5ITWA

Crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
255
structure length
255
Chain Sequence
b'MIMNLTDKTVLITGGASGIGYAAVQAFLGQQANVVVADIDEAQGEAMVRKENNDRLHFVQTDITDEAACQHAVESAVHTFGGLDVLINNAGIEIVAPIHEMELSDWNKVLQVNLTGMFLMSKHALKHMLAAGKGNIINTCSVGGLVAWPDIPAYNASKGGVLQLTKSMAVDYAKHQIRVNCVCPGIIDTPLNEKSFLENNEGTLEEIKKEKAKVNPLLRLGKPEEIANVMLFLASDLSSYMTGSAITADGGYTAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroanticapsin 7-dehydrogenase
molecule tags Oxidoreductase
source organism Bacillus subtilis (strain 168)
publication title Probing the influence of non-covalent contact networks identified by charge density analysis on the oxidoreductase BacC.
pubmed doi rcsb
total genus 98
structure length 255
sequence length 255
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.385: Dihydroanticapsin 7-dehydrogenase.
pdb deposition date 2016-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5itwA00
3V2GA 4J49A 2DT5A 3VVBA 1LRJA 1XQ6A 2J3JA 4M49A 3AOEA 1PWXA 5JC8A 1R4MA 4CMEC 2AG5A 1HZJA 2P9GA 1YWGO 1NHWA 3GAZA 3LLSA 5T57A 5COAA 4PLPA 1NPYA 3JD0A 3QY9A 1MXFA 3VC7A 3A28A 4YJDA 2DVMA 4U5QA 2H5LA 2A94A 2GPTA 3OA0A 3VPFA 1R4NB 2YV3A 1QR6A 2O3QA 3E5MA 3A9WA 4PLZA 2BI8A 2VYND 3JQCA 4CLRA 5IFLA 3L0DA 3JD1A 1P1KA 2CY0A 2B69A 3E1KA 3QVWA 2QYTA 4L76A 3JD3A 3UF0A 1HYGA 2IZ1A 1KC1A 3JQDA 1I8TA 2C54A 4D7AA 4YRBA 2X23A 1ZK2A 4IDAA 1LRLA 2GN4A 1ZW1A 5JCJA 4IQ0A 4CM5A 3KTDA 1XDWA 4AJLA 2HLPA 3I83A 1G0NA 3V2HA 2JL1A 4E31A 2J3HA 1WZEA 1BW9A 1DPGA 3I9KA 4BO9A 4FFOA 1SZJG 1H0KA 1DO8A 2HCTA 5A9SA 3UH1A 1ORRA 2EP7A 4KUEA 3QWHA 1GUYA 4ALIA 3DBLA 3WFJA 2GRAA 1LLCA 4OMUA 2AEMA 3QIVA 5JMPA 4K28A 2G17A 2ZB4A 5TC4A 3AM4A 2O3TA 3LC2O 4JN6B 5L4SA 1R4NA 2JCVA 3TOXA 1XA0A 4FFNA 1LA2A 4CQMB 3IUPA 2X6TA 1A72A 5JCJD 1PJSA 1Z45A 1PZEA 1PZFA 2DUUA 2GCGA 1WAMA 1MXHA 3LSYA 5BNFA 3NAQA 1ID1A 1NAIA 3DBHA 4WLEA 3HADA 3RKRA 4DYDA 5ICMA 3BHJA 4XIJA 1T26A 5KWEA 1SEPA 5JYDA 3WWYA 4CLXA 2HUNA 3NUGA 1LUAA 4RLSA 1NFRA 1GR0A 3OEWA 3WB9A 1E5LA 1UP4A 3HZZA 4BO6A 1V3VA 5FF9A 4N54A 3EYWA 4J9VA 4R9RA 1I10A 1M76A 1P74A 1JLLA 3RUIA 4EJMA 1GYRA 3MWEB 3OJOA 4R4JA 2W2KA 4BQPA 4RDHA 3ULKA 4LCJA 3ZWMA 1RYDA 2WMDA 4BB5A 3GRKA 5ITWA 4XKJA 2ZTMA 3FWNA 1LSUA 4CM3A 2ZATA 2ZJ0A 1NX6A 2ILTA 4ND4A 1CDOA 3KSZO 2PKRA 3ORFA 2AG8A 4PIVA 1X1TA 3VTZA 1GFSA 4CQMA 3WGTA 1VRWA 2NWQA 5TSDA 2EGHA 1H6AA 4JROA 4AJHA 1A7AA 3I6IA 3G1TA 3H2ZA 3DR3A 3FNEA 4WCDA 3PYLA 3GA0A 1MV8A 5L7YA 1CJCA 3ANNA 2PH5A 4ZD6A 1CEQA 1E6EA 1LQTA 4IJVA 3FNFA 3QWAA 1C1DB 1EFLA 2BFPA 3WQRA 4NPCA 3W8FA 4CM4B 3DAPA 5KNLA 3I52A 4Z9YA 1R66A 4FFPA 3L9XA 5ICSA 2AMFA 4R1SA 4WLVA 4BNLA 4WLFA 4HFRA 4CM9D 1LDGA 4GL4A 2AXQA 2FOIA 3P5SA 2P9CA 1BRMA 4EYEA 4YXFA 3AFNA 3IP3A 3NV9A 1K6XA 3V2UA 3FNHA 1KETA 3WQQA 2POQX 4L9RA 4CQMD 5B4TA 3D4NA 1EFKA 2HJRA 4IXWA 1XG5A 2YDYA 1LXCA 3VH2A 4BOYA 4CV0A 4YQYA 4H16A 5IZ4A 2VWQA 1A4IA 2QQ5A 4G2NA 5CHEA 4AJKA 1QYWA 4IDFA 4Q3BA 4WGGA 2UYYA 2VTDA 1ONOA 1KERA 2E48A 4PVCA 1ZFNA 3HUDA 3N7UA 1CQIA 5AOVA 4TQGA 1Y9AA 4GWGA 1C0KA 1ULSA 1EK5A 2P91A 4R3WA 1DIGA 2HMVA 1KBZA 4PN3A 1N8KA 3H8VA 3S1LA 2W4QA 3JQGB 4OIMA 1GY8A 5A9TA 1HXHA 4RF4A 2VNSA 1E1NA 1ISJA 4IDGA 1PJTA 4Q3NA 3QSGA 4FN4A 4EEZA 4DBZA 4BNUA 4BUCA 2V65A 4L73A 3ZWOA 4IMPA 4AICA 3TZKA 3SXPA 1ADFA 1YBMA 1IZ0A 4P4GA 4EDFA 4W82A 3IP1A 5HBRA 4GX2A 5C7LO 5CG2A 5L7TA 4Y6SA 2TMGA 1PZGA 3K73O 1Q7CA 5KIAA 3P7MA 3ZWAA 4IJWA 1WDLA 1ZEJA 2CDAA 4BNHA 4ZU3A 2GD1O 4YQZA 4IQGA 3BA1A 3JYPA 5C7IO 2CF6A 3F5SA 3H65A 3FCOA 3O8QA 1PX0A 3KYCB 4I8XA 2G0TA 1TB4A 1Q0LA 4Y6PA 3U3XA 4BNTA 1MUUA 1Y8RB 3PFWO 3U4CA 3OF2A 5JAZA 3WGIA 2IDZA 3OQ1A 3CTMA 2NVUA 5L9AA 4BVAA 3JQAB 2WYWA 3OECA 5BSHA 3IKTA 1QRRA 5T64A 4ZRMA 1W8DA 4QFDA 1H6DA 1VC2A 1SOVA 4YJHB 1SPXA 1C1XA 1YB5A 2Q45A 1LLUA 2B83A 2CFCA 4NNJA 3JQBA 4YT8A 1PL6A 2NTJA 3JQFA 1M6HA 2X86A 1MG0A 2WD8A 1Y1PA 1H93A 8LDHA 4BKQA 5BSGA 2O4CA 4J43A 5KTKA 2B35A 4EJ0A 3VZQA 3H9EO 2YYYA 3BTSA 3FSRA 4DIOA 4XQ9A 5IDXA 2DPGA 3W4KA 4DC0A 2YV1A 1Q7GA 3ON5A 3WG9A 4QFCA 4JIGA 4NFHA 3WXBA 2W98A 4B7XA 1BMDA 1XLTA 4LVUA 4OSPA 1F14A 5DCUA 3CINA 4FBGA 1E3EA 1DIBA 3QV1A 2WD7B 2Q46A 2VWGA 2G5CA 1V35A 2ZB8A 3ZV4A 4YVFA 5FWNA 2BI7A 3B20A 1P45A 4H7PA 1WXDA 4MVJF 2WYUA 3K92A 4LGVA 1Z82A 3MJCA 3SLKA 3GAFA 3GVCA 2Z1NA 1FF9A 1GPJA 1Z6ZA 4MDHA 1WVGA 3INGA 4EBFA 3MJ4A 4PZEA 5JMWA 5ER9A 1E6WA 1NYTA 3GOHA 3KYDB 4NBUA 2R00C 3VZPA 4KWIA 3OIFA 5IN4A 3N74A 4DREA 2WJPA 4K9DA 4LMPA 4LSWA 2GUGA 4MKRA 4XB2A 3EUWA 4HKTA 4RDIA 1OC2A 3QP9A 3ZU4A 3L4BA 5HS6A 3ASVA 5L53A 3EVTA 3GVPA 3TFQA 3INRA 1L7EA 1NQAO 4U8GA 2XF8A 1HEUA 1PEDA 4CV3A 5KJ1A 1A7KA 2HMWA 2BHLA 1V0JA 1EDZA 1ZJYA 4Z9XA 1WP4A 4XYGA 4D46A 1VKNA 1SEVA 5B4VA 5DP1A 2D3TA 3NJ8A 3I5MA 2JHFA 5A1TA 4R68A 1G1AA 1BGVA 3E5RA 3GNQA 3HFSA 4PG8A 1ZCJA 2VWPA 4CMIB 1TT7A 5K9ZA 2P4QA 1DC3A 4E3ZA 4OQYA 2CDBA 3VKUA 5A05A 4F6LA 1N1GA 1U9JA 1YONA 1YL6A 1GPDG 1YO6A 1ENPA 3VDQA 3S55A 3PHHA 2PZJA 3FI9A 4ALJA 5A5EA 2HQ1A 1R37A 1T2DA 2Y0DA 1ENZA 1Y5RA 2QRKA 3E18A 5KJEA 2I99A 4I5FA 1G0OA 3LT4A 4B7UA 1PR3A 3WNQA 3L6EA 4CUJA 4QECA 3AOEC 3RUCA 3GZNA 2FP4A 2YZ7A 1VSVA 3WLEA 3UFXA 2EG9A 3WBBA 3C1TA 1KEWA 3L77A 3NDJA 1LDEA 3DTYA 4GMGA 4WLNA 5TQVA 3E48A 3MJSA 5DP2A 3IOYA 3E9MA 1PSDA 4P8RA 1U3WA 3ZWCA 3GH3A 2DBZA 1NR7A 2PGLA 1E7WA 3PHIA 3A06A 4W99A 5DF1A 3PJDA 3IMFA 5TNXA 3BTUA 1LRKA 5TJ9A 1I0ZA 1HDYA 1GV0A 1M75A 2FPPA 5IF3A 1U1IA 3KETA 3PDUA 3DMTC 4IGFA 4MP6A 4CLDA 3ZWBA 3KLPX 3FRJA 3FPLA 2ZQYA 3MTGA 3WFIA 1P1JA 3ZU2A 1PJBA 3HJAA 4QT0A 4UREA 5KOIA 2CVOA 2NU7A 3V1YA 4RO0A 4EUEA 4BKRA 5ENVA 4CR6A 1I01A 4C4OA 4NBWA 3GC6A 1ARZA 3STHA 1GEEA 1I33A 4PLFA 3F4LA 4QO8A 3DZHA 1SNYA 4BO2A 2WWRA 3D0OA 4KQWA 2RHRA 2GZ3A 1R16A 4R1TA 3DMTA 4XGKA 3ZHZA 5CDUA 1N2SA 2YV2A 3OP4A 1X7GA 4PRLA 1O95A 3H4VA 1O6ZA 3OQBA 4LSMA 3RC1A 2PTGA 1LEHA 2QW8A 3DL2A 3R3JA 2OMEA 1JAXA 5EJ2A 4XR4A 3UAGA 3WTBA 4BO5A 1PGOA 2WDZA 4R01A 1NFFA 4RPLA 1CF2O 1GUZA 1TA4A 1GZ4A 1MLDA 4J6FA 3V1TC 3BYZA 1Y8QB 3NRCA 4MVJA 4OAQA 5F1KA 4BO4A 3MOGA 5BQFA 5I9LA 3UOGA 4ZA2A 3AM3A 2Y1CA 1MA0A 3W8EA 1CRWG 4L4XA 1M67A 1P1FA 4J1SA 4DPKA 1RM5A 3FR7A 3NTRA 2B37A 1LDNA 3ZV6A 1IB6A 3S2EA 4D41A 1NQOA 2PD6A 3ONEA 4L75A 1R0KA 1XEAA 3L4SO 1JWBB 1A4UA 3HSKA 4IUYA 2GR9A 1XIVA 2UUOA 1WZIA 1BW9B 3D64A 4IDDA 2C2YA 1N7GA 3DBHB 4NIMA 4W7IA 4L4SA 4BNKA 3X2FA 2BMAA 1DIRA 5C3MA 1K6IA 5G4KA 1FXSA 1I5RA 4MINA 3SX2A 1U4OA 1IL0A 3GN2A 5ILOA 5JFOA 4MVJD 1KY5A 2XAAA 1SOWA 2R6JA 3VPHA 3ZU3A 4ZJUA 5JAMA 2CDCA 1ZKMA 4LCEA 3KV3O 3AJRA 1MC4A 3E03A 1BWSA 3I23A 1X14A 1BXGB 1VJTA 3GEGA 4M8SA 1K2WA 2VT3A 3NGLA 4L4RA 4BNFA 5KVSA 2B4QA 3PGJA 4NG5A 4FPXA 4R5MA 2PK3A 1NHGA 1U7TA 3KYCA 5L51A 4Y8VA 4FDAA 4S3MA 2BGMA 2JD1A 4R3NA 4ALLA 1EZ4A 4CLOB 3WWZA 5JAQA 4DUPA 5KJCA 5TGDA 3NDRA 2EKPA 4TVOA 4YAKA 3PJGA 1P0FA 1SB9A 4IQ8A 2W2KB 4TSKA 2V6MA 1SO8A 4B4VA 3I9OA 4YJHA 2PNFA 2X5KO 1LDBA 1OOEA 3ITKA 3U4DA 4Z9FA 2E4AA 4YT5A 3TZ6A 1TLTA 1CIVA 2Y0EA 3O38A 4P4NA 1GYQA 4OM8A 3RBXA 1NTOA 3P19A 4BGUA 1ZK3A 4I1IA 4OQZA 3WOHA 3DAGA 5IJZA 3E82A 3PJFA 4GSKA 4KDEA 1B7GO 4R69A 1HETA 4ALMA 4H15A 1MG5A 1CETA 1I32A 3WS7A 1E7RA 3L6DA 1P33A 1F17A 4G5HA 5TT1A 3RUHA 1RPNA 5L3ZA 3U62A 3O4RA 2BELA 3FTNA 5AYVA 2V6BA 4AL4A 3PXXA 4CM1A 3AI3A 4NI5A 1FMCA 5BNTA 4NK5A 4QEDA 1NFQA 1E1LA 4QUKA 1E7SA 4XB1A 4E12A 2EHDA 2ZTVA 2H63A 4HADA 2X9NA 1U8XX 3JD2A 3OHSX 4PLGA 3FD8A 3GUCA 4RPHA 3KXDA 4FJ1A 3K8ZA 4E5NA 1Y6JA 4GX1A 4L74A 1YS4A 5JE8A 1BDBA 2IEBA 3VH4A 1GD1O 3NEPX 1R15A 1RJWA 1HDRA 4GI2A 3K2EA 3WGGA 5TLSA 3WJ7A 4DYVA 5T8KA 1U4SA 1H94A 3BMCB 1RWBA 1YRLA 1NVGA 2GGSA 4O6VA 2Q1UA 4URFA 1KVQA 3DQPA 1YL7A 2UV8A 4PLVA 3ZW8A 3AM5A 3BXXA 4WOJA 4LK3A 3T7EA 5A4DA 2QRLA 5CEJA 1HE3A 1AE1A 3L6OO 3R1IA 3ETEA 3RBVA 1WWKA 3KEQA 5KJFA 4B3HA 2ZCVA 1UAYA 1DJNA 3GGOA 4WJZA 1DFGA 3ABIA 5EERA 4R1UA 4UUOA 3WGQA 4YJFA 2H6EA 1TT5A 3ZWYA 3EZLA 1Y7TA 4RZIA 1O94A 3W4IA 3NGXA 1ZO8A 4J4BA 3ENNA 4GX5A 1O0SA 5ILGA 1YOVB 1PS9A 4YCAA 2FHSA 2BF7A 3NKLA 2C59A 3BAZA 3C1OA 4AVYA 4BNZA 5I9NA 4P38A 3G0OA 4FGWA 3ETDA 4YAJA 4B79A 3WTCA 3MTJA 5GZ6A 5THQA 4Q3CA 3I9MA 1P1HA 4CM6A 2P9EA 4B7CA 3RBZA 4MP8A 3LQFA 4A0SA 2X0NA 1AUPA 2PGJA 3JQ6A 4RF5A 3KM0A 3ZHBA 4PG4A 4CMIA 4OOEA 2C0CA 1HT0A 1XELA 1DXYA 3F47A 2PWZA 2D5AA 4AJ4A 4XDYA 2RCYA 4PG6A 2C5EA 2VQ3A 4CMEA 4U0JA 1E3JA 3PWZA 5KJ6A 4LMRA 2OFPA 2H9IA 1QV6A 5BSEA 1JA9A 1U28A 5L45A 1YQDA 1UDCA 4W9NC 2NVUB 5G4LA 3MEQA 1PJCA 4CMJA 5C7OO 5CDGA 4XJSA 2FMUA 3WGZA 3PYMA 4PVDA 3O26A 3K5PA 3AWDA 5H82A 1DDOA 4ESOA 2ZYAA 2WTBA 5TT0A 5AQ1A 4PLTA 2ZB3A 3JQ7A 1J4AA 1QSGA 2EERA 3PPIA 3PEFA 4IJKA 3PQDA 3ASUA 2WD7A 2BLLA 4HNGA 2DBQA 1E92A 3TSCA 5JDIC 3VH1A 3HHPA 2V7PA 5CDSA 3ZHYA 1AGNA 2YFHA 3JQ9C 4XR9A 5FI5A 2PD3A 5K6AC 3WDSA 5IZCA 1V8BA 1E0DA 3BMOA 4DQVA 5F21A 1MFPA 1EE9A 4R51A 2QIOA 1AXEA 3U4IA 1UXGA 3LF1A 2NU8A 1I36A 4IDBA 3AY6A 3GFBA 4PZDA 3H5RA 2ZB7A 2FRDA 2J5KA 3RC2A 5F5LA 4E2YA 3B1KA 3EGOA 5IDQA 3K9QO 3GHHA 4PGFA 1TI7A 1UXJA 1ULUA 2O7QA 2YQ4A 3JQGA 1VKOA 3JQ8B 3TZHA 3V5NA 2AEJA 9LDTA 5AXDA 5G2OA 4DIBA 2JD2A 4J1QA 3A14A 3U9LA 2CUKA 3AU9A 3QHAA 1DRWA 1Z7EA 3KLMX 5GY7A 3GDOA 4GVLA 4NHEA 3ZNPA 2IZ0A 3ADOA 2WYVA 1DLIA 2JAPA 3HDQA 4CUZA 2C82A 2OO5A 1B14A 3GPDG 1EVJA 6LDHA 4J9UE 3ICCA 3F4BA 2PZKA 4UUNA 1EDOA 1QYDA 1PZHA 2PV7A 4RL6A 4NQZA 3LDHA 5DN9A 4A03A 2Y1EA 1FDUA 1P9LA 2BGKA 3IL2A 1H9BA 3JQ7B 2O23A 4JXKA 1IHXA 1KEUA 2D1YA 1RM3A 4RVHA 4XQGA 2EJVA 1R4MB 5T5QA 5TS3A 4MP3A 2BGLA 2DTXA 5EQDA 1I3NA 1YB4A 3EAGA 3NTOA 3BMQB 4MVJH 2Z1MA 3ANLA 2EW8A 2OP0A 5HWSA 1YXMA 3KUXA 3DAFA 3LC1O 3TRIA 4BIIA 1PU2A 3CUKA 4CJXA 2OGUA 2PD4A 1WDMA 4GKBA 4R54A 1EVIA 1D4FA 1DFHA 5JBIA 1J49A 4CM7A 4KDFA 5CFZA 1H5QA 4BNVA 1GYPA 1K89A 1N7HA 1B3BA 4JP2A 5MDHA 2LDBA 4MVJP 5AXCA 5H81A 1GDHA 2BRUA 1KVTA 4GGOA 5I8ZA 1ADCA 5U9CA 1NWCA 3E8XA 3OJ0A 3NX4A 2JCYA 4NH4A 4Z0PA 3IUSA 5CPBA 1T4DA 3DHNA 4BO0A 4GBJA 4INAA 4GWKA 1E3WA 3DHEA 3W6UA 4JGBA 1XHLA 2X0JA 4QQRA 3E6AA 1MB4A 1H6CA 3SEFA 3T4XA 5A03A 2VTEA 1U2DA 1FDWA 4CV2A 2OOSA 3X2EA 4Z3KA 3FWZA 5JC1A 4XEHA 2V6FA 1LTHR 2FR8A 1X0VA 3GHYA 1OBFO 3QWFA 3OM9A 2B0JA 3DTTA 1JW9B 4GLOA 2ZYDA 1A5ZA 1EEHA 2GERA 3DEYX 1KEPA 4DLBA 1UJMA 3QWBA 3DOJA 2EWMA 3LF2A 4LN1A 4ND5A 2Q99A 3DZFA 5AVOA 2AQHA 4J4TA 4ZQGA 2Y1DA 3B1FA 2Q50A 4YAIA 1ISFA 2UVDA 1HYHA 4UULA 3ICPA 5TF4A 1E3SA 5FEUA 1ADGA 4Z6KA 3MCVA 4U7WA 1Q1NA 4BNJA 3BMQA 2JAHA 2Q49A 3C3XA 5DBFA 4NK4A 4YAGA 2O48X 4E21A 5TIIA 1OFGA 1Z75A 4J90A 1GEGA 5G0WA 1UUFA 4Y9DA 2VT2A 3AY3A 4XDZA 1N9GA 1XSEA 1HDZA 4HXYA 1QP8A 4E13A 3NTQA 1T2FA 4HX5A 4N5NA 1NBOA 4A73A 4NBRA 1GZ3A 5FYDA 2IODA 3ITDA 4HUJA 3LT0A 5ADHA 1YVEI 3JCZA 1H9AA 3GG9A 4WCFB 2XPCA 3TQHA 2GO1A 4KTVE 4FR5A 2NADA 1DOHA 2Y1GA 3F46A 4J91A 1QKIA 5JO9A 1T1SA 5IXYA 5HRUA 4E33A 1GAEO 2JFFA 3JV7A 5HTOA 4XYLA 3Q3CA 2G82A 4BKOA 4GQAA 4QX6A 1YQGA 3M1AA 1YOVA 2PA3A 3D3EA 4UAGA 4YBZA 4D3FA 4DBVO 4UVHA 4GPD1 5L4LA 4F45A 3Q9UA 5U1PA 2O50A 4WASA 2I65A 3TL2A 3ZCXA 5A3JA 2DBVO 2W2LD 4K6FA 4XYBA 4E6PA 5JCXA 2BFMA 5A04A 2X9GA 4KP7A 1IY8A 5JYEA 1NNUA 3G3EA 1UXKA 3BMNA 5ES3A 2VOJA 1W73A 3WR5A 1PS8A 5I7EA 1U5CA 2EEZA 2VHYA 1LX6A 2P68A 4XQCA 1X13A 2X5JO 5DULA 3SC4A 3ZGYA 4TRRA 2BD0A 3KBOA 2IYPA 3F1KA 3IS3A 2GASA 3OMLA 4NFSA 4AJJA 3OIDA 2Y93A 1CWUA 4I5DA 4DMMA 4ZHSA 3PYXA 3TDKA 1O8CA 3ZWXA 4R5HA 5JDCA 4ZQFA 2I66A 3C85A 4I5EA 2Z5LA 3TZCA 3GGGA 1UZNA 2A92A 3B70A 4DVJA 1M6WA 4M54A 2O7SA 4Q3AA 1X0XA 1WNTA 1TEHA 5B12A 5HM8A 4B3JA 5JO0A 2OL4A 4JBGA 1N5DA 4A7PA 5L7WA 5JPIA 1D1SA 1VSUA 2AQKA 5I7VA 3RFVA 3O03A 4U6SA 1HTBA 1H2HA 4KQXA 5DT9A 1XCBA 4D0SA 2A35A 3GK3A 1EBUA 1T1RA 2I67A 3GRPA 4FFMA 2B5WA 4YACA 4U0KA 4XX0A 2FR0A 1OI7A 3KYDA 4EUFA 1LLQA 4EGFA 1JVBA 1E3WB 4JCOA 4W9NA 4B8ZA 1PWZA 2FPIA 3U49A 1RM4A 1G6KA 3P2OA 3NT4A 1VE9A 3SBOA 3ZV3A 2UUPA 3WIEA 2EP5A 2VOEA 3PHJA 4LVCA 3RJ5A 5B4UA 1NXQA 1EVYA 3K96A 3JYQA 5A5FA 1QORA 4OXNA 3R6DA 4K1LA 4X54A 4E0BA 1LU9A 3AUTA 3RWBA 3PVZA 4HWKA 3RC7A 4BNIA 4BHTA 5BT9A 1PGJA 3V8BA 4RVUA 1I24A 5C5IA 1UZMA 4MO2A 2GN8A 2EIHA 3FNGA 3I4CA 3KSUA 2VUSA 1JKFA 3PDJA 5F1OA 3PHGA 4FJ0A 4BKPA 4N18A 3ETGA 3HN2A 4OJNA 3G79A 4G81A 2VRBA 2ZTLA 4RPJA 1LQUA 2O2SA 3H9JA 1AXGA 3AI1A 1D3AA 1U3TA 2PR2A 3F3SA 3H2SA 3PGXA 4DPMA 4RV9A 1SC6A 1J6UA 4CR7A 4BMVA 3OIGA 2P2SA 4E2WA 5CP8A 1BVRA 2C07A 1ZNQO 3AU8A 1M66A 1OZAA 1IE3A 4LRTB 3PLNA 4JJIA 4CMGA 3DDNA 4BB6A 5IG2A 4RCVA 2FSSA 4J0EA 1KVUA 4YAEA 4OGWA 1JTVA 2NUAA 2X5OA 4NR0A 4BO3A 3GVIA 1BG6A 1U2GA 1D7OA 3OSUA 5ER6A 4E2ZA 5JSFA 4GSLA 4CODB 1B16A 3DO5A 3ROPA 4TKMA 4YJFB 4YT4A 3CIFA 3VPXA 4OOFA 2DM6A 2A4KA 2D59A 5THKA 1YL5A 2AHRA 4JX8A 3PJEA 1ZXLA 3TN7A 1O89A 3M2TA 3QVXA 1QLHA 5J23A 1GQQA 4UEOA 3A4VA 1E7YA 3FF4A 5F3RA 8ADHA 2JHGA 4BKUA 2NV6A 3ZW9A 3SVTA 2OBYA 3KSDO 2OORA 3EMKA 3GNTA 2B4TO 2CF5A 4R16A 2E82A 3LT1A 1HL3A 3PP8A 2HKIA 3EK2A 2WM3A 4DLLA 1T2EA 4D44A 2FSVA 3PZRA 3RUEA 2AEFA 3JD4A 3IIEA 4DTIA 4F6CA 1FDVA 2JFGA 5EIOA 4KWHA 1E7QA 3AUAA 4CL3A 4PRKA 4HV4A 3CMMA 2J8ZA 3DOCA 1C3VA 3Q9NA 1P77A 1VJ1A 1H6BA 1EK6A 4IGEA 3VDRA 4CM8B 3CKYA 1WW8A 1I2BA 2WSBA 3I3OA 3JSAA 6ADHA 2FZWA 3AUSA 3TOZA 2AA3A 3DBRA 1U5AA 4PFJA 5COBA 1PL7A 5TJHA 4XYEA 4II2A 1CYDA 4GGPA 5TX7A 3RUFA 1PGPA 3QLJA 2X4GA 4YB8A 4EJ6A 2ZQZA 4ND1A 5DOVA 3TNLA 3K30A 4MIEA 1B8UA 2DTEA 4RGBA 4ILKA 1ISGA 3SJ7A 3IJPA 1NASA 3Q2IA 4AJ1A 4J7CA 1DB3A 1DHRA 2HDHA 3UGKA 3VPGA 2C7VA 4EW6A 1T2CA 1Z73A 3I4FA 4BGEA 3QJ5A 3SC6A 4IPTA 2NVBA 4DMLA 1ZZEA 3LLVA 2NVWA 3F5QA 3ZWWA 2GYYA 4ND3A 1B8PA 1PL8A 5T67A 2B5VA 4E2XA 5DBGA 2ZIZA 2Q1TA 1C1DA 4CMAA 1U3VA 2HMTA 3D7LA 4CLRB 2VZ0A 4XWYA 3WMWA 3CEAA 5G0VA 4MVJM 4N7RA 4P4LA 3GEDA 1Z74A 4RORA 4NJOA 5KVVA 4D79A 1A71A 2YQ5A 1W0CA 2AQ8A 4BMNA 1EMDA 2VHVA 1U8FO 1IUKA 3D5QA 1LNQA 1ISHA 3RJ9A 4OH1A 3EVNA 3ZWPA 5TRTA 3PWSA 4IBOA 4IDCA 4JK3A 1VM6A 3F9IA 1B15A 1V6AA 2YFQA 4GVXA 4O59O 2HRBA 2VNAA 4BV9A 2G1UA 1NVMB 1K3TA 1O9BA 2PY6A 2NM0A 3HDHA 3RSHA 3VAZA 3ZN2A 1I3KA 5IN5A 4IM7A 2HJSA 1OAAA 3DZGA 2SCUA 3Q0EA 3FTPA 3GG2A 1P1RA 2X8LA 4WOKA 5K0ZA 4OSOA 3KHUA 2AW5A 4YT2A 3O9ZA 3IQDB 4J7XA 1KIFA 1ZUD1 3KB6A 2DUWA 4DIFA 5L4NA 1TXGA 3AW9A 5ITVA 3LT2A 4TRNA 4Y6RA 4DQXA 1Q2XA 4EI2A 3WYBA 4OHUA 5CAEA 1MX3A 3LK7A 3IKVA 2AE2A 3OETA 4NJMB 3TZQA 1JAYA 3DBVO 3RCBA 1BTOA 4G65A 4GAEA 1OC4A 3SJUA 5L40A 1LC3A 4WCFC 1BDMA 2AQIA 2WEKA 4IS3A 4DRYA 4MJLA 3GLQA 5HA5A 3JQAD 1X15A 5KCZA 2Q2WA 1T4BA 1DRUA 3H5AA 3PIDA 2JCXA 2GSDA 2Q2QA 4W4TA 2PZMA 4JLWA 1ENOA 4TKLA 2O4UX 1FK8A 2VWHA 1PTJA 5KVQA 3P2YA 1U7HA 4MIYA 3WX0A 1GV1A 4UVGA 1JDJA 2YDXA 4QO7A 4EITA 3H9QA 1VJ0A 2PGDA 1E1MA 3RUAA 2X0RA 2YHIB 1T2AA 1AHHA 1ZMOA 4IIUA 2Q1WA 1DLJA 4FFRA 4XD2A 3LZ6A 2P5YA 2G76A 3PFFA 1Y9EA 4CUKA 5EQFA 1ISIA 4M55A 3D5TA 2CMDA 3FR8A 2E6UX 4N5MA 3JQEA 2ZTUA 3CZMA 3PQFA 3DMYA 3ROMA 4O63O 2P4HX 1JVSA 4J0FA 2C5AA 3CMCO 4IZHA 5GMOA 1WPQA 2Y66A 3AI2A 1J0XO 2YY7A 1EBFA 1N1EA 2O3SA 3GMSA 3R0IA 4OKNA 1I2CA 1TVEA 1UDBA 4XIYA 3WJAA 1LSOA 3ZHXA 1K5HA 2CSUA 2F1KA 1LBEA 3CPSA 2LDXA 1ADBA 2Q4EA 2ZKLA 4JP3A 4RPGA 4XGNA 2FPGA 1VL6A 2DKNA 2QX7A 3PK0A 4K6CA 3I1JA 5EN4A 3GZ4A 1IULA 1DC5A 4LW8A 4MVJE 1UXIA 2ZYGA 1KY4A 2GN9A 1N9GB 1ONPA 4XGIA 2NU9A 1X7HA 3BHMA 2QZZA 5CG1A 4E5YA 3WMXA 3I6QA 2OP1A 3FPCA 4PLWA 2B4RO 4R9SA 1LSJA 2C7GA 4UEKA 3VZRA 2F00A 1XKQA 3NT5A 3VH3A 3DXFA 1HDOA 4PZCA 1VL8A 4IDEA 4RQUA 4XRGA 1EUCA 3QVTA 3HG7A 4KUHA 4M87A 1D8AA 5F1PA 3ZNQA 3CZRA 2CNBA 3EY4A 2O2YA 4JBIA 1FJHA 4HP8A 1XQ1A 5DCYA 5A9SB 3VKVA 4I9HA 5H83A 1CERA 3DZJA 1NWHA 2AE1A 3GNSA 4D43A 1I3LA 1YJQA 3VTFA 3D4OA 3Q6IA 4CMCA 5EESA 3MOIA 3AK4A 2VRCA 4HFMA 1Q0HA 1HRDA 3WNVA 4TZKA 5GZ1A 2V6GA 1JKJA 2HMSA 3PI7A 1HF3A 3JYNA 1LI4A 2Q4BA 2PFGA 5JY6A 1J5PA 3K2BA 5JW6A 1PQWA 2E49A 3AUUA 5AXBA 3S2FA 2I6TA 4M86A 1HKUA 1M2WA 2X58A 2D0IA 3IAHA 1K0UA 3TL3A 4DLAA 3RFXA 4E5PA 2RBEA 1MP0A 2YHUA 3VVCA 1XWFA 3DZKA 3IDSA 3IC5A 4CPDA 4AJ2A 4BNMA 3RAJA 3UKOA 1PGQA 5JNLA 5EINA 5A3VA 3RKUA 4LRSB 4AJOA 2VCYA 1L1FA 3DOOA 3WQSB 4BNXA 1HLDA 1YKFA 1YJ8A 4FS3A 1GADO 3WIDA 3ZWVA 2YJZA 2VRCD 1I30A 3WGHA 1BVUA 1F06A 2I3AA 4CMKA 3OJFA 4PG7A 3W4JA 3GQVA 1F0YA 1FDTA 5COQA 1UDAA 4Q9NA 2VN8A 1WMAA 3ONDA 1LDMA 1FDSA 1EE2A 1YE3A 3QW2A 4J4HA 5LC1A 2Q1SA 3WYEA 2VUUA 2IZZA 4CM8A 3JQ9A 4J1TA 4LISA 2CD9A 1PJ4A 1A9YA 1UH5A 3EZYA 3U09A 3KRTA 4HFNA 4NDNE 1NVTA 3BZUA 3KEOA 3HN7A 3OEYA 3PRJA 1HLPA 4BQRA 2UDPA 2FN7A 4WUVA 3MZ0A 1SMKA 4OXYA 1MGOA 1PJ3A 3BHIA 4NZ9A 3OFSA 3AOGA 3LYLA 1E77A 4EEXA 3HFGA 3GGPA 4BGVA 3JQBC 2Y99A 1ZSYA 1X1EA 3HNPA 1E1KA 4ZQEA 3WSWA 3TF5A 4JJGA 4A5OA 1UR5A 2O3JA 2XOXA 2VHXA 2Y05A 3ENKA 3HQ4O 4FC7A 4BV8A 2D5CA 2GNAA 4FIZA 4UVDA 2D8AA 5G0SA 1W6UA 2OBNA 4UUMA 4YJGA 1GTMA 3UUWA 3ZZNA 4HY3A 1GQYA 4AFNA 9LDBA 4PG5A 4F46A 3EHEA 4Q3DA 1Q7BA 3QRWA 4F3YA 1A9ZA 3LVFO 4CLOA 1A27A 3GDFA 2W2LA 1E5QA 4M89A 4WNIA 3A1NA 4WE3A 4C7JA 4A2CA 1PS0A 3OQ6A 3UCXA 2H1SA 4I9UA 4U6QA 4ZQBA 1YH3A 2D2IA 3DFUA 4QTZA 3TFOA 1DIAA 2JFHA 4EZBA 2J5RA 5I9MA 3RU7A 3GN1A 1PJ2A 3Q2KA 3MWDB 4Q3EA 4A10A 1BHSA 4I08A 4I9NA 4YRAA 1YBAA 1JU9A 4TMFA 2EF1A 3S2IA 4IXTA 2OUIA 4XQEA 3WBFA 3HDJA 3DZBA 3ZNNA 4DC1A 3EC7A 4ZQHA 1QV7A 4FQ8A 3QE3A 4D42A 1E3LA 1XGKA 1X7DA 3PQEA 3RVDA 2NTNA 3RFTA 4IJUA 4WLUA 4XCVA 2IXBA 2Y1OA 3VHRA 4D3DA 3KOUA 4FCCA 3ZNOA 3CE6A 3T4EA 5ENDA 2BFOA 3IJRA 5KVCA 2VHWA 5I7SA 3T7CA 4J1NA 1JQBA 1R12A 1HE5A 5C37A 2I5PO 2D4AA 1QYXA 3UVEA 4K26A 1ZH8A 3INTA 1T24A 2IE0A 5A02A 3RROA 5JAIA 2DFVA 4S1VA 5MGBA 1NP3A 1L7DA 3GF4A 3VOSA 3VPSA 3RC9A 1QG6A 4WECA 3FN4A 2VZ9A 4B3IA 1HDCA 3K31A 1BXGA 3QA9A 5A06A 1PIWA 1BSVA 3D3WB 1I2ZA 2RH4A 1ZIDA 2FZEA 3FHLA 4YYZA 3U0BA 1ZJZA 2EGGA 4E4YA 1KVRA 1HSOA 1ML3A 1PR9A 2HSDA 3JQ8A 3QVOA 1ZMTA 5KKCA 3TWOA 2Y1FA 3RQSA 1DSSG 3GDGA 3KYBA 1DJQA 3RI3A 1RM0A 2ZK7A 3KVOA 2I76A 4OO3A 5I7FA 3C8MA 4TROA 2Q2VA 4MVJG 4ONEA 3KZVA 5HS4A 1EUDA 1IPEA 4RLHA 1DEHA 4AJIA 3DBRB 3PWKA 3NJ4A 1GCOA 4W6ZA 2UAGA 3ST7A 1P0CA 4DPLA 2J6IA 4WCFA 3RIHA 4D45A 3DBLB 3ROQA 4WKGA 1KVSA 4AG3A 3CSDA 4ZRNA 4RVDA 1EVZA 4BGIA 1R6DA 1ZBQA 5A9RA 3BTVA 2QG4A 1E6UA 1DC4A 3GY0A 5T6BA 3W6ZA 4CM9A 2WE7A 3I9NA 1P3DA 4J3FA 1RYEA 5IAAA 4BNNA 5GZ3A 4KMSA 5T8KC 5KKAA 2HU2A 4B4WA 1C0IA 4BS9A 3WYCA 2W90A 4MVJI 4MIOA 2XXJA 1V3UA 1E3IA 3HWRA 4I5GA 4E5MA 2C2XA 1HWYA 3HB4X 1ZSVA 5I8WA 2PZLA 1DHTA 4DGSA 1YDEA 1JKIA 3ONFA 4JJFA 5K6AA 3ADPA 2NQ8A 3M1LA 2P5UA 3BMNB 5L95A 4RVFA 3GT0A 4JBHA 3K6JA 1U3UA 5DNAA 3GMDA 3LU1A 4AJPA 4CMBA 4AJNA 1LDYA 4IZIA 1PGNA 4Y67A 4RVSA 4D3SA 2VYVD 1Y8QA 4QXMA 1IOLA 4NBTA 3BIOA 2GN6A 2ZCUA 2CZCA 2X1HA 4A27A 4FB5A 1P44A 3G17A 3OICA 2IXAA 2IEDA 3DWFA 3N58A 2HMUA 3COSA 3G1UA 1R0LA 4YEDA 1H2BA 3NT2A 2OHXA 5CEEA 1ZEMA 4YPOA 5B1YA 3RD5A 1IZ9A 1SAYA 2NTVA 4GMFA 2DU8A 4TZTA 1R0SA 1KYQA 4L8VA 3D4PA 4D0RA 3BMOB 3DC2A 3M6IA 4RPKA 1BXKA 1ENYA 4YWJA 2Z95A 4NBVA 2HK7A 5IZCC 1DBVO 3C7DB 1S7CA 4KZPA 3WICA 2VYVA 2J3KA 4OXKA 3U4HA 4XZ3A 5JDIA 4WPGA 4E32A 1F8FA 1LC0A 2PKQO 3WGYA 3BMCA 3I9JA 4CQLA 2DC1A 3DZIA 4FC6A 3QQPA 4NJMA 1VL0A 1AN9A 5JDCC 1I3MA 1HE4A 2EKQA 2DPHA 2C29D 2PLAA 2VHZA 3H6KA 4JNKA 4N5LA 1ZSNA 2DAPA 3L07A 3OJLA 4WNCA 4FSHA 3SLGA 1PQPA 1B3RA 2Y68A 1HYEA 5DBIA 3GFGA 1GCUA 1YB1A 2J5QA 3FBTA 1ONNA 1W4ZA 2NSDA 3U5TA 4ALKA 4FW8A 3F1LA 4UUPA 4PLCA 1HSZA 4UEJA 1P31A 2NU6A 2X22A 1CQJA 1VPDA 5U4QA 2NQTA 3GEMA 1V9LA 1JN0A 3PIIA 1MFZA 2E37A 3F6YA 4MKZA 1NAHA 4CV1A 4FJ2A 1EUZA 4O0LA 1IYZA 4GH5A 3PZBA 2PKQP 4IY1A 4M1QA 2YW9A 3M2PA 3OA2A 1XYGA 1QXSA 1WDKA 1D1TA 3S2GA 4DL9A 3GUYA 4GKVA 2I3GA 3UHAA 2BKAA 4CQLB 1F12A 5BSFA 3ZV5A 1JWAB 1ZK4A 1C0PA 1HZZA 1IHYA 5FI3A 4Y98A 2YUTA 3ROKA 4Z0HO 3H9UA 4PCVA 3H3JA 3ZU5A 2X7HA 4WEOA 4BMSA 4IINA 2FR1A 5IDYA 3ZI0A 4DWVA 2DBRA 3D1LA 2EKLA 3VZSA 3B6ZA 3DB2A 4DQUA 1XU7A 3E9NA 4Q39A 3I9LA 2RIRA 5DCWA 4B8WA 1YQXA 5CDYA 1QMGA 4W7HA 1GU7A 2GZ1A 3AFMA 5EPOA 3GR6A 3G49A 4IMRA 4HFJA 4RF2A 1QLJA 1PJQA 3UICA 3MJTA 1YBVA 2CVQA 1ZK1A 3OBBA 3HE3A 2R2GA 4ND2A 1DAOA 3JYOA 1Y5MA 3UCFA 4O1MA 4TRJA 2JD0A 1B26A 4GLLA 1KC3A 5DZSA 3OH8A 4HNHA 4KUGA 5LDHA 3NYWA 3JYLA 4YA6A 3AY7A 3C7CB 1DC6A 2NNLD 4AJEA 4PLHA 1V3TA 1K6JA 1LSSA 2EJWA 2Y0CA 4EUHA 4J16A 2IYOA 2RAFA 1HDGO 2B36A 4ZVVA 2OXIA 5G0TA 1SBYA 1LLDA 3BTOA 3GZNB 1DRVA 4TWRA 5G4KB 4OL9A 1SCUA 5B37A 4XA8A 4YDRA 3DFZA 2DTDA 4WEQA 3S8MA 1YDWA 1C1XB 2DLDA 4FFLA 1EQ2A 4CL8A 3GVXA 2FWMX 3FBGA 2HO5A 3H7AA 2J3IA 4JQCA 4OKIA 2Q3EA 3JQAA 2HRZA 5DOZA 1HDXA 1NM5A 3PHLA 3MJEA 5JY1A 1N92A 2JKVA 2ZJ1A 3C7AA 3E9QA 3H9GA 3TJRA 4P22A 4A26A 5G0UA 4GX0A 1NPTO 2QRJA 4H3VA 1Z7BA 3W8DA 1BXZA 2O3UA 1EQUA 4RF3A 4FOSA 2FY8A 2RH8A 2TMDA 4YTEA 4ID9A 3PLRA 4HBGA 3JTMA 5EMHA 4CLEA 3ZDFA 1Y81A 3DONA 1NQ5A 2OZPA 1TT5B 2C20A 3H5NA 5JS6A 2W8ZA 5IXSA 4RZHA 1ZXBA 2DQ4A 3RUDA 2PH3A 4J7UA 5FFFA 3D3WA 4BO8A 4E30A 4E5KA 4OYRA 4CMHA 4L0QA 3UN1A 1OMOA 2RHCA 4ALNA 4J2OA 1UXHA 4CR8A 1O5IA 1NQTA 2VZ8A 4NU5A 1KOLA 4QSMA 1XR3A 5LDGA 4BO1A 4Z0TA 1ZK0A 4Z3DA 7MDHA 4DXHA 3R3SA 4IIVA 4DA9A 1DIHA 2IRWA 2Y67A 3LC7O 4C7KA 1GQ2A 2BH9A 2DFDA 2X0IA 5CDTA 4MKXA 4B4OA 5IDWA 3PTZA 4ROSA 7ADHA 3HB5X 4BO7A 1C0LA 4NU6A 2A9FA 4YR9A 1B8VA 2YHIA 2XXBA 3C24A 1Q0QA 2HK8A 1NR1A 4YRDA 2GF2A 3QWIA 1SB8A 4R1NA 2ET6A 4RJTA 4J2HA 3L4BC 4NMHA 4FD3A 1LJ8A 4KTTE 3RU9A 4BNYA 2NACA 1DFIA 5BR7A 1KEVA 3HDYA 4TVBA 2R00A 1F8GA 2VUTA 3Q1LA 3GPIA 3O8QB 4NFYA 1UAGA 3CXRA 5DDIP 1E7MA 1PQUA 4WK6A 3GVHA 1NPDA 3JQFC 2WE8A 1DAPA 4ZGWA 3UXYA 1C14A 4IS2A 1T25A 3V1UA 4MOWA 3Q11A 5F5NA 1HE2A 1QYCA 1VI2A 4XJTA 4ZICA 4CM4A 4TRMA 3EDMA 4R41A 2HK9A 3MJVA 4YJGB 5BNIA 2QYSA 3NDIA 4XRRA 5CPFA 1KS9A 1RKXA 3WLFA 3TPCA 3B1JA 1VLLA 4BL5A 4ZN6A 4FOOA 2CVZA 5EL0A 4B4UA 1Y8RA 5LCXA 1P1IA 1YGYA 2HAEA 3RASA 3UCEA 4CLHA 4ITUA 1B2LA 1UP7A 4BNGA 4BNWA 2EV9A 3CH6A 2NLOA 3ANMA 2JJYA 4UVEA 4UVIA 3L9WA 2QZ9A 2EW2A 1GZ6A 2QHXA 3ZH2A 2X9VA 1ZVMA 5AXAA 5JLAA 4RVGA 1UZLA 4XYMA 4PLYA 4RQTA 1PJLA 1UP6A 2EXXA 1WMBA 1GL3A 3H3FA 4II3A 1GUFA 4MPDA 2BFAA 1WLYA 2I9PA 1B0AA 2O3RA 4KOAA 3ZWNA 1S6YA 4FGSA 3UW3A 1MC5A 2VYNA 4WLOA 3KO8A 1ISMA 3QVSA 1IPFA 3OJEA 3WGOA 1QYVA 4O5OA 3WSVA 1AHIA 3W1VA 5CEFA 5JXWA 2GDZA 3EW7A 3DHYA 2GZ2A 2GLXA 3C1AA 1XU9A
chains in the Genus database with same CATH superfamily
3VVBA 1RC1A 1SUAA 1XQ6A 1YFKA 2Q41A 2J3JA 1EG2A 4H1HA 2QMOA 4PAGA 3THYB 5JC8A 3FTEA 3DYBA 1VJDA 1R4MA 3TE7A 2AG5A 1HZJA 2P9GA 1YWGO 2XITA 4IICA 4M1WA 4HDNB 4QXQA 4R98A 5COAA 3JD0A 1NOKA 2ADFA 2JNWA 3FUCA 3UW1A 2E87A 1Y5LA 3Q85A 3KUUA 3A28A 4OH7A 4P7FA 2DVMA 1PBNA 3HCDA 3QBVA 2GPTA 1K0FA 1J97A 2E7ZA 3OA0A 3U3RA 3VFDA 4AZSA 4BBAA 4COKA 5JZSA 2VXOA 3SVLA 1R4NB 3O93A 1NKTA 3HYLA 3RBAA 1BD4A 2C2GA 1ZS9A 4PLZA 4TQAA 3DO8A 3BD9A 1V41E 1TJNA 5IFLA 1TUBA 1Z88A 2O0HA 5EKDA 3ICEA 2CY0A 4G0WA 2B69A 2QYTA 5EZYA 3JD3A 3GWGA 2NZWA 3ABOB 3IV7A 2C54A 2QF7A 3WV4A 5ELLA 4JR2A 4PZZA 2IBSA 1E0SA 2NZXA 1LRLA 1GNQA 1ZW1A 2PX2A 4NAVA 3THWA 1T1IA 4CM5A 4B09A 3EXEA 5IBQA 1XDWA 2QX6A 4XOIA 1KGDA 2OV1A 1TU0A 1OYOA 3VX3A 4JHLA 3WSTA 2WAYA 3V2HA 2JL1A 4E31A 2VDOB 2UXBB 1QGOA 4BO9A 4KNWA 4AAYA 1H0KA 1Z13A 1DO8A 4RGQA 4A5SA 3BWEA 4P5EA 2BFCA 5ECDA 4UDYX 1JLRA 2ZRLA 3IMEA 5FB3A 1RI2A 2OFXA 3BPSA 4UHCA 1W25A 4HNQA 4ECEA 1JDZA 2GCOB 4PQEA 4I1OA 1X6VA 5HNKA 2CHVA 5BOSB 4PO8A 3HCFA 3KDSE 3WFJA 1Q3HA 5KYWA 2I78A 4GOXA 4MEJA 1FU8A 1NDUA 4UAUA 5JMPA 3NGMA 3R0ZA 2NW6A 5ETJA 3AM4A 3ND6A 1I13A 1E9BA 1JAZA 4JC5A 3ZBPA 2O3TA 1KIMA 3GAMA 4TTRA 5FOSA 1I7SB 2ZUBA 4MVYA 4B35A 4WXPA 5KYYB 3TOXA 1XA0A 2PCLA 4FFNA 1EUCB 2HHLA 3FFWA 4KPUB 2RCNA 4CQMB 4EB8A 1GGFA 3D3QA 1HYBA 3ZIUA 5JCJD 5HQJA 2O5CA 1ECJA 4HQOA 4MHOA 1NXVA 2Q6LA 3PV0A 1UWVA 3IEXA 3NAQA 5B3JA 5LBIA 5JNVA 1NAIA 4H17A 3SR3A 2EGUA 4WLEA 3GDWA 1YRQA 2C9OA 2OGZA 3MWFA 5ICMA 2YR0A 2VBIA 1JDNA 5G02A 3DS8A 3PA6A 4JOSA 2F67A 4MV7A 2D62A 2AWNA 3FZGA 2XUQA 3F9CA 4U2EA 3WK7A 1W47A 2WA1A 3HZZA 4J0CA 4Q6BA 5GADl 4H7JA 1ZOSA 2VKTA 1PAUA 1V3VA 3AF3A 4EUKA 5FF9A 1NUAA 1PK8A 3DUFB 1CTQA 3GUZA 2ZAIA 4AZVA 2BEWA 1NLUA 3OX1A 3LX6A 5D3KA 2O0LA 2VDKB 4O2BF 4LJRA 3AB3A 3RUIA 1NY6A 2ID4A 3O8BA 1XAIA 4ZYXA 4EGAA 4V1CI 1PK7A 2PBZA 2VDRB 1Q1ZA 3KZNA 2W2KA 3MOSA 1OD6A 3DVSX 4RDHA 3LRTA 4LXGA 3UHOA 1CV2A 1RYDA 2GRJA 4BB5A 1TO6A 2AUNA 2AN4A 1LSUA 1IK4A 4CM3A 4F21A 1EGVB 2ILTA 1EWQA 1O2DA 2VA8A 3IOMA 3MMXA 2PKRA 2X40A 4FYWA 3S4YA 3NOXA 4PIVA 1N5KA 3FY4A 5HUHA 4YV0A 5DO9A 1RACA 4CQMA 2NWQA 5JAOA 1MX5A 1T2UA 2EGHA 5BW8A 4X66B 3UB4A 3Q12A 1WEHA 1YS1X 3H2ZA 4IV8A 4OU4A 3LY7A 1NBMA 3C98A 5IBCA 3VQTA 3PS9A 5L7YA 4X24A 3WV5A 5DE3A 3ZY5A 2A5FA 1LPBB 3IT0A 5JQWA 5HP4A 3FNFA 5CH8A 4WVLA 1W9HA 3NNSA 1P17A 4D9JA 3OPQA 3UWKA 3DVAA 4C0AC 3R23A 4ZIRA 1NVWQ 2ACVA 1IIBA 3RHTA 3RYIB 1G20B 2HX1A 5TPWB 2E85A 3I52A 3R3XA 4D8UA 4QU5A 1IUPA 1R0RE 4N8SA 1SBIA 4QUAA 3V3TA 3BGWA 3VHXB 2VJQA 1J33A 3NBYC 4BNLA 5AW3A 4BXOA 3D6VA 5I6DA 2J6HA 5CJ2A 4CM9D 2FOIA 3P5SA 2P9CA 1SM4A 3IAEA 1I9GA 3A4LA 1GQOA 3RREA 5BR1A 3ER9A 3EASA 1K6XA 2CDNA 1KETA 2IPOA 4L9RA 1J2UA 5I7AA 1EFKA 1G8SA 1PX2A 1G5QA 3N05A 4GYWA 4Q6WA 4LVNA 1GXSB 1LXCA 1OYYA 1TA0A 1TYEB 2A1TR 2ZYTX 4PQFA 2FFAA 3OVMA 1IJKA 2J9ZB 4K5QA 3WYAA 4YQYA 4Y2TA 5IZ4A 2VWQA 1O6GA 5J43A 5CHEA 2H07A 1SXGA 1K7XB 1WBJB 1L9KA 2HGZA 4Q3LA 1ODFA 3O4IA 1UBTS 4WGGA 3VU0A 4P1ZA 2VTDA 1UBCA 4V2IA 3TX6A 4KIGA 2OYSA 4H59A 5JASA 4QJ4A 3HUDA 1XAJA 4D98A 3PNQA 2VXBA 2XEDA 4C3UA 4TQGA 4GWGA 2P91A 1EK5A 3SN6A 2XZLA 1U7ZA 3HFRA 1RYNA 1WUKS 4U8HA 3RS0A 3T9FA 3QU4A 4PN3A 4LOKA 2X13A 1OLSB 1UMDB 1UQUA 3S1LA 4M8NE 4JI2B 4GICA 1GY8A 3D0QA 3NPMA 1RWNA 4PNHA 5A9TA 4BN4A 5HUQA 2COEA 2HIAA 1I80A 1E1NA 1JHQA 1ISJA 4HQRA 1S9HA 3D8UA 2WAAA 3I6MA 3OLCX 3OOSA 4FD2A 1G8KA 2ZYSA 4PSUA 3BREA 3QSGA 3IAM6 4P3OA 3LBIA 2Q3MA 3D7MA 4AXXA 3QITA 5JATA 3ESXA 4BUCA 3RIGA 3HSYA 1DBQA 1S4QA 3HU5A 3UOAB 3ZHOA 4NDZA 4AICA 4IMPA 5SZHB 2BFEA 5FV4A 1JH9A 5JYBA 5KSOA 1PG2A 2HU8A 4LJLA 1XRMA 3BGOS 3P2IA 1NI4B 3EGDB 5TMPA 1A4XA 1QB7A 3PKIA 1WMDA 2YIVX 3IP1A 1RSZA 5HBRA 4YMSA 1XRRA 2YRWA 1CS0A 1N1MA 2O8EA 1XDZA 2C4NA 4GOMD 2D1SA 3IUBA 2OD9A 4WZBB 2AMYA 5E2AA 4MS3B 5KIAA 1WDLA 3LUPA 1ZEJA 3QPBA 1L7OA 3B51X 4ZU3A 1UWLA 1G6Q1 2IUFA 1TZBA 2ZYIA 4HDKB 1ZHHA 2IXEA 3JYPA 4FKBA 3VYVA 5J4LA 4G6ZA 1ZR2A 2AXEA 5FA6A 3T7KA 4I55F 3IESA 3H65A 3FCOA 1FYXA 1PX0A 4I8XA 3RHZA 2EDCA 3K1YA 1DWOA 3DQZA 3MWLA 4G0MA 1ZJ4A 3OBIA 1T0IA 1MUUA 4QGBA 3U4CA 1CQZA 3S1SA 3WGIA 1JG4A 4WT7A 5E7QA 3ZXIA 3OQ1A 4F2WA 2OM2A 1BVYF 1CJBA 2D0PB 2OSBA 4BVAA 4CKZA 3D3NA 3OECA 1QRRA 4ETIA 4ND8B 2PN1A 2YICA 3IO5A 5T64A 3AINA 2F90A 4ZRMA 5BSRA 4XASA 4IGKA 3JQRA 1U0RA 4QFDA 1QFYA 3N8HA 3OLXA 4J3JA 1EJBA 5BOSA 5LN1A 4OBWA 1ESNA 3MBKA 1OWNA 4MS1B 1OKKD 1SVMA 1I14A 4WH0A 1LLUA 4PFQA 4KN8A 1AB6A 5E3HA 2CFCA 1TTTA 3VHQA 3B38A 3CZ4A 3B9BA 3R3WA 5IHPA 3WGMA 4YMVA 1XNJA 5KEIA 4ZEVA 1Y1PA 3UJCA 3ZEIA 4BKQA 5BSGA 1YK0A 3NS7A 1JUDA 1PDVA 2FUCA 2B35A 2RGBA 1CP3A 3EXHC 4M8LA 5LQNA 5I4BA 1Z2PX 1M34A 4DIOA 2ZANA 3AEUB 1IVNA 3AUFA 4KSYA 4CCYB 5AW7A 1SCAA 4DC0A 2AKAB 2M2IA 2DEUA 3I30X 4TS1A 2Z8ZA 3V1KA 3LX8A 4AO7A 5CA0F 5EG5A 2FN3A 3WXBA 4CL2A 4O08A 4N65A 2G6TA 3GAAA 3DLTA 4L3OA 1DWPA 1EIZA 3JWGA 3JWPA 3QFHA 1LPPA 1ZH2A 4LVUA 1BQEA 4DMFA 5DCUA 1L8QA 4UNQA 1SELA 2X3FA 4QUHA 5FTWA 4K8OA 2WD7B 2BBWA 1GGKA 4RJKA 1Q95A 3GJSA 2VP5A 4PYNA 4AU1A 3KQNA 1JTFA 1R8JA 3ZV4A 2YY5A 1PR0A 2Z2ZA 4YVFA 4DEXA 3OUZA 4N9WA 3JZIA 5FWNA 4GNKA 3VR4D 3KPJA 1N2CE 4Z2YA 2FH5B 5E4TA 4B76A 1TJ4A 4FMBB 2O14A 4B3XA 4MVJF 2I33A 2C00A 3K92A 2FCAA 1RLTA 1MC8A 3D9QX 1Z0SA 1Y42X 1W4BA 2OBLA 3GVCA 3N59A 4DV5B 2PUVA 1FF9A 4MDHA 1WVGA 1JEOA 1BEEA 4B43A 1N2BA 1E6WA 1PNQA 1QMPA 2AZ4A 3AT1A 3KYDB 5I9SA 4BJ6A 4KWIA 4BWYA 5KYGA 1GTSA 1KRWA 2I7VA 3UMMA 3A26A 4V0QA 5D3ZA 5IN4A 3GPBA 4Y0VA 2HF9A 2XJ4A 2WJPA 4K9DA 4HUTA 4MKRA 2JIMA 2JFZA 1IEWA 4UMFA 3EXAA 3L4BA 2X4IA 3ASVA 3NHRA 5HS6A 5L53A 3MMSA 4MV0A 3AL2A 4KNYA 4KN6A 3NPAA 5B1DA 1Q83A 3ETHA 1PEDA 2DLNA 1FSSA 3TD2A 3STYA 1LV8A 5IWCA 1V0JA 2R65A 2CLSA 3S3TA 1TM1E 1SKYE 4HMOA 3HKBB 3L8EA 5DP1A 1C4KA 1G8GA 3I5MA 3ORHA 3I28A 1SQGA 3FMIA 2R1TA 4YPVA 3E5RA 1XZAA 4PG8A 2GXAA 4Z9BA 4W5QA 1ZCJA 2XTNA 4IXNA 1MZPA 3Q8MA 4LKOA 1DC3A 4LC1A 4ZT3A 1FVFA 2CDBA 4QPJC 2XCOA 4KX5A 3VKUA 3RVPA 1XF1A 2YV4A 3IKJA 3AR2A 2AFVA 4Q34A 1GPYA 1YZGA 4M3NA 2XNJA 1F3OA 3F7TA 1RRKA 4JMLA 1OREA 1QKKA 5K0EA 2R44A 2AWOA 1DX6A 2WKPA 2SKCA 4KBYA 3S55A 3PHHA 3AERB 5BORA 1KZHA 2QRKA 1N7JA 1ENZA 1Z0KA 3KWMA 4UPDA 5I51A 3BWVA 4AF8A 1KMHA 2I99A 2JK1A 5GM1A 5KX5A 1SU4A 3LT4A 5JHGB 2BYTA 3L6EA 3AOEC 3GZNA 2I4MA 2R8BA 4UTPA 1M5RA 5BRAA 3UFXA 2EG9A 2Z43A 3TLXA 1ADJA 3SF8A 3RYHA 3C1TA 3FOBA 1GA4A 4RK7A 4JEMA 4PSVA 2YMPA 1KFBB 1ZAKA 4OLFA 4CGYA 1E4YA 3DTYA 3V8MA 4TN5A 5B3AA 5TQVA 4A2PA 5JZVA 1FEZA 3GMIA 3KQQA 3MJSA 5DP2A 5CBKA 2BGGA 4OD0A 3PC7A 3G0IA 1HORA 2R1ZA 4MAFA 4RHFA 4BV3A 4AKGA 4C0SA 3ZTWA 4I99A 3GH3A 1GLVA 1NR7A 1R0XA 1E7WA 2DBZA 5BUSA 1WXXA 3PJDA 4MQBA 3IMFA 2BMVA 1EJ2A 2CLKB 4RE6A 1TO2E 3T7AA 4EB0A 5TARA 1C50A 3L43A 4KQIA 2YXDA 4JLUA 2NPOA 3WIBA 3HJGA 3TVDA 1ICIA 1LQ2A 3PQCA 2FPPA 3LO5A 3DMTC 5L6LB 5E9QA 1X3SA 3ND9A 1KEZA 3FPHA 3MW8A 5AHKA 3OZAA 4IG4A 3WFIA 4EG4A 3UANA 4E03A 4LJKA 4UASA 4RH3A 5KOIA 1DAKA 2N75A 4WFKA 1VLHA 5ENVA 3K0HA 2QE6A 4DV0B 1UT5A 4S1OA 1ARZA 4LY3A 1HZZC 4PC3A 3STHA 1I33A 4KKXB 5H3LA 2B9VA 3PWTA 4B80A 3HWX1 3ILXA 1PEAA 4QXRA 3D0OA 1A96A 1HNNA 1PHPA 2RHRA 2GZ3A 2XOKA 1R16A 2LR0A 3DMTA 3X1MA 2V3VA 1WUJS 2YV2A 3F97A 1X7GA 3RTCA 3EH1A 3H4VA 4H08A 4NNOA 1A1SA 1CHNA 1NN0A 1O6ZA 3B1VA 2ZXEA 3AV0B 3MNFA 4MYUA 5ALLA 4YI5A 3G2LA 2JK0A 1AS0A 4K3VA 4QPNA 3ZE6A 3G0CA 5EJ2A 3DL2A 3R3JA 2OMEA 1TCCA 4HDAA 4XR4A 3HO6A 4AN0A 4R01A 4F4JA 1NFFA 5GQSA 3A05A 3TUIC 1MLDA 4J6FA 5JCOC 3V1TC 3BYZA 3HU2A 4KVAA 5H3HA 4BCCA 1YQ9A 1CHDA 4DBLC 5DTIA 4KXLA 4XJXA 4ZA2A 3ZGLA 5KYXB 1JWLA 1H0RA 1NVDA 3LSTA 3AIMA 5I3ZA 3PEVA 5BXYA 4UBJA 1JG1A 4J1SA 4EKGA 3WL7A 1JBEA 4C7MA 1D6JA 2JGDB 4PNPA 2NAFA 4D41A 2PD6A 4YCMA 1EIWA 2XDYA 2QSYA 4QTXA 2IPNA 4F4DA 2J9FA 3HSKA 3OF5A 1OXSC 3MINA 3BXEA 1XIVA 3JRNA 4KL8S 4RMIA 3U60B 2JLAA 3B48A 3QPCA 1TK9A 4M0MA 3D64A 4RY8A 2IYRA 5TY0A 3TZLA 1N7GA 5E8JA 3DBHB 3SBDA 16PKA 3GCDA 4L4SA 3RARA 2PZ8A 1N6LA 1H65A 2IBMA 5B30A 3ONNA 1L9XA 5EPEA 4MINA 2CZGA 2WWGA 4YMGA 5KVAA 3ZLJA 3ZKAA 3F0TA 5K3AA 1EGQA 2ZUCA 4FYPA 2XAAA 4G5QA 2EFJA 3ZGXA 5JAMA 4Z99A 2C1ZA 3FHJA 4B2YA 3KDPA 4L57A 4RABA 4HWPA 1EJ0A 1MC4A 2C92A 2FSUA 3AESA 1BWSA 3BQNB 3E03A 1SIOA 4RSRA 1K7CA 2PMDA 3IAS6 5JIBA 4M8SA 4RELA 3BCRA 3NGLA 4H4CA 4M7WA 1FDIA 8ABPA 1W9MA 3PGJA 4FPXA 1UIRA 4MH0R 1IXRC 3T7TA 5L51A 3DWIA 4MMYB 1MDFA 1P39A 2FWPA 1EFRD 3S2YA 4BATA 2EF0A 2B7CA 1MTOA 3KT3A 4S3MA 3V55A 3KJHA 1Q14A 5BW4A 2ZWOA 1MENA 2IPAB 2J59A 1QF6A 4ALLA 2BTEA 4B40A 3EC1A 4JUBA 3Q3HA 1T1EA 1RRGA 3GJXC 4MMZB 4CLOB 4ZTUB 2VT7A 1TMOA 4RJIA 5B3LA 5KJCA 1CP2A 1RRFA 2CXSA 3LL4A 4MJ3A 1FUKA 3TSOA 5CDFE 1YUNA 4IQ8A 3W2GA 2V6MA 1V5GA 3MHTA 1SO8A 1NX9A 2NYUA 3I9OA 3W8NA 1OX4B 4B4VA 5CB4A 5B1HA 5JWOA 3U4DA 3ZDZB 1AK9A 2PO5A 2YZ2A 5CNJA 4Z9FA 3TZ6A 3WE7A 4Q1AA 1PQ4A 2JI9A 3MWDA 3E2IA 3OU7A 5DTRA 1CIVA 1RHRA 1QHYA 2Y0EA 1ZA2A 5B2EA 1GYQA 4TM7A 1GG2A 3AR4A 1NTOA 1ZCFA 4XX0B 1YRWA 2WJ3A 3P19A 3II6X 2QR5A 1ZRNA 3DAGA 3TTUA 3E4DA 5CJPA 1TQHA 3IV6A 3JZFA 3PDIB 3PJFA 4IRXA 5HK8A 4NARA 2PSJA 4AF6A 4BX8A 2PSSA 2AD5A 1LNSA 3NM5A 4H15A 3VGPA 3H0CA 2HLHA 1W581 2C5SA 2UZ1A 2VJOA 2JI4A 2IHKA 2PQ0A 3DVLA 5KUTA 4M46A 3TW6A 5K3EA 1TEVA 4AZWA 2IYSA 5BR8B 2NAPA 3O4RA 1W48A 1K7SN 4LNHA 4TLDA 3T7SA 1OZ0A 4Q47A 4BAUA 3ZVRA 3EB9A 3SP1A 4DVGA 3PXXA 3T1TA 4PBTA 3RADC 4CM1A 4CEHB 2J9YB 3QVGA 2HJWA 5D8DA 4J03A 1WXIA 1NFQA 2DKFA 3FDZA 1E1LA 1L3CA 1J42A 3L7KA 4WIAA 4BECA 4UNRA 1K9SA 3RHSA 3AX6A 5DGCA 5F2EA 1DUVG 5JBNA 1LPSA 4YX9A 3DEKA 4PLGA 5JJBA 3FD8A 3LP5A 3SSMA 3AEKA 3FMVA 1SQ5A 3RSFA 4M37A 5TE9A 2Q8PA 4GOOD 4FI3C 3SZOA 4LXQA 4E5NA 1FTNA 4INJA 4R7TA 2BP7A 4UHDA 3BX1A 1YS4A 5JE8A 2QPAA 3S68A 4EVRA 5F9HA 5J4VA 2JLZA 2HD4A 3A25A 1DBSA 4L8WB 4EDHA 1DZ3A 2PX0A 3FPKA 4RYDA 1VE6A 5C32A 1L7AA 3TLYA 3WGGA 3CRMA 2OR3A 1XVAA 5KPDA 3GOQA 3N0WA 4FHCA 2QLLA 4EI7A 1JQAA 5DLYA 3PRHA 1H94A 4H6VA 4U39A 1O94D 1SG9A 1EJ6A 1JQ3A 2ZT7A 4UQLA 1OWLA 2RGNC 3F90A 4P7GA 4URFA 2OM6A 4YQEA 2EP8A 4LTNA 2JIZD 2RKOA 3FVTA 2YINC 1YVDA 3CF4G 3N5CA 5ADVA 2QTBA 4PLVA 3ZW8A 1T8YA 5HJEA 1LZKA 4FEYA 2IHYA 2QRLA 2JLSA 3CJQA 5ABPA 1RAAA 1AE1A 8OHMA 4Z4FA 3L6OO 4P0PB 3ETEA 2VNJA 1P1BA 2Q21A 3RBVA 4CHGA 5KJFA 3MT8A 5FJIA 3TW8A 3AVPA 3MUNA 4OMCA 4D8VA 4FZVA 1N6OA 2VR1A 2ZCVA 1MB3A 1JB1A 2LW7A 5J4HA 1JXMA 2RHGB 3QEKA 4WJZA 4IFEA 3URKA 1IPHA 2NT4A 4WOPA 4BIMA 1J2RA 1QNLA 2X77A 1RP7A 2A4MA 3U17A 5AHOA 1FUEA 4ENTA 4L15A 2HADA 3TEMA 5DYIA 4EG7A 1O94A 4UNPA 1ADYA 1ANKA 1KZ9A 1PUXA 1RC8A 3EIFA 5DI3B 2BZSA 4GX5A 2FPUA 3QMWA 2ZE7A 4CE6A 2XCUA 4QL3A 1XNRB 1LKZA 3ZOKA 4URZR 2ZIFA 3TUZC 2HTEA 3M83A 3BAZA 3HEBA 3ILYA 1J07A 2BISA 4HDSB 4DA6A 4DV1B 3U3DA 3FSJX 3NEJA 4EUSA 3A10A 4ZOLF 2P6RA 4MW5A 1UOPA 3QXSA 5LIPA 4MP8A 1H69A 1L4FA 3HRKA 3A6HA 1HV8A 3WIVA 2M6SA 2EG5A 4OXQA 3MCAA 1RWMA 4L9SA 2WY2D 1JYSA 1HT0A 1KZ4A 2ZJ2A 5EP4A 1XELA 3ZLUA 5FLEX 2XVXA 4AJ4A 4J29A 2OXCA 2FZ5A 2G28A 2V1UA 3D2LA 3OCZA 4FR2A 4GPTA 5EXDA 1MJ5A 2JLQA 1W35A 2GHTA 1IUNA 3ISVA 4JL6A 1H22A 2B6NA 2VJKA 4AK9A 3ZQJA 1KE2A 4CMEA 2HHHB 2FV8A 3WYDA 2A0XA 1E3JA 5IC5A 4M1OA 5KJ6A 4HPXB 1KY3A 3OUTA 2XMQA 4QDOA 5EHXA 5A2GA 2Y92A 3CCBA 1Q3TA 3JALB 4O4IF 1JA9A 3PFHA 4CG0A 5L45A 1N5OX 4DUYB 1RIIA 3RR2A 4I4IA 1YQDA 1UDCA 1H23A 1QAMA 5REQA 1IVYA 4EPTA 3OQNA 1E0AA 4WXEA 4CMJA 1QYIA 1TE2A 2WV7A 3FA2A 4XJSA 3E1GA 4P9NA 2MSEB 3IX7A 3PFBA 1TQDA 3PYMA 4PVDA 3VA7A 1XYYA 4FZJA 1YS7A 2C9MA 3O26A 3PDWA 1L7QA 1NUQA 3K0FA 4N5IX 4TTQA 1P6UA 3GRRA 3AWDA 5K0SA 1OTHA 4B74A 4JD5A 1MF7A 4AWAA 4ESOA 5HRAA 5HFNA 5TT0A 3GP3A 3A3YA 3IIJA 5AM3A 1WD5A 3DM5A 2AVDA 2KX7A 3JQ7A 1J4AA 3LGSA 4IJKA 3PEFA 2QN6A 3ASUA 3C41J 1QQBA 2GS9A 4HGYA 4LJ8A 1A88A 1XZBA 1QIMA 3A4NA 1NN5A 2ORIA 2C8KA 1YUMA 2ZU0C 3EGCA 3GV0A 2PSDA 2P30A 1H4SA 5CCBA 3FHTA 1QX4A 1Z35A 1R2QA 4JP1A 4MUNA 3QVJA 4QOEA 3VPBA 4TV9A 3M6MD 2Z56A 3BMOA 7ABPA 1Q91A 3I09A 1XAGA 1MFPA 1NBAA 2WJHA 3FETA 4J7AA 3CLRD 2VFAA 5JZ9A 1MABB 1WO8A 4DEVA 1J5EB 3EVFA 1GTJ1 2QIOA 4COOA 3I5XA 1UXGA 4PC7A 4C6TA 3LF1A 5EE3A 5DU2A 1I36A 4IDBA 3ZHSA 2HXGA 3OD5A 4L22A 3W5IA 2R48A 1E8DA 2YBDA 1VCNA 2ZB7A 3N6VA 2FRDA 2PLWA 3OZ7A 3R41A 4OHXA 4AY4A 2OCYC 5F5LA 3EQ7A 2P65A 1YS6A 5SY4A 2QMZA 2V7TA 5B3KA 1WCYA 2CFSA 4TXJA 1DVRA 3PGLA 5FR2A 1W49A 3JQ8B 3TZHA 3VR2A 3FTFA 4DGQA 2IY9A 2QJTA 9LDTA 4BN5A 3DMDA 1ZMXA 4DIBA 5DIFA 1KU0A 3TK1A 1G9SA 1AK2A 3AKYA 1VLMA 2FVXA 3IRUA 2CUKA 3Q6MA 3SHOA 5C1DA 1DRWA 1KMMA 3IE2A 5DSTA 2FDCA 1E2KA 3DW3X 4A0GA 3U6KA 4NPAA 2IZ0A 5HILA 2KPOA 3ADOA 4Z7NB 1NJSA 2UU9B 4DV4B 3C6YA 1A2QA 2AFIA 4CUZA 2QT1A 5DX1A 2ZTSA 1B14A 4LMAA 2JRCA 4C04A 1EVJA 2PFKA 4EHIA 3SSAA 1Z4OA 4MYSA 1A9XB 2AN1A 2X19A 3EG9A 5IW8A 1OGIA 3RS2A 2FLKA 3GFVA 4RENA 3ZWQA 4HAZA 2QRVB 3EGXA 3R75A 4IWYA 3UG7A 3E7PA 5IVHA 2DR2A 1LNZA 5DN9A 3KKKA 3OIVA 4A03A 5CVUA 2Y1EA 4RA6A 4NEGA 1BOFA 5K51A 2ETVA 5AM4A 1H9BA 3L0ZA 1Z83A 4WKBA 5DHFA 2F4NA 1KEUA 4AZ0A 4FM9A 4RVHA 1LWOA 1LVUA 1R4MB 1Z3IX 2EJVA 3IBTA 4R1OA 4U7TB 5DK4A 5T5QA 1F4VA 3W5DA 3EEQA 3F8WA 1VMKA 1K6EA 1I3NA 3EAGA 3KR2A 4RK6A 2HHJA 3TNDA 1K8YB 1EB9A 1XZIA 4BMPB 1MW9X 3ANLA 4BWGA 1W7AA 4N7MA 1RRVA 1DJLA 5HWSA 1YXMA 4LYDA 3RFFA 3TRIA 3LC1O 3ZGOA 2WUGA 4KMRA 2YS7A 1JGTA 5JROA 5JWRA 4PIMA 1KAOA 4LXHA 2PD4A 3FZYA 2B4KA 4L5JA 3U2QA 1PWHA 3ELWA 4KLCA 1WDMA 1VG0B 2A5JA 3CSUA 4OJYA 1CUAA 3SZLA 1EVIA 4KO2S 3SYTA 1WS6A 1J49A 5CFZA 1XZDA 1HH4A 3C6ZA 4ZO9A 3UQYS 1NRXA 3CWCA 4WINA 2DFLA 4O2AA 2P0YA 1ORDA 4XCXA 2LDBA 1G7SA 4MVJP 4TKZA 5AXCA 2QUBA 4CIXA 1NBIA 1ZHOA 1TLLA 3SKVA 3ZHUA 2BRUA 2GM5A 2ZSDA 4NBSA 5HBGA 4QFBA 5U9CA 4GXTA 4JXXA 4QREA 3LFHA 3E8XA 3FYUB 4N5DA 4MQMA 1DOZA 2BIFA 5E6UB 2JCYA 4Z0PA 3QI2A 3O21A 1U3FA 5JTTA 1VE7A 1T4DA 4N0DA 1X1BA 3SX4A 1E94E 5IUNC 4YCNA 1P7ZA 4L07A 1E3WA 1F2TB 2FX3A 3W6UA 3LDGA 4MKIA 3X43A 1WV1A 3BWBA 3WMFA 3HNRA 4X41A 3E6AA 3NBFA 4WL0A 2J3LA 5KHOC 3DEHA 4MLPA 5A03A 2VTEA 3HJFA 1U2DA 1XMXA 1MVLA 1FDWA 2PUEA 4IOMA 2O6LA 3CUWA 3EFOB 1AOXA 4Z3KA 5BUZA 3FWZA 3I2HA 3Q7RA 1MR3F 1YD7A 3LBYA 1LTHR 3FZEA 1S2LA 4INOA 2FR8A 1YZKA 1X0VA 1IOZA 4N40A 3GHYA 5EIBD 5K09A 2F9FA 3PUVA 3A6JA 5DNWA 2B0JA 2W22A 2GX6A 3X1JA 2BRUC 4C05A 1TVCA 3E7DA 4UNIA 1A5ZA 1EEHA 3CTPA 4DLBA 4EJFA 4NPHA 4Q7QA 3KFLA 4B6JA 3CM0A 4KBGA 4ZCQA 2H1RA 3GRZA 3CW9A 4QRHA 2IYQA 2GK4A 1DNPA 4S2EA 4LDQA 1JLLB 1MO4A 4YAIA 2UYHA 2O8CB 1HYHA 4F4FA 3I45A 1E3SA 3NWBA 2XWQA 4EMTA 1VG9B 4DSUA 3DQQA 4FYYA 1UJ5A 3AG6A 1FL9A 4RKYA 4ZOQI 2ZRCA 1N5MA 1EGMB 1POWA 1EFAA 3F71A 3IVXA 1HMPA 2V54A 2HREA 4YAGA 1Z6YA 5DLPA 4E21A 5LPNA 2WFMA 1OFGA 1RQPA 4QODA 3HJNA 1RZRA 3G9TA 1CUDA 1EHIA 4GWLA 1K86A 2VT2A 3AY3A 1GAJA 2XGSA 1XSEA 4AT1A 1SBQA 1E63A 4DADA 1BN7A 5EMNA 5DHRA 5HIMA 1E1RA 1NBOA 2BMWA 1OIWA 4OK5A 2M1ZA 4PANA 1ZBDA 4NBRA 2VH5R 5DYWA 1TAUA 4UAJA 5ADHA 4IEFB 3JCZA 1H9AA 1N5RA 3G8DA 4FYJA 5LOVF 2XPCA 5EWJA 4EFNA 2I54A 4KTVE 1Y8ZA 2OXEA 1DOHA 5A3RA 4N9QA 3F46A 3WKAA 1TTPB 1H3NA 4YCJA 1QF7A 3FFBA 3VNQA 1T1SA 2AX3A 1HX7A 3ZG6A 3ICOA 2CJYA 2Q4RA 3IHKA 1RI1A 3PUJA 4B33A 1GAEO 3R09A 1Y8CA 3V6LA 5E3JA 2PWYA 2QNBA 3H2YA 2CXNA 3HY4A 3Q3CA 4XYLA 5HTOA 1SRRA 3FYSA 3OEEA 1TKRA 4F91B 1K66A 1TW2A 3U0VA 3F78A 4M9QA 1GUDA 2OGSA 2VL7A 2REQA 2PA3A 3D3EA 4MB2A 4YBZA 4D3FA 4BJ1A 4Y2RA 4P93A 5LA6A 5L4LA 5LQUA 1YT5A 4E5VA 2I65A 3CNEA 3OP1A 2BDEA 1K92A 4RFLA 4TL6A 5JCXA 2E18A 4JI8B 2NXCA 2H17A 4OMDA 4GQIA 2GXQA 4EOGA 5K0JA 4BDSA 5IJ9A 5JYEA 2YWJA 4LRQA 2ZJ5A 3O1HB 3NASA 4LUCA 5F23A 5BW6B 1LF5A 4FS8A 4CTJA 2EYUA 1W73A 2CZQA 2KWIA 3FGNA 3RV3A 4ZI7F 5I7EA 2I9KA 2F3UA 1NVVQ 2NN3C 4G67A 2PSHA 4XQCA 4UEQA 4HC4A 1E4EA 2X41A 1M2NA 4K9RA 2NSLA 4HHEA 3QTLA 1GZHB 4R6WA 2GCEA 1KDOA 3LVRE 4JLBA 5TS2A 1WY7A 5CA0B 1SCBA 4E15A 1PUIA 2WPDD 1EA5A 2OCBA 2Y93A 1CWUA 4I5DA 4ES6A 3TDKA 4ZHSA 3J81k 2NNWB 4TV9F 4W1SA 5DV9A 3ZWXA 4R5HA 5FPSA 3WHKA 3RYCB 1M74A 2EKZA 2CLEB 1MHPA 1CB0A 4MQFB 1A77A 4ZQFA 2RARA 4ZEXA 4ABYA 3H5TA 2J1LA 4I5EA 2Z5LA 2IKSA 4D8TA 3GGGA 4UTOA 2ZVQX 1UZNA 2W6ZA 2W2XA 4OQXA 2WTMA 1WCIB 2O7SA 4JP8A 4Q3AA 2V4UA 3BH6A 5HUJA 3AILA 4B3SB 1TJ5A 3BIWA 1N0UA 4B32A 4EM6A 2HRDA 5B12A 4CVNA 2AFIE 4JBGA 1UBSB 2A3NA 4LHEA 1N5DA 4A7PA 4GOND 4DCVA 2DPXA 1Q7RA 5JPIA 3BKWA 4OCZA 5K6TA 1VYVA 1Y63A 5I7VA 2FJPA 4KLZA 4B6RA 1HYQA 3D31A 4F11A 3F6CA 1ESZA 1SUSA 4HVAA 5DT9A 5FIUA 2QZ4A 1Y48E 1TF2A 2I67A 4ER6A 4WK4B 1JDPA 1UFKA 3FDXA 2Y1WA 3SYNA 4YACA 2WPDA 821PA 4JUFA 2GBLA 4IYJA 2FHPA 3GJYA 3KZMA 1LLQA 3VYRB 1IOVA 4LG1A 5SICE 1ZX1A 1E3WB 2PAAA 2ZJ7A 3WJ1A 3H2IA 4JCOA 5ALQA 5CFRA 3SNHA 2FPIA 2Q5IA 2RI1A 2ZWIA 3A1TA 3U49A 1RM4A 4G5OA 2G08A 3X44A 1X2EA 2V8OA 4CG1A 3NT4A 5AKJA 3SBOA 1BE6A 2NSYA 3WL3A 5E4FA 5JG7A 3U7RA 1XZGA 5FO1A 1XOIA 5A5FA 1EEXB 3NOOA 4IDPA 3OHMA 3N86A 1EX7A 3MJFA 3R24A 1KKUA 2P9BA 3R6DA 5EJ6A 2DFTA 1RZ3A 1LU9A 3AUTA 3C3DA 4I4TF 2GAOA 2X8JB 4LYJA 1UK9A 4L3VA 2DSNA 4HWKA 4RKWA 5EJIA 2AOVA 1KP9A 1PGJA 1X7YB 2NU6B 4HGPA 1ZN8A 3M7IA 5C5IA 4RV4A 2OXFA 2UUBB 3PNMA 2EIHA 1URPA 1W59A 2QJRA 3FNGA 4X90A 2VCHA 3UJDA 1YZTA 3L8DA 4BTLA 4DV6B 1JKFA 3CLSC 4OYHA 3R0JA 2JFVA 2I4NA 3IDFA 3HR7A 5BMVA 1EFVB 4QARA 2BLNA 4J75A 4N18A 4C3VA 5LP6A 3ETGA 4FOLA 2D0DA 3WLKX 1AQJA 2H1WA 1L8OA 1R8QA 4AI6A 4C0KA 2H4ZA 3ONVA 2XY4A 4DJTA 5AW8A 1LQUA 3NHMA 5LQRA 3S27A 3AERA 2PR2A 2QI9C 3PGXA 5FPQA 1TIKA 5C8VA 3OCUA 2MWMA 1SC6A 1X70A 3AEYA 5JEEA 3OIGA 1S2GA 5I7WA 3DP7A 1TADA 1RE0A 5CP8A 1QGUA 4KR0A 1C0EA 3AU8A 1ECPA 2QN9A 2G71A 4KO8A 4HXFB 4RHYA 1C8KA 4PSKA 4HNUA 1K27A 4EJ2A 4JI5B 3OURA 2OAP1 1IXZA 10MHA 3M6WA 1NYRA 2RFLA 5AHWA 5IG2A 3HA3A 3G13A 4YAEA 3G59A 5DNYB 2J3EA 5ALRA 3GLTA 2O19A 4NR0A 3SVZA 3SBXA 1BG6A 3AESB 4E2ZA 4M0PA 4K9QA 5E4YA 5C5CA 2GN2A 1E2UA 4GXRA 4GSLA 1B16A 5ISMA 3RT9A 1RHMA 1HNZB 1ZQ1A 2PL3A 5K2MA 3C8ZA 3K0SA 2HSJA 4YT4A 3C4VA 7YASA 3OG9A 4MJXA 4OHOA 5DM4A 3KQWA 4LJ5A 2JZOA 3VPXA 3DXXA 4EA8A 2WSSA 2G67A 5THKA 1YQWA 1DXQA 1YL5A 1YBFA 2AHRA 3KFXA 4ZOCA 5SV2A 3EDCA 1R5BA 4DV7B 3PX7A 4Z49A 2I4LA 4NE2A 3KLOA 5CH3A 4QKQA 5J23A 1BC5A 3BRCA 1J06A 3B7GA 3DGEC 3ESYA 3O2SB 4YI3A 3X2SA 1D6NA 2QQFA 4CQJA 1YUBA 1G38A 8ADHA 2JHGA 4K9MA 4TWIA 5IK2A 2B4TO 2CF5A 3LBAA 4O8CA 1LFDB 4PHGA 1SRQA 4TLLB 4WY2A 4JUIA 2HKIA 2R66A 3S2UA 1CVIA 3PGA1 2LD4A 3NR2A 3JVVA 4Z4IA 4TKVA 3TIIA 3V34A 4MWCA 5H9WA 3PD0A 4QU0A 3CG4A 5KYXA 1E9AA 3U26A 1N32B 1QVVA 4YRNA 5EIOA 4KWHA 4A92A 1QIJA 1KMQA 1V11B 1YR7A 3KTOA 4DLSA 1KI2A 1QDUA 1DTSA 1C7FA 2HA7A 2J8ZA 2WMNB 3LPAA 4POAA 2UUCB 5I4CA 3Q9NA 5FP0A 1IVSA 4Q3KA 4I3HA 1RQ2A 1KJYA 2WJVA 5JFGA 1CUCA 2QE7A 3H5LA 3EGWA 1WW8A 5AJUA 4PE5B 4CFSA 4EA7A 3JSAA 1GT91 2FEMA 3EZFA 2AA3A 1DTWB 3C3YA 1KZYC 1T6ZA 1WRBA 2ATEA 4EP1A 3Q7SA 3V6MA 2R6DA 3KKNA 4G23A 4XYEA 2FXVA 3BSYA 2R11A 1SVOA 3HCPA 3IALA 4YRZA 5IJ0A 3M4YA 1XZNA 4MQLA 1PGPA 2G7ZA 3LWNA 3QEMB 5A6SB 3FYUA 2ZI3A 4EJ6A 2ZQZA 2CJWA 2YVKA 3HY6A 2EX1A 3DVAB 2OZEA 1G16A 2ABWA 2R1TB 2VK2A 3K30A 2OV6A 4ZYWA 1VRVA 3DYIA 2DTEA 1VPWA 1TNDA 2XCLA 2Z5FA 1MORA 3DP9A 3V2IA 5SZJA 4LAFA 4AJ1A 4HLCA 4LJSA 1Z4IA 1TQ8A 1XALA 1NIPA 2HDHA 1M10A 3OHPA 2EBHX 1XZEA 4QJ5A 3UGKA 5BVHB 3MUFA 3F3YA 3I4FA 5IZCC 1Z5OA 4HYQA 1GLNA 1VFPA 4ZCTA 2XODA 3NQ41 4EI8A 1CPYA 1T5IA 2ZJ3A 3GFSA 2QM0A 2NVBA 4INZA 3GRAA 2QSUA 2VJCA 4DRXB 3I62A 1NJ6A 3CVYA 3AF0A 3F5QA 3GW8A 4ND3A 4F2GA 2GSWA 1PL8A 5TF0A 1KXJA 5NLLA 2B5VA 5KTNA 1T8RA 4V0ME 4RGVA 5FHRA 3D7LA 1EVQA 2BUAA 4MEBA 4DF3A 2QY9A 3CLSD 4HNAA 4XWYA 1WZUA 2ZSUA 3QFFA 1OUMA 3CEAA 1LB1B 4IHJB 1JALA 1ZM9A 4MDYA 1KPHA 4DA8A 4EHBA 1YE8A 1XJ0A 3GEDA 2CDRA 5CFPA 1RQLA 1XEXA 4FP9A 4H0NA 4UM9D 4BMNA 3QNWA