC 3CPSA 3E82A 3PWKA 1JAYA 2IEDA 3QWAA 5IXYA 4CMEA 4FFNA 4XQ9A 3OEYA 4JJGA 4GWKA 4D7AA 3D1LA 3TOXA 1GPJA 4W7HA 3IDSA 1DOHA 5TRTA 4BNTA 3ZWMA 1ULSA 1XR3A 3JQ7A 1D8AA 1VM6A 2NVBA 2J5QA 4YPOA 3TSCA 4H7PA 4BNMA 2ZB7A 1ZXLA 4DIFA 3KEQA 4CR7A 4YEDA 4O1MA 4QO8A 3VZSA 4JIGA 3AUSA 4XRRA 1M66A 4TRNA 4OGWA 3FNFA 2GDZA 3BHJA 1YJ8A 5DBGA 1Y8QA 5GZ3A 4W99A 5JC8A 4E5NA 5I9NA 4DYVA 1HSOA 4GVXA 5THQA 3MJTA 2OUIA 2WTBA 3HFGA 3QV1A 3OJFA 4KMSA 2PTGA 4BNVA 5ER9A 1AUPA 1Q2XA 3VC7A 4E21A 1SOVA 2DU8A 3FCOA 4JBGA 3WGQA 4RJTA 1NQ5A 2BH9A 1BTOA 3PRJA 3B1FA 2D1YA 4XX0A 2VYVD 3LU1A 3Q9NA 3GPIA 3S2IA 4LVCA 1H93A 3COSA 4GSKA 5B12A 2HJRA 3GGOA 1ZFNA 2Y67A 2CVOA 4YYZA 1LUAA 5KVCA 4ROSA 3IOYA 4M49A 3VKUA 4A27A 4BO8A 4UAGA 4HNHA 2PKQO 4UVHA 4U5QA 3OP4A 4IXWA 4ND5A 1YB1A 1N5DA 3K9QO 3BTUA 1H6CA 1BGVA 1IZ9A 3ZWBA 4OXNA 4DTIA 4ZJUA 1NR7A 1ZK1A 3H5RA 1ZZEA 2EJWA 1ZKMA 1NM5A 2Y1OA 3BMNB 3E9QA 4LMRA 5U1PA 1GCUA 4CV3A 3GGPA 4E2ZA 3BHIA 4YAIA 5DCWA 3DHEA 1YQGA 3GRPA 2VWPA 2GGSA 1B15A 4IINA 3ZH2A 3H4VA 1DEHA 3IS3A 3PJDA 1U4SA 4FJ0A 2IE0A 3SC6A 3SBOA 3RKRA 3IC5A 1GPDG 4RF4A 3LT2A 3RWBA 1PQWA 2P2SA 4MJLA 3ABIA 2NU8A 1TVEA 3ROKA 3X2EA 4B3IA 4CJXA 1U4OA 4PLWA 4FB5A 1EVJA 4PG7A 3WDSA 3U4HA 4S1VA 1BSVA 3E9NA 2RIRA 5IN4A 3PHGA 1YBVA 1YWGO 2PV7A 1YVEI 4B4VA 3V1UA 3QVSA 2AA3A 4PLGA 4FC6A 3ONEA 4XYLA 4DBZA 3JD1A 1DIAA 3GDGA 2VZ8A 4J1QA 4BIIA 3NTQA 4IDBA 4INAA 4IMPA 4KDFA 4J6FA 4IZHA 1M67A 4CL3A 1RYEA 1YBAA 2Y05A 2E37A 1A4UA 2IDZA 1ZVMA 3GAZA 4B4WA 5KKCA 5L3ZA 4CPDA 5CDTA 3F5QA 3GLQA 3DBVO 4UVIA 4A03A 2V7PA 1P44A 3L9XA 3W8DA 3DZJA 1ZEMA 1F17A 2PD3A 2OP0A 3EGOA 3QSGA 1E3WB 1NASA 4MDHA 2C0CA 5EJ2A 3PJFA 3GVHA 1H2HA 3EC7A 3JQGA 1PZGA 2ZATA 4TROA 5T57A 1ADBA 1MG5A 2QQ5A 2C7VA 4NG5A 3LK7A 4XYEA 3PWSA 1DIHA 1IHXA 4FGSA 4MP3A 3F4BA 2AQHA 1LNQA 1NFRA 2VT2A 1EUZA 1VL0A 2XXBA 4EJ6A 4BL5A 1E7SA 4WLFA 3JYQA 3L4BA 5AQ1A 2X23A 3U09A 1PGNA 4Q9NA 2TMGA 1B8PA 3TDKA 1N9GB 4I5DA 5C3MA 1P3DA 2BGMA 2PK3A 1F0YA 3ZNPA 3NYWA 4IM7A 2GUGA 4KUEA 3IJPA 2J8ZA 3WGTA 4ZQFA 2PFGA 1Z7EA 2EKLA 2EGGA 4J1NA 3ST7A 2PD4A 5A3VA 1K0UA 2FN7A 4BO1A 3NGLA 4XD2A 3DZGA 1UZMA 5L4NA 4BO7A 4UUOA 1M6WA 3NX4A 1LSJA 1ZUD1 1I2ZA 3A9WA 4QT0A 2H9IA 2J3JA 4FR5A 4B8ZA 2Z95A 3DBRB 4LSWA 1NAHA 3CMMA 2DTEA 3KZVA 4WCDA 3TNLA 3H9GA 3DOOA 3TL2A 4JCOA 2WMDA 3PFFA 1JKIA 1WW8A 3HADA 3RUIA 3GVXA 3P7MA 1DJQA 3LZ6A 2ZIZA 2NADA 3FF4A 2ZTVA 1U9JA 4EITA 3GC6A 3BMQB 5A1TA 4HX5A 3VH2A 3STHA 2X0RA 3LT0A 4BS9A 1BG6A 3AUUA 3ZW9A 5B4VA 4E0BA 2PKQP 2ZYAA 1LDYA 1HT0A 1HYGA 1N1GA 4U6QA 1WMBA 5IDWA 5COAA 5CP8A 5A5FA 3QVWA 1LC0A 4N54A 3WJ7A 3GT0A 1PGJA 3PI7A 2NVUB 3PK0A 1V6AA 4J4BA 3F5SA 3JQ7B 1LDMA 3ZW8A 5L4SA 3I6QA 1AXEA 3BMCB 1E3IA 3MJCA 5L7TA 4HUJA 4MIEA 1ENZA 2UVDA 3OICA 1PL7A 1HDZA 2BF7A 3WNVA 3ZNNA 1KVSA 4ALNA 2YV1A 3OJOA 4WKGA 5KOIA 5JS6A 1PU2A 1KS9A 2OO5A 4J49A 4EJ0A 3ENKA 3JQ9A 4CMIA 3INRA 3TF5A 2ZQZA 3AWDA 3D0OA 1DRWA 4BNYA 3A06A 3ULKA 4PRKA 4TKMA 3TN7A 2QX7A 4E13A 5CDYA 4UEOA 1LX6A 2FY8A 2HUNA 4N5NA 4BNWA 4Y6SA 1O0SA 5F21A 4XYMA 3U5TA 1UUFA 5HM8A 3AU9A 3KLMX 3VH4A 2VN8A 3I9KA 3AK4A 1YDEA 1ZJYA 2Z1MA 3SEFA 1JWAB 1QKIA 2G82A 3P2YA 3V2HA 2AMFA 2UUPA 1X7GA 1I3LA 5BNFA 4L9RA 2NU6A 3U0BA 4BNJA 1LQTA 3ETGA 4M55A 2VQ3A 2VCYA 4DL9A 3L6OO 1K6IA 4D3DA 4UVEA 4D0RA 5DNAA 2P9CA 3SJ7A 1YQXA 1UAGA 3KUXA 2JHFA 3RJ9A 3ETDA 4QECA 4W6ZA 4F3YA 2OFPA 3ICCA 4AL4A 4DUPA 2POQX 3SJUA 3DMTC 4ALLA 3HN7A 4R1UA 4RF5A 1E3JA 3Q2IA 3RU9A 2CVZA 1ARZA 3OECA 2NSDA 4BNKA 4XQCA 2VYNA 3OIDA 5I7FA 4DPKA 5JBIA 4PLPA 3CKYA 1DC6A 4BNXA 4GSLA 3PYLA 1KIFA 3U49A 1VJ0A 2AG5A 2XAAA 2VUSA 2D3TA 3IL2A 3WQRA 2Y1DA 2B5VA 1JW9B 3H5AA 4MVJF 2PZKA 4K6FA 2X86A 4GL4A 3PIDA 3WQQA 5T8KC 3L6EA 1FDTA 2DUUA 4R3NA 3QW2A 2GZ3A 3HFSA 2NTNA 5T8KA 1KEWA 4NFYA 3WR5A 5CDUA 4S3MA 2DVMA 3AW9A 4RPJA 4CLDA 1A9YA 3I9NA 2HJSA 4K1LA 2O3RA 4LGVA 4CUZA 1I3NA 3TWOA 3D3WA 3M6IA 3FRJA 5JMPA 4CV2A 1XQ6A 2JD2A 3KB6A 4K6CA 1A9ZA 3IUSA 1P1KA 3FI9A 3CZRA 4BB6A 3CUKA 1M75A 4XYGA 3GVIA 3RIHA 1YJQA 1C0IA 4HFJA 4XWYA 1X7HA 3HWRA 1DBVO 2EKPA 1ZMOA 3WNQA 4EZBA 2Q3EA 5HS6A 4ONEA 3INGA 4YRBA 4R4JA 1J5PA 2A9FA 3NT5A 3PGJA 2YHIB 4ZU3A 4IPTA 4B3HA 1SZJG 4IUYA 3GNQA 1U2GA 1Y8RB 5JE8A 1VL6A 4R1NA 1E7MA 4QQRA 1OAAA 3TZHA 4ND2A 2YYYA 5H81A 2I9PA 1KEUA 4F6LA 5JAIA 1HXHA 4RPKA 3RC9A 1UP6A 3V1TC 1ZH8A 3WJAA 4BO0A 2VRCD 9LDTA 1VRWA 4CQLB 1DJNA 4NR0A 1N9GA 1QYDA 3DAGA 3H9EO 2OL4A 1QMGA 4R5HA 3DZHA 3LC1O 4YJFB 4ZA2A 5IJZA 1QYWA 3AU8A 2YY7A 1HEUA 4ALJA 3ITKA 4J1SA 2C82A 4GLLA 2CVQA 2X5KO 4J16A 4MKXA 1GV1A 4IQ0A 3OA0A 3S8MA 1CYDA 1Y7TA 1J4AA 1YE3A 4RL6A 5G0SA 2BD0A 5HBRA 1HE4A 1R0SA 1Z6ZA 4RVFA 2GPTA 2QZZA 5L7WA 3JQ9C 3JQBA 2XPCA 1FDWA 4O0LA 4IXTA 3UF0A 4ZQGA 1H6AA 5EESA 5JDCC 1H9AA 2P4HX 1E3EA 3HB5X 2V6FA 5TT1A 2HMWA 3LYLA 4NHEA 4BNNA 3ZV3A 5TNXA 4ZQHA 5U4QA 1ZCJA 4R9RA 2GYYA 4CQMD 5COBA 3WLFA 3KLPX 3RKUA 4EI2A 1XCBA 5F5NA 4ND4A 4CLXA 1MG0A 3TZKA 3PFWO 2P9GA 4OXKA 2B36A 1FXSA 3GEGA 4MIYA 1P31A 3K2BA 3I1JA 3BAZA 1GADO 2JJYA 3EW7A 4QO7A 1PWXA 3EYWA 5F1KA 2EW8A 2AE1A 5FYDA 4UEKA 1J0XO 5FF9A 3ZU3A 1Q0HA 3RROA 1JVBA 2UDPA 3ZU4A 4J9VA 4UUMA 1E1KA 5MGBA 2GZ1A 4TRJA 3WX0A 1YONA 4CLRB 4AJEA 1IUKA 1CERA 2NACA 3H9QA 3O8QB 2AEMA 2YV2A 5CG1A 4R51A 3GG2A 3BMQA 3UCXA 5ICMA 1T2EA 3L77A 3GHHA 4PG4A 3ZWWA 2E4AA 3E6AA 4WCFB 4ZHSA 1BVRA 2A92A 4J0FA 4AJLA 3D64A 4LRSB 4ILKA 4J4HA 4HWKA 4BNFA 5TIIA 2Q2QA 1WZEA 3VZRA 4NJOA 4G65A 4JX8A 5BQFA 1PJQA 3R0IA 4FN4A 3TZQA 1BXGA 1WLYA 1NQAO 1YL5A 2NU9A 1Q0QA 2AQIA 4KDEA 3VPXA 1LDNA 2VHZA 3VZPA 4JQCA 3VH1A 1HDYA 4AJ4A 3RQSA 1JAXA 4A5OA 3N58A 4CL8A 2HAEA 4LVUA 4GGPA 3TFOA 4EUHA 1B0AA 1P1HA 4BMVA 4CQMB 3SXPA 3QVTA 4OAQA 1GUZA 1P0FA 4D3FA 1NFFA 3OHSX 5A9SB 1SMKA 1MX3A 1JWBB 3RC7A 4E2YA 1YL7A 3D4OA 1E3LA 2HRZA 1HLPA 1OZAA 3VH3A 4RDIA 2VTEA 2QYSA 5JMWA 1P45A 3WGOA 5JSFA 4NFHA 1LRJA 3G79A 5HWSA 4YJHA 3GZ4A 4NZ9A 1HETA 4ZD6A 1JA9A 3CMCO 2X8LA 4PLYA 1C0KA 3U62A 3LT4A 4TVBA 1K5HA 1YQDA 3H5NA 1P1IA 1GZ4A 2Y1CA 1V3TA 3RAJA 4GKBA 4TWRA 5F3RA 3T4EA 4E32A 3V5NA 5CG2A 5KJ6A 1HF3A 4AG3A 5CEFA 3KSDO 3DHYA 4FC7A 2VWQA 4BNUA 5AYVA 4WEQA 3F9IA 4ZQBA 1CETA 3AJRA 5KTKA 5KNLA 1Y6JA 4FJ1A 2FR8A 3ONDA 2Y66A 3OIGA 2XF8A 3JQAB 2EHDA 4H15A 4GBJA 4HFNA 4RF3A 1BDMA 5A4DA 4WGGA 4D42A 4D45A 4Z9YA 1VI2A 1N7GA 5F5LA 2ILTA 3CZMA 3NGXA 1PJSA 2ET6A 2PY6A 3PDJA 4R54A 5IN5A 3B70A 2VRBA 3S2GA 1IE3A 1FMCA 4IBOA 4MP6A 1LDBA 6LDHA 4OO3A 4A0SA 1R12A 3S2FA 3JYOA 2NLOA 3UCFA 2CDAA 3GMDA 4LK3A 4Z9FA 4MO2A 3DBHB 4MVJD 1GYQA 2GF2A 4RO0A 3X2FA 3JD4A 3JD0A 2X5JO 3ZHZA 1MC5A 1PSDA 2O2YA 1U5CA 5A05A 3PDUA 3TRIA 2P5UA 1B3RA 4R9SA 5FI5A 2O4CA 4ZGWA 4RGBA 3G0OA 4FFLA 3PZRA 2H6EA 4TZTA 3EVTA 4WUVA 4EJMA 3KXDA 4Z3DA 5CEJA 2NU7A 1AN9A 5C5IA 1EDOA 2WJPA 1F8GA 2YQ5A 5L9AA 3ROMA 2TMDA 1BXKA 2UV8A 4GMGA 1OC2A 3UW3A 1VKOA 1SC6A 1GL3A 4KQWA 1WMAA 1KVQA 3DBLB 2H5LA 4R3WA 3E5RA 3RJ5A 2HQ1A 4M54A 4RVSA 1QR6A 1VLLA 5DBIA 4FW8A 5DP2A 1GZ6A 5CFZA 1OMOA 4KTVE 1NQTA 4YJDA 1T2FA 4M1QA 3IIEA 2W4QA 1K3TA 4FJ2A 1UP7A 4YT5A 3ZV5A 2GD1O 3PIIA 2OGUA 1GDHA 1GAEO 1MB4A 3QE3A 3I4FA 4J2OA 3WGHA 4ND1A 1HWYA 5B4TA 4AFNA 2J3IA 1ORRA 2HMTA 3NV9A 3DEYX 2F00A 3RVDA 1F14A 4DA9A 4Y67A 5IZCC 1HE2A 3EUWA 3BTVA 3HQ4O 3PHHA 3TPCA 3W4IA 4L73A 3PWZA 5JCXA 3HB4X 2D59A 1LBEA 2I3AA 4OHUA 4U6SA 2X22A 2OMEA 3FTNA 1HDGO 3GNTA 4II2A 3GN2A 1BWSA 3MWEB 5C7OO 5CDGA 1LRLA 3RBZA 4O5OA 5BSGA 3T4XA 2Y1FA 5DOZA 1WNTA 3ENNA 3PXXA 4YRAA 1XU9A 3NAQA 1M76A 1NWCA 2YW9A 1ISJA 4PVDA 4WLOA 4XB1A 5LCXA 3WWZA 4Y9DA 1K6JA 1FDUA 3ON5A 3QQPA 4XQEA 1GFSA 1Z82A 4IQGA 3AY6A 3F3SA 3M1LA 2W2KB 1LSSA 5TS3A 1ID1A 4AJJA 4BGVA 2E48A 3H9JA 3V2GA 4CMBA 3ZNOA 3RFVA
chains in the Genus database with same CATH superfamily
2JIQA 3DMTA 1KPGA 3R44A 5ADVA 2VOJA 2C5GA 4CM8A 2Z08A 1H0RA 1XTIA 2OEPA 2PKEA 2VJDA 1D9ZA 1J9EA 1VIDA 3EHEA 2VYFA 2WF5A 2JATA 3FPHA 3L0BA 5C31A 1VB3A 3WGIA 2W5UA 2WTUA 4KODA 1EP9A 4UMDA 5AVUA 3GOHA 4W7SA 3EIOA 4AY5A 1QE5A 1J8MF 2ADOA 2CBZA 2H85A 4RHEA 5KOYA 3MCVA 2CYCA 1UADA 2BGNA 2FN3A 4MINA 4MVWA 4N9QA 3JQPA 2YTZA 5BVHB 5AW0A 1K5PA 4POAA 4C4ZA 3GUVA 4G1CA 3QWHA 2G4LA 1ZHOA 2JJ2D 5DDIP 1A04A 1FBNA 2FHSA 3IT3A 3KSMA 3RHZA 1QPZA 3W5BA 1XVVA 1PUIA 1N8KA 2Z2ZA 3GV0A 5F7ZA 1E5XA 1KZ9A 1RQGA 3H1TA 5A4IS 3K5PA 2NP6A 1KI6A 4GKAA 2IPOA 5L3QB 4R1MA 1SPXA 1P33A 2PH3A 3HYSA 2C78A 1HQYE 1SC4A 3VNRA 3WFIA 2I9KA 1WUYA 4KR0A 1UBKS 2E49A 3EFBA 4JBLA 4OSPA 3ZS8A 5J5AA 4NOLA 3GWZA 3AUKA 4XIJA 3HJAA 2WLSA 4N7MA 3PL5A 2V7QA 1W88B 3W5DA 1I30A 5GMOA 3HO1A 1SM4A 4FUQA 4Y2TA 1JBQA 1LI5A 3HRKA 1CVRA 5J4YA 4H7EA 3BMOA 4RIIA 1PX0A 2X5NA 3SLGA 1L5OA 1JLSA 2RONA 2ZB8A 2WV7A 2RHBA 1RJFA 1JR3D 2QUZA 2REQB 3ND7A 1NXVA 4PZ9A 1N8NA 4B6JA 2QX6A 4H08A 4XM0A 2IL1A 5CFQA 4J91A 3WADA 1VPDA 2HK7A 1BW9A 5AVRA 5IKPA 4FNAA 1JIXA 1VJCA 2I7TA 3A9RA 5BUCA 3F0TA 3FSEA 1X87A 3PHCA 5EP1A 4YMTA 4RA6B 3EG9A 5ENZA 4CXMA 1X9HA 4IY1A 4KIWA 4E1AA 2Z6VA 3PUHA 4TT8A 2QMOA 2BUAA 2OHOA 5AK0A 3W2TA 4EHHA 3F71A 1R0LA 1JL3A 4MQFA 4J3JA 2GO1A 2XNDD 1RYNA 3T5PA 4XD7D 1UKCA 1I32A 5DWVA 1VDMA 4UNSA 3RUEA 4S35A 1IXYA 2Q45A 3EGWA 3LUAA 4HWTA 3K6JA 3L43A 4LZWA 4OHPA 1GTZA 1AXRA 5AM3A 3QHAA 4DJTA 3CLUD 4F92B 2JI6A 2ZTUA 4EYEA 5KS2A 3QEJA 2XY4A 4MA0A 2DP4E 1TE2A 1Q16A 2C31A 3PTLA 3MGKA 2CUNA 4RFSA 3M4XA 1FVOA 4OL9A 3TOVA 1SIBE 1ORIA 4QDOA 1D1QA 4U39A 1Z36A 1JZQA 3C6XA 4KWIA 4OHFA 1NONA 4FZJA 5BRAA 3PFBA 1JALA 1ZESA 1E89A 2CVPA 2D4HA 4I8XA 4G9BA 4JB8A 2QPOA 4QUAA 3RKSA 1ZICA 3TW6A 1SZPA 1EBFA 1Y1TA 2R8OA 3T5CA 2I6FA 3OU2A 4AC9A 4BB0A 4Q15A 5BPHA 3IQDB 1ZW1A 4PFKA 2GLXA 1XZPA 2AQ8A 3FYUB 2R6HA 3U1BA 1T0UA 4HTFB 4F9EA 4O2AA 4A2CA 3VU3A 2BMDA 3QFCA 1VHJA 1JILA 2OGZA 3CLUC 3O3OB 4ECAA 2REBA 3EDOA 3Q3CA 4V39A 5ECYA 3GJZA 2ZRKA 1AM4D 5A4KA 3S55A 1U0BB 5ESWA 3TX2A 1OXTA 3IAUA 4BQQA 2OCIA 2JBWA 1MDFA 3CRRA 1EVEA 4DLRA 3F4LA 1O0CA 4O0MA 5GV7A 4Z1MD 3S1AB 1ZP6A 2ZR7A 3M5WA 5K5EA 4LKRA 1CUVA 1KPHA 1GKYA 2F17A 2DQ4A 1NDHA 2W2PA 4FSHA 4AXXA 4IIJF 1HL3A 3JARA 5F52A 3S99A 1FS4A 5FULA 4TZ6A 1SGWA 2C2KA 2P65A 3EAGA 5JAUA 5IDYA 1HGXA 1P7VA 3IUMA 2LIPA 1E9BA 2RGNC 3DE4X 3GPCA 4OQEA 1OLOA 1U7HA 1N2OA 4L28A 3JRNA 1YZUA 2R2GA 2I8CA 2ZRNA 3H17A 2ZCVA 3DXFA 3O4IA 2R60A 4HG2A 1P77A 3AKDA 5IYZB 1XKTA 1TK9A 2E4WA 1JI0A 3W5UA 4E14A 1RWWA 2CN1A 4P98A 4X1IB 5JO9A 1SK9A 3FBGA 4JKOA 4PONA 2F9FA 3TCNA 2QTZA 4MXDA 3W3AA 3OZWA 3SMVA 3WLOA 1VMEA 3BIWA 3E18A 1RP1A 2JF0A 2WMOB 1DJLA 1IU9A 5ES3A 3TR6A 3E7FA 4UTXA 5DHUA 3UT6A 4DIUA 4R1OA 2X1HA 2PTHA 7ABPA 5JHHB 1FDVA 1RM4A 3C3XA 3HL4A 3Q6NA 4JWTA 4W1SA 1SKUA 2V54A 3CTMA 4IFBA 4NMHA 3T52A 1W4AA 3RVRA 3A6KA 1LJ8A 2PRZA 4GMXA 2E5WA 1DUIA 2RC5A 3G2NA 4PAQA 5DO9A 2O0MA 3W5JA 3WIEA 4B5KA 2A9OA 4CUKA 5LMCA 1ZU5A 3T7EA 4Q5IA 2FAXA 2C59A 3VUFA 3TTTA 4HLUA 4E15A 3TIIA 2BFOA 3WP1B 2OAEA 4IGFA 4E2XA 3W6OA 4IDDA 2HIGA 2OBLA 4YV1A 3D6MA 4ZV7A 1N3LA 3I05A 2I7XA 2A1UA 2JAOA 3EVFA 3PHIA 3H5LA 4PAOA 4KR6A 1NI4A 4XUDA 2PUTA 4OMDA 4J6EA 1RU3A 1VKNA 3UV6A 4HVLA 2PNJA 4QGAA 1H94A 2I71A 3LZDA 4HB4A 4RCVA 3ZQKA 3IAFA 1MEEA 4HZGA 5FFNA 1SRQA 3L4SO 1TM3E 1SZDA 3TVDA 2KQUA 1NSTA 1NT2A 3CE9A 4ZVRA 2FSVC 3PNMA 3RC3A 2JZCA 2HDWA 4FIZA 2JIZA 5C7LO 3ANYB 1BVUA 1QHHA 2QK4A 2V6GA 1O89A 5E9WA 5JSHA 2PXCA 3CQ9A 2A5DA 2BOVA 4G5GA 2GM5A 2OV1A 4AWBA 1Y48E 2ZRAA 3N2LA 3OTQA 1PR4A 4EAQA 2AG8A 3KQNA 3IBTA 2YASA 1NW6A 4D5EA 1NVTA 1Z7GA 4U63A 4I9UA 3B7GA 3L3BA 5AW5A 1WUHS 3M7IA 1SKYB 4TRMA 1FNSA 4DNPA 2HU5A 2YV4A 2IHBA 3HRIA 4B87A 2XUAA 1YUMA 3NEPX 5K09A 2GPWA 1GL6A 4IVRA 1EFPA 3A6GA 4Q9KA 5KYTA 4RV4A 2QD2A 3UN1A 3M5PA 2JH3A 5CEEA 5CM2Z 3IAHA 3G1TA 3GPBA 3N2KB 3Q9SA 2BEVA 3BXZA 5KIAA 8LDHA 1FSZA 4YC7A 3CF2A 5BWNA 5KKNB 1E18A 2G83A 4HXEB 3KFXA 5G0WA 4JJFA 1N5JA 4MRVA 3NT2A 1DDOA 3OJWA 4HDCA 3LS2A 1V8OA 1VZ2A 1W75A 2GJ4A 3RSCA 4ZOEA 2IYWA 3I9V1 3S2EA 1SD2A 1QQTA 3CINA 1T9GR 2C9YA 3ETNA 2ZBQA 2PUWA 4G86A 3T34A 4F2GA 1E1RA 1I7NA 1TM4E 4LQLA 3RJZA 3TUIC 4DABA 3W6NA 3QMMA 5IK2A 2AHOA 4A73A 2H7YA 3C1TA 3DLIA 4O4JB 3B12A 5J2UB 3TQHA 3VSEA 3WK9A 4D6YA 3WIDA 4YRAA 4ZO9A 2VPPA 1AKEA 1X1TA 3P9ZA 3SJZA 4E6EA 3SD7A 3HR8A 2VRCA 2VXOA 2QRQA 3ZZUA 5IJ9B 1T29A 1N2BA 2F55A 4URZR 5LQDA 4P7JA 4U0KA 2QE6A 3HMQA 3FHOA 2OHXA 2FZGA 1V4NA 4P58A 5E6RA 5T3YA 3FTDA 5C3UA 2YNMA 2IT1A 3D5EA 5H3LA 1H1LA 3Q7RA 3IGFA 4O2AB 2C7RA 2OGTA 1TZJA 2VCEA 4DJAA 1JQLB 1QYCA 2C8VA 4RBNA 1M10A 3ROPA 4CU5A 3ZGLA 2HGSA 3IX7A 1WCXA 1ITZA 4P4GA 3ROFA 2PAAA 5F2KA 1FQOA 2OBNA 2WDZA 1M33A 1PQ4A 4CT5A 3LUBA 4HPJB 4K40A 4QDXA 4EVSA 4PAGA 2ECFA 4C6TB 4DRYA 3OAAA 1REQB 1XRQA 3PX3A 3VO1A 4XWOA 3FLEA 3QWFA 1Z4KA 4YX9A 1HDCA 1Y8AA 1G6KA 3QELB 4BLVA 1G7RA 2ZFUA 4B6RA 1QU2A 4CKWB 3VM6A 4GZ5A 1QTRA 1ILEA 4BNZA 4QZVA 5IKEA 2IYAA 4RQUA 2VHEA 4JA2A 3ORSA 5DHAA 1U7UA 3G49A 4YRZA 2XX3A 5C5EA 1NX6A 2XHEA 4PX9A 3TI9A 4TLAA 5CIQA 4AZWA 1MIHA 2AW5A 1KVRA 1FNNA 1RAHA 2VQ6A 3SG0A 2VLIA 5BWBA 1VSUA 3R1IA 1WVGA 3IA2A 1BQ3A 2HQBA 3MBOA 3SC2B 2Z8XA 3SQNA 4DIDA 2BAGA 5IK2D 1KFCB 3WRYA 4XX0B 3NT4A 5HTKA 1ODFA 3FMGA 1A2QA 2JBAB 4GDMA 3ZN2A 4ZICA 4GWGA 2R6GA 1PW5A 2MMGA 2P3OA 4RXMA 4ZQEA 1ZM2A 2JKZA 2NPIA 4R7ZA 4R41A 1OZHA 2GDJA 1T13A 2IZZA 1OX4A 1BAPA 5KQPA 2DPGA 1I0ZA 1SXGA 1BN6A 2HCFA 2AR9A 2ORYA 3NLLA 5JS2A 3COJA 4UTPA 4JUDX 4M9SA 1WXEA 4EUSA 1RWQA 4ZEWA 2I1QA 3W6UA 1G5PA 1GSIA 1KERA 1EZZA 5IU6A 1OFHA 3Q8MA 3EQ2A 3NKVA 4Q3EA 5T7BA 4IX1A 1ICEA 4M1TA 4IDEA 1CT9A 4RLQA 1CZLA 1EUDA 1BFDA 1YS7A 2BCGY 2JDID 4HGOA 4X3OA 5DYWA 4BU1A 2YXEA 2OMKA 1XZBA 1IHUA 3L8FA 1GSOA 2VYND 2JFGA 3SU8A 2F8MA 2HADA 4K0RA 2WIJA 4QHTA 4IGAA 1XU4A 1ODJA 2JD0A 1SG6A 2WF8A 1NW5A 3BB4A 3KYDA 3OLYA 4H27A 2BUBA 3EVGA 3GLHB 3CVUA 3PLAE 4TXHA 5IVKA 1KEEA 1XHFA 2I2BA 5F77A 3GEEA 4MJ3A 3UK6A 1ZSNA 2RHCA 1T2DA 1G63A 4M9ZA 1Z16A 3GLFB 3PEEA 1FTGA 2F1KA 1AQIA 3DKKA 5TJHA 3KUDA 3WMGA 4BUZA 3AVPA 3PRYA 2O8EA 1ZRHA 1KPIA 3Q0EA 3UMYA 3NFYA 1IHYA 3O4HA 1ESZA 3GH3A 5KVVA 5H9WA 1RACA 2HSWA 1T1SA 3IB6A 3HZRA 3KJXA 4GUDA 3R9XB 2JGDA 4LYYA 2BUCA 3VU9A 4BX3A 9MHTA 3UAXA 1XLUA 1YH3A 3JALA 4LDJA 3K20A 4LXQA 2D5AA 4YRGA 5JYEA 1IAVA 1TD1A 2AC7A 3USCS 4C0LA 3FGOA 1AGXA 5C1PA 2C84A 2FF5A 4XGIA 2WJ6A 2G88A 1HDXA 3A9UA 3N8GA 4V24A 2VIIA 3OCZA 1T10A 1QSGA 3EWIA 4ZMBA 2H8GA 4MUGA 1PJAA 2C2MA 3DE0X 4EUFA 4X71A 1D03A 2AOVA 2P6OA 2OBMA 1KFKB 1LPOA 4A6DA 4BCCA 4EBBA 3VYWA 4NCJA 1R4MB 5DCUA 4ZEMA 4P8RA 1W8IA 2YC4C 1XTVA 3J7TA 4M87A 5GP1A 5FOUA 4ZCRA 2JASA 1JAIA 3DFIA 4GX1A 4LDAA 4FFSA 4US2R 5DJ5A 3QBTA 3CUVA 4G81A 4HFMA 3KXLA 4JELA 3HLYA 2JCXA 1L3BA 2Q4BA 2VK1A 3D4PA 3F8TA 1RLOA 4XQGA 3W78A 4Y1FA 1EUCA 4G01B 1SBQA 3V00A 4NBVA 3ANNA 2ZS8A 1XL1A 2AMYA 3R40A 2NN3C 4QOHA 3R5XA 1ZCAA 4WX2B 3ZHXA 4DNXA 4KR7A 1EQUA 1AU9A 1Q91A 4QBHA 4F84A 4F9FA 3Q8LA 3U4QA 1YMVA 4LXXA 1B8OA 2J0VA 1AZWA 5JAQA 4B71A 2VL7A 5DX0A 1RP7A 4RTNA 1MVNA 1VBNA 1V39A 2ZYWX 3HO6A 5THKA 1PTJC 3G8CA 3WI7A 4F4DA 2EKDA 2WFAA 1PBNA 2W2TA 3Q3HA 3RU7A 5F2NA 3RAFC 5THXA 4KO8A 2AOXA 3U3RA 4DCUA 1YVDA 1JT2A 1OGJA 3AR7A 1Z12A 2P90A 1AK1A 4QOFA 3PVCA 1BXGB 1XVIA 1USUA 2F9LA 3NTOA 1KQOA 3QNUA 3FF1A 3I1FA 4NK4A 3SS8A 2OFWA 4I50A 1BKDR 1U2PA 4OX9B 3O4JA 3R8CA 5LDDC 2H52A 4OHZA 3RG2A 3O21A 2R85A 4CQJA 1AF4A 1Z75A 2NUTB 2YDXA 3INTA 4JP5A 4JVNA 2YIJA 4KNWA 4Q9HA 3VYSB 4RH3A 3GCZA 2G3YA 2QRMA 2ZYVX 1Z3CA 2WWRA 2BVNA 1QHGA 2ZE5A 5FTNA 2JEYA 1FFYA 1ESCA 3F96A 3H84A 1CUUA 1LKZA 2C83A 1SA0A 4EA6A 5BMVA 3ICVA 5JDIA 3RANA 1X8KA 2BI8A 2DLDA 1DEKA 3V4OA 3S8YA 5GZ6A 3HE3A 4LWPA 4YBRA 4Q4AA 1EFVA 5DW0A 5TT0A 4AMYA 2L19A 4R2MA 4YK7A 1N1DA 3QVUA 2REOA 1QKKA 3DO5A 4XARA 3SE0A 3QXSA 1K63A 4MW0A 1DEXA 1JVSA 421PA 5BN1A 1E79A 1SXHA 5TMEA 4XJSA 1Z8DA 2EERA 1YVUA 2A5YB 1W48A 4I3FA 5CT8A 2Y0CA 4EG7A 3MT7A 2I03A 1ISRA 4Q7LA 4RKQA 5C8DA 1F9EA 3BH0A 1J1IA 1YGYA 1THZA 5DTJA 3UAWA 1WXDA 1ZUHA 2H5EA 2PXAA 2PYIA 1AY0A 1NF2A 2Z2JA 3NW9A 4PXSA 5DV9A 3BC1A 3PJEA 1DJMA 3UHAA 1XJCA 5ADHA 3S3TA 3UMVA 1T1GA 2RKBA 1DWOA 3HXLA 3ZUPA 2FRDA 2IRWA 3QYJA 3ER6A 4MR8A 5CA0B 3ZLVA 4YAUA 1JU4A 2W6PA 3LWBA 4CLOB 2VPQA 1P5FA 4KIUA 4ZO7A 3S2YA 2PIDA 4WACA 2XRMA 4HNSA 5JISA 2B4RO 2E4ZA 1DFIA 4OYHA 4PS0A 2HHLA 1J6UA 4BVGA 5ADWA 4C88A 3O8LA 1E0DA 4LV8B 4RFVA 1V71A 4C7KA 1AKQA 1DAFA 3K9BA 4E51A 2DAPA 5DZSA 3WIBA 1FJHA 4FCVA 1P1RA 4L4SA 3B2QA 1UOOA 4IS3A 1D1TA 4KR9A 3K6KA 1GYRA 4WXHA 2FPPA 1BD4A 1RYHA 1UBMS 5E1OA 1G64A 2WWWA 4Y6QA 4POOA 3H16A 2VLBA 4Z1MA 1LS6A 4EX6A 5ISMA 1MX5A 2H29A 5FHRA 3OM1A 1X7ZA 4OQDA 3H0KA 1UP4A 1YDFA 1UT6A 2X9LA 1C9MA 1Q0SA 1I2CA 1UKEA 1I2MA 1E2JA 4NAHA 4QUEA 3PEYA 5IMSA 2PGXA 3BBLA 2HBRA 4O4LA 2J4CA 3RRXA 4EKYA 1EB9A 3ERCA 4MPPA 4TS3A 3LWNA 2M1XA 2Q1SA 4JP3A 3D3EA 1DHTA 5ALRA 5CW1A 3WS7A 1Q83A 2QB5A 4MV0A 1OFGA 4MIKA 5EUQB 1XO1A 2XRFA 1IBCA 4FYKA 2XIJA 4CCYB 1IOZA 1WETA 4PHCA 1CR2A 1NC1A 4LZAA 1F9AA 4YCSA 1GTMA 2QPLA 4YJ3A 1ISFA 1U3VA 1Z83A 2J3DA 2JVIA 1WXQA 2OB2A 3P2OA 4IW3B 4NDNE 4PCAA 4X1IA 3DLHA 2NQ8A 3UA3A 3JV7A 5BQOA 5NLLA 2B94A 3CW8X 3GLHA 2I2DA 3HCDA 4YS6A 1J99A 1JXMA 2QQEA 1A2BA 4MUMA 4W5HA 4GI1A 2Z2XA 3BFVA 5G1PA 2IY8A 3FW1A 1JQKA 1O97D 4GI2A 4RK7A 4ZI3A 3SKXA 2PZEA 4NZYA 3SHVA 4RUKA 5JQGF 3GNSA 2H0QA 4M1YA 3I5UA 3DS8A 3UQZA 2LKCA 4B09A 1SHUX 2Q2OA 4TKUA 4A8PA 4LXHA 3EVDA 3N2IA 2NZUG 3NBQA 2DBRA 2P41A 5F64A 5KSPA 4P35A 4CF6A 3I5XA 2N46A 2XVYA 4I1PA 3QM1A 4XGNA 3OMXA 2HSEA 3VSDA 2BJWA 2XOKD 1NW9B 3G5LA 4X63A 1ZD5A 2QTFA 1BMDA 5GPBA 2UVPB 1M2EA 2WIKA 3U1VA 2HMSA 3PDHA 3LLSA 5CUQA 3TZCA 2IXDA 2B5OA 4QUBA 3V8QA 3E15A 2IVZA 4GZLA 1U1GA 1AZTA 2DFVA 3ZWNA 2D1QA 2YHAA 3I2IA 1HORA 2PGIA 5TB5A 1VLZA 4J0EA 4NDZA 3GUZA 1UWCA 1N5KA 2PQ6A 1II9A 2ZBUA 3H0CA 5HGXA 5SV2A 1YL6A 2PVSA 1UFQA 4JSTA 2JA2A 4DLPA 4I9FA 2OD2A 5LVAA 3T3GA 3BWCA 3I23A 4YN3A 1GQYA 3G0CA 3VMMA 2Z2KA 3ZIDA 2ACWA 2CD9A 2GFIA 1MVLA 3AG5A 4UDYX 4LISA 1A77A 2HLDD 3RE1A 4BTVA 2G8LA 3QF4A 5GQSA 1FFBA 1ZN8A 4KBFA 3GFTA 3GGDA 1CY7A 4EY3A 5BR4A 3T3HA 2QROA 3L0PA 1JG7A 1Z6TA 1X2BA 2NXJA 4CL0A 3I1IA 4RWZA 3LBFA 5DGCA 3CNNA 1G8SA 1SELA 5A3RA 5EZ6B 1XEAA 4A5SA 2GJ9A 2WUFA 1FUUA 3H65A 2O23A 4CF4A 4MWTA 3W77A 4DG9A 1FJ2A 3EBPA 1RQPA 1FB5A 1U02A 2H4WA 1JX6A 3QITA 1L1FA 1JDJA 3N0WA 4DB4A 3KTOA 1WW2A 3PVZA 4Q4AB 2I6GA 3MF4A 3ZBQA 3BWEA 1F48A 3PT5A 1IXSB 1EE2A 5A2QA 1OR8A 3EW9A 4ZYXA 1DG3A 1EKXA 3VR4A 1NVDA 5BYJA 3VTAA 2H1VA 1GPLA 2EJVA 1XN4A 3R6TA 5EUBA 3X1ZA 3H4IA 2WVAA 3A3YA 1DDGA 2Q1UA 2YIVX 1ZM4A 3RASA 1PDWA 1NRXA 5A06A 4NI5A 1RMQA 2M32A 4MAAA 3P9CA 2JFNA 1ND5A 2CWDA 1PNTA 3PQCA 2ZXEA 2AXQA 2UAGA 4HP8A 3QA9A 1DTWB 4OATA 5LBTA 1RLMA 2FPRA 2WJ3A 3DJFA 3JQDA 3ITDA 2SBTA 3LYHA 4OQZA 1SVIA 1YC5A 4EFMA 4BNDB 2YJTD 3IBFA 5F2OA 3ZHRA 3CUTA 3DHVA 1Y1RA 1XRLA 2VRNA 3V1YA 2P2ZA 1Y8ZA 3OZSA 4RTPA 4QPZA 1PS0A 4G0VA 2O8NA 2J0EA 3ZYCA 4D6XA 4W63A 1EAMA 3FJ1A 2EJBA 1DS6A 5F7JA 5B7NA 3LI2A 4GSYA 3WJ1A 3FPBA 5A0VA 1JLHA 3FR8A 1ZWKA 4TQGA 4TV8A 5GV8A 5I8ZA 3GLGA 4M1ZA 4UNNA 4IJ5A 4NMXB 3UATA 1VGRA 5IBRA 5AXDA 3LQFA 1J70A 5C8YA 3OEED 2IOFK 2X9VA 5SYMA 2H4ZA 2PRKA 4EA7A 2LVBA 4WH0A 5H7XA 5G1NA 1ZA2A 4AB1A 1F6WA 3DCYA 4C6TA 5AVQA 1STOA 3QUAA 1FYVA 1XALA 2I99A 2P68A 3AEXA 3LYAA 1VL1A 2I8LA 4JHXA 4JQSA 3AILA 1VPLA 3GK3A 1J2RA 1L7OA 4FDLA 4GL2A 3D3NA 1N9ZA 4Q4JB 5TV2A 1NRWA 1XJ5A 1JR4A 1OLUA 2PR2A 4Z9AA 1FZQA 2WM9B 3ZHSA 1SQFA 3K6SB 2UZ3A 3B6ZA 1XZAA 4PYLA 1Q21A 5AW9A 2FRXA 1RI4A 1M7GA 5AW7A 1MO6A 2DF8A 2ZYIA 3AXSA 3VVLA 2DGDA 2IYNA 2OO3A 3N6VA 2W6JA 4BRUA 1N4AA 4MI1A 4Y3UA 1BDBA 3S1SA 3LL4A 3AL2A 3QXHA 4AICA 5IRCD 2PZLA 4XFJA 1KZYC 1I2AA 4PLZA 2Q41A 1IUOA 3ETHA 2YZKA 1OFIA 1TLFA 4GQIA 4I1IA 5JAHA 4P7BA 4ZAGA 4DCGA 4Q1VA 1DBIA 2OHGA 2A9QA 3J80A 2IHUA 1C7FA 1WWKA 2AI3A 2AMLA 3N2NA 1BGXT 3MCTA 1FNDA 4BE4A 1CS4C 1COWD 1CWUA 3RBXA 1H2YA 1M8JA 5BV0A 5B3JC 1UFKA 2V3WA 4M9CA 1N92A 5EJ8A 2BP7B 5FLEX 1CQIA 3UV3A 4B43A 2PUBA 3FHCB 2DERA 3MFYA 1ANKA 1EGVB 4QVGA 4ROTA 2AMJA 1JHMA 4UOZA 3JQGB 1U7WA 3QX9A 2Q07A 3D4IA 1Z3IX 3WNDA 1AKVA 1FFSA 3D43A 1CUEA 2OK7A 4QREA 4OHRA 3RSFA 5I8PA 5JDCA 2PGNA 3KYDB 4OUDB 3F1KA 1NVBA 1YUBA 2WG1A 3ICWA 3NRJA 2IEBA 4BQNA 4RGVA 2EP7A 3A6JA 1J8YF 5E1MA 2P4UA 5IH7A 1VE3A 1WZNA 2FVXA 2H92A 721PA 2BMEA 4UATA 5L8VA 4P9NA 1TTPB 4WY5A 3ZKWB 2PNFA 2YJNA 5FADA 3WLTA 1TT5B 3EY9A 1XEXB 2O4UX 4YJGA 4DIOA 4DXDA 1P7CA 1TKBA 2HPAA 4NE2A 4C7OB 5CFPA 2Z09A 4WFKA 5BVGB 4HXFB 2CXQA 3DKIA 3N0RA 2WWFA 1CEQA 1T9AA 2BKLA 5KJCA 3Q9LA 2I2AA 4I81A 4G24A 3JD3A 5AKGA 3I01M 3I9MA 4GGOA 3E81A 2Q9CA 1XLTA 3QLJA 3CLTD 4B2YA 3NASA 2CFTA 4DWVA 2YVLA 2P7HA 4MYDA 3RNLA 2P6NA 3K70D 3L01A 1JLRA 4KQCA 4DHWA 4GKKB 1D07A 4K3UA 4BNIA 3WXMA 2CNWA 1UZNA 1VL5A 4CMGA 1EUDB 1JI3A 3W8NA 3L1KA 3I45A 4WFJA 3ZGYA 2IZ6A 3I53A 4MYRA 3D6UA 5IT4A 2O3UA 3AM4A 3IDOA 3L7YA 1SIUA 2C54A 3P1JA 2ZJ8A 1XAGA 4AIRA 1E5LA 2XTNA 3BXPA 4KVAA 2SCUA 2WAXA 1B14A 1Q74A 1XHLA 4MS3A 2X2OA 1CW2B 3ZCPA 3HXKA 1M2OA 4GPD1 1GNVA 4H0FA 4MVJH 4RJJA 3UMFA 3H1AA 1MXHA 1Z2EA 1SD1A 4G89A 4WUTA 5HCIA 3KQSA 3NHAA 4X64B 4CNBA 2JGNA 4AY4A 1SIWA 4OFZA 4CVNA 2IITA 3UPUA 1I13A 3IA7A 4QYXA 4HBGA 1EZ4A 1DX9A 1ZY2A 3NJ4A 1NMEA 4W6QA 3DFUA 3WFJA 3P5SA 1PP4A 5HE8A 2O19A 4HEJA 2CMDA 3AY7A 2X3FA 2ZULA 4TWAA 1TXGA 1B6RA 2UYQA 3KOXA 4JJAA 3WGKA 1W0JA 2HREA 3MQFA 2PLRA 1I6LA 1KFEB 4QTZA 4RQTA 2D6FA 1SKYE 3K30A 3U26A 1VMKA 4EGSA 2P69A 4YLYA 2H59A 4N3GA 4G1FA 5C80A 3DXXA 3A6HA 1ILWA 2B1IA 2J3MA 4IS2A 1WUTA 4U9HS 4B3BA 4AZ3A 1GT91 4C07A 1KMNA 2QP4A 5E3HA 4FD3A 3ICQB 3A6FA 1XQ1A 4URXR 4TWIA 5B53A 4C1NA 5FUMA 4FR2A 3K0AB 5G0VA 2XEDA 3F46A 1T0HB 2EQAA 1G291 4IDFA 2BTQB 3L6RA 1T4BA 2YJGA 1AKWA 3JWEA 3ZU2A 1SQSA 1XCJA 1MH9A 3EEBA 2QL5A 4AQYB 4TV9A 3HCNA 4H3SA 1B7GO 3F6RA 3OI7A 1OI2A 3MA0A 3IKMB 4Q21A 5LA6B 4BP8A 5I7RA 1CIJA 1FXWA 4YT4A 1I6KA 4UTOA 2Z6QA 3GG9A 4GU5A 1HG1A 4YJFA 3FPFA 5LMZA 4ZTZB 3MCAA 2ZRIA 4IEFB 4EMTA 3IIJA 1AUQA 4L2IB 4XLLA 2IKQA 1NR5A 2UZAA 3E0QA 1C8VB 4WXRA 5P8WA 3QOXA 4IO0A 4BNDA 1T34A 2HDHA 3HU2A 1AQNA 2BZGA 1C41A 4FZ3A 3UT5A 1RE1A 2UZ0A 4C20A 1Z06A 4U2CA 1JRLA 1SBCA 4LYFA 5FJIA 4R8RA 3RVLA 2BKUA 1JQBA 2COEA 1QB8A 3UJ9A 1IIRA 2IF2A 3LZCA 2HCRA 4IMJB 2N3ZA 2Z5VA 2J59A 1YZTA 2PO7A 3PUJA 1ZN7A 3IAS1 3BL5A 3L6DA 1UBEA 5CPFA 5JTTA 4N41A 1CDZA 2DR0A 3SYLA 4XWAA 4ENQA 3ONVA 3GFPA 1T6ZA 2F4NA 2NAFA 2OZEA 3I30X 1ZMBA 4EPTA 2XTMA 4QFCA 4MA4A 3KKMA 4LCJA 4RHFA 5LZ4A 2WF7A 1Q0UA 2X0IA 4ZHQA 2L2QA 5L3RA 1SVNA 1CFZA 4UQLA 1MENA 2GTPA 5F78A 2Y6UA 3EMDA 3JQAA 2V3VA 3WNZA 2ZYHA 2J45A 3VOTA 4BAUA 3IUYA 5EQTA 4A8JC 1PEDA 4X24A 5HEKA 1L4YA 5KX5A 4N7RA 5IVIA 1RIIA 4ZI7B 2H1OA 4GPTA 3L04A 5AKEA 5E2IA 3T7DA 4KBGA 1XPOA 4DLNA 4HQFA 1RWKA 3WYDA 4BVAA 1MKYA 2PMCA 2DY1A 1ADFA 1DHRA 1S8NA 4A3SA 1PEKE 1QDLB 4R8MA 5EGSA 2O7VA 4XPIB 2OD7A 3M5CA 5LNK1 1M6HA 4FUTA 2L0XA 2JLCA 2AG0A 3BZUA 4JN6B 1JEQB 4MYUA 4O33A 2XSZD 3BOSA 4HX2A 1MV5A 1CLEA 1FTWA 1UC5B 2IW3A 2P2LA 3R3SA 1FDOA 4HPWA 1TZBA 1XROA 4OAPA 1JP7A 4Q7EA 2DECA 2FE4A 1DAEA 4L74A 1G5RA 3WWYA 1CG6A 1Y63A 4OXQA 3ZDQA 1XG5A 2JIDA 5AVYA 4D57A 3DDHA 1C1DB 1GA1A 2I2XB 4EPXA 3IKVA 4B2IA 3ZPXA 5EJGA 3DNMA 1KAEA 1FMTA 1G6HA 4EA9A 1EQ2A 3HLTA 2I0FA 5BUQA 3CG0A 3QFSA 3CYFA 1IBKB 1YS9A 4YECA 4TKVA 2K7FA 4GZMA 2H7CA 4JSYA 1Y9DA 3A6ZA 1NDQA 1SCBA 4FS3A 3CRQA 1W59A 1UBLS 4Q9DA 4CTJA 3IQGX 5DNVA 4PZZA 2P9JA 4EIWA 1U6IA 2ZCUA 1A95A 1IZYA 5FTKA 3I2JA 1JSZA 1CQXA 4P38A 1EFTA 3I8XA 3QEBZ 4EG1A 3G9ZA 4R69A 1G59A 1MT3A 4B84A 3KLBA 1AS0A 3QEAZ 1F2UA 4J76A 1V1RA 3CUEF 1FFXA 2FDXA 2JZNA 2X6TA 3WO0A 4TPKA 4DCVA 5K51A 1JR3E 2FYTA 1M5UA 2E1RA 5KQMA 1J07A 4K8RB 4NS4A 1SUFA 2ASEA 3MM4A 1LTHR 5D01A 2B4QA 4XOIA 5DXAA 3TQOA 3V9PA 4RE5A 3H7AA 3KOWA 3CKLA 1NY5A 4JXKA 3QEMA 1Y5LA 5EE9A 3KQUA 3EZ2A 1E3SA 3LKZA 5FYQA 4YBZA 1FSGA 3HEBA 4IGEA 2HMUA 4KC0A 4EX7A 3PXDA 4TUYA 4XR9A 3C3EA 3U9TA 4ACBA 1CZNA 4EHKA 1NGSA 2GYVA 2BZ1A 2BT4A 3OETA 2CZQA 1RLIA 4C2AA 5IAOA 4YH1A 3ZHBA 4M2LA 3WMXA 4N0MA 4MEBA 1XQVA 3OCUA 4BO5A 4EGFA 1PRYA 1Z6QA 4G36A 2VEDA 4DBLE 1L5LA 1T26A 3OF3A 2Q6OA 4FXPA 4FYMA 5AOBA 1OYVA 2FJPA 4MUEA 4PG5A 4KMOA 2FWIA 4UDNA 3DE1X 5C7IO 5MF6A 2IHYA 2QZ9A 4RHTA 1RZ3A 1RE0A 3EEQA 4MWCA 1F06A 3M89A 4EFLA 4BNHA 1G8HA 2OT3B 3KFLA 4N47A 2JLQA 1RNLA 4OM7A 4O59O 2VA9A 4JBWA 1YJ5A 2FSVA 4GBMA 3B36A 1U6JA 2OKGA 3RPEA 2ZE7A 2YC2C 1E9CA 3D8HA 1R10A 2ZSDA 3QG1A 1TECE 2ZPAA 3OZIA 2FU5C 1JTVA 4TTVA 3QVKA 5K6RA 3ZYZA 3W0LB 3LQYA 1Z4OA 4NMWA 1EE9A 1GQFA 2GVZC 4CHGA 3U13A 1OFUX 5ALWA 3DTVD 3KOOA 3RARA 3W2EA 3KTAA 3CPJB 1GRNA 3DD5A 2O6HA 1AO3A 2WLTA 3ORYA 5AKIA 4OKNA 2ADMA 1ATZA 2IZ0A 4EHBA 5DLPA 3H8VA 4EQ6B 1K66A 1R0RE 2ODNA 4D41A 3OG9A 3KKQA 3Q1LA 4HNAA 3L84A 2FEMA 4R7TA 1L8QA 1G5FA 2WBLC 3EDMA 5AICA 5T6BA 3HB7A 1P8JA 3QV2A 3WRXA 3VHXA 3EC1A 1W0KA 1Y6FA 2EX1A 2JI7A 4P4TA 4Q34A 4MZDA 2NO6A 3VKVA 2BTOA 1E2DA 1WUIS 3OC6A 3S28A 1KO5A 4BX0A 3EXG1 5I6DA 3FDXA 1LPMA 2VYCA 2WPNA 1QRAA 1DBQA 1KI2A 3DA8A 5KC9A 3M6MD 2H54A 2ATEA 4B4DA 4UTNA 1RHRA 2EGHA 3V7UA 1QVAA 4KW7A 2A9PA 3O2SB 4CM4B 2RHHA 4QODA 4R8VA 5FV4A 2Q2WA 4J2HA 1UEJA 4JU8A 4YRTA 4AJ1A 1KP2A 5FIUA 1U80A 2DCMA 1GWNA 4N76A 2WOOA 5AOCA 2WINI 2O8CA 3N7UA 2H51A 4B47A 1U7ZA 2IBMA 4AQDA 1JNYA 1J22A 2ONJA 1M72A 1EFRA 4ZCSA 4ND8B 5KQRA 1O4WA 2JAUA 4P2BA 5DWDA 4KSCA 4DMGA 3IB3A 5EKUA 2RGNA 1XN1A 4GIBA 4DG5A 1LSUA 2JJQA 3LA6A 3G9XA 4G4SP 4OQPA 5C5DA 2FUNB 2PJUA 4YCCA 2V9CA 3W5CA 2YMQA 4JLWA 1TIBA 5DTRA 3QX8A 4GM4A 2Z6UA 2RGDA 4N5HX 1KBZA 5T5QA 1NHGA 2XBLA 4DCCA 2QTCA 5AJVB 1D09A 1EUQA 2H7XA 4WD3A 4IIJB 1WPGA 1ZYUA 1OYWA 1J23A 5CCBA 3G6WA 1IXRC 4CUJA 3CR7A 1NYTA 2O3SA 2FSPA 2PS0A 1GQRA 1HMYA 4TLCA 1ORVA 4U2DA 5CVCA 1E8NA 3DZIA 4JQOA 1PCXA 5FB3A 2HSGA 3RR2A 3HG7A 3VPHA 2GEBA 1A4RA 4FOLA 2X77A 5CH5A 5KZMB 3O2NA 1H1TA 1JVNA 4KXVA 3AO0B 4WNIA 3AUJB 3N8KA 4C08A 5A7FA 1ID8A 3SZOA 4PIPA 3HM2A 1TDJA 3LPNA 4MKHA 1CUWA 2VT6A 2WG0A 4WZAB 2J6BA 3NHFA 5K2MA 2QENA 1EPUA 5ANRB 4IJVA 2NM0A 3TLGA 3FRHA 7REQA 5K6AC 4YXFA 1SBIA 3QJGA 3HKEA 3ZD9A 3SAJA 2XMPA 2PVPA 2R751 1BVYF 2FWPA 3NBUA 4BWGA 2ATXA 1UK8A 5LQAA 3AT1A 3SI7A 3CGWA 1QAQA 4G8BA 4HAZA 4R0NA 4BVBA 3UH0A 4QDUA 1BO6A 1UJ6A 1RWNA 4D8VA 3DFZA 4R2JA 4TX1A 1Z7BA 3CXRA 2O50A 3L7IA 3LUJA 4MR9B 4QFDA 4WGFA 5TXGA 4B75A 4NCIA 4MGYR 4YAIA 5FCDA 3KVYA 1IN5A 5HFJA 3TK1A 4DV6B 4PSUA 4YR9A 3IR5A 4OHVA 3VQTA 4HNQA 3ER8A 5HKBA 2DB3A 2Q5EA 3C3YA 5ICSA 2I66A 1NNI1 3PF8A 3M70A 1TM1E 2ZK7A 3HY6A 5AKHA 1X0XA 4QJIA 5DGDA 4BCBA 3RADC 1ZG3A 3Q2KA 3U61B 3IHLA 4LTDA 2FGJA 1WULS 3OQ1A 2GKOA 4FZVA 4N3NA 4D44A 2P2CA 5JZ9A 3W34A 3SXJA 3HYLA 3RH0A 1L5FA 1XWFA 3BFKA 2QMUA 3FNHA 1T4DA 3HRHA 3QPDA 4FBMA 1AHIA 2EBFX 1TMKA 3F47A 3GA5A 1YDGA 3KEGA 2YHBA 3Q9UA 3WB9A 2JFZA 1DT3A 4YFYA 2XE6A 3NI2A 2GPJA 3WK7A 1IWOA 5EJIA 4ZV4A 3TQTA 3KL2A 1BE6A 4E6PA 5K8IA 1DKLA 1NBMA 1W93A 4M7WA 1FFXB 2DSNA 4O8CA 2OC4A 3FPLA 3PEFA 4KJZA 5MN4A 3WNCA 5LOVB 4JCCA 3RRYA 3ZE9A 2R5FA 5KOJA 2VDNB 2D7DA 5KYYB 1QPGA 3QK7A 4G09A 1TO6A 2VDLB 2FLVA 5GOZA 1DKMA 2AB0A 1IOVA 1QFMA 2H9AA 2WNSA 3DM9B 3ECSA 5TF0A 2IWHA 5GONA 2WJJA 1Q22A 3WB0A 2J5XA 5D6NA 3BSSA 3KUCA 4TUYB 2FFBA 1AS3A 2BELA 1P29A 2FMKA 4FFVA 4NNJA 5HW0A 1QO9A 4WFIA 4R1QA 4BECA 4C2TA 4I3HA 2XUFA 1CLUA 4LCBA 5H9VA 1P81A 1RADA 2G4CA 3NUQA 1T8TA 4GC9A 4QQKA 1KJIA 2E89A 3GT3A 3SLKA 1Q0RA 1XZHA 5T6MA 4B3DA 4X6XA 3KQWA 4BDSA 1UXOA 2EFCB 2W2LA 4HDOB 2EKQA 3O4VA 1UMBB 5AK6A 5I9MA 4GYWA 1B23P 2Q4RA 2FSFA