5ITWA

Crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
255
structure length
255
Chain Sequence
MIMNLTDKTVLITGGASGIGYAAVQAFLGQQANVVVADIDEAQGEAMVRKENNDRLHFVQTDITDEAACQHAVESAVHTFGGLDVLINNAGIEIVAPIHEMELSDWNKVLQVNLTGMFLMSKHALKHMLAAGKGNIINTCSVGGLVAWPDIPAYNASKGGVLQLTKSMAVDYAKHQIRVNCVCPGIIDTPLNEKSFLENNEGTLEEIKKEKAKVNPLLRLGKPEEIANVMLFLASDLSSYMTGSAITADGGYTAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroanticapsin 7-dehydrogenase
publication title Probing the influence of non-covalent contact networks identified by charge density analysis on the oxidoreductase BacC.
pubmed doi rcsb
source organism Bacillus subtilis (strain 168)
molecule tags Oxidoreductase
total genus 98
structure length 255
sequence length 255
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.385: Dihydroanticapsin 7-dehydrogenase.
pdb deposition date 2016-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5itwA00
3NAQA 4Z0HO 2XXJA 1B2LA 3TFOA 2CMDA 1R0SA 3PQFA 1ZJZA 2HAEA 1K2WA 3ONFA 3PQEA 1OBFO 1P1KA 3KSUA 4C4OA 3QSGA 1ZK2A 4Z0PA 3AFNA 2EIHA 1HDGO 1N7GA 5JLAA 1E6WA 3IQDB 4AL4A 4G65A 3Q11A 3DAFA 2UYYA 3I3OA 1T25A 2HMTA 3FNFA 4U0KA 2Q2VA 1J49A 2F00A 4UEOA 3VH4A 3DONA 3Q2KA 1ZEJA 2FRDA 4YRBA 4IM7A 4D0SA 4B7CA 3GF4A 1UXKA 2VNSA 4U8GA 5CDUA 3E1KA 3CZRA 4YAJA 4IMPA 1DFIA 3F4LA 2NV6A 3EAGA 5KJ1A 2YZ7A 3NDIA 3GZNA 3OQ6A 1G0NA 4GMFA 4KP7A 3ZGYA 4BB5A 1QYCA 3EDMA 4R9SA 1PJTA 4BO9A 5TGDA 5ADHA 3ETGA 4ND5A 3E5RA 1NBOA 1F0YA 3F4BA 4BNMA 1YDWA 3AK4A 1NAHA 2VTEA 2EF1A 3QVSA 3WYBA 1DFGA 4LMRA 4FJ0A 2I3GA 4PRLA 3SVTA 5T8KC 1IZ9A 1ISGA 1XSEA 2B35A 2O23A 1K6IA 3JQAA 3W4IA 4Y9DA 1T2EA 2PZLA 1HDYA 4XX0A 1DIHA 3OIGA 5IZ4A 5DN9A 2DFVA 4HFNA 3BMOA 1HE3A 3WX0A 3KOUA 1QXSA 5G4LA 1RYDA 1B26A 1P74A 1NHGA 2YDXA 1I32A 2D59A 1ID1A 3S2FA 4R54A 4R5MA 3M1LA 4N5MA 5COBA 1F8FA 2CVQA 3Q0EA 1MP0A 5HA5A 4KZPA 2ZTUA 1UZMA 3B20A 1DJQA 4LRSB 3CINA 2FZEA 1QR6A 4CV1A 1IHXA 2ZB3A 2WYVA 3GZNB 4A2CA 4AJNA 4F3YA 4PG4A 3K6JA 3QJ5A 1N92A 4PFJA 4J4TA 4L4SA 2B36A 5ITVA 3QHAA 3PJEA 3Q9UA 1BVUA 1P9LA 4DMMA 1UH5A 2OL4A 2CNBA 4IUYA 1TT5A 3VH1A 3PIDA 1DJNA 4E30A 3JQAB 4ALIA 2JCXA 3UCXA 4DL9A 4DC1A 4WEOA 3D5QA 3GNQA 3CEAA 1PJ2A 3MTGA 5F1KA 1ZVMA 2VCYA 1I3LA 2NNLD 3GRKA 3NT5A 4MVJH 5DF1A 3WFJA 5HTOA 3I5MA 3BMOB 4I9UA 2YV2A 2P4HX 3MJCA 5G0SA 1WPQA 5LC1A 3BZUA 5ILGA 5I7EA 1OFGA 4NBVA 4RQUA 3RCBA 4L73A 4CMBA 5JAMA 1GYRA 3UGKA 1IPEA 1NM5A 1PQUA 4GWGA 1A7KA 5TIIA 5DNAA 3RU7A 3MTJA 4CMKA 4W7IA 2EWMA 1AXGA 3AM3A 3C3XA 5L7WA 4AJEA 9LDBA 4P4LA 5JO0A 1Y81A 4M8SA 1WLYA 2C82A 5FF9A 3G3EA 4CLHA 1VJTA 4IJKA 4BO3A 2PD4A 1R0LA 1TT5B 3IP1A 5AOVA 3CMCO 3PHIA 1T2FA 1QRRA 1OMOA 3UVEA 2XOXA 1EZ4A 2Q4EA 4CM9A 4DYDA 2VYND 3O4RA 2BFPA 5F5LA 4CM9D 1C1DA 3JYPA 1EFLA 4BNXA 3DDNA 1QYWA 4IIVA 1ZK3A 1H5QA 4X54A 4ZQFA 2JFFA 3C8MA 1VJ1A 3QLJA 1Q0QA 5B1YA 9LDTA 4EEZA 3VKVA 4CLOA 4NJMA 4OHUA 3L77A 3PFFA 1WDKA 4JLWA 1X1TA 1E7MA 3D7LA 3LYLA 3MOIA 4FDAA 1N7HA 2AG5A 2H6EA 3JYQA 2X0JA 3TOZA 3UKOA 4DIFA 1EUCA 1QKIA 2PK3A 5ITWA 5L53A 3UCEA 2Y0CA 1Y5RA 2AEFA 4EGFA 3INGA 3U3XA 1X7HA 1ZBQA 4D0RA 1DRVA 4RPKA 3U0BA 3MJSA 3FWZA 5TT0A 4YCAA 2A92A 4D42A 1A71A 5A03A 2NU6A 1GV1A 5KNLA 3WBBA 3TZKA 3DEYX 1LXCA 3PPIA 1C1DB 3OJOA 3WIEA 3ZWVA 3RBZA 3C24A 1Z6ZA 1EE9A 2ILTA 5H82A 1LLCA 4U6QA 2OHXA 4HFMA 3U4HA 3CTMA 4IPTA 4NJMB 4RVSA 4CLOB 1RM0A 3QE3A 3RFVA 1RM4A 4IDBA 1MXFA 1X14A 2JFHA 4RL6A 1YE3A 3RSHA 1J6UA 3ZU5A 4BKOA 4IXWA 4JK3A 4E2ZA 3E6AA 3DOCA 3JYNA 3SJUA 1P31A 3OM9A 4JBHA 4K9DA 5EMHA 1B14A 4ZQHA 2W98A 1Y8QA 5TJ9A 3UHAA 3SLKA 2UV8A 3FD8A 3GDGA 3LC2O 1VKNA 4DLAA 3VPFA 3DHYA 4S1VA 1I2CA 4QTZA 4CM7A 5KVVA 2YV3A 2C07A 2EKPA 5TLSA 2UDPA 1O0SA 1FDWA 3WLFA 2C29D 3BAZA 1P33A 3ON5A 4D41A 1K5HA 3UUWA 2HDHA 1XWFA 1ISHA 4N5LA 2Y1DA 5JC8A 4Q39A 3LT1A 3C7DB 4FN4A 4HNGA 4OXNA 4WKGA 3WTCA 4B3IA 5JAZA 3IJRA 3NX4A 3JQDA 2OBNA 1NQOA 3OJLA 5DCUA 1AXEA 4DUPA 1H93A 1J0XO 4YAIA 2OMEA 4FD3A 4RZIA 1ENYA 1YKFA 2C5AA 4MIEA 1PZHA 3WSWA 3GN1A 4P22A 3QIVA 1EVYA 3H6KA 1HEUA 3HWRA 3NEPX 2VYVA 1SCUA 4YR9A 2VYVD 1Y8QB 4OXYA 4MVJF 3HG7A 5DBGA 3C1AA 3ULKA 4RPJA 4MINA 3E48A 3R1IA 1LBEA 3CPSA 3IIEA 4NK4A 2ZB4A 4ALMA 1JAYA 3VDQA 1MC4A 4PLFA 1Q0HA 4H16A 3BA1A 4E5PA 2DUUA 2O2YA 2PV7A 1EQUA 3VAZA 3G0OA 2PKQP 3GGGA 1U3UA 1UXGA 4LVCA 1T24A 1PQWA 2NWQA 3WMWA 1I33A 1TI7A 3FI9A 5DULA 3VHRA 1NQTA 4ND2A 1DC6A 4GVLA 2I99A 2IODA 2XPCA 4CUZA 2PGDA 3UFXA 4YT8A 2G0TA 5IXSA 3H9GA 4JROA 2X23A 2GZ3A 3B6ZA 4NBTA 4NQZA 1YB4A 1HDXA 2HRBA 3SXPA 1VSUA 1HDCA 4J49A 4ZJUA 2D1YA 4XYMA 4ZN6A 2DAPA 4GX0A 2UVDA 2FPIA 2HMWA 4D7AA 3PGXA 4JNKA 4BGUA 1DLIA 2C2YA 2AEJA 2AE2A 1KVSA 3DFZA 4O5OA 3P2OA 4J7XA 1PS8A 1BXKA 3M2TA 1B7GO 2WEKA 4BO4A 2EW8A 4WK6A 4QFDA 2GDZA 1V0JA 4E2WA 4UVIA 2ZYDA 3E9QA 3TPCA 1AGNA 1CWUA 3HFGA 2P4QA 4BO0A 5K9ZA 1HSOA 1FDSA 3VKUA 3ANNA 2O3QA 3NRCA 3IS3A 2J3KA 4CV3A 2B4TO 3KEQA 3OH8A 4OKIA 1NAIA 4YACA 5HRUA 3JCZA 4I1IA 1VLLA 4CODB 3AU9A 1NR7A 2JHFA 2VT2A 1ONOA 2ZCUA 4UVGA 2J6IA 1PTJA 1A4UA 1QLHA 2D5AA 2X0RA 3GEDA 4J6FA 2PWZA 4CUJA 4Z9FA 3ZU4A 4YT2A 1EVIA 4NMHA 3LT0A 4XIYA 2I66A 2E48A 2F1KA 3OEYA 3VH3A 2YY7A 4Q9NA 1CERA 3EVTA 3BTVA 3F5SA 4HP8A 4CMEA 4XRGA 5GZ3A 2PLAA 1PWZA 3A9WA 2C59A 4HX5A 5DOZA 2GPTA 1Z7EA 2I76A 3R6DA 3DB2A 4NR0A 4YWJA 1EFKA 2GUGA 3WTBA 5I7VA 1X15A 4Q3NA 1FK8A 3Q6IA 3RROA 2BGKA 4BGIA 4XGNA 1GQ2A 1D8AA 5FI3A 3Q9NA 2QYSA 3X2EA 4M86A 2B83A 4P38A 2PY6A 1DRUA 2AQIA 4BL5A 3NJ4A 3DZIA 3A06A 3ONDA 3WGQA 3DZHA 2C20A 1RM5A 1WZIA 4B7UA 3WQSB 5CDYA 1Z74A 5JYEA 1WXDA 1SB9A 4OAQA 3BTOA 2IYPA 4XDZA 3INTA 5I9NA 1DC5A 3H5RA 4N7RA 4Z3KA 3HDYA 2P9CA 3T4EA 3L4BA 3JQEA 5JMPA 2X1HA 5L3ZA 2UUPA 4IZIA 4YJFA 2O3TA 2JAHA 5ENVA 3DQPA 3PHJA 3AUUA 4B4WA 2VRCA 1K6XA 4I9NA 1M66A 4ZHSA 1KVQA 2VRCD 1YGYA 3PHLA 1GY8A 3KYBA 2OORA 2PNFA 3Q3CA 4GWKA 5J23A 4QECA 1PGOA 3CXRA 1P3DA 1JN0A 2GGSA 2Z5LA 3QP9A 5A06A 1X0VA 3TFQA 3I4FA 2VOEA 1XYGA 3CSDA 4U7WA 1XQ1A 4Y98A 3CUKA 3UN1A 2GZ1A 3H3FA 4E21A 2HMVA 4WLUA 4AJPA 3GAZA 1Y1PA 2ZB8A 4J91A 4J9VA 1IPFA 1LLQA 1IULA 3PI7A 3ROQA 1GUZA 3W8EA 4RCVA 4XQGA 3S8MA 1R4NA 3BHJA 1H6CA 3GN2A 5DZSA 1ZEMA 4UEKA 3D3EA 1N5DA 4IJVA 1LU9A 4BGVA 4CL3A 2DM6A 5IZCA 2JCVA 1L1FA 1KEUA 1PGPA 4BHTA 2CUKA 3RBXA 4RPHA 1W0CA 4RVDA 3RD5A 1HYHA 4YJFB 4J1NA 4QUKA 3TQHA 4XD2A 4JCOA 4DA9A 1B16A 2Q1TA 5L40A 2AG8A 4PLPA 1PIWA 1CQJA 1KIFA 1JQBA 1R12A 1HXHA 5GMOA 2NTNA 4E31A 1F12A 3QW2A 5F5NA 1ADGA 2QG4A 1I3NA 1YWGO 2HU2A 4PZCA 1CQIA 1O89A 4FS3A 4EUHA 6LDHA 3T7EA 1T4BA 1GZ4A 2VHYA 4IGFA 5U1PA 4ESOA 1EBUA 3WG9A 4CQMA 2CF6A 2Y1OA 3GHYA 1R4MA 2J8ZA 2O4CA 3OETA 3DZBA 5A5FA 2IZ0A 4ROSA 4LW8A 2G1UA 1H9BA 1DSSG 3OFSA 4XGIA 4BIIA 4RO0A 1OAAA 1W6UA 4IDGA 4WCFA 3RC1A 3MWDB 5BT9A 4RVGA 4XYGA 4O63O 1LUAA 5EIOA 4YJHA 4MOWA 3WGYA 1PJLA 2PGLA 3OJFA 5DCWA 1P0CA 3OICA 5AXDA 1NTOA 5HS6A 3I9KA 3RUCA 4UEJA 1LLUA 3ZWYA 4KWHA 4QSMA 4GI2A 3OHSX 1MV8A 2LDBA 4GLOA 4A0SA 1UDCA 4NBUA 2OP0A 1U1IA 1BXZA 1BVRA 3K9QO 5KWEA 4NHEA 4ITUA 1ENOA 4R68A 4JP2A 1U4OA 4W9NA 1BDBA 4MKZA 1N1EA 4CMEC 2QQ5A 1PS9A 3JQ6A 3GEGA 4XEHA 3AI3A 3HN7A 3WOHA 1BHSA 4NH4A 2PKRA 4PLWA 4KTVE 4CQMB 5AQ1A 1R4MB 3D64A 3F1KA 3JQBA 5DP2A 1ISMA 4MKXA 4NU6A 1L7EA 4MP8A 3ZWXA 3GG2A 5JFOA 3AOGA 1ZMOA 2IXAA 1U8FO 4WCFB 4BMNA 4BQPA 4ND1A 5KVCA 3LT2A 5AYVA 4PG8A 1NVMB 1K89A 1BDMA 1LQTA 2J5KA 3AM5A 4YJHB 3WJAA 1YDEA 4OH1A 4D45A 3NGLA 2J3IA 3PGJA 3AM4A 4DXHA 1NVTA 3PTZA 4RJTA 4PG5A 1GYQA 4DPMA 2AMFA 2P68A 1B0AA 3E5MA 3L4BC 4IMRA 1ADFA 1QV6A 2BFAA 1Q7BA 4Y6SA 3AWDA 3PP8A 1LDNA 1XCBA 1MG0A 4WNCA 5DP1A 4M55A 4O6VA 2JD0A 3TZ6A 2HUNA 4KDEA 1JW9B 5TNXA 2IEDA 4Y6RA 4GKBA 3C7AA 3NYWA 3EW7A 3LLSA 2TMGA 4DQXA 5F1OA 5ER6A 2DBRA 4M89A 5DOVA 4OQYA 1DEHA 1E7RA 2ZQYA 4CM4A 1BSVA 1MFPA 3ZCXA 3GPIA 3UCFA 4HUJA 4GSKA 1GU7A 1Q2XA 4YAKA 1E7WA 4MDHA 3RUDA 3HN2A 3KM0A 3QA9A 4NFHA 1QORA 2FOIA 2G17A 2XAAA 3STHA 4OOEA 4R41A 1DB3A 3ICCA 3D1LA 3H9JA 1GPJA 1NR1A 1ZW1A 4AFNA 5IFLA 3O26A 3AW9A 4DGSA 2CDCA 3I9LA 4ZRNA 1E5LA 5IZCC 2EGHA 2DQ4A 5LCXA 3LC1O 4DLBA 3KSZO 1ZSYA 3DC2A 3L0DA 5JW6A 2GN9A 2YUTA 2W4QA 4HADA 3O9ZA 1GEGA 3GNTA 4Z3DA 3ENKA 1HWYA 4N18A 3NGXA 4TSKA 4RVUA 1OZAA 4OGWA 2CVOA 1LDBA 2Z1NA 1WW8A 3COSA 1IY8A 3RU9A 4CM4B 4EJ0A 5CAEA 2EJVA 3I9NA 3OJ0A 1KY4A 3NJ8A 3GLQA 3E82A 4QXMA 4KQXA 1KC3A 3D4OA 4J2HA 5B4TA 3B70A 4FFNA 4L9RA 1GUYA 1SNYA 5I9LA 1C0KA 3PLNA 3F46A 3GC6A 3L6DA 2PZJA 1FDVA 4JP3A 1V35A 4WGGA 5TSDA 3WQRA 4YJDA 3QQPA 2NADA 1LDGA 4E6PA 3M2PA 3U4DA 3JQ8A 1BXGA 3WXBA 4BNLA 1H0KA 5IN4A 1LRKA 4R51A 3KB6A 1HLPA 1X7GA 2IYOA 3I6IA 3L07A 1I01A 4WCFC 4NIMA 3HSKA 3ITKA 1ONPA 4BKPA 1UUFA 2AEMA 2A94A 5LDGA 1OI7A 1PL6A 4MIYA 4RQTA 1LSSA 5BR7A 4D3SA 1E3JA 3GVXA 3K73O 4L4XA 1B3BA 4CLEA 1DPGA 4CMHA 1DXYA 1BWSA 2ZATA 3IDSA 3TN7A 2DU8A 2IDZA 3DAGA 3K5PA 4CL8A 1EQ2A 1E0DA 2H1SA 1X13A 3IL2A 2TMDA 1B3RA 4W9NC 1PL7A 2GR9A 2AHRA 4J7CA 3L6EA 3VPSA 4L8VA 4MVJD 5T67A 4FGWA 2DLDA 3AI2A 2C0CA 1P1IA 1DIGA 4GH5A 2C54A 3JQBC 4PZDA 4XB2A 4XJSA 3ASUA 3JQ8B 1BXGB 1ZFNA 2Q1UA 2WM3A 2O48X 4BNHA 2YQ4A 2JD1A 1DFHA 4E5YA 4GX1A 3WGGA 1UR5A 4Q3DA 1T26A 2QRLA 4OKNA 4BB6A 1HRDA 1SEVA 1XDWA 1Z73A 2CD9A 4GPD1 3W6ZA 4CV0A 3ASVA 1BGVA 2VZ0A 5BSFA 3QWIA 1HDOA 1HLDA 4EI2A 4G81A 2GLXA 4BV9A 1LSOA 1AHIA 3ONEA 5C7LO 3UXYA 4L75A 4EUFA 5G2OA 1UP6A 1P1HA 3BHMA 3BYZA 1QYXA 4FFRA 4AICA 4NU5A 4Z6KA 3IMFA 5CDSA 4F46A 2E6UX 2Q50A 1E92A 4RPGA 3DBRA 5IDXA 2H9IA 4J2OA 2EP5A 1HYEA 1DAOA 1PQPA 4K26A 4GLLA 1A72A 1HE5A 1H2HA 1N2SA 2DBQA 1GUFA 3PDUA 1D4FA 3X2FA 3D4NA 4YT5A 1YB5A 3V1UA 3PWKA 4JN6B 1H2BA 3L4SO 4J9UE 2Y05A 3GH3A 3OSUA 2E4AA 1GZ6A 3AY7A 4TRMA 2LDXA 2DKNA 1R66A 4M1QA 3KZVA 4ID9A 1YBMA 3GHHA 5HM8A 2VYNA 1A9ZA 1MLDA 1XA0A 4BQRA 3ITDA 4I9HA 2FSVA 3S2IA 1JTVA 2VN8A 4OIMA 2RBEA 5A04A 4J7UA 2VHWA 1OOEA 2BI8A 2IZ1A 4OXKA 4OOFA 1DIBA 3H3JA 4AJ4A 4IQ0A 1VRWA 1FDTA 3KV3O 2FR8A 1QG6A 2E37A 3C1TA 3GDFA 2BHLA 3DBRB 4YRAA 3JD1A 2FR0A 4I08A 1FF9A 3AOEA 1YL5A 4PN3A 1QYDA 1NYTA 2WJPA 3PZBA 1C0LA 1XIVA 5TQVA 4BNUA 2X5JO 3MOGA 4TZTA 3U4IA 2OGUA 2BI7A 4FSHA 5DBFA 2W2LA 2W2LD 4FBGA 1YQGA 4RF3A 3JD2A 1GV0A 1JA9A 1XELA 2Z95A 2VZ8A 4L76A 1ZO8A 3GGPA 3LQFA 4WOJA 2O2SA 2CSUA 3AU8A 2DTXA 2PZKA 4HNHA 4YAGA 2RAFA 3FPCA 4D46A 4E4YA 3ST7A 4EUEA 4UAGA 4BGEA 5C3MA 4XCVA 3TDKA 2BF7A 4BNZA 3WYEA 1NFQA 2W2KA 4II3A 4UUOA 2HK8A 4XR9A 1SAYA 1ZK0A 3HQ4O 1DBVO 1YOVA 3KSDO 3MEQA 4JIGA 3QVWA 1KETA 2BRUA 3EUWA 4EITA 3EY4A 1I0ZA 2BELA 2IE0A 3GUCA 1ISIA 2GYYA 3Q1LA 1NQ5A 1Z75A 3AFMA 4DPKA 3F3SA 3V1TC 4IQGA 3R0IA 1NX6A 5KKAA 2VRBA 2BFMA 3QVTA 3ICPA 1ZNQO 5JO9A 2X22A 1V3VA 3EZLA 5TJHA 1DAPA 3OA2A 4R01A 5CFZA 4H7PA 4L74A 3V2GA 2DT5A 3LLVA 5C5IA 3PZRA 1LLDA 2ZIZA 2C7VA 5A4DA 2P9EA 1VE9A 3GT0A 3PWSA 4J4BA 4NI5A 3F9IA 3WSVA 1PJSA 1ENPA 4HFJA 1JKIA 1T4DA 1SEPA 2ZTLA 3JQFA 4YB8A 5JDIA 3DBVO 2R2GA 4H15A 5EQFA 1YOVB 3RAJA 3QVXA 1HL3A 1F14A 1TLTA 4L0QA 5JAQA 3AJRA 3PRJA 3FRJA 4CMCA 5MDHA 4J1SA 1ADCA 4Q3BA 1MC5A 1WVGA 4N5NA 1S7CA 2HSDA 4GX5A 4DPLA 1ZSNA 3I23A 1UDAA 4GGOA 1ZMTA 3ZHZA 4O1MA 1P44A 3CKYA 4M49A 3DOOA 3D0OA 4R69A 5THKA 3RQSA 3WLEA 4M87A 4HBGA 4YEDA 4CLDA 3F47A 5DDIP 4O59O 1YS4A 2AA3A 4OSPA 3WNQA 1ZK1A 1A4IA 2X6TA 1LX6A 4B4OA 1T2AA 4EEXA 5FEUA 4BNWA 3FNEA 3OMLA 1U2GA 3GVIA 3T4XA 1NPTO 4DQUA 1UP4A 4MPDA 1T2DA 3JYLA 4AJJA 4FFPA 1KBZA 1Y7TA 2Q49A 2ZQZA 4XDYA 1UP7A 1KERA 3BMCA 5HS4A 4D79A 2BLLA 3GMDA 4D44A 3TSCA 4DWVA 4J16A 5C37A 2I67A 4DIOA 1E1LA 3UICA 1EUDA 4LRTB 2OXIA 3I6QA 4PLCA 4PLVA 4ALKA 3M6IA 3W8DA 2B4RO 5KCZA 1GCUA 3PYMA 2AQHA 3ZW8A 1ZUD1 3IJPA 5I8ZA 4W7HA 5BSHA 3AOEC 1EK6A 5DCYA 3HB4X 5BSGA 2FP4A 1QP8A 4URFA 4CLXA 5TX7A 2C2XA 1WMBA 2GZ2A 2QHXA 4P4GA 1FXSA 1H6BA 3FTNA 1R15A 2H63A 4J1QA 1NFRA 4OYRA 1D3AA 4AJOA 2PH3A 5B4UA 1J4AA 3VZPA 4I5GA 4F45A 1Z45A 3I83A 3V2UA 1ZXLA 1U8XX 1WMAA 2X7HA 1DC3A 4CM8A 4CR6A 1I30A 1W4ZA 3WMXA 1KEWA 2H5LA 4OL9A 4ONEA 2ZJ1A 2G82A 4D3FA 3RC2A 5ICSA 1CETA 1M67A 3VPGA 1ARZA 1VPDA 4II2A 3MJTA 4FFOA 2Q1SA 4GMGA 3R3SA 3ROPA 2HK9A 4F6CA 1PZEA 4EJ6A 3GDOA 2RHRA 4GSLA 1ISJA 3BMCB 5TS3A 2CDBA 3TL2A 3AUAA 4IXTA 4YVFA 4RVHA 1EUZA 4UVDA 1OC4A 4HXYA 2JL1A 2POQX 1C0IA 3DZFA 4BKQA 2DBZA 1SBYA 2PKQO 1H9AA 2YHIA 2OBYA 2GN4A 2OOSA 3AUTA 2X8LA 3ZWNA 2C7GA 4S3MA 2WWRA 2NACA 1A5ZA 2W90A 3BMQA 5JDCA 2V6MA 3DFUA 4K6CA 5A3VA 5C7IO 2E49A 2JD2A 4BNFA 4QFCA 2Y67A 1C0PA 4GQAA 3DZGA 3F5QA 4XWYA 1E6EA 4CM8B 3SC6A 2VWGA 3PDJA 2ZJ0A 3ENNA 2NVWA 3LU1A 3OQBA 2XF8A 4QEDA 3V5NA 2D2IA 2VTDA 1DRWA 1VC2A 1E7SA 2FSSA 3CIFA 2WE8A 3HHPA 3GFGA 4YQYA 1ZKMA 3QWAA 4R4JA 1E77A 1XU7A 3W6UA 5BQFA 2GN6A 1JLLA 4TVOA 4GAEA 5BNFA 3WR5A 1ZSVA 1WNTA 1PJ4A 2Q46A 2YQ5A 2HKIA 1E1MA 3DHNA 4CR7A 1YONA 2GCGA 5U4QA 4NK5A 6ADHA 4E2YA 2JJYA 3JQFC 3KO8A 5IDWA 2NUAA 5JDIC 5KIAA 2YHIB 3FBTA 5KJEA 3PEFA 1U7TA 5DT9A 3JD3A 5GZ1A 3CMMA 3HFSA 4UVHA 1HDRA 4RLHA 1PJ3A 5JY6A 1LNQA 2WSBA 3BMQB 5ER9A 2JHGA 4RVFA 3ZWCA 3OIFA 4A26A 4DLLA 1EE2A 3B1FA 2P9GA 4CLRA 4BKRA 1NNUA 3GY0A 4NBWA 4AJIA 3ZU2A 3ZWBA 2P5UA 3WIDA 4AJ2A 4NG5A 1LI4A 5EJ2A 3ZH2A 3PJFA 3FN4A 3PFWO 3C85A 1C14A 4FW8A 5G0TA 3OP4A 3OQ1A 3NTRA 2X4GA 3RC9A 2OZPA 2QZZA 5U9CA 4G5HA 4E33A 3H2SA 4B3HA 3T7CA 2VUUA 4E5MA 2NQTA 1P1RA 3GPDG 1SO8A 4WLVA 2Y0DA 3HADA 3WGTA 4QT0A 3HJAA 3PLRA 1KVRA 1UDBA 3K30A 4CMAA 4A03A 1ISFA 2RH4A 4PVCA 4PZEA 2VHXA 3GUYA 3DHEA 5A02A 3E9NA 3IOYA 5COAA 4PVDA 1VSVA 4YAEA 1XG5A 3GRPA 4IDAA 4KOAA 4OMUA 4PG6A 1Y5MA 4CLRB 5BNIA 3ZV3A 4E32A 2WTBA 1XQ6A 1R4NB 4R1NA 2FY8A 1GTMA 2VWPA 4K1LA 1PR9A 4NZ9A 1SC6A 3VDRA 1O94A 2VHZA 2I9PA 1H6AA 4RF2A 4WLOA 1YJQA 4E3ZA 5JSFA 3BTSA 4H3VA 4BMSA 1GDHA 2W8ZA 5DBIA 2BKAA 4J90A 5FFFA 1CDOA 4R3WA 2C5EA 4D3DA 1WP4A 2V7PA 5CHEA 2CVZA 2EHDA 5GZ6A 4AJHA 2EGGA 4FCCA 3WS7A 2NQ8A 4BO1A 4BNGA 1Q7GA 2ZK7A 2ZCVA 4XKJA 4DYVA 3G1TA 3QWFA 2DC1A 2WYUA 4JJGA 3A28A 2D4AA 4A7PA 4TRRA 5A9TA 5G0WA 2CY0A 1U5AA 2B0JA 1GCOA 5K0ZA 3ZNQA 1IYZA 3TWOA 4CM1A 3LF2A 3SX2A 4WUVA 4Q3EA 3FR8A 1JWBB 4Q3AA 4JJFA 3WYCA 4WECA 3LVFO 4WLEA 1R16A 3ROKA 4J3FA 4LCJA 4HFRA 1EBFA 1PJBA 2PD3A 1V8BA 5CG2A 1YH3A 4RGBA 1UJMA 1Y9AA 2FPGA 3FPLA 4U5QA 1HT0A 3NDRA 2D8AA 4XR4A 5JDCC 3TNLA 1LDEA 4TZKA 4Z0TA 1E6UA 4KDFA 1ZH8A 3PWZA 3VPHA 4MKRA 4CMIA 3TL3A 4XRRA 1PJCA 2NTJA 4FQ8A 2RHCA 2GN8A 1WZEA 3E9MA 4BUCA 4BNIA 2VUSA 2OP1A 4EZBA 4J4HA 4RZHA 3RJ5A 1U3VA 2I5PO 3NV9A 4ALLA 3PHGA 4JX8A 3ZW9A 3GK3A 1E7YA 4FIZA 4Y67A 4ZA2A 4JBIA 3BIOA 4IIUA 3ZN2A 1DHTA 3DMTA 4CJXA 1R6DA 3QWBA 4E5NA 4QQRA 5BSEA 3INRA 4DVJA 1LSJA 4IQ8A 4RLSA 4I5DA 7MDHA 4AG3A 4WE3A 3RUAA 1V3UA 1CEQA 2DPGA 3O38A 3KVOA 1HTBA 2J3JA 2NSDA 4IGEA 3WJ7A 1U9JA 1UZNA 5KVQA 3FR7A 4YPOA 2EXXA 3K92A 5LDHA 3MJ4A 1XR3A 1A9YA 3D3WA 3DTYA 3Q2IA 1NFFA 3H2ZA 4UUNA 5TC4A 3JD4A 1W8DA 3I4CA 3K8ZA 2WD7A 3IP3A 4FC7A 4AJLA 2VHVA 1Z82A 1E5QA 5ILOA 1M6HA 4JXKA 4XJTA 3WFIA 3K2BA 2VUTA 2Q99A 1C3VA 1YL6A 3ETDA 4IJWA 2WMDA 4PG7A 3RKUA 5A05A 4DBZA 3KYCA 1SZJG 3KETA 1KVTA 2I3AA 2NU7A 3WICA 1KY5A 4CM3A 4CM6A 4PLTA 1G1AA 2A4KA 4E12A 5G0UA 2GSDA 5L45A 2HK7A 3RJ9A 1GQYA 2NU8A 4BNNA 3KLPX 2FN7A 1IE3A 1JVSA 1MA0A 2YDYA 2NTVA 5L95A 2QW8A 3SC4A 1VL8A 5CG1A 2DPHA 3MJVA 1TB4A 3GOHA 3I9JA 4CUKA 4A73A 1U5CA 4KWIA 1AHHA 4BO7A 3VC7A 1D1TA 3GVPA 4GBJA 4HKTA 3W4JA 4YYZA 3LC7O 3HUDA 3QV1A 4A27A 3MJEA 1B8VA 3PHHA 5FI5A 3D3WB 1HKUA 3WGZA 3ZHXA 2O50A 1ORRA 1O95A 2WD7B 4DIBA 3CE6A 4ND4A 3AUSA 4YTEA 1PWXA 4IY1A 1LSUA 5IF3A 3U5TA 1VM6A 3UAGA 4PLGA 1UAYA 3ZU3A 4D43A 3PK0A 2YFQA 2X0NA 3KYCB 2RCYA 1EEHA 3EMKA 4TKMA 3H4VA 4OQZA 1ONNA 3ETEA 1U7HA 4FC6A 4RF5A 4TWRA 3BHIA 4FJ2A 4ZRMA 2B5WA 2IZZA 1N9GA 2HCTA 2P5YA 3H8VA 3GR6A 3OECA 1GFSA 2BGLA 2BGMA 2Q2QA 3K96A 4WLFA 3JQ9A 3O8QA 5AXBA 2HJSA 1QMGA 1JKFA 1XHLA 3UH1A 4FOSA 1WDMA 4QO7A 3DR3A 4P4NA 1XU9A 1E3WA 1O6ZA 3LDHA 3G49A 3GEMA 1H6DA 4NDNE 2Q45A 3NUGA 4CR8A 1GR0A 3HB5X 4G2NA 4PLHA 3RUEA 4TVBA 1DHRA 2I65A 3WGIA 2JFGA 1E3LA 1SMKA 4KTTE 4KUGA 4TRNA 5KVSA 5IDYA 2UAGA 1U28A 3W8FA 1DOHA 3PYXA 3L9XA 3ROMA 3BXXA 3SJ7A 3OBBA 2RH8A 1EMDA 1E3IA 3DWFA 2EJWA 8LDHA 1A27A 1PGNA 2V6BA 3JQAD 4MVJA 1BG6A 4BOYA 5I8WA 4IS2A 3LF1A 4BNVA 1DIRA 3GG9A 3TOXA 3LT4A 3ZNPA 1KC1A 3U09A 5A9RA 4A10A 1N9GB 5K6AA 3LK7A 4PLYA 5CEFA 2VNAA 3RVDA 1GQQA 4UUPA 1J5PA 3JSAA 3O8QB 1BW9A 1IHYA 3VPXA 3PJDA 1MGOA 2G5CA 1E3WB 5ES3A 4BVAA 3KUXA 3QRWA 4MP3A 4J0EA 3JV7A 1PX0A 2HRZA 5CDTA 3DO5A 1ADBA 3ZV4A 1R37A 4R1TA 1CRWG 3DMTC 3OF2A 1PZFA 2XXBA 2O3JA 1UXJA 1PS0A 1M2WA 4HV4A 4O0LA 4IDFA 4AVYA 3IUSA 1ML3A 1RKXA 2B37A 5B37A 4Y6PA 5JCXA 1HF3A 3ORFA 4NPCA 4U0JA 3EYWA 1H94A 4Y8VA 3KYDA 4IINA 2GO1A 2JAPA 3H5AA 1CF2O 1NPDA 1FMCA 4XQCA 2Y0EA 1F8GA 2WE7A 4AJ1A 2DTDA 1BW9B 3KEOA 4MIOA 1EDOA 1JDJA 3A4VA 3LZ6A 5JAIA 2FR1A 3G1UA 2NVBA 3S2GA 4W6ZA 3FTPA 1T1RA 4Q3CA 1GEEA 5F3RA 2Y68A 1X7DA 2ZYGA 2YV1A 3H9EO 2Q1WA 2AE1A 3KLMX 4R5HA 1HYGA 3P7MA 5BNTA 4XYBA 4N54A 1DO8A 3GVCA 1I2ZA 3RI3A 3D5TA 3RUFA 2CDAA 1M6WA 3ZHYA 3GNSA 4CPDA 1VJ0A 4EJMA 1D7OA 2EKQA 3CZMA 3F6YA 2VQ3A 4DRYA 1K0UA 1P45A 3ZDFA 1ULUA 1T1SA 4QX6A 2J5RA 2DBVO 5EL0A 1I2BA 5JMWA 3B1KA 3KYDB 4PRKA 1YO6A 1XGKA 2FWMX 3PVZA 3ZWMA 1HE2A 2HLPA 1KVUA 2VT3A 1MG5A 4YDRA 5I7SA 4BO2A 2ZTMA 3K31A 2GF2A 1UZLA 5L51A 3HDQA 1VKOA 4XGKA 4B8WA 4BNJA 4CMJA 5IDQA 2D0IA 5IXYA 2EKLA 1AE1A 5EPOA 5AXCA 2X86A 1QYVA 4TRJA 2SCUA 1B8PA 4FB5A 3EHEA 5I7FA 4LN1A 1M75A 3JQ9C 4IDDA 1E3SA 2PD6A 2GD1O 2VWQA 1PGJA 1LEHA 4YRDA 5FWNA 2O3SA 3HE3A 4ILKA 2OO5A 3WNVA 1KYQA 1YBAA 2X58A 1DDOA 2HQ1A 2P91A 1JAXA 3H5NA 1Z7BA 5B12A 3JQCA 3GZ4A 2EW2A 4BO8A 4RDIA 1UXHA 3KHUA 3O03A 4FR5A 4EW6A 5T5QA 4IJUA 1XKQA 5TF4A 3SBOA 4IDEA 3W4KA 1B15A 3H9UA 3JQ7A 3WGOA 3U9LA 1LTHR 1NQAO 1F17A 4XIJA 1GADO 2VWHA 5KTKA 5A5EA 3NTQA 1PGQA 3V8BA 3RFXA 5CPBA 4CMGA 4WJZA 2GERA 1LA2A 2IRWA 3A14A 3MWEB 1LC0A 5K6AC 3OEWA 4FGSA 3I9OA 4I5EA 3NT4A 5MGBA 2OFPA 2W2KB 2QX7A 3KTDA 1GAEO 4ZQBA 3H9QA 3QY9A 3C7CB 3DOJA 1VL0A 3ANMA 4EBFA 2O7SA 3ADOA 2PH5A 4K28A 3FHLA 1SOVA 4WEQA 5JY1A 3RC7A 4MVJE 3JYOA 1ZK4A 3LSYA 1JKJA 4DTIA 4LMPA 1KEVA 1TVEA 4LSWA 3AI1A 1PL8A 1HE4A 1NWCA 4LGVA 4M54A 4ND3A 2WDZA 3JQ7B 5FYDA 5H81A 3GQVA 4B4UA 1HSZA 1EK5A 3DMYA 4I8XA 3U62A 4HWKA 3EC7A 3FNGA 4WCDA 2V65A 3AY3A 4Z9XA 1GYPA 4YA6A 5JE8A 4JBGA 4YT4A 2G76A 4OM8A 4R9RA 2AXQA 3NT2A 1RWBA 4J43A 1ULSA 1YJ8A 1LC3A 3A1NA 4J1TA 5T6BA 5HWSA 2B4QA 2HO5A 5KJFA 3S2EA 2B5VA 2BFOA 2Q2WA 1OC2A 3HNPA 1EVZA 5HBRA 1ZIDA 4C7JA 1AUPA 1Q0LA 3ZWWA 4RDHA 3IAHA 3M1AA 2X9GA 4BO6A 5JC1A 2WYWA 5IJZA 5IG2A 2NLOA 4FFLA 3VZQA 3W1VA 5F21A 1U3TA 5JNLA 1Y6JA 1NHWA 1MFZA 4QO8A 3HZZA 1GZ3A 1CYDA 1NP3A 3ANLA 1N1GA 2YJZA 1VL6A 3GAFA 2A35A 1QLJA 4J0FA 4BV8A 1P1JA 2Z1MA 2HMSA 4BO5A 4PIVA 5L9AA 1KEPA 3H7AA 5TT1A 5EERA 4R1SA 2HMUA 1G6KA 2EG9A 4UULA 1I8TA 3HDHA 1I10A 1BRMA 2ZTVA 1O5IA 2YFHA 3FSRA 3S1LA 4IDCA 4RV9A 3DBHA 2PA3A 1GL3A 5G0VA 1YXMA 2R00A 1HETA 3EVNA 3FCOA 1E1KA 1IB6A 2YW9A 3F1LA 4FPXA 3E03A 2BMAA 4DC0A 5A9SA 3DL2A 3D4PA 1IZ0A 4GGPA 4BS9A 1I3KA 4BNKA 3KRTA 1S6YA 2Y93A 2QIOA 3L9WA 5L7YA 2X0IA 2JCYA 1WDLA 3G79A 4E2XA 3K2EA 1ZXBA 3NDJA 1LRLA 3DAPA 3VZSA 3WWZA 1YL7A 3TRIA 1L7DA 3BMNA 5JXWA 1R0KA 3FBGA 2X5KO 2D3TA 2P2SA 4E0BA 4NFSA 3RIHA 2BD0A 4XA8A 3IKTA 4KMSA 5I9MA 4WLNA 3N58A 1K3TA 2JKVA 3JTMA 3V2HA 1HZZA 2FZWA 3GA0A 3QVOA 1PJQA 3JD0A 4ZQGA 4MVJI 3DBHB 3ZZNA 5CDGA 3FWNA 4IZHA 3OA0A 1SB8A 1DLJA 2EV9A 2PTGA 1BTOA 4LK3A 4XB1A 3ZWOA 3GVHA 5JBIA 4PGFA 3R3JA 2ET6A 5A9SB 3WGHA 1U4SA 2QRJA 1GD1O 1O9BA 3PIIA 2DVMA 1ZJYA 4JGBA 4OO3A 5EN4A 3WDSA 4GKVA 1E1NA 4IBOA 1MXHA 2J5QA 3L6OO 3PYLA 4YBZA 4TROA 1FDUA 4XYEA 1W73A 2DUWA 1UAGA 4UREA 4L4RA 2ZKLA 1E7QA 2IXBA 2Y1CA 4INAA 4UVEA 2HJRA 3BMNB 3WB9A 3UOGA 3G17A 1EVJA 2V6GA 4C7KA 2PFGA 1B8UA 4PCVA 3EGOA 3ZHBA 1CIVA 1Y9EA 4KUEA 2GNAA 2CZCA 4WNIA 1Q7CA 2I6TA 3DZKA 3IUPA 2IEBA 1Y8RA 1RM3A 4TMFA 2RIRA 3I1JA 2NM0A 2CFCA 4ZD6A 2O3RA 3SLGA 4BNYA 1HDZA 5CEJA 3GGOA 1XEAA 3P19A 3I9MA 4MO2A 1LJ8A 2CF5A 2WD8A 4WOKA 4W4TA 4XQEA 5TRTA 1V9LA 1ENZA 4OSOA 5T64A 4GX2A 2V6FA 1FJHA 1P0FA 3H65A 3VVBA 4UUMA 2Y1GA 4XQ9A 8ADHA 5CP8A 1U3WA 1HZJA 1DIAA 3NTOA 3WBFA 2AQKA 4ZQEA 1N8KA 4A5OA 2GRAA 3QWHA 4ZICA 3N7UA 1LRJA 1YBVA 2VOJA 5F1PA 2FPPA 5CEEA 2J3HA 5L4LA 3GFBA 1PSDA 1JWAB 1RJWA 5ICMA 1SOWA 4CV2A 3EK2A 4JJIA 1ZZEA 1Y8RB 1U2DA 4MVJP 4FFMA 4XZ3A 4EYEA 3FF4A 3MCVA 4PLZA 4LCEA 2D5CA 1YQXA 2EEZA 5EESA 2NVUA 2Y66A 3NKLA 4NFYA 5IN5A 3OIDA 4R1UA 4AJKA 3U4CA 3SEFA 1NXQA 1P77A 1VI2A 3RWBA 2Y1EA 3VOSA 3UW3A 4KQWA 3PJGA 1YB1A 5C7OO 5KOIA 1M76A 4XYLA 1JVBA 2Q4BA 3P2YA 4LISA 4MP6A 4CM5A 4F6LA 4FJ1A 4LVUA 5H83A 4BKUA 3OJEA 4TKLA 4JQCA 4P8RA 3RUHA 3KBOA 4TQGA 4BMVA 2PR2A 4E13A 4EDFA 2ZB7A 2PZMA 5THQA 2DTEA 3FNHA 4GL4A 1NPYA 5A3JA 4KUHA 2R00C 2QYTA 3ADPA 2E82A 4E5KA 4NNJA 5L7TA 4LSMA 4CQMD 1IUKA 1C1XA 4RPLA 1I5RA 3VTZA 3EZYA 4CQLA 5JCJA 1Q1NA 4DREA 1I36A 5JCJD 1V6AA 3S55A 4ALNA 4R3NA 1GPDG 2GASA 2O4UX 3DXFA 3VTFA 1ZCJA 5GY7A 3ZWAA 2UUOA 1PU2A 5AXAA 4MVJG 5T8KA 4FOOA 2NVUB 5G4KA 1NVGA 4BNTA 1TXGA 2YHUA 1G0OA 1LQUA 1EDZA 4K6FA 3U49A 3WQQA 2YYYA 2PGJA 4DMLA 4GVXA 4NBRA 4ALJA 1AN9A 1F06A 1I3MA 1CJCA 1T2CA 3ZV6A 1TT7A 5KJ6A 4B4VA 4U6SA 5IAAA 1KOLA 3RASA 2O3UA 1PR3A 3DZJA 3ZWPA 4R16A 4ZVVA 3TZCA 5JYDA 5JPIA 1X1EA 3TZQA 1DC4A 1QSGA 2DFDA 3I52A 3UF0A 2R6JA 1YQDA 4I5FA 3C1OA 3ZNOA 1PZGA 5KKCA 1YVEI 1D1SA 2FHSA 2EP7A 1IOLA 3MZ0A 3KXDA 1V3TA 1C1XB 4B3JA 1KS9A 4MJLA 3TZHA 4ZGWA 1A7AA 4WPGA 1JU9A 4CQLB 3BTUA 4MVJM 1BMDA 3TJRA 3B1JA 1PEDA 4ZU3A 1TEHA 3JQGA 5B4VA 3ABIA 1P1FA 4NJOA 3GMSA 5COQA 2Y99A 3PQDA 5CPFA 5ENDA 2X5OA 5T57A 5G4KB 4YJGA 3ZV5A 3DBLA 3E8XA 3VVCA 3TF5A 2VZ9A 1MB4A 1MX3A 1NASA 1NWHA 2NU9A 1TA4A 1RYEA 2O7QA 3DTTA 1XLTA 4DQVA 2BH9A 5L4NA 1SPXA 3RFTA 3VH2A 1X0XA 2OUIA 2Y1FA 1I24A 3CH6A 5KJCA 2QRKA 3ZI0A 3RKRA 2A9FA 3RUIA 2FMUA 3ZNNA 4CMIB 1LDYA 1K6JA 1E3EA 2X9NA 2X9VA 2Q3EA 3HDJA 7ADHA 1UXIA 4W99A 4B7XA 2AW5A 5A1TA 4OJNA 3P5SA 4DBVO 4W82A 2AQ8A 4YQZA 3WWYA 2QZ9A 3V1YA 3IKVA 3IC5A 4RORA 2ZYAA 3RBVA 2B69A 4Z9YA 4HY3A 5AVOA 3E18A 3JQGB 4IS3A 3N74A 1WWKA 1WAMA 4B79A 1RPNA 3AY6A 1IL0A 3PXXA 1QV7A 4YJGB 3DBLB 5L4SA 4B8ZA 1MUUA 2EERA 3VZRA 5JS6A 4RF4A 1O8CA 1LDMA 5EQDA 4WASA 1YRLA 5EINA 4YXFA
chains in the Genus database with same CATH superfamily
4PFQA 3KFLA 2LTAA 3QEJA 3V1MA 1M6VB 1T5OA 2OESA 2GJ9A 2CMDA 1JYSA 1U31A 1IRXA 2ZOSA 5A4IS 1A5AB 4ZZ2A 1K2WA 5CVVA 3ONFA 4DC9A 2ZRKA 1MAHA 2RGBA 3OWXA 3E23A 4FCVA 3V7NA 1PDVA 3QSGA 1ZK2A 3AB7A 4R8MA 1U99A 2ANBA 2FSGA 1OKKA 3PUYA 4JLVA 5JQGA 3BJMA 4MI3A 2AFHB 3IEVA 2Z5GA 1FW8A 4MKHA 3CPEA 2NO9A 3DAFA 4WNYA 4Y6LA 2E4VA 3KPWA 4U0KA 1XCGB 1ZHOA 1F5NA 1NN5A 1J49A 2Q2VA 3CWZA 4K86A 4UEOA 3DONA 4LXYA 2WUGA 3OQIB 1ZEJA 3Q2KA 1CIJA 4CIDA 3N7TA 5JLJA 2IHJA 3L49A 3NHMA 4IM7A 1UBFA 2G25A 2LCIA 3L7CA 3VTKA 1TTHA 1UXKA 2Z83A 5HE9A 4AXBA 4U8GA 4ZOEA 2QNRA 1OF1A 3CZRA 3E1KA 4ZMRA 3LFUA 4IMPA 1OH6A 1Z6YA 2C7RA 1Q0RA 2JH3A 5M29A 2Z4TA 2OD9A 1PJTA 2WIKA 2YFKA 5B53A 5TGDA 3PWTA 1BH6A 4GPTA 3RLIA 1F0YA 3F4BA 3AK4A 1Q7EA 3OI7A 3GZTB 3LXMA 5HIIA 5KI6A 3WYBA 4D0GA 1TX4B 3BXEA 5FADA 2KHZA 2Z9CA 5LP6B 2I3GA 4RU1A 3G9UA 5DXJA 4C7OB 2VF2A 1TU4A 2J3QA 1QE3A 1IZ9A 2VF5X 4D74A 3KE9A 3AH8A 1Y6ZA 4FZ5A 1OA0A 2R6FA 4BYGA 3UA4A 4QHYA 1L7XA 5SY9A 3VR6D 4YRPA 4ZDKA 3UPUA 2I2XB 1QE5A 1PT8A 2CLFB 2C4KA 1XNQB 4GOKA 3TB4A 2FX5A 5JU6A 1F4PA 4FEEA 3BKWA 3QVVA 1YULA 2ZE7A 4GO1A 3RHZA 3WA6A 4DCJA 2FPSA 3VZBA 2G77B 3WDKA 3HV0A 2N9UA 4LHWA 2B99A 2YYAA 3KXLA 1WP9A 2M2IA 2FHPA 3U7JA 4R0MA 2ZUTA 3R0JA 1KYTA 3QG1A 2UUCB 1F8FA 3OCXA 3W5VA 4Y2XA 5HA5A 2BGIA 1JXQA 1H2YA 2I8CA 4PHTA 4XM1A 2ZTUA 4N7JA 1UZMA 3B20A 1FY2A 3HXTA 4GNKA 4Q6BA 5FI0B 2NG1A 5TV2A 4HEA6 3G2HA 4X3OA 4RY0A 2DR0A 3T41A 2PBZA 2WYVA 4YYEA 4F3YA 3QJ5A 1JJAA 5DGIA 4H18A 2WF6A 2O06A 3D0KA 4L4SA 5BO5A 4TYMA 1UWLA 1B1AA 4X24A 5AKGA 1OWOA 3Q9UA 1D2EA 5A4AA 2ZUEA 4LPSA 4LWOA 5H4GA 1R5NA 4O0MA 4D9GA 3OUUA 1DRJA 4ANFA 2G09A 3PUVA 3TYXA 4AF7A 1K8RA 1TT5A 1PBNA 1U0SY 4QASA 3UG6A 2OZLA 1IK4A 4XUCA 1DJNA 3JQAB 4ALIA 1IY9A 4DL9A 4DC1A 4QAJA 4UDXX 4WEOA 4F71A 3D5QA 5CLIA 2L69A 1GCGA 2PS0A 1DZIA 1ZVMA 3CURA 5TGTA 2OV6A 3A3OA 3WFJA 1YRAA 3FZQA 1KDOA 5LR6A 4OX9Y 3CR3C 3AEKB 4JLNA 4I9UA 3KQQA 4WOBA 3U48A 1XLTC 4Z4FA 1MC8A 1FZQA 1DINA 1PQYA 1XI2A 3MJCA 2RH5A 5T4EA 1EWTA 4XM0A 2IEGA 1WPQA 1YZLA 4N82A 1LBSA 4BAGA 4U2FA 2DR2A 3IHWA 1BFKA 5JAMA 3RM3A 3RTCA 1DTEA 3FVRA 3P9PA 4LJ8A 3V9PA 1A7KA 1JLHA 1DRKA 1YQTA 3CUTA 3AJ9A 4YCDA 4G8JA 5DNAA 1E20A 3IAM6 4A0RA 3EG9A 3ZHSA 4NE9A 3HPQA 2HNBA 4ZV4A 5JMTA 1G4HA 5INTA 2VH2A 2W6MA 3GA5A 4GPAA 4DCVA 1ZA1A 4AJEA 3A4MA 3NDBB 1DCFA 4P3NA 1Y81A 1C7ZA 1YHYA 4M8SA 3PCRB 3RVRA 4AMZA 2O6HA 3CX8A 5E9QA 5KTTA 1V3QE 2TSYB 1VJTA 2X4LA 2LNDA 4IJKA 4C5AA 2XRYA 2X7XA 1V4NA 3HHEA 4QU9A 2PUEA 3TSAA 3IP1A 2EHJA 4GBGA 3PHIA 1PR2A 4EP1A 4X3PA 3EEBA 4YIHA 4CM9A 3SR4A 3MXOA 2HMYB 2ZYSA 4G0PA 2QAJA 1LBQA 3EB9A 1FFDA 1SC3A 2N3ZA 3DDNA 1LCIA 2XMBA 1JIXA 2JGDB 4X54A 4ZQFA 4JUDX 2QTBA 2BOVA 5C35A 3C8MA 4Q00A 4N65A 3K0AA 2UZ4A 2FDCA 4ZTBA 1DX9A 3DH0A 2ZI7A 9LDTA 3A6HA 3U6BA 1Q1ZA 5IASA 4D5GA 4CLOA 2NVOA 4OHUA 1OYWA 3L8HA 2IK8A 2XIJA 2GAFA 4F9FA 5KYKA 3D0RA 3PNMA 3V32A 5F7XA 1EXDA 2VPPA 5JS8A 1TM3E 4FDAA 1BIFA 4KGXA 4X1OA 1N7HA 2AWOA 2AG5A 2VQ6A 1RBZA 5ULLA 3DYBA 4ZMSA 1JNYA 1WCIB 4DIFA 1II0A 2ATCA 2PQ6A 1J8MF 1B1CA 2PK3A 3DBOB 4W6QA 2OV2A 3D6MA 3UCEA 2XNDD 5ITWA 2Y0CA 1OB5A 1MHTA 1NY5A 3E3LA 1H66A 4AW9A 2OQ2A 5IKPA 1BD3A 5ILQA 4ND2A 3K1AB 5KVAA 3NNDA 1EB9A 1X7HA 1C2YA 2OSBA 2KBFA 4Q3KA 5CX1B 2VQSA 3MJSA 3PF9A 4CT4B 1WD7A 2OXCA 3UG7A 3GELA 1EM8A 1DQZA 2O5EA 3IXLA 2R7KA 4C01A 1U81A 3PC3A 2EFJA 3UA3A 9ABPA 2FH5B 1GV1A 3WBBA 4OMFG 3PPIA 1LXCA 3UHPA 3A9SA 3OJOA 4U7HA 3LLCA 1QTNA 2PGXA 5AHKA 3ZWVA 2I2FA 1Z6ZA 1MVOA 3PUXA 1KR5A 1EM6A 4MV0A 5HQJA 3CIOA 4QDKA 3O8NA 3NNNA 4YJ3B 3U4HA 4DDKA 1ZX1A 3H8JA 4EKEA 4YRGA 4F04A 1ZGHA 4ZWNA 4NJMB 4RVSA 4EB8A 5BWLA 5K2MA 2P2NA 5AKLA 2AOXA 4BBJA 1A77A 1ZR2A 1J97A 1Z6TA 1NBAA 4AZTA 5BNIA 2QT0A 3RSHA 1YE3A 7ABPA 1J6UA 2F43B 3Q8LA 4IXWA 5EYPA 4YCSA 4CCWA 4JSYA 3ZX5A 1B0PA 1G5RA 3Q8WA 2WT9A 3DOCA 1TF7A 3JYNA 4G0WA 3VYWA 4BMXA 4URYR 5EMHA 1CV2A 1N2XA 4KE9A 5F78A 2AMVA 3QLVA 1ZJ5A 3UK6A 1UKVY 5TJ9A 3UHAA 3IUMA 5H0IA 1Z8HA 3WK7A 2UV8A 1N5JA 3D2AA 4HLQB 4S1VA 4QTZA 2MR6A 5BRJA 2IKQA 3AI7A 1W36B 4B83A 4RD0A 2HEGA 1Z2NX 3V6MA 4C2UA 2C9CA 1QRAA 1N6HA 3N6VA 4MS1B 2P2CA 1JV2B 1Z47A 1Z3IX 2PSSA 2V97A 3GT7A 3FW1A 4RIIA 4D4GA 3UUWA 3VAAA 1O4WA 2HDHA 1XWFA 3NETA 3RWMB 1FPMA 4V02A 4XLZA 1O4VA 2Q7XA 3R6WA 1W9MA 4N5LA 5AM4A 2FPOA 3TW4A 2R85A 1X87A 2EX1A 2I2AA 4DQ0A 4EW1A 4Q39A 1U98A 5EIFA 2QMOA 3CTPA 4HNGA 4B6FA 1U5BA 5TMPA 5CT9A 2IX3A 1E2HA 4EKIA 1W87A 2J32A 2P9BA 3Q3VA 1NQOA 3HU3A 1IC6A 2RHTA 3GCZA 1AXEA 4PSKA 4DUPA 4IG4A 1J0XO 1GLVA 4DLPA 2FJPA 2OMEA 4RZIA 3S5JA 4EQ6B 1V47A 2C5AA 4EGQA 4BKMA 2JEYA 3NPAA 4AY5A 2CEKA 5HQTA 3KELA 1QQTA 3GN1A 4P22A 1QHNA 4I99A 5K3OA 5IH7A 1EVYA 3H6KA 4S0ZA 3NEPX 2FFHA 3QHQA 4IJ5A 1RRKA 3HEBA 3LG2A 5AHXA 5DGTA 5GINE 3MHPA 4IWYA 2H8GA 1N8NA 3C1AA 4UNIA 3RTEA 4ZDIA 2DFLA 3M3HA 4COKA 4QBHA 5IJ0B 1LBEA 4RNCA 3P1JA 2OGTA 3MQ2A 3QOWA 2UU9B 1N3IA 1MC4A 2Q28A 4KNVA 5HDBB 3JATA 4EKYA 3GFFA 5CBPA 2O2YA 2XI4A 4C0BA 3K6SA 2PV7A 1TYEB 3N8HA 3WWDA 1NG1A 3DXYA 4OCZA 2FE4A 1EP1B 4UHKA 1PQWA 4CI9A 3GLSA 3K0BA 4CDGA 4Q4HA 1CEEA 3VHRA 4NICA 1KK1A 2WF7A 3IUQA 3PXCX 4GVLA 2I99A 2XPCA 3FKSD 1R64A 4HNTA 1RQXA 1EK1A 2PGDA 3UFXA 4FONA 4YT8A 2G0TA 1P2GA 4C0JA 3B6ZA 4GQIA 4NBTA 1DCMA 2DFTA 4NQZA 3LIPA 4E5VA 1KP9A 1YB4A 3M4NA 3OLVA 3UK1A 1L5YA 2ATIA 1P4JA 1GARA 4YMTA 4ZJUA 5HQ3B 4O02B 3O91A 4GF5A 1WHSB 2ONKA 1MTOA 1YZYA 1XNJA 4LYEA 1ISPA 4D7AA 4BX3A 1V39A 3AKEA 2QE7D 3O8RA 3W5IA 3TIXB 4JNKA 3MCUA 3QNWA 4WESA 1DKRA 1ANKA 1SCUB 2QD4A 4TMVA 3ZK7A 3ENWA 2W22A 4MW5A 1WR8A 3P2OA 3AFGA 1K3UB 2HPHA 1B7GO 4IXDA 1JZTA 4PZUA 4DHWA 2EW8A 1YS1X 3IXQA 1HT1E 4GBED 4WK6A 2GAOA 1D2MA 4H1TA 2I4RA 4L0MA 1FYXA 1V0JA 2JGLA 1VMKA 3UMRA 1AGNA 3TIVA 3X0DA 2P4QA 4BO0A 5FP0A 1KYYA 3VKUA 1R3UA 4X62B 1JEDA 3ANNA 2O3QA 3GRRA 4RZSA 4PXYA 3WIBA 1XYVA 1GTVA 3IS3A 4X61A 5EMJA 5JI3E 1XZLA 1X42A 4Z8YA 1NAIA 2BWJA 2V9CA 2VJYA 3M49A 3MRSA 5BY2A 3DG9A 1OV4A 5HCUA 3VR5D 2PX8A 4CODB 4LUCA 3THSA 5ITZA 1NNEA 3BJRA 4P58A 1C9KA 1KO5A 5FNZA 4E5UA 3TCNA 1QZ3A 1SPBS 2ZCUA 3M4XA 3OPNA 3OX2A 4UVGA 1QLHA 3PNQA 4J6FA 3LUJA 3C3CA 1JBEA 1UC4B 1BWRA 2PWZA 3D3QA 3PNSA 4QPZA 5E9JA 4BZZA 2J6CA 1BA2A 1H8ED 2NZVG 3SKXA 3L6UA 4LQCA 4NMHA 4Q4DA 1I1NA 2E48A 2I9KA 1R0WA 3OEYA 4YMSA 1MU0A 3EVTA 3F5SA 1TECE 3FNQA 3OTQA 4ZREA 5GZ3A 3W6PA 2C59A 1PI3A 4HX5A 5K0LA 3E7FA 4Q1DA 4DJDC 1UK7A 1MT0A 2I76A 3R6DA 4NR0A 3DW3X 1EFKA 2AF3C 2AZXA 2LUOA 3BXFA 5I7VA 4TUYF 2XBLA 4M1ZA 5DN6A 3L84A 3ZY2A 2EWVA 1Q16A 3EXHB 4BGIA 1NUQA 2JJ1A 4LJAA 2RARA 4EPXA 1D8AA 3DBIA 3TAXA 2C3MA 2JK1A 3D6FA 3LX6A 3ZE6A 3JZMA 1Y5NA 3TQIA 2HSJA 1AD2A 3KXKA 3Q4GA 3QLVC 5E6UA 2PY6A 1DRUA 3MMXA 3LLUA 3MS4A 1NMQA 4ILEA 3GMIA 3TOVA 1Y3AA 2C20A 3SK0A 1IXYA 3K35A 3RGGA 3KKMA 4C21A 2VTVA 1SB9A 1L4NA 2A9KA 1NUTA 4TYNA 2CLCX 2IYPA 2IL1A 4XDZA 5M04A 1GSIA 4YONB 3X1ZA 1J0EA 3ILYA 1TTQB 3D8TA 3O84A 4N7RA 4Z3KA 2JVKA 2P9CA 3T4EA 1AXRA 4QNNA 1C8VB 1I7NA 3L1JA 4FINA 1K63A 5KHLB 5LLSA 2P30A 1L9XA 1TIKA 4MRMA 4J0GA 5AVZA 1NJGA 2NMVA 5ENVA 3LUGA 4MGYR 1SY7A 3AUUA 4B4WA 1K6XA 3P0EA 3PHLA 2PHZA 1C0EA 3KKNA 1T8PA 2CYBA 1N0WA 4GWKA 2MSLA 4FFBB 1TKBA 1D2AA 2WDPA 1ZUWA 4QECA 3AV3A 4D4LA 1VMDA 4G86A 2BT4A 4NENB 4W8HA 5FFMA 3J81k 4ZU6X 3FOZA 2ZJBA 3SFTA 1X0VA 4M9UA 3A1WA 1Z0AA 3BDIA 1T9GS 1L5LA 2KX7A 3FUUA 4MDFA 2Y4OA 3CPHA 2HMVA 3RE1A 2Y1LA 4TKZA 3MSXA 4Z1MD 4CDNA 4IXNA 3S40A 4E1VA 1LLQA 3W06A 3FHTA 1IULA 3U0VA 4DJEC 2BR5A 2FPXA 1GGMA 1BCSB 2J0SA 4D02A 3R3XA 1T8SA 1H6CA 3EVGA 3DEFA 3S8YA 2D5BA 3IJ5A 1ZEMA 4UEKA 3LC0A 4L95C 2HOQA 3HYTA 4BGUA 3WYNA 3FSJX 2DM6A 4YP5A 2JCVA 4OP1A 1KEUA 1PGPA 1L1FA 2XTAA 3RBXA 2CW5A 1N1DA 3ZE7A 3ABRB 3G23A 4RVDA 3VJKA 4D56A 5JZOA 2WTUA 1AZLA 1Y37A 3HLYA 4HF7A 4YJFB 1QTIA 1SUDA 3WK5A 4Z53A 2R1UA 4AK9A 4X6LA 2GN0A 3ZJ4A 1SUAA 5K3BA 3TAHA 3JALB 3HNRA 4DA9A 2HHCA 3ISJA 2A3NA 4N76A 3V8VA 2PE5A 2AG8A 1PIWA 1CQJA 1XNGA 1JQBA 3OUTA 3R6TA 5BSRA 4OHRA 4RZQA 1DV1A 5H59A 2CMHA 3V4VB 4E31A 1Q1AA 3QW2A 1TCUA 5F5NA 4BIMA 4GI7A 4EATA 4YP9A 4DCSA 5HMLA 1WW2A 6LDHA 3GAAA 5FULA 3FETA 2ZBQA 4EUHA 3KCQA 4MI9A 4YHHB 2KLBA 1J56A 2RI1A 2ZWVA 4RELA 2NZ2A 5AJWA 2G1KA 5HUQA 3WG9A 1VCMA 2Q2OA 3N2YA 3TX2A 2PL3A 3R77A 1X1CA 1R4MA 3OETA 1ZPDA 3DZBA 3G2LA 1P4RA 2FVXA 4YRIA 4UMFA 2IZ0A 2JIBA 1XMIA 2EU8A 2JI6A 2ZREA 1PQ4A 4PQRA 1FSGA 2J3MA 4I1OA 3OFSA 3VV3A 4YALA 1IJEA 5I45A 4TL8A 2I1QA 2VT6A 1E79A 4HUQA 3H0EA 4X45A 5JJCA 1JFLA 3GJ6A 4UJ5A 2R47A 4H1WA 4PZAA 4D9EA 4KW7A 2PMBA 2ZWMA 3AR6A 1BX3A 1YUBA 4MQ6A 4XYGA 4O63O 5EIOA 1JG6A 2BZ0A 1V5WA 4MOWA 3WGYA 5A0VA 4HQLA 2PGLA 3FLEA 3HACA 4R2KA 5AXDA 4HWSA 1NTOA 3T3PB 3AEQA 3ZWYA 3KL4A 3B53X 4FGZA 1QGYA 1EVQA 1X7XA 2GJ8A 2OBFA 3MWYW 4IFEA 5FX2A 2ZM6B 2BGRA 3OHSX 1HFWA 4ZVKA 3D6UA 4F4FA 1V96A 4URHA 4NBUA 2VTKA 2OP0A 2C4MA 4RJJA 2PKYX 3OZEA 4LY3A 1BVRA 3RIYA 5GM1A 2QPTA 1N1EA 3QNUA 3GEGA 4XEHA 3AI3A 1ZGBA 3O1JC 1BHSA 2R68A 2YVLA 3O8BA 5GV8A 1KQNA 3WOHA 2FW9A 2ZSAA 5DNUA 3ZY4A 4Y1EA 2K7ZA 2XZDA 3FDXA 3PE6A 1MAAA 1KJ8A 1ISMA 3TE6A 4KYVA 4AF6A 5LXTB 5JOQA 4HPWA 4PGAA 3LVBA 3TRJA 1DAHA 1ZMOA 4E5SA 1BX0A 1U8FO 5LD2B 1E1CA 3T61A 3LT2A 4KSBA 1OXUA 1M83A 4UHCA 3C6BA 4PCUA 3EQZA 3I28A 3S81A 1NVMB 3DYIA 1VECA 1OE0A 1E8MA 1KSHA 4TTSA 3VKHA 3OZWA 1FUUA 3IO5A 3IKLA 3PGJA 5H16A 3VI4B 2VJLA 4YBRA 4DXHA 3PTZA 3VO2A 1K5PA 4HJXA 4D9NA 3LPNA 2XKKA 4KYIB 3GD7A 1BMFA 1CJUC 3AF6A 4DPMA 2AMFA 2BM9A 5ED4A 3N8KA 1Y1TA 3UJ9A 3UWDA 1I51A 4RMIA 3RYFB 3WMRA 1TYCA 4BP1A 1GTZA 3JWIA 1IOWA 1SCBA 3OQVA 3Q15C 1N25A 3Q3HA 4OI1A 3SDSA 4TXNA 5KSZA 2JI9A 2OKCA 4KRXA 4CKCB 4M55A 2REQB 5IT4A 4FMDB 3TZ6A 2HUNA 4KDEA 2DY1A 3WZLA 3BWMA 1JDBC 2C99A 5K0CA 1AHPA 2I8LA 4NV3A 1SKYE 5EFOA 1QFJA 3EW7A 1JJFA 3HB7A 1FP4A 1EG2A 2I62A 2SKEA 2AC4A 4M89A 2RGYA 4OXIA 5ER6A 3SEZA 2QORA 3MCWA 2BTOA 1UOOA 1N0HA 2J46A 3N0VA 4CM4A 4ML3A 4PC7A 1V48A 1N2CB 1JEQB 3RRBA 3V1NA 3ESZA 3ZCXA 3UCFA 2QY9A 4NZPA 4C7XA 1FFGA 2BZSA 1ZL2A 2FF5A 2AOTA 3PT5A 1QYIA 5DHTA 1NW8A 4CE6A 1GPBA 4M8LA 3TEFA 6NULA 4DV1B 1QORA 5ALJA 4O1IA 2FOIA 4UBOA 1I0LA 3EBLA 5AW1A 2VSYA 2XJ9A 1ST3A 2OA0A 1TE2A 3EUAA 4YDQA 3HDGA 1JILA 1DG1G 1QG4A 3D1LA 1HG0A 2EP8A 1GNTA 1W30A 1T4GA 5G41A 1KIMA 2NTEA 3AW9A 1QQ6A 4DJ5X 1QC5A 1E5LA 3IELA 3JAWA 2V7UA 5CW1A 4A8JB 3PD1A 1FTSA 5IC6A 3UO8B 3FWHA 2VP4A 4DLBA 5F23A 1ZUIA 2ETXA 4AURA 3HYLA 4J07A 1DXHA 2AR0A 4ZCQA 1E63A 1PT9A 2ORWA 2YUTA 4RKRA 4EY8A 3HVIA 4HADA 3NM6B 3O9ZA 3R76A 2AHOA 5KDOA 3AR5A 4BC0A 5FTJA 2H7VA 3WZ2A 1RYMA 3VDMA 1HWYA 2BEKA 3OEHD 1KZ4A 1JQ5A 4TSKA 1D2GA 3CHYA 2GTIA 3CONA 1A5BB 1ADJA 3UC5A 1PNOA 1VLHA 1WW8A 4K3VA 1P0PA 1IY8A 4R2XA 1G19A 2FFJA 4DEVA 1A82A 3EF1A 1VOTA 1T9ZA 3GLQA 3E82A 3ZIUA 1JXOA 1G66A 4W5WA 2XUZA 5GTDA 2H1LA 3UJDA 5B4TA 1BQ4A 4FFNA 3L6BA 1R5BA 4L9RA 2WA2A 4PX2A 3NEAA 4QLOA 2QBYB 3PLNA 5JXJA 1D4OA 1CEXA 2IDKA 4JASB 3E27A 2I54A 4JP3A 2O8VA 3IBTA 1K68A 4AMGA 2IXFA 2NADA 1MVLA 3JQ8A 1JWLA 1K3FA 2XQKA 1VSQA 2YWCA 5AD1A 4EY5A 2BP7A 2K2WA 3TGWA 5AUQA 2ZS8A 1L4FA 1LK0A 4V38A 5F12A 3RDPA 3QKUA 5JC1A 3LUDA 4OFXA 4EHLA 3VR6A 3ITKA 2JG3A 2QZSA 3DHVA 4GPEA 5KSPA 4BKPA 2PUAA 2I6GA 1YQQA 1DJMA 3O4HA 2A94A 3M6FA 1HORA 2QL6A 4MIYA 5LDDC 2VXBA 4JI2B 4BEJA 4D3SA 2XE6A 3GVXA 4XXHA 2B1GA 2GEBA 1B3BA 2CJWA 4HZUA 4MVYA 1OWPA 1K8ZB 1Y4DE 2EZ4A 3K0CA 4QYIB 4CLEA 5EIAA 2UYOA 4CMHA 1Z8NA 5BVGB 1MQSA 4CL8A 4J29A 3MTIA 1AIPA 4XWOA 5KREA 2WVHA 3O47A 3ROFA 4AKGA 1EQ2A 5LA6B 1V5IA 1X13A 1SG9A 2VK1A 2FEPA 2TMDA 3FSGD 3OAAA 2AB0A 4P81A 4YRCA 1PL7A 2GR9A 1MMFB 2FUNB 3Q72A 2AHRA 4TTAA 4J7CA 1K08A 5FJJA 3R7FA 4TLAA 4UHFA 3ET4A 3ZQUA 2H1RA 2R97A 3QPBA 3OC0A 4KEAA 5G53C 2DLDA 3KPUA 3GX1A 4B9EA 3HP1A 1OFVA 1P1IA 1DIGA 3H6HA 4UPVA 3WVNA 4C4SA 5JAPA 3WHIA 3JZFA 4XJSA 4HN4B 3FHCB 5BYJA 1J2TA 1ZFNA 2ZJFA 3I42A 3LA8A 4IR7A 3VVLA 3MTQA 4RH3A 1CKEA 4F12A 4Q4LA 3EVAA 4Q3DA 2VQEB 1MX9A 4OKNA 2CD9A 1Z73A 1XTVA 2H3EA 2OXTA 1L5NA 4F38A 1FX0A 2AL7A 5BSFA 4GYJA 3ACBA 2W2TA 2XUFA 2YWEA 3K0FA 2BFBA 4MMYB 1HLDA 1XXLA 2C2MA 2RONA 2WKPA 3VBEA 4B35A 4EI2A 1L4BA 1LSOA 2D1QA 5I3CA 2Z9BA 3HVHA 2W93A 3ETNA 2ABWA 4HBZA 4GI1A 1I1HA 4DILA 3BHMA 6ABPA 5SICE 1A88A 1N6OA 1CDZA 1QYXA 2WF8A 4GDFA 1Q3HA 4I50A 1AZSC 4G5XA 5AJVB 4I4TB 3AZPA 4GKJB 3RV4A 4FMCF 3WHPA 2Q50A 4ASUD 4LOJA 5FB3A 4LNUB 1BEEA 2IPNA 1T5HX 1A72A 2HWUA 1J5XA 3KPJA 2VAPA 3REQB 4C03A 5C7YA 3ZCRA 4OX9B 1N2SA 5HZKA 3FMGA 1M74A 1WMSA 3P94A 3PDUA 1KMMA 3X2FA 3V1UA 1M1YA 1OGYA 1YB5A 2RAPA 3PWKA 1U0GA 3BRSA 3UQZA 4J9UE 2R8PA 4RIFA 2CNDA 2Y05A 3EFOA 4C6RA 3QBDA 2WFMA 1GZ6A 2DQSA 2B1JA 1E1QA 2WU8A 4G09A 2FMTA 1VL1A 2FWPA 2ZSBA 3HABA 3HB1A 1A2OA 2PXAA 3UKJA 1HC7A 4HNQA 4WT7A 4KI0A 1MIHA 4CVNA 1RJGA 1XA0A 2WMYA 1CF4A 3F6EX 1SXJA 2FSVA 4I9HA 4JR0A 1ZU4A 4KQHA 3T4PA 3GUUA 3UWKA 3H1GA 4F97A 2RBEA 3UJ6A 2VP0A 4ZCIA 3M9LA 2AUNA 3WLMA 3G2QA 3C3KA 2BI8A 2IZ1A 1FTGA 2IT1A 4OOFA 3AGQA 3LPMA 4IQ0A 3CW2A 1KMNA 1JIQA 1VFNA 2PZFA 1W88B 1QG6A 2IYYA 3C1TA 3KV3O 4I1SA 4IUCS 4K05A 2Y27A 3A9TA 1XAGA 2WV9A 3B85A 3M0EA 3OCWA 4PYJA 5FOUA 3I9V1 3TLXA 3KKLA 4Q47A 3DBRB 4RFSA 4YRAA 2H2IA 1P2UA 1FUYB 2FR0A 4I08A 2C4VA 3MQ4A 1YL5A 2WJYA 4MYUA 1TVKA 2WBLC 3KQLA 1QH9A 3RAGA 2ZJYA 1HURA 3PZBA 4BFTA 4V0NA 1C0LA 3G5UA 3O82A 2AFRA 5TQVA 4BNUA 4WY8A 3NHSA 3EXIA 1ABFA 3MGGA 4EJ2A 2PH1A 5DBFA 4HZGA 2W2LA 4DM3A 2VDWA 3BVPA 1JQKA 2HPAA 4P5DA 3BGOS 1G1MA 4P3YA 2JGNA 3VU9B 3P4UA 5GOZA 3WI7A 3UK0A 3AR4A 4FU0A 2GJ4A 3HSYA 2I3DA 4GZ3A 4Y2QA 1SK8A 5T3YA 1FUKA 2P77A 4L76A 3VU1A 2GM9A 3GGPA 1YQUA 1L7MA 1WXQA 2O2SA 2PCJA 2QU7A 2CSUA 3M6XA 2WW8A 3N2GA 3WGMA 3AU8A 2I3BA 1C3OB 3LXUX 2RAFA 3QPWA 4GR4A 4MTLA 4MZDA 4P34A 2QPLA 1Y6QA 5BT8A 3LY5A 4HEHA 4PXAA 4UAGA 4LVOA 4BGEA 3QELA 3GQBA 1C2TA 2P9ZA 3BJIC 3PXUA 4WD3A 4CN9A 3MXTA 1E1YA 2WR8A 4LBZA 4EG6A 2W2KA 4JS0A 5E7QA 1U9CA 4N01A 5B1DA 4II3A 2HK8A 4XR9A 1RYBA 4JI5B 1M33A 3I1YA 2C2OA 4DUZB 3SICE 3ZGLA 4G89A 2CVPA 4X5OA 3QVWA 3A1CA 4PZPA 5HJ2A 4DSAA 3OPYA 4GMDA 1I0ZA 2RHBA 4OLHA 4MTCA 3RVJA 3IPCA 1AKVA 2G4CA 5AHOA 5E2AA 3A26A 2GYYA 1KQ3A 3N3BC 1NQ5A 3ANTA 3AFMA 3K0CC 4EMTA 1FMLA 3HNOA 5DM60 1WMEA 1Y7LA 1HLGA 1ZNWA 3L6CA 1UDXA 4IQGA 2A9OA 3R0IA 3VYSB 1F8YA 2EJBA 4B3GA 1Y5IA 1QHHB 2VHTA 2P11A 5DIZA 4ITVA 3JY6A 3SIPA 1IN6A 1E2JA 3B2EA 3VU8A 5TJHA 5DYIA 2QN3A 5FTWA 2G83A 1ACMA 1AS3A 3NB0A 2QJWA 1GRNA 3P2IA 5EUMA 4ARUA 2GHQA 1CUAA 4C4AA 1W85A 2DT5A 3EF0A 3GRAA 3LLVA 4ZZIA 1Z5GA 4OA5A 3WLIA 2ZIZA 5LFAA 2BUAA 2J3DA 3ET5A 3KT8A 4PU0A 4Q01A 4TTIA 2W5UA 3IUEA 1LJLA 2VP3A 1AGXA 3DE7X 3PWSA 3IE0A 2RFLA 1PJSA 1XJ0A 1ENPA 1L5ZA 4FCTA 3RC3A 2QN1A 2X0FA 2IYVA 2X8JA 4AU1A 5HOEA 1FVFA 1EGMB 1YOVB 2AFIB 2C77A 1TLTA 3JWHA 3QVXA 1JDNA 4L0QA 3AJRA 4L5BA 1A7JA 1EFCA 2H2WA 2FFRA 1TCAA 2UYQA 2UZ1B 3CNEA 4HLUA 3JZDA 4ZXFA 2J1LA 1ISRA 4UHEA 3WWOA 3DS8A 2F62A 4JH0A 5IYZB 2XRZA 1Q1GA 4RQBA 2J9FB 3S28A 2JH9A 3I23A 4EG8A 2XLBA 5TB5A 4GGOA 1JG3A 4JEHA 2VRWA 3ZHZA 3AVYA 4HC4A 3F5FA 2IITA 1R5OA 2O2ZA 4RZUA 4AULA 4HDCA 2WTMA 4D1YA 1L3CA 5LOVF 3DOOA 3D0OA 1ORWA 4QHTA 5KAPA 5THKA 5JALA 4M9CA 4F5EA 5FLKA 1YACA 1UQUA 1J70A 3R9XA 1J39A 1XMXA 4HBGA 5JPCA 3Q5DA 5JVDF 5KYUA 1KI3A 3GO4A 4MGKR 1V11A 3ZDXB 5CFNA 1UKCA 1QDEA 1JI3A 2WNIA 4OSPA 3PXAA 3P26A 4XIIA 1T6NA 1DBWA 4BLVA 4D4KA 1L8XA 4QDUA 1CULC 3S0JA 2CV0A 3FNBA 3CPJB 4ZHQA 4IFIA 4W1PA 2AXPA 2X6TA 3PPWA 5BSKA 1T2AA 4EEXA 5FEUA 1AMUA 4BNWA 2WQZA 4DLKA 2RGAA 4K9OA 1XK7A 2ILVA 1PV2A 4REQA 4HS4A 2PPVA 5DASA 5B4UA 1JFFB 1U2GA 2QM3A 1Z7WA 3T4XA 4D0NA 4DQUA 3A3NA 1T2DA 1G16A 1KBZA 5EMKA 3RFCA 1SXJC 2FSVC 4XDYA 1AO0A 4TLBA 1Q21A 4ITRC 1OZFA 2QE7A 3KR1A 1X80A 2FQXA 3WK9A 3ZHVA 1E9EA 1QK4A 1U2EA 4BEWA 1EB8A 2JIZD 3HEMA 5C3MA 4H08A 5A3RA 3V3TA 4U7FA 3OCZA 1SBZA 2ZM5A 3MK31 2OCYC 5IVKA 4A5SA 2CWWA 2YZKA 3AF4A 3M6IA 3MGKA 1FC0A 2ORIA 3KQYA 3O4FA 4HDKA 2C7OA 3TLKA 4MWSA 5GVSA 4PYOA 2D0PB 1GU1A 1Q6YA 2GPAA 3A1EA 3KAJA 2J45A 4X97A 2GZ2A 4P4GA 1CB0A 4J1QA 1EFAA 1Q12A 3Q85A 4RWZA 4XD7D 5C46F 3FKQA 2G6BA 3GBPA 1W4LA 1IUNA 3L02A 2Z30A 4GOMD 4M99A 4X9XA 1QGZA 3FCUB 1Z0DA 3KZKA 4GW3A 1CS0B 4R8RA 4IJMA 4YPFA 2WYIA 1S3SA 2Q5EA 2XB9A 2Z6AA 2XGJA 5ALQA 3UJNA 1XQYA 2HC9A 3OFVA 2JVJA 4RDCA 2H5LA 2V9PA 1O54A 4ONEA 3L40A 5ICSA 4BQSA 1G7SA 3PEVA 2VUIB 1UADA 2X13A 1VPDA 4FKZA 4II2A 4G5OA 5AI5A 4GMGA 4BJ1A 4F6CA 1EUYA 2HK9A 3DZ8A 1N5OX 3BE4A 4BNDB 5BP7A 4MW2A 3RJZA 3ZKWA 3BMCB 4KE8A 5TS3A 1GITA 3VNBA 2QRPA 3I1FA 4D97A 4UBIA 4DM7A 1G38A 1VPWA 1YTUA 2PSDA 1GAJA 1EUZA 1CFJA 3JWPA 4DMHA 5KDDA 4UVDA 4R71A 4FDMA 4HXYA 5BV0A 3C5WP 1CJSA 3EOBI 1KJJA 1C0IA 4H31A 1N5KA 3ME5A 4KO2S 1AH2A 1MX5A 5J47A 4KSYA 1NV9A 4D6YA 1IEVA 5TPWB 2WJGA 3F9CA 5FR1A 5IC4A 4RK6A 3TXAA 4C22A 1X9IA 2PJDA 2YHIA 4ID3A 4FW9A 2H4ZA 3SSMA 2AX4A 2A6PA 4UDNA 5HGXA 4OHMA 5DNYB 4QYSA 1T35A 1PVDA 2FP4B 4B85A 2XT9A 4ZIRA 4ZI2A 2QXYA 4OQPA 3A9UA 1A5ZA 3GLFA 2QQ0A 2C2GA 4A6DA 1RP1A 3M6MD 5B6PA 2E49A 3K1ZA 5F77A 3THYA 4CIBA 4QFCA 5CM2Z 1IBKB 2P0EA 1C0PA 4M37A 5FO0A 3DZGA 2PX4A 1IATA 1KK3A 4I46A 2W2PA 4TXHA 3TS1A 1P3Y1 2NPIA 2NXEA 4ZV7A 4B87A 1QFMA 3EVDA 5DEIA 1D03A 2XIQA 2NVWA 4QEDA 5CYOA 3S4YA 3TH5A 3V5NA 2D2IA 2VTDA 1DRWA 3IV7A 5M2QA 2VH1A 1E7SA 4LJRA 4B09A 1UM8A 4OHZA 1UBJS 1A9TA 2YWDA 3H1AA 1JDVA 3UB2A 1FTYA 4AS1A 2PXCA 3OOEA 3OT1B 1JLLA 4TVOA 4GAEA 4WFQA 3M1IA 1ZSVA 3BQ9A 5J2TB 4WA7A 2HKIA 1WHTB 1YZTA 1E1MA 3DHNA 5J1TB 1PLKA 4N9QA 1YONA 4J3NA 2EJUA 4IOKA 2VEDA 4NK5A 2EL9A 3DEIA 2QDKA 6ADHA 4RY8A 5KYGA 3RRJA 5I7UA 3VMMA 2JJYA 5KIAA 1PZNA 1U7TA 3JD3A 4KQ2A 1AQUA 1RFGE 2L2QA 3CMMA 3KUDA 4HLUC 1W0JA 1XVTA 2ZJ4A 1WSWA 3UV7A 1NI4A 2WSBA 2J9ZB 3BMQB 1QE0A 2JHGA 2JDID 2IQ5A 3OIFA 2RKBA 4CF6A 4CLRA 4DMUB 1VB3A 3DTVD 1NNUA 2O0HA 4BKRA 4B3RB 1GSAA 2OG2A 1KAHA 2YOGA 4AJIA 5REQA 1AA9A 1CRQA 3FKJA 3TSWA 2VDKB 3LK6A 1SUPA 3ZH2A 1LI4A 3LKDA 3K0KA 3R5FA 3PJFA 4WZBA 4IGAA 3PFWO 4LOKA 3VGPA 4K5QA 1KH3A 3N9IA 2M6RA 5DGHA 2JCGA 4FKBA 2FG6C 4YUZA 2HBQA 1QAOA 2QZZA 4G5HA 3DM5A 2G4VA 1HL7A 3EG5A 2CVFA 4MQ4A 2Q5HA 3TDMA 4YGXB 2NP7A 3G0CA 1QB7A 1E9VA 1P1RA 2NQTA 3FA2A 4XPIA 2X77A 2ZJ3A 4QXQA 1G42A 1QIFA 1WPGA 3CEHA 4WLVA 1A9XA 1W75A 3WGTA 3IBGA 3QSYA 4AN4A 4JA2A 2ECPA 3HJAA 1Z5ZA 1CY2A 1KVRA 5BWOA 1Z3CA 1VHWA 1VP9A 2CJFA 4AI6A 1U2GC 3T7JA 5ITSA 3K30A 2GA8A 5ALZA 1TYZA 2FFBA 2RH4A 4PFSA 4CYMA 3V7YA 4H1HA 1WCXA 1K1EA 3GUYA 4L02A 3HZRA 5COAA 2CHGA 1BGWA 2XITA 5B57C 3EEFA 3MJFA 4YAEA 2HF8A 4YAWA 5A5VA 1X39A 2QU8A 4DJFC 1R74A 4POOA 3SKVA 2D1TA 1JG2A 1Y5MA 4R6XA 2VJMB 4WZ6A 1QVZA 3DTVB 4B7AA 3LJKA 2GBPA 1U8ZA 2H4HA 2PBLA 4S1PA 2YBEA 2YJGA 4K2HA 2W2MA 4KMRA 4E32A 4PPFA 1ZCBA 1FMTA 2VWPA 4K1LA 4DANA 4NZ9A 3UJAA 1SC6A 1YNOA 4BFYA 4U9HS 2A0FA 4LMBA 2I9PA 5ENZA 3BN3A 1M2GA 2FG5A 1H6AA 2WF5A 2GCPA 4KJZA 3MHTA 4ZTUB 2O1WA 4KI7A 4BMOB 2O07A 1Q0PA 1GDHA 4GR9A 5DBIA 1WG8A 2O54A 2BKAA 1IEQA 1VPTA 4FYXA 4A9AA 3WQBA 2ZUUA 4KHPB 2V7PA 5CHEA 3PE4A 3WGUA 1UKAA 4QPCA 3DWGA 4D8XA 5JXIA 5LZ7A 3Q6MA 4QM6A 1MJ5A 1MHPA 2EHDA 3Q8XB 4B75A 5AVQA 4CKEA 4ENRA 4BO1A 2JLZA 1MOSA 4BNGA 1FDIA 1Q7GA 4BLSA 2QT1A 2ZJ5A 2ZCVA 4IZOA 4QQNA 5ICEA 2HQRA 3LP8A 4HR7A 4ZVNA 3D43A 5KWIA 1ML4A 1TO1E 1VA5A 2WYUA 3A28A 4LNHA 1WX1A 3NTLA 2D4AA 1BU5A 3LY8A 4TMWA 5KTSA 1E2MA 2BVNA 1U5AA 4KCGA 1VHLA 1G6Q1 1FZTA 3ZNQA 3ZVKA 3LF2A 1TD1A 4WUVA 4ZI7A 4Q3AA 3ZDZB 3O4VA 2IH5A 3WYCA 1GHTA 4WECA 2OM6A 1R16A 3JASB 2MYUA 4J3FA 1XNHA 1MAVA 4HFRA 1Q50A 1EK2A 1PJBA 2QGFA 2PD3A 1ULZA 4G9GA 4NTZA 3TR6A 5EE0A 3W9YA 2F4NA 4B74A 5BORA 5CG2A 1CP2A 1KZ1A 1O57A 3FFBA 1BC5A 1FP2A 1EXNA 1WB6A 4U5QA 3FPLA 4XR4A 4AZ0A 3RVPA 1JA0A 2PS1A 3CQ9A 1PYGA 4TZKA 5AUNB