5IUHA

Crystal structure of the anaplastic lymphoma kinase (alk) in complex with 5d
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
312
structure length
285
Chain Sequence
NPNYSFAGKTSSISDLKEVPRKNITLIRGLGEVYEGQVSGPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMACAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords ALK tyrosine kinase receptor
publication title Pyrazolylamine Derivatives Reveal the Conformational Switching between Type I and Type II Binding Modes of Anaplastic Lymphoma Kinase (ALK).
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 285
sequence length 312
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5iuhA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5iuhA01
1H08A 3ZDUA 4FK3A 4EK4A 5F9EA 2UZDA 5IH4A 3QRIA 3FZOA 2BAJA 3NCZA 4TT7A 4CV9A 5H8GA 3VBWA 4IAAA 2ZVAA 2G2IA 3L8XA 1YVJA 2PZYA 3A7IA 1GZNA 3KRXA 4MF0A 4DLIA 5JQ8A 3EL7A 5IA0A 1GIJA 3H10A 1OM1A 3B8QA 3QTWA 5M09A 5DNRA 3S3IA 4M84A 5LMAA 4IM2A 5FEQA 3THBA 1W7HA 2W9FB 2ITPA 3I5NA 3Q9ZA 3QQLA 3EN5A 2JLDA 5TT7A 4BTJA 4CYJA 2VTTA 3EIDA 3NYOA 5CXHA 2BRNA 4I22A 3UO5A 1Y57A 3IECA 4D2WA 3BEAA 4P7EA 4CKRA 1OIRA 2V7OA 3LQ8A 3QTUA 5EI2A 2YITA 3VS5A 3HUBA 3ZFYA 2XNBA 4CKIA 4BDIA 4FNXA 2JKOA 4EKLA 4BBMA 4FG7A 1PMEA 2GNJA 4ANMA 5C26A 4DF3A 4IEBA 4QQJA 2I1MA 4FKUA 4C4IA 4KIPA 2WPAA 1KUTA 2PVYA 1LPUA 4JJRA 4GCJA 4H1MA 1OKZA 4S2ZA 1PYXA 1W83A 2W99B 3LFDA 5CNNA 5CQUA 3MVHA 4YTCA 4U97A 2EXEA 5HHWA 4D28A 4YBJA 2ETRA 5AM6A 3Q4CA 4RIOA 3OT3A 3K54A 5D7VA 5J79A 5BVOA 2JIUA 2XIKA 4TWPA 3CR0A 5HD7A 2BZIB 2VTPA 1W98A 1FGKA 3QQFA 4G2FA 4NM7A 1DI9A 3CP9A 1J7UA 1YKRA 2C6IA 2IW8A 2OJIA 3QLGA 3ZRKA 4IVCA 5JT2A 1M7QA 1GOLA 3LXLA 4A4XA 3KGAA 3HLLA 3QXOA 4O7RA 1Q5KA 1MUOA 3EKNA 2QQ7A 2FSOX 3EZRA 3EFKA 2X8IA 4KB8A 5EM7A 4KKGA 3W16A 3CY3A 2J0KA 4W9XA 4KBCA 2WMUA 4HNFA 4O7VA 5AR2A 4RWKA 4GU9A 4XV1A 4HCVA 4QMVA 5F4NA 3GCSA 3H3CA 3ZEWA 2OICA 3HMIA 3LPBA 3QHRA 4HVSA 5DT0A 5C9CA 2UW8A 3IOKA 3KMUA 3ENHA 4Y73A 3ORMA 4EHGA 5ITAA 3LFBA 4KA3A 3CTJA 4XYFA 5C03A 4O1PA 3UMXA 3R9DA 2CCHA 4BKZA 4NTSA 3TM0A 1ZYSA 4FV5A 5IQBA 3PZEA 3FKOA 3TKHA 2GFSA 4IB5A 3P7BA 5AV3A 2W7XA 1PXOA 3TEIA 4WNMA 3F2AA 4M69B 3VUKA 2F2CB 5HE3A 4E1ZA 5CEPA 3N4VA 3QHWA 3VJNA 2O5KA 5EHLA 2W1EA 3GOPA 3HAVA 4LUDA 4F7JA 4XS2A 3QTIA 4HVIA 4I5HA 4XG7A 2P4IA 3BX5A 4DEDA 2A2AA 2OXYA 3OCTA 1NXKA 4IC8A 3FEGA 1PY5A 5DA3A 1E1VA 3G0FA 3R9HA 1NA7A 4DAWA 3KXNA 2PUUA 3Q4ZA 4E6CA 5IQDA 3OHTA 4GYIA 4A4LA 4AWIA 3ZO3A 5IQAA 3GCVA 1PXLA 4XUFA 1IG1A 5FDXA 2SRCA 3VRZA 2RFDA 4Y72A 3VUTA 1XH5A 1SZMA 3OP5A 5IA5A 3RAIA 5HCYA 1OL5A 3FQHA 4RVKA 4J8MA 3LAUA 3I4BA 5HG9A 4PL3A 4KS7A 1OUYA 4ZZMA 4XLVA 3FLWA 3KRWA 4IBMA 4ZS4A 1PXNA 3O8PA 5DG5A 2VWUA 5GJFA 1TKIA 3VQHA 1KV2A 1WBWA 1BL6A 3PY1A 4D4RA 1H28A 5A4LA 1E9HA 5DGZA 2E9VA 5T68A 4H36A 4LL5A 4YJNA 3QUDA 3VBTA 3MB6A 2PVMA 5AM7A 3MA6A 4ANBA 3BGQA 3D5UA 3TZ9A 4BCOA 4FT0A 3ORXA 5HI2A 2JBPA 4E73A 1FVTA 4QMXA 3HA8A 4IH8A 1Y8GA 4W4VA 4YJUA 4JQ8A 3OROA 2I6LA 4MNEB 4FIIA 4I23A 3RAWA 5CAVA 1YQJA 3WIGA 3E7VA 4RGJA 3DY7A 5I9VA 4IANA 2XMYA 3OCGA 4JNWA 4NSTA 2ITXA 2WTJA 4WUNA 2I0VA 5CSWA 4D9UA 2R3FA 3ANRA 4RX7A 4OR5A 3M2WA 2Y6OA 4FUXA 3TIZA 4L8MA 5LCKA 4F08A 2YCRA 5A4CA 5BMSA 3CXWA 3EQFA 4RLLA 4O7YA 4XG6A 4FTTA 2B9IA 4QMUA 3CS9A 3LMGA 3POOA 4FEUA 3Q3BA 1F3MC 1ZYCA 4IVAA 3EFWA 4RJ7A 4U0IA 4UZDA 4PQNA 5IQHA 5AJQA 1Y6BA 3FI8A 5K4IA 1GIHA 4HVHA 1KE7A 3MDYA 3Q5IA 4EC8A 2VX0A 4FF8A 5DT3A 5A6NA 4AXAA 5LJJA 2C6LA 2ACXA 4QTAA 2RG6A 4ZK5A 3UTOA 2JFMA 4QTCA 1MQ4A 3PXZA 4MF1A 5DHJA 5DMZA 3ZEPA 3Q5ZA 4TPTA 1OPJA 2CN5A 5AX9A 4NFMA 1U54A 4IVDA 1GJOA 1R39A 2C1AA 3HMOA 4PMSA 4YZCA 4O86A 3IW4A 2WMXA 5FP5A 3RK9A 4AGUA 3TACA 3KXGA 4ZTRA 3O51A 3TT0A 2WIPA 5F1ZA 4M12A 4JQEA 3CY2A 3R9OA 4EK6A 1JVPP 4PV0A 3QF9A 3EN9A 3GU8A 4C34A 4FK6A 3G33A 5HTIA 2IZSA 1Q8WA 2QOIA 4L00A 1YXTA 1Q8UA 1WBTA 4AGDA 3DJ6A 5I4NA 5CU0A 5CASA 3C50A 5C1QB 3UIBA 2BAKA 2QURA 5HBHA 4F9BA 2C0IA 2O64A 3VHEA 1YDRE 3AD4A 3MFRA 4GVAA 4C4HA 1SVEA 4ZJIA 4MHAA 4IW0A 4BBEA 4XNEA 4YGAA 3UVQA 3R02A 3OT8A 4QYEA 4BDFA 4IWOA 3LOKA 4TYHA 2VTSA 3RJCA 4ITIA 3O8TA 5J87A 3GGFA 5J7BA 1NVSA 5EQYA 4L3LA 3DV3A 4BIBA 5EW3A 3WF6A 3U54A 2R3HA 4AN2A 2UVZA 4TZRA 1AGWA 5GJDA 4JG6A 5GIPE 5K4JA 2ITYA 3FL5A 2OO8X 3L9MA 4FBXA 4OTDA 4DLJA 2PUNA 1WBOA 2W17A 3PP1A 2GSFA 3KMWA 3ZO2A 4QMPA 2OWBA 3R2YA 3A61A 3EN6A 3ORTA 3SHEA 5AR3A 4AA4A 1NY3A 3TV6A 5BYYA 3TJCA 4CZUA 2BRHA 4ALUA 3O23A 3WILA 3QGYA 4ZSLA 5ANDA 5HORA 4CG8A 5CTPA 4NJDA 3HNGA 5BVWA 4EORA 1VR2A 2FB8A 4FA2A 3PZHA 1ZOEA 2ZV9A 4X0MA 5M08A 4F64A 1SVHA 4GYGA 3OF0A 5HO8A 4RC3A 4E26A 3QFVA 3R7UA 2W5HA 5G1XA 4YJVA 4M8TA 4DE4A 2QOLA 3FMDA 3MBLA 2WMTA 5ETCA 2LAVA 2QLQA 3QAME 4BHNA 4NUSA 3H4JA 3P79A 1UKIA 2B9JA 5ETFA 3W2CA 5DVRA 3V3VA 4ZZNA 3CCNA 1PMVA 4MCVA 2ITTA 3GU6A 3DA6A 4EK3A 3TNIA 3AT2A 2ESMA 2GU8A 3ULZA 2YCSA 4AOIA 1KOAA 4TYJA 4DFNA 4ITHA 4DH5A 5E8WA 2F57A 2YJRA 3QL8A 3CTQA 5CNOA 2PULA 4NJ3A 1GNGA 2RIOA 4MTAA 3GFEA 4PP7A 4J71A 4EEVA 1LEWA 4K18A 4RJ6A 5AV4A 4QYFA 4DT9A 1WVXA 2FYSA 3R28A 4B8MA 4R7HA 2BPMA 2WMWA 3FHRA 4K1BA 3UQGA 4V0GB 3FI4A 5B7VA 3VS1A 4KNBA 2J4ZA 4IFCA 3FLZA 4WBOA 4MWIA 1IAJA 3CTHA 3ORIA 4UXLA 4EH7A 1STCE 4ZP5A 4BVUA 4E93A 4DA5A 3BLHA 4TNBA 4WNPA 1O6LA 1M2RA 3E8CA 3O8UA 3ORLA 1YXSA 3F82A 4QP1A 1H25A 4C36A 3VRYA 2UZWE 3UC3A 2QHNA 2CGXA 3AC8A 5EW8A 4AZTA 3PYYA 1ZLTA 4WOVA 4XH6A 3LQ3A 4LQMA 3EN7A 3NUSA 5EM6A 4DG0E 3ZS5A 3QRJA 2WEVA 4EC9A 4FKLA 2WMBA 3Q9YA 5CANA 2YFXA 4RBLA 3DQXA 3UZPA 3HRFA 4KABA 4O7ZA 4ZSEA 3BYMA 3LFEA 4RC2A 4RIWB 2QONA 3FZPA 4XRLA 4I0RA 1ERKA 2JKKA 2C5XA 3C4FA 3MVJA 4I94A 4BIDA 3QYWA 4F0FA 2CN8A 4IWQA 5EYDA 2XBJA 4IDVA 4M14A 5HVJA 3LMIA 4KD1A 3O96A 4FNYA 2W9ZB 2XKCA 3VUMA 4CQGA 1Q41A 3POZA 2GDOA 5CAPA 1PW2A 3W2PA 4DGMA 3NUUA 3GC8A 3PXFA 2ZYBA 2JDRA 3A7HA 3DKCA 5E1SA 3ZSHA 4A07A 2OIBA 2RG5A 2UZVA 2V62A 4UMRA 5HLWA 1YHSA 1G8SA 4O82A 3NWWA 3OBJA 3MW1A 4ANOA 4LMUA 2P2HA 3ZM9A 2GNGA 5J9ZA 4Y8DA 4DH7A 4EYJA 3OCBA 4BFMA 2PZRA 1LR4A 2WQEA 3EQHA 5AP1A 4BZDA 3E62A 5HU3A 4QMLA 3UDBA 1FVVA 4RG0A 4BBFA 4EKKA 4F1OA 4YO4A 4CLJA 5KMLA 3UZRA 3P5KA 4YLJA 4YO6A 3SDJA 4AX8A 4CFUA 1RE8A 3OD6X 1JNKA 4XHKB 3UQFA 2QR8A 3P1AA 3LJ1A 1WVWA 2C5OA 1UV5A 3LCKA 2UZOA 3I6UA 1YDSE 4IC7A 4U3YA 3FKLA 3S95A 1WZYA 3KN5A 4CFFA 5IA2A 5IQFA 2O8YA 4QMTA 4D2SA 5E91A 4ERWA 4GKHA 3SC1A 3UIUA 4AZSA 4AP7A 3ACKA 1BX6A 2C3JA 2IVSA 4O6LA 4TYIA 2DS1A 5CF5A 2XIYA 5HX6A 4NEUA 4RIXB 3SOAA 1W8CA 3OS3A 1LEZA 3C4CA 4GT4A 4HYSA 2GNHA 3PRFA 3I1AA 5LXMA 1TQPA 2LGCA 4XG2A 3R1SA 2IO6A 2VWBA 2IVVA 3NUYA 4NKAA 4L67A 4GFGA 5JRQA 3KQ7A 4YLLA 1YRPA 2IZUA 4RX9A 3V51A 3BGZA 4BB4A 4O0TA 4BDCA 1OL7A 4NIFB 4C4JA 3F66A 3D15A 5H3QA 3LMHA 1QPDA 3EH9A 1XH7A 4C57A 3QWKA 1R3CA 2VTNA 3G51A 3DNEA 4II5A 3KFAA 1J91A 3MH3A 5CVHA 3OXTA 4P4CA 5BMMA 2HW7A 3DOGA 4BWPA 2HZ4A 4L43A 1ZYLA 3LQ5A 4ALWA 3NMUF 4ZLOA 3O0GA 2O3PA 2EB3A 1F5QA 3D2IA 4H3QA 4YP8A 1XWSA 1BI8A 2HY0A 2X39A 4CVAA 1GZOA 3OXIA 2IW6A 4GSBA 1PXJA 3DCVA 3FMNA 4I41A 2HAKA 4PL4A 1REJA 3AD6A 4M68A 4N0SA 4LRJA 1JQHA 4EH8A 2C6MA 3JXWA 3V5TA 5ACBC 2W5BA 5DYJA 4FOCA 5CF8A 2BMCA 3EQGA 5IUIA 3DGKA 3LM5A 2YABA 2HK5A 4G5JA 2FUMA 3GC9A 4IM3A 4HGTA 3PWDA 1Z5MA 4F9AA 2BKKA 1SNUA 2B55A 2WTVA 4P90A 3RALA 4Q2AA 2BR1A 3VS3A 5CU2A 3PJ2A 3NSZA 5FXRA 4HCUA 3LZBA 3T9IA 4D5KA 4H1JA 4I4EA 4X2KA 4FKPA 3ZDIA 3WF5A 5HCXA 2ZV2A 4A4OA 4AGCA 4F9WA 4U6RA 1ZWSA 3OY3A 2XNOA 4I93A 2BIYA 4PF4A 3R9RA 4CG9A 1YWVA 3HVCA 3FLNC 5GZAA 3F3TA 5B2LA 3KEXA 3G90X 4H39A 4Y83A 2X81A 3D5VA 2YM6A 5B0XA 2GS6A 1PJKA 4H58A 5AV0A 2JD5A 2JEDA 3KMMA 4KIKA 3NIEA 4X7QA 3NUNA 3PY0A 4GL9A 4D2PA 4F09A 1SYKA 2PVHA 1KE5A 2WO6A 4QMWA 4A06A 2ITZA 1ZMWA 4WHZA 5ACKA 1VYZA 2ZMDA 4FIEA 2XM8A 3F6XA 3FMEA 4C3PA 3MESA 3CIKA 4CFXA 4FKWA 5CENA 5FRIA 4JDKA 5KUPA 5BUEA 4QP9A 4BDGA 3MV5A 2GQRA 1UU9A 4C4FA 2VRXA 4E8AA 2QCSA 5L6OA 2X6DA 4FKQA 4JRVA 4PTCA 4QP6A 3ORKA 5HIEA 3F2RA 5IZFA 2ERKA 4MD7E 4KKHA 3RVGA 4ZTQA 4N70A 4CT1A 5EDRA 5HX8A 4FIGA 4OLIA 4ANLA 4QYGA 4EQCA 2DQ7X 2HWPA 3KK9A 3E8DA 3RAHA 4PDPA 5A14A 4W4XA 4EOIA 4F65A 4YZDA 3QCSA 3ZSIA 4KKEA 3HYHA 4ARKA 3PPZA 4FG8A 1KE9A 3R7GA 2FSLX 5BYZA 4LOOA 4U3ZA 4F4PA 4PL5A 2IPXA 4TYEA 3QUEA 3PSCA 4FV4A 4IZ5A 2W05A 4PMTA 4FTQA 5CVFA 4AOTA 2YCFA 3JVRA 5TOZA 4QPAA 2HCKA 4CXAA 4FV8A 5A46A 4R1VA 4O7WA 5KO1A 4CRLA 2IN6A 2GCDA 4MXAA 2OZOA 4MQ2A 5AFVA 1ZYJA 4FZ7A 4Y5HA 5LVOA 1FINA 3ID6C 4YZNA 3MPMA 3BYUA 5HBJA 4H3PA 3WIKA 3MJ2A 4IAYA 3T3UA 4A7CA 3RMFA 3QTZA 1UNGA 3ZRMA 1Q3DA 4BI1A 4DH8A 3BCEA 4FTMA 2R3IA 3VC4A 3VF9A 4DBNA 4E7WA 2WELA 3KY2A 1NVRA 3HECA 4QP8A 4FT7A 3P7CA 2J2IB 2PVRA 5EG3A 2XZSA 3E63A 4MH7A 5L2IA 1CSNA 3DB6A 3IW5A 3PE1A 4JQ7A 5CEKA 2ITOA 4FT5A 4GU6A 3WYXA 1XH9A 4M3QA 4AOJA 4DTAA 5KHWA 3VHKA 2VNYA 3AT3A 4XCUA 5CAUA 4R1YA 3ELJA 3FPMA 3VW8A 4C0TA 4OAVB 3R7IA 5AAFA 4WG5A 4AW5A 4YTHA 3ALOA 4UYAA 4L3PA 3P9JA 2PMIA 3HRCA 3JY0A 3RKBA 2VTJA 1JPAA 2XH5A 4DEHA 4EOMA 2I0HA 4EK8A 4BCPA 3DBDA 4NM0A 4DITA 3DKOA 4ZTSA 3OUNB 4K9YA 4TNDA 3LHJA 2UW6A 3QWJA 4HZSA 5E8YA 2X0GA 4GMYA 2Q0BA 1JSTA 2CGUA 2HWOA 1EH4A 3U6HA 2PY3A 3NR9A 4FSUA 3QTSA 4FGBA 3QD2B 4R6VA 2XNMA 1B39A 4HGLA 4AW0A 2C6DA 4U81A 3VS2A 4IVBA 5AA8A 4RVTA 4TWCA 4KRDA 2UZNA 3AC1A 4O7TA 3I0QA 3NDMA 3D5WA 3JVSA 4IFGA 4IQ6A 4WKQA 2WKMA 4O81A 1CMKE 1OMWA 2FVDA 1PXIA 3AMYA 3O7LD 4IX6A 3V6SA 2WAJA 4DGGA 3GCQA 5K5NA 2X9EA 2YLFA 3TZ7A 2WB8A 4DFYA 5D1JA 5C8KA 3GCPA 5HE2A 4N4SA 4USFA 1V0OA 3QU0A 5E8UA 5IU2A 3VULA 5EH0A 3WYYA 4RA4A 3WZJA 4FKIA 4D1SA 5K9IA 3TL8A 3TNHA 3DZOA 3FZ1A 3Q9XA 5IISA 4WA9A 1OB3A 4L45A 5DLSA 2YM4A 1V0BA 1MQBA 3BEGA 3P0MA 4LI5A 3KRJA 4IWPA 3ITZA 3W2OA 2UVXA 2UUEA 1WBPA 1H07A 5A54A 4YZMA 4BDJA 2GNLA 2E9PA 3DBQA 3EQBA 4MD8E 4PX6A 4GUBA 4ENXA 4BR3A 4IACA 3UYSA 2REIA 5AIKA 1JOWB 3U9CA 4DBXA 5IEVA 3MA3A 4HGEA 3TUDA 2W1FA 4FSQA 4RVMA 4APCA 3UPZA 4LV8A 2OFUA 4LOQA 2ZB0A 3RNIA 3LW0A 3MIAA 3DXPA 2BCJA 1FPUA 4C38A 4BI0A 2R0IA 5L2TA 2WMAA 3KKVA 2XNNA 5M4FA 3VBVA 1LUFA 4EH2A 4NT4A 3RPRA 3VS6A 4HPTE 4BIEA 3GU5A 3A2CA 2JFLA 3DKGA 5HNIX 3W2QA 3I7CA 3SAYA 3VWAA 1PRYA 3IGOA 3PG3A 1XJDA 3AG9A 5DT4A 3ZTXA 2VTOA 3FBVA 4TN6A 2C6OA 1UU8A 1VZOA 2E9OA 2VU3A 3OOGA 4FX3A 2W96B 2YM5A 5L4QA 3PWYA 5JFWA 2R3OA 3ZMMA 3R8LA 4TRLA 3ZUUA 1UU3A 4RFMA 1DS5A 1OI9A 4DH1A 5AAGA 2GHGA 2XIXA 5BX0A 5HG5A 3QC4A 2JIVA 3EYHA 4YTIA 4BYIA 3GEQA 4RA5A 5A4TA 3R30A 3N9XA 3HMPA 3GXLA 4TYHB 5AP6A 2WTDA 4A9RA 4EH9A 3PUPA 3QCYA 3Q4TA 3WF9A 3N4UA 5E4HA 5L2WA 4I3ZA 3UC4A 3A8XA 3RK5A 1XHAA 1A06A 3FPQA 3K3IA 4FI1A 5E8VA 4ZY5A 5I5ZA 2F2UA 5C01A 4C37A 3TKUA 3IOPA 4TWNA 4IAFA 3I60A 1PMNA 2XNGA 3MH0A 4L7SA 1WBVA 5IA3A 2NPQA 2H8HA 2UW5A 5M4IA 2RGPA 4ZTNA 3ZRLA 2PVFA 4Z55A 2RL5A 3MY5A 4UEUA 4CD0A 5M4UA 2GTNA 3SW7A 5FTOA 5J95A 3LLTA 3HV4A 1YWRA 2GS2A 4BWXA 2PZ5A 3W2SA 5E9EA 2PZIA 2R3LA 2J51A 1OITA 2OZAA 4TKSA 1I09A 4U40A 4IJ9A 1Y6AA 5AR7A 3ZM4A 4AG8A 2XK7A 3RINA 3MN3A 3IPHA 1UNHA 1XKKA 3C0HA 2YJSA 4AFJA 1U5QA 2VTAA 3FC1X 4FIFA 3FY2A 2Y7JA 4IXPA 5GJGA 5GINE 1X8BA 3CE3A 2HZNA 2Y4IC 4J52A 4G3EA 2B9FA 3WBLA 5J1WA 3GFWA 5E8ZA 3NNWA 1JKSA 3SXFA 3PLSA 3DDQA 2HZIA 3ACJA 4ZIMA 3PIZA 3UVRA 3UIMA 3NYVA 3UYTA 4I24A 1YI6A 2X7FA 2VWVA 5ANJA 4CFNA 2RF9A 4RSSA 1H27A 4CQEA 4I6BA 3HX4A 4X21A 4E5BA 3HV5A 3OCSA 4FTLA 5AMNA 1ZY4A 3PJ8A 2QC6A 3CC6A 2XP2A 2IZRA 3U9NA 5EYKA 2CJMA 3F5GA 4JDJA 4RWLA 3QC9A 5JN2A 5HLNA 3TN8A 3FQSA 4IAKA 3F5XA 4UY9A 3CGFA 3I7BA 4A9SA 3AC4A 3OY1A 4F0IA 5IUGA 1Q8ZA 4QP4A 5FUTA 3TWJA 3BHHA 5JSMA 3R1NA 3AOXA 3FMKA 3WZKA 1Q8TA 3NX8A 3O2MA 3ZU7A 3V5JA 3UQCA 3HP5A 1NW1A 1XBBA 2W4OA 4O0WA 4FYNA 1M2QA 3ROCA 2C5VA 3W1FA 5LOHA 1YHWA 3VJOA 4ACGA 4E4MA 2CKPA 2JAMA 4FTNA 3TI1A 4S30A 2HXLA 3KF7A 4M0YA 3C4XA 2F9GA 3GVUA 1HOWA 2OKRA 2OJGA 3HV6A 4W8EA 2VTRA 1YI3A 4RWIA 5L2SA 1M14A 3EQCA 3Q96A 3NNXA 1OKVA 3A62A 2F49A 3OEZA 4JVGA 4DTKA 3TDVA 1ZZLA 5DI1A 2ZV8A 2OGVA 1RQQA 3S0OA 1OIUA 4UMQA 3MH1A 1P14A 4BGQA 4GIIA 4IM0A 3GBZA 4F9CA 1DAWA 4JBOA 4LMNA 4Z16A 1UWHA 4DINA 2XYUA 2JDTA 2XKDA 2Z2WA 4IB0A 3E88A 4TWOA 3R9NA 3RPYA 5IG1A 4CFMA 5EQPA 3QTQA 5M07A 3I0OA 3LCOA 2OH0E 2VWZA 4OBQA 4XV2A 2FSTX 3DTWA 2E9UA 2C6TA 3QTXA 4G17A 4IJPA 3EFLA 2JDOA 2XYNA 2V55A 3IW8A 3MWUA 3D14A 5CU3A 5L6PA 2PU8A 3IS5A 1ZMVA 4J95A 4RZVA 5CT0A 2F7ZE 4BTFA 5H8EA 4D1XA 1QL6A 3DLSA 3G6HA 3GQIA 3DB8A 1Q62A 4BDAA 4IMYA 5HTCA 4YHFA 4UMTA 3VW6A 2PVJA 3VS0A 4G9CA 3NUAA 3H9FA 3NYXA 3FY0A 3LFAA 3RPVA 3VIDA 2WEIA 4E4XA 3OZ6A 2YDJA 4JXFA 3BHUA 4L68A 5CY3A 5LVPA 1QMZA 3IG7A 5AP4A 3RGFA 4QD6A 4I6QA 4HGSA 1YOJA 4O0VA 5I9UA 3ZBXA 3ULIA 2F7XE 3A4OX 4FICA 5ANKA 4QOXA 1T45A 4AW2A 1M17A 2VX3A 4MBLA 1ZY5A 3MPTA 5HEZA 4JG8A 4Z7GA 1BYGA 4X6RA 2W1ZA 2EB2A 3ZSGA 3VUDA 5CQWA 1OVEA 2BDJA 5HTBA 3Q2MA 3QALE 3W8QA 3RM7A 2WFYA 2WMVA 2B7AA 2GTMA 2UW9A 1PYEA 2YIQA 3ALNA 3L1SA 4FYOA 4U79A 5D9HA 3WZEA 5AUTA 2XJ0A 5KBRA 3EHAA 4XG4A 5DRBA 3F5PA 4FKOA 4AE6A 4XMOA 5JGAA 3PA3A 2R3PA 5EOLA 2OJFE 4FVRA 4W4WA 1APME 3C5IA 1CM8A 2BRGA 5CU6A 3IW6A 3R8MA 4BYJA 1PMUA 2Y4PA 5KCVA 3LLAA 4MKCA 4IAIA 5AADA 4EJ7A 1BMKA 1OIYA 3VAPA 2E2BA 2OBJA 4U42A 2J5FA 4N6ZA 2GNFA 3UMWA 3ZZWA 2YWVA 2W1GA 3HKOA 3BHVA 5TF9A 3MFSA 2XS0A 2A4LA 3AGMA 2FA2A 3UO4A 5CVGA 2VN9A 5CZHA 4YSJA 2Z02A 2CLQA 4GT3A 3BWJA 1YDTE 1R1WA 4AF3A 4G6LA 1FMKA 1IA9A 2OU7A 4TW9A 4J53A 2VWIA 3CQUA 3M11A 5BVEA 4BCMA 4E6AA 4UN0C 4Z7HA 2O2UA 1QPJA 3SXSA 4PTEA 3EOCA 3FXXA 5EM5A 4J97A 2JGZA 4PNIA 4K77A 1KE6A 2WMRA 4XP0A 5F95A 3W2RA 3S1HA 4AZWA 3D7TB 3DKFA 3G2FA 4FSMA 3O50A 4D58A 5I9XA 2WQOA 5CI6A 3FJQE 3WARA 4K0YA 1FBNA 3CEKA 3VBQA 4G6OA 4O0UA 3PPJA 3DFCB 1JWHA 3QLFA 4EHEA 5AUWA 5F94A 1VYWA 4H05A 2ZOQA 4JX3A 2H34A 5HGIA 2BRBA 3LVPA 3ZHPC 3R0TA 4G16A 3W18A 4BCNA 3PVBA 3PLAE 4AT4A 5IF1A 4FL2A 5JZNA 2YISA 3W32A 3VUIA 1UNLA 4FEVA 3TCPA 5JGBA 4EOLA 5I9YA 2ERZE 3NPCA 3ZFXA 4FTOA 2WQMA 4Y95A 3PXYA 3ZLXA 4KIKB 4YJOA 4CLIA 2YIYA 4BWKA 3V8WA 3WF8A 3L8PA 3LJ0A 4ZXTA 2VNWA 2QKRA 5IMEA 5EHOA 3SQQA 2C5NA 1OPLA 3IDCA 3T3VA 3SW4A 5GNKA 4RJ3A 5AP0A 4QMOA 3V6RA 3ZYAA 1O9UA 2VWXA 5EFQA 4FKGA 2R3GA 2CKEA 4FV7A 1Z9XA 3ODZX 4M7IA 4S34A 4WG3A 1QPEA 2PUIA 3LKMA 5LWNA 4FSWA 2X2KA 4AA5A 2G01A 4DYMA 4DG3E 4YU2A 2Y8OA 4P2KA 4W4YA 2YAKA 5K0KA 1IR3A 2J5EA 3UPXA 4D1ZA 5GZ8A 4BCJA 5DR6A 4JAIA 4B9DA 3M42A 4YSMA 2OJJA 1ZARA 4FKVA 3DK3A 2QNJA 2XCKA 4B6LA 4XV9A 1F0QA 5HE1A 4MAOA 4EOKA 2Y6MA 3SG9A 5FXQA 5I3OA 4C2WA 4WT6A 4XOZA 3BI6A 4NZWB 3OOMA 4QMZA 4U7ZA 5JFSA 4Q5HA 3U55A 2YDKA 1DI8A 3E5AA 5IKWA 3GQLA 1ND4A 3KXXA 5F20A 4XBUA 5LVMA 3NCGA 4O22A 3PSBA 2RFNA 3ZLYA 3VUGA 3S4QA 4BTMA 2WXVA 5FBOA 3BYVA 3RWQA 4C02A 3FL4A 5KZ0A 3UG2A 4C3FA 5ANEA 3PPKA 3RHXA 2Z7RA 3UBDA 2BKZA 2J50A 4FNZA 3BGPA 3FI3A 4FTJA 4PMMA 1URWA 4NCTC 5HNGA 3TNPC 4K33A 4AN3A 2WU7A 2ITQA 3M1SA 5HD4A 4Y85A 2XEZA 1BLXA 4JDIA 4RC4A 3W55A 5D7AA 3QYZA 3E8NA 1ZOHA 3UNKA 3PY3A 5EOBA 3MI9A 4X3FA 4XG3A 4EWQA 1PXKA 2BROA 4PNKA 1R78A 2ZM4A 5BQ0A 4F70A 2VAGA 3PXRA 4I6FA 2ONLC 3QD0A 3LCDA 4E6DA 3E3BX 5IH5A 2W0JA 5JFVA 5E1EA 3RK7A 4V04A 4TXCA 5KNJA 1XBAA 5FDPA 4RT7A 2IVUA 3C51A 4LV5A 1W82A 4F6SA 4DCEA 3B8RA 3Q4UA 2A27A 4G3FA 1M7NA 3OTVA 5JKGA 1Q24A 2ETKA 2VO0A 3F7WA 4MEDA 5DN3A 4D9TA 3RAKA 4WRSA 2GQGA 2XUUA 3ORZA 1SMHA 1R0PA 1JKKA 4PRJA 3R6XA 1OPKA 4ID7A 4AQCA 2X8DA 4CSVA 4IZYA 4OBOA 4EZ7A 5AUUA 3DBEA 3G0EA 2WU6A 2V0DA 3I6WA 2X8EA 3FLQA 4RX8A 3FKNA 3DAEA 1VJYA 4WUAA 5C27A 2I7QA 4O83A 5BUJA 4WRGA 2HXQA 3A7JA 2CSNA 4HZRA 5HESA 1YOLA 4O0XA 4BY9E 4I21A 1YOMA 3REPA 4FV2A 4S31A 5CXZA 3VS4A 3C7QA 4EBWA 4CMOA 5E8TA 4TL0A 2PWLA 3L9NA 3UZTA 2R4BA 3LJ2A 2W5AA 4BC6A 3BU6A 3H9OA 3HV7A 4JBPA 5BYLA 1PXPA 3BLRA 4KIQA 2P2IA 3IQ7A 4YBKA 3UOHA 4C33A 5JQ5A 2UZLA 5DEYA 4ZMFA 2WGJA 2X2LA 5CWZA 1ZMUA 4WO5A 5DPVA 3QRKA 5L8JA 4ZSJA 4BDEA 5ICPA 1AD5A 2XBAA 3EFJA 3MPAA 2YCQA 2B0QA 3TV4A 4RFYA 3IKAA 3ZFMA 5FWKK 5FTQA 3I5ZA 1K2PA 5GZ9A 3DK6A 2A19B 2VO7A 3GI3A 4ZS0A 3KRRA 3V5PA 5FD2A 3PTGA 5AP2A 4LFIA 3NVMB 3OFMA 4CV8A 2VV9A 3FC2A 3GC0A 3LCTA 4ZLZA 4RJ5A 2QG5A 3JR1A 4DFZE 4JR3A 3KREA 2BTSA 3TUBA 3VBXA 3C4EA 4ZAUA 4EWHA 3NYNA 3C1XA 5HE0A 3PDTA 4AAAA 3FSKA 3OWPA 3ODYX 2OIQA 2AC5A 4OT5A 2Y9QA 4FSRA 1OZ1A 2CHLA 3OWKA 4J8NA 1WCCA 1XR1A 2NP8A 2C6EA 4AACA 4YUQA 2XK3A 3TNQB 3K3JA 2B9HA 4O21A 2X6EA 1OUKA 3PIXA 3MIYA 4U43A 1MRUA 3DJ7A 4NK9A 4YC8A 2BRMA 2HZ0A 3AD5A 4G3DA 1Q3WA 3G9NA 1JKLA 4CCBA 3WI6A 3SLSA 5EYMA 2UVYA 4MVFA 2JDVA 4PWNA 2ZAZA 2R3JA 5FLFA 3QCXA 2DWBA 4B4LA 4EK5A 1QCFA 5HLPA 2BILB 4D55A 4X2NA 4FV0A 4L42A 4UXQA 2QI8A 4IZ7A 3ZO4A 2YIWA 3DDPA 3R00A 5IEXA 4JAJA 3EN4A 1P5EA 3Q9WA 4USDA 3G15A 4G34A 3ZXTA 4PPAA 4QMQA 4C58A 4FEQA 2PK9A 4WG4A 4X2FA 4MBJA 4ASDA 4EH6A 4TYGA 3U4UA 3O71A 2C5YA 4DEAA 2GHLA 3PA5A 5IA4A 3UNJA 3K5UA 3SRVA 1OECA 5C8MA 2YA9A 4B7TA 2UZBA 4RLKA 3BU3A 2YDIA 4ASXA 2VTLA 4YNEA 3UODA 4G1WA 2XKEA 2VUWA 4EJNA 1Q99A 3EQIA 3Q32A 4KSPA 4W9WA 3EYGA 1KOBA 1TVOA 3ZUVA 2Z60A 3QZHA 4YZ9A 4V05A 2QKWB 2C68A 4BCIA 5EK7A 4MXXA 2CNQA 1YWNA 4O2ZA 4U5JA 5KKRC 2NRUA 4U41A 2QOFA 2VO3A 2CDZA 2I40A 3TIYA 4JT3A 3FE3A 3MVLA 5AEPA 4L9IA 2XK6A 4FZFB 4RIYA 4B99A 4JIAA 4YC3A 2NO3A 3K2LA 4ZSAA 3P08A 3RZBA 3FAAA 3R8VA 5A6OA 5FXSA 3U87A 2OZAB 5E92A 5KMOA 4Y46A 2YM3A 3VQUA 5BVFA 4YC6A 4AN9A 4BL1A 3DXNA 2JC6A 4G9RA 1LP4A 4HYUA 4EOJA 1J7IA 4AUAA 5AIRA 5KMKA 3OTUA 2OH4A 2FH9A 4UALA 3QZFA 4NWMA 4LGHA 4RX5A 5CAOA 1HCKA 3DFAA 3TKIA 1KE8A 3TTJA 4JIKA 1G3NA 4PP9A 3AC3A 3AQVA 3R63A 3U51A 4F99A 5K0XA 2WTCA 4S33A 2CKOA 4ZSGA 4ACHA 2XF0A 3Q6UA 3UIXA 5IQGA 4KINA 4N6YA 2GS7A 3UOLA 3FDNA 3WF7A 4MK0A 5EI8A 2GPHA 5EHYA 4OTFA 4C8BA 2F4JA 4U9AA 4ZLYA 3R2BA 3C4ZA 4YLKA 4IX3A 1AQ1A 3JUHA 4NCTA 2QO2A 5LMKA 1JKTA 2WQBA 3FXZA 3U4WA 4EI4A 1FMOE 3SOCA 3LE6A 3JS2A 4M66A 3ZO1A 1YW2A 3LFQA 1U4DA 2V7AA 3GCUA 2ONLA 4EBVA 4QYHA 3SG8A 2BZJA 3H0YA 2G2HA 3QUPA 3F3ZA 3A4PA 4J96A 2ETMA 5AV2A 3R01A 3A99A 2HY81 3LFNA 3F88A 3H0ZA 3ORNA 1RDQE 4O2PA 5IA1A 3T9TA 2UV2A 3CSVA 1H26A 2X4ZA 4FZAB 4PY1A 2X2MA 4DHFA 4IB1A 3SGCA 4G31A 4KAOA 5CI7A 4GH2A 4GT5A 2R5TA 5D41A 4O91A 1P4FA 2GQSA 3FWQA 5CEMA 5LVLA 4AE9A 4PPBA 5C4KA 2UZEA 3I81A 2WOTA 5HO6A 4IX5A 4CYIA 5IUHA 4FL1A 3QQJA 3COIA 3FI2A 3ZBFA 4AT3A 3LXKA 4JRNA 4E5WA 4CZTA 3CLYA 3FZSA 5TE0A 3T8OA 4QPMA 4E4NA 5GHVA 1ZAOA 3C0GA 5DFPA 5L3AA 2C30A 4FG9A 3RCDA 4FV1A 2QVSE 4BCQA 3HP2A 1H0WA 2OXDA 5TR6A 4AGWA 1MRVA 3GOKA 4YJSA 5J8IA 4F6WA 3L9PA 2OJ9A 4IHPA 3BRBA 2PSQA 5AX3A 5HVYA 4MXZA 2NNWB 3RCJA 3ZLWA 1Q4LA 4L52A 1GAGA 1V0PA 2IW9A 4YTFA 4ZTHA 5FM3A 2IG7A 3FMHA 3QQKA 4JI9A 4MQ1A 4R3PA 4GK4A 2IZTA 3NAXA 4YJPA 2J90A 2QOKA 5TKDA 4QPSA 3E3PA 4AFEA 4A9YA 3QX2A 4XLIA 4F6UA 4OBPA 1U54B 3UO6A 2VX1A 5HNBA 4G3CA 4G6NA 4PUZA 4RQVA 4UYNA 1YXUA 2JIIA 3QA0A 2VZ6A 4GKIA 2EVAA 2XRUA 4DFLA 2QU6A 4GG5A 4BRXA 5EM8A 3QZGA 2EWAA 2BDFA 4EOSA 4EUUA 2YZAA 1J7LA 2WTIA 3COKA 4X2JA 4EOPA 5DH3A 3F69A 4XP2A 5HCZA 3BQRA 4CZYB 5KHXA 1BL7A 2XK9A 2RKUA 3Q60A 2W06A 2PUPA 3ANQA 3IGGA 3HDMA 4GK2A 4GFMA 4BF2A 3EJ1A 2YEXA 3F3WA 4FTAA 4DEEA 2R3MA 4L3JA 2UW7A 3OEFX 4QP3A 4BCHA 3ATSA 2PHKA 4PDSA 2RFEA 5T3QA 4K2RA 3U8WA 4HYIA 4BZNA 4CKJA 2H6DA 3A60A 3KCFA 3PIYA 3WZUA 2C0OA 4HVGA 3KC3A 3PSDA 4UMUA 3NNVA 5M51A 4FODA 3QGWA 4OTHA 4N57A 3ZOSA 4CT2A 4UWCA 4AT5A 5L6WL 3FZTA 4A9UA 1WAKA 2GFCA 2QHMA 5EYCA 1NT2A 3TV7A 2OW3A 3EQRA 3TDWA 3DPKA 2YERA 4QQTA 3V01A 4R5YA 2YAAA 3C9WA 2OF4A 2VWYA 3TJDA 4P5QA 3KULA 5KX8A 4D4VA 4RJ8A 3FUPA 4YJTA 2P55A 3KU2A 1XH6A 4FNWA 4O0YA 2J0MB 1IASA 4CEGA 1A48A 4R7BA 3GC7A 4R78A 5AV1A 3SD0A 4JR7A 3NLBA 4KS8A 4GK3A 5DR9A 4CTCA 2GNIA 4RWJA 3DBFA 2OXXA 2ITUA 5G6VA 1OKWA 2XJ2A 3BHTA 3CQWA 3EWHA 3RWPA 3KXMA 3TTIA 2X4FA 3R7YA 5J9YA 1O6KA 4ACCA 4C2VA 1M52A 4HW7A 2OK1A 4O6EA 4M0ZA 4M67A 5AUXA 3FLSA 2BTRA 3NAYA 4OTGA 2B54A 4KSQA 2J0LA 1JLUE 3SXRA 5FG8A 3UVPA 4FL3A 4F63A 3A7GA 4GG7A 4O38A 4P5ZA 4NTTA 3QXPA 2CGVA 3W8LA 2QOCA 2VTIA 3DS6A 3KB7A 2P33A 4FTRA 3DAKA 2BDWA 2QO7A 4BDBA 3R73A 3RPSA 3ZUTA 4GEOA 4M15A 4YNOA 5FEEA 3V8SA 4EH3A 2PYWA 1S9IA 3DQWA 3RBWA 5DE2A 2EU9A 5IMXA 4FE2A 3L8SA 5KMNA 1KWPA 4PDYA 3FYKX 3VUHA 4DEBA 2J7TA 4PTGA 1XO2B 4UZHA 2WOUA 4O1OA 2OLCA 5LARA 1UA2A 4L01A 2BFXA 4YJQA 2R3RA 2Y4IB 4G3GA 4O7LA 2ZV7A 3R71A 3QQUA 5A3XA 4C4GA 3FZRA 4EZ3A 4JBVA 1IRKA 4USEA 4U8ZA 2QOBA 5ANOA 3BBTB 5DWRA 3CJGA 3EZVA 2O0UA 1WVYA 4QMNA 1XH8A 3H9RA 5E8XA 3O7LB 3LXNA 3MY1A 4QMMA 4AZEA 4OGRA 3BELA 4BKYA 4CTBA 4G5PA 5KMMA 1WBNA 3FSFA 1H01A 2WIHA 3MTFA 4FZDB 4FZ6A 4U80A 5J1VA 3BQCA 3RTPA 3F3UA 4MXYA 5LVNA 4JS8A 4JBQA 5FGKA 5CEIA 3S00A 3PXQA 1SVGA 1VEBA 3ERKA 4I92A 2ZMCA 2Q83A 2BUJA 1PKDA 1CTPE 2XM9A 2JDSA 4X3FC 2QR7A 4F7LA 5CF4A 3KF4A 4O7SA 3BWFA 2PMNX 4OTQA 3VN9A 5CEOA 5CT7A 1PF8A 4WSYA 3BBWA 4OW8A 4DEIA 3E92A 4X6QC 3R83A 2CNUA 4D2VA 2BALA 4ANNA 2NRYA 2BZHB 4LGDA 3DT1A 3OVVA 3NUXA 3DTCA 3OWJA 1JBPE 3SA0A 4QNAA 2W4KA 1MRYA 2C4GA 2OI4X 3OWLA 3BE2A 4IADA 4JG7A 4XBRA 3ZLSA 5T6KA 4C35A 1URCA 4I6HA 4OUCA 5CS6A 2B52A 2VTHA 5EI6A 4GW8A 3SX9A 4ASZA 4IX4A 2AUHA 3L9LA 5JZJA 5AUZA 5AUYA 3DXQA 5HOAA 1Y91A 3C5UA 4WSQA 2YIRA 2YIXA 4X3FB 5KE0A 1WMKA 3ENMA 4HYHA 5AP5A 4RFZA 5LWMA 4ZTLA 4QQCA 2QD9A 3CBLA 4HJOA 5J5SA 5FBNC 1FOTA 4GJ2A 4K8AA 5D12A 2IWIA 3HEGA 5L2QA 1FQ1B 3GB2A 4AU8A 3MFUA 2YHVA 3UP7A 1ZZ2A 5JFXA 3R1QA 5CSVA 5HKMA 5IDNA 4ASEA 2R7BA 4FVPA 4YJRA 2GMXA 4QP7A 4EOOA 4GIHA 2C1BA 2XA4A 4WNOA 5FM2A 4C59A 3WE4A 4OT6A 4DEGA 2C3LA 3BV2A 1FVRA 3PG1A 5AR8A 4ITJA 3RP9A 5AAEA 3JY9A 2J0IA 2X7OA 3CPCA 3BKBA 1I44A 4Z3VA 3EKKA 3QCQA 3HMMA 3MB7A 4Q5EA 4D0XA 2WD1A 1JSUA 4IIRA 2YN8A 5HZNA 4O96A 4B0GA 4BN1A 3QD4A 4O0SA 4BCKA 2R9SA 3IDPA 5ANIA 1K3AA 3ZC5A 4MWHA 2WZJA 1K9AA 5I0BA 4J99A 4E3CA 5JK3A 4FTUA 4OTWA 4RMZA 4XG9A 1B6CB 3HV3A 4UV0A 4D4YA 3I79A 1O6YA 2VTQA 4D5HA 2QOOA 4DGOA 3HGKA 2CKQA 2ZM1A 3IK3A 1ZRZA 3UGCA 4RRVA 4WNKA 2HOGA 2CPKE 3DU8A 1BKXA 3ZZEA 1DM2A 4NFNA 3TXOA 3K5VA 5AUVA 1XBCA 3QD3A 4EL9A 5GIOE 2RSVA 2W1DA 2WNTA 4DN5A 2PE0A 3LCSA 2JBOA 4UWBA 4YHJA 5KZIA 2GHMA 2XB7A 5IQEA 4HCTA 4IDTA 5IEYA 4WIHA 2BHHA 1OBDA 2XEYA 4R7IA 3W10A 2V22A 2R0UA 4MD9E 1PXMA 4QP2A 4FV9A 5JRSA 4EOQA 4DFUA 2HIWA 2UW0A 3EMGA 5BVDA 3NW6A 4QMSA 3G9LX 4H3BA 2PMLX 1H8FA 2XRWA 2FSMX 2J6MA 4MX9A 3WZDA 3GU4A 1H1RA 3D0EA 4GRBA 3OBGA 2C3IB 3P78A 4U44A 4D2TA 3BYOA 1BUHA 4M69A 2WQNA 3HZTA 2G2FA 2VTMA 1H0VA 3AC2A 3COMA 4GV1A 4LG4A 3MVMA 4OTRA 3R8PA 4QYYA 2C0TA 3B2TA 4YPSA 4AS0A 5FQDC 3DNDA 4FKTA 4IAZA 5HG8A 4BDKA 1CKJA 1YI4A 4J1RA 1Q61A 1ZYDA 1ZXEA 5M55A 2YM7A 3OG7A 2C6KA 5HU9A 5AP3A 3CJFA 1YXXA 3FYJX 1R0EA 3E93A 3QZIA 2XCHA 2ZM3A 3BU5A 5FP6A 3FMLA 4BCGA 2HW6A 2CMWA 2Q0NA 1JAMA 2X7GA 2I0YA 3S2PA 3UP2A 2CCIA 3D4QA 5JMSA 5IQCA 1P4OA 5L8KA 4O27B 1H1WA 1GZKA 2VGOA 4BGGA 5A4EA 2Z7SA 3E64A 4YURA 4FSYA 3R21A 3D7ZA 2Z8CA 3OMVA 3HRBA 4JDHA 2H9VA 2J9MA 3ZCLA 5BUIA 5KBQA 3KVXA 3IONA 4D0WA 3BLQA 4EONA 2QLUA 3FXWA 3NIZA 2EXCX 3VBYA 5K5XA 3D5XA 1UKHA 1U59A 2AC3A 3DK7A 3EL8A 2XVDA 1UWJA 4IB3A 4NKSA 3MY0A 1SM2A 4AW1A 4WD5A 3UG1A 5A4QA 4I5CA 4C4EA 2CNVA 4NH1A 3SRVB 5M56A 4RPVA 4NL0A 3HUCA 3NUPA 3V8TA 4AZFA 1OIQA 4RQKA 5DIAA 4BKJA 3HDNA 2R3QA 5BVNA 4QMYA 4C62A 2PVLA 3EQDA 4FTIA 3JYAA 4GJ3A 4CNHA 4R3CA 4DTBA 3HL7A 5EDQA 4CGAA 3G5DA 3GU7A 2O63A 3IDBA 4F0GA 2BZKB 4IE9A 4MNEA 4HNIA 5I9WA 3EQPA 1CKIA 3CKXA 3GT8A 3F7ZA 3LFSA 3MFTA 4IZAA 4L7FA 4KUJA 5CSHA 2PZPA 4ZOGA 4QT1A 4BI2A 2B4SB 2PVNA 2X9FA 3GENA 2P0CA 4XRJA 2DYLA 5DR2A 3TZ8A 4RIYB 2VGPA 3U6IA 2ZDUA 3E7OA 3D83A 4E4LA 5J5TA 3NNUA 2UW4A 2WMSA 5E8SA 4BDHA 5EW9A 5LMKC 2IVTA 4UX9A 3NW5A 3C0IA 1OGUA 3D94A 2XNEA 3CPBA 4EYMA 2G9XA 3R8ZA 1Z57A 4GUEA 4HOKA 3KXHA 4RVLA 4FR4A 2YLEA 4HPUE 2HELA 5CSXA 3A7FA 5DRDA 3B2WA 4YR8A 4L6QA 4LGGA 5M4CA 2VD5A 4OAUC 3DBCA 4FIJA 1H00A 1TQIA 3CD8A 1CKPA 3ZONA 1U46A 2RFSA 5ETIA 4DCAA 4O7NA 3KN6A 3G6GA 2HENA 2ITVA 2VO6A 2I0EA 4BHZA 4EQUA 2QG7A 3AGLA 1IEPA 2E9NA 3QX4A 3R7EA 3CD3A 3VO3A 1L8TA 2ITNA 2W1CA 3OW4A 5CEQA 1GIIA 3II5A 4RJ4A 3NS9A 2JITA 4X2GA 4CFWA 5DEWA 4F9YA 2OSCA 4NM3A 3V5LA 3LM0A 4CRSA 2V5QA 3KK8A 5JEBA 4KBKA 5CSPA 3BPRA 4HVDA 4XEYA 5KMJA 4Y5QA 3QRUA 4ACDA 4GS6A 4BZOA 4MYGA 1H1SA 5CLPA 4XJ0A 5HICA 3F2NA 3QQHA 4ANQA 3OC1A 4U45A 5LCJA 3QBNA 4JOAA 2A1AB 3PJ1A 5IH6A 4NW6A 3FQEA 4I4FA 2Z7LA 3RNYA 2JAVA 3PXKA 3QKMA 3UOKA 2R3KA 4B8LA 5CZIA 4IWDA 5L8LA 3QA8A 4LOPA 3R7VA 4MXOA 5LMBA 4ZMEA 2W4JA 2C69A 3DAJA 3BV3A 5ETAA 3ZH8A 2FO0A 1SNXA 3GUBA 2YACA 3NVKI 3EB0A 2WTKC 5J7HA 2C3KA 3PA4A 2CGWA 3P23A 3QRTA 5IPJA 5FEDA 4QTDA 3W33A 5M06A 3BIZA 2HYYA 1B38A 4OTIA 1TQMA 3PP0A 2XIZA 5BNJA 4NW5A 3RZFA 3IW7A 3E8EA 5IDPA 4DG2E 4O0RA 1RW8A 4LM5A 3MYGA 1H1QA 4DT8A 4OTPA 4FSZA 4KWPA 4FVQA 4BDDA 4XG8A 4DH3A 3R22A 2UW3A 3GNIB 3KL8A 4Z9LA 1DAYA 2O65A 1CDKA 5BPYA 2EXMA 2ITWA 2QU5A 4QNYA 4A9TA 5C8NA 2OFVA 4C3RA 4QQ5A 3PVWA 4FEWA 1OL1A 3L8VA 5AWMA 3FMJA 5DOSA 2YZLA 3UE4A 5HBEA 4I0TA 4F1TA 5EQEA 4LRKA 3MTLA 3ETAA 2OF2A 4NYEA 2QOHA 1H4LA 4I1ZA 4C7TA 2AYPA 4ORKA 4ZEGA 2WTKB 5HQ0A 4FKJA 1S9JA 2ZJWA 1G8AA 1QPCA 4J7BA 3UOJA 4UWYA 4JX7A 4D4SA 3PE2A 4FKSA 4ZJJA 1P2AA 5HO7A 2FGIA 4Q9ZA 1J1CA 5M53A 1G5SA 1KSWA 4ONAA 4QTEA 4KRCA 3H30A 5CX9A 3R04A 3ET7A 3D7TA 3F61A 4NU1A 3LIJA 3FV8A 2B53A 3COHA 3P86A 3NGAA 4FC0A 1L3RE 4L44A 4LRMA 4ERKA 4YZBA 3Q6WA 5LQFA 3SKCA 2PL0A 2C47A 2YWPA 3MGYA 4FIHA 3AMBA 3A8WA 4X3JA 5CU4A 3ZC6A 4R77A 2WHBA 3CKWA 3O17A 5E90A 2KULA 5H8BA 3Q04A 4CMUA 5EKNA 4YPDA 3E87A 5B2KA 1OL6A 4BICA 2R64A 3F5UA 3MS9A 4ZTMA 3KRLA 1ATPE 2WMQA 4DGLC 5J9LA 2R3NA 4I0SA 3NW7A 4J98A 4CCUA 5CALA 4E5AX 3FMMA 4M97A 4V0GA 2PMOX 3MSSA 4YHTA 2JKMA 3VS7A 2XIRA 3VNTA 2BHEA 4WBBB 1KV1A 1W0XC 3NZ0A 4R3RA 2W1IA 3RHKA 2XK4A 4TY1A 3UNZA 2X1NA 4ZY4A 5IQIA 3Q53A 1PKGA 2WTWA 3LFFA 3QKLA 4LL0A 4MBIA 4RZWA 4FSTA 4V01A 5D10A 4ZJVA 4FV6A 5AA9A 2G1TA 3R7OA 5I9ZA 4FTCA 3U6JA 1H24A 2P3GX 1OBGA 5D11A 3JPVA 2UZUE 5AR5A 3TG1A 2XK8A 5HIDA 3SV0A 3RM6A 1Q8YA 3LFCA 4QO9A 1BI7A 1T46A 2W1HA 5AP7A 4EUTA 4Q9SA 3NEWA 5CF6A 5FTGA 2ZB1A 4ALVA 4PMPA 5JH6A 2BFYA 3ORPA 4ANSA 2XNPA 3BHYA 2Y0AA 4I5PA 4ENYA 5KMIA 3V5WA 3AMAA 3KULB 4FV3A 4QTBA 4KBAA 4RIWA 3Q52A 2B1PA 5BVKA 5JGDA 5CYIA 5E7RA 3SVVA 3C13A 4EQMA 4FOBA 1UVRA 3MH2A 3AT4A 3HAMA 4UBAA 2H96A 2QODA 2CLXA 4FT9A 4UB7A 2OIDA 3BYSA 3N4TA 1HCLA 1IA8A 3DZQA 2A0CX 5DBXA 5C4LA 4O84A 3CGOA 1M2PA 1REKA 2R7IA 3BE9A 3FLYA 3HA6A 3QTRA 4LYNA 3FHIA 4PPCA 4BGHA 2PE2A 2F7EE 5H2UA 3ATTA 1YHVA 3TUCA 4BCFA 4R8QA 1XQZA 1NVQA 3N51A 3CQEA 3KXZA 5KKRB 2XJ1A 4FKRA 4K11A 3RPOA 4EZ5A 3DLZA 3QKKA 4ZZOA 5M44A 1J1BA 2DUVA 4LUEA 2XKFA 4F7NA 4S32A 4EHZA 4BTKA 2KTYA 5HIBA 3V04A 4W8DA 1Q97A 3HMNA 3PJ3A 3KA0A 3PRIA 3QQGA 4F1MA 3AXWA 3WOWA 2VWWA 2QO9A 2PVKA 1XH4A 5ANGA 4JL9A 1H1PA 4PDOA 3Q2JA 1WFCA 3OW3A 5TO8A 4TTHB 1IAHA 4C61A 4XV3A 4UMPA 4AA0A 4GVJA 4DFBA 4L53A 2EUFB 3LXPA 4MXCA 3R8UA 4YMJA 2JKQA 2R2PA 1Y8YA 1WBSA 4FUYA 3NRMA 4ZY6A 2PPQA 3F9NA 2QOQA 3PJCA 4XX9A 2BVAA 4RIXA 1J3HA 3GP0A 5I3RA 1W84A 1U5RA 5HG7A 4FSNA 5A9UA 3OXZA 1UU7A 4F7SA 3VF8A 3PFQA 5HVKA 1OL2A 4L46A 5EKOA 3VVHA 3F3VA 4K6ZA 4AZVA 1PHKA 4D2RA 1OKYA 2J0JA 1GY3A 4XP3A 2OG8A 3R1YA 1V1KA 3P4KA 3ROYA 2PTKA 4GFOA 3TZMA 4E20A 4EHVA 5K3YA 4APPA 5H9BA 4DC2A 1JSVA 2BAQA 4DFXE 2YM8A 3WE8A 3P7AA 4ACMA 4NIFA 1FGIA 3MJ1A 3PVGA 2Z7QA 3D9VA 4E6QA 2ZDTA 4I5MA 3C4WA 2IJMA 1MP8A 3KCKA 4FT3A 4MNFA 3UJGA 3ZXZA 4EH5A 4XOYA 4EH4A 1ZOGA 2PE1A 3OUKA 2BIKB 2G15A 1E1XA 3IO7A 3TNWA 5B2MA 4FGRA 3V5QA 1RJBA 5CAQA 3AC5A 4FTKA 2UZTA 4M13A 1GZ8A 5AR4A 4DGNA 5EDPA 3BZ3A 4JLCA 4FEXA 4CMTA 4QRCA 3D2KA 3PVUA 4KIOA 4I20A 1YXVA 1A9UA 4CFVA 4FMQA 3DJ5A 4NM5A 5M57A 3RI1A 4R5SA 3KVWA
chains in the Genus database with same CATH superfamily
1H08A 3ZDUA 4FK3A 4EK4A 5F9EA 2UZDA 5IH4A 3TYKA 3QRIA 3FZOA 2BAJA 3NCZA 4TT7A 4CV9A 5H8GA 3VBWA 4IAAA 2ZVAA 2G2IA 3L8XA 1YVJA 2PZYA 3A7IA 1GZNA 3KRXA 4MF0A 4DLIA 5JQ8A 3EL7A 5IA0A 1GIJA 3H10A 1OM1A 3B8QA 3QTWA 5M09A 5DNRA 3S3IA 4M84A 5LMAA 4IM2A 5FEQA 3THBA 1W7HA 2W9FB 2ITPA 3I5NA 3Q9ZA 3QQLA 3EN5A 2JLDA 5TT7A 4BTJA 4CYJA 2VTTA 3EIDA 3NYOA 5CXHA 2BRNA 4I22A 3UO5A 1Y57A 3IECA 4D2WA 3BEAA 4P7EA 4CKRA 1OIRA 2V7OA 3LQ8A 3QTUA 5EI2A 2YITA 3VS5A 3HUBA 3ZFYA 2XANA 2XNBA 4CKIA 4BDIA 4FNXA 2JKOA 4EKLA 4BBMA 4FG7A 1PMEA 2GNJA 4ANMA 5C26A 4DF3A 4IEBA 4QQJA 2I1MA 4FKUA 4C4IA 4KIPA 2WPAA 1KUTA 2PVYA 1LPUA 4JJRA 4GCJA 4H1MA 1OKZA 4S2ZA 1PYXA 1W83A 2W99B 3LFDA 5CNNA 5CQUA 3MVHA 4YTCA 4U97A 2EXEA 5HHWA 4D28A 4AXFA 4YBJA 2ETRA 5AM6A 3Q4CA 4RIOA 3OT3A 3K54A 5D7VA 5J79A 5BVOA 2JIUA 2XIKA 4TWPA 3CR0A 5HD7A 2BZIB 2VTPA 1W98A 1FGKA 3QQFA 4G2FA 4NM7A 1DI9A 3CP9A 1J7UA 1YKRA 2C6IA 2IW8A 2OJIA 3QLGA 3ZRKA 4IVCA 5JT2A 1M7QA 1GOLA 3LXLA 4A4XA 3KGAA 3HLLA 3QXOA 4O7RA 1Q5KA 1MUOA 3EKNA 2QQ7A 2FSOX 3EZRA 3EFKA 2X8IA 4KB8A 5EM7A 4KKGA 3W16A 2XARA 3CY3A 2J0KA 4W9XA 4KBCA 2WMUA 4HNFA 4O7VA 5AR2A 4RWKA 4GU9A 4XV1A 4HCVA 4QMVA 5F4NA 3GCSA 3H3CA 3ZEWA 2OICA 3HMIA 3LPBA 3QHRA 4HVSA 5DT0A 5C9CA 2UW8A 3IOKA 3KMUA 3ENHA 4Y73A 3ORMA 4EHGA 5ITAA 3LFBA 4KA3A 3CTJA 4XYFA 5C03A 4O1PA 3UMXA 3R9DA 2CCHA 4BKZA 4NTSA 3TM0A 1ZYSA 4FV5A 5IQBA 3PZEA 3FKOA 3TKHA 2GFSA 4IB5A 3AKLA 3P7BA 5AV3A 2W7XA 1PXOA 3TEIA 4WNMA 3F2AA 4M69B 3VUKA 2F2CB 5HE3A 4E1ZA 5CEPA 3N4VA 3QHWA 3VJNA 2O5KA 5EHLA 2W1EA 3GOPA 3HAVA 4LUDA 4F7JA 4XS2A 3QTIA 4HVIA 4I5HA 4XG7A 2P4IA 3BX5A 4F78A 4DEDA 2A2AA 2OXYA 3OCTA 1NXKA 4IC8A 3FEGA 1PY5A 5DA3A 1E1VA 3G0FA 3R9HA 1NA7A 4DAWA 4MUQA 3KXNA 2PUUA 3Q4ZA 4E6CA 5IQDA 3OHTA 4GYIA 4A4LA 4AWIA 3ZO3A 5IQAA 3GCVA 1PXLA 4XUFA 3W0NA 1IG1A 5FDXA 2SRCA 3VRZA 2RFDA 4Y72A 3VUTA 1XH5A 1SZMA 3OP5A 5IA5A 3RAIA 5HCYA 1OL5A 3FQHA 4RVKA 4J8MA 3LAUA 3I4BA 5HG9A 4PL3A 4KS7A 1OUYA 4ZZMA 4XLVA 3FLWA 3KRWA 4IBMA 4ZS4A 1PXNA 3O8PA 5DG5A 2VWUA 5GJFA 1TKIA 3VQHA 1KV2A 4DHIB 1WBWA 1BL6A 3PY1A 4D4RA 1H28A 5A4LA 1E9HA 5DGZA 2E9VA 5T68A 4H36A 4LL5A 4YJNA 3QUDA 3VBTA 3MB6A 2PVMA 5AM7A 3MA6A 4ANBA 3BGQA 3D5UA 3TZ9A 4BCOA 4FT0A 3ORXA 5HI2A 2JBPA 4E73A 1FVTA 4QMXA 3HA8A 4IH8A 1Y8GA 4W4VA 4YJUA 4JQ8A 3OROA 2I6LA 4MNEB 4FIIA 4I23A 3RAWA 5CAVA 1YQJA 3WIGA 3E7VA 4RGJA 3DY7A 5I9VA 4IANA 2XMYA 3OCGA 4JNWA 4NSTA 2ITXA 2WTJA 4WUNA 1W2DA 2I0VA 5CSWA 4D9UA 2R3FA 3ANRA 4RX7A 4OR5A 3M2WA 2Y6OA 4FUXA 3TIZA 4L8MA 5LCKA 4F08A 2YCRA 5A4CA 5BMSA 3CXWA 3EQFA 4RLLA 4O7YA 4XG6A 4FTTA 2B9IA 4QMUA 3CS9A 3LMGA 3POOA 4FEUA 3Q3BA 1F3MC 1ZYCA 4IVAA 3EFWA 4RJ7A 4U0IA 4UZDA 4PQNA 5IQHA 5AJQA 1Y6BA 3FI8A 5K4IA 1GIHA 4HVHA 1KE7A 3MDYA 3Q5IA 4EC8A 2VX0A 4FF8A 5DT3A 5A6NA 4AXAA 5LJJA 2C6LA 4LV7A 2ACXA 4QTAA 2RG6A 4ZK5A 3UTOA 2JFMA 4QTCA 1MQ4A 3PXZA 4MF1A 5DHJA 5DMZA 3ZEPA 3Q5ZA 4TPTA 1OPJA 2CN5A 5AX9A 4NFMA 1U54A 4IVDA 3UDZA 1GJOA 1R39A 2C1AA 3HMOA 4PMSA 4YZCA 4O86A 3IW4A 2WMXA 5FP5A 3RK9A 4AGUA 3TACA 3KXGA 4ZTRA 3O51A 3TT0A 2WIPA 4QDEA 5F1ZA 4M12A 4JQEA 3CY2A 3R9OA 4EK6A 1JVPP 4PV0A 3QF9A 3EN9A 3GU8A 4C34A 4FK6A 3G33A 5HTIA 2IZSA 1Q8WA 2QOIA 4L00A 1YXTA 1Q8UA 1WBTA 4AGDA 3DJ6A 5I4NA 5CU0A 5CASA 3C50A 5C1QB 3UIBA 2BAKA 2QURA 5HBHA 4F9BA 2C0IA 2O64A 3VHEA 1YDRE 3AD4A 3MFRA 4GVAA 4C4HA 2X0QA 1SVEA 4ZJIA 4MHAA 4IW0A 4BBEA 4XNEA 4YGAA 3UVQA 3R02A 3OT8A 4QYEA 4BDFA 4IWOA 3LOKA 4TYHA 2VTSA 3RJCA 4ITIA 3O8TA 5J87A 3GGFA 5J7BA 1NVSA 5EQYA 4L3LA 3DV3A 4BIBA 2ZFYA 5EW3A 3WF6A 4DDGA 3U54A 2R3HA 4AN2A 2UVZA 4TZRA 1AGWA 5GJDA 4JG6A 5GIPE 5K4JA 2ITYA 3FL5A 2OO8X 3L9MA 4FBXA 4OTDA 4DLJA 2PUNA 1WBOA 2W17A 3PP1A 2GSFA 3KMWA 3ZO2A 4QMPA 2OWBA 3W0OA 3R2YA 3A61A 3EN6A 3ORTA 3SHEA 5AR3A 4AA4A 1NY3A 3TV6A 5BYYA 3TJCA 4CZUA 2BRHA 4ALUA 3O23A 3WILA 3QGYA 4ZSLA 5ANDA 5HORA 4CG8A 5CTPA 4NJDA 3HNGA 5BVWA 4EORA 1VR2A 2FB8A 4FA2A 3PZHA 1ZOEA 2ZV9A 4X0MA 5M08A 4F64A 2XAMA 1SVHA 4GYGA 3OF0A 5HO8A 4RC3A 4E26A 3QFVA 3R7UA 2W5HA 5G1XA 4YJVA 4M8TA 4DE4A 2QOLA 3FMDA 3MBLA 2WMTA 5ETCA 2LAVA 2QLQA 3QAME 4BHNA 4NUSA 3H4JA 1XMMA 3P79A 1UKIA 2B9JA 5ETFA 3W2CA 5DVRA 3V3VA 4ZZNA 4BJJA 3CCNA 1PMVA 4AQKA 4MCVA 2ITTA 3GU6A 3DA6A 4EK3A 3TNIA 3AT2A 2ESMA 2GU8A 3ULZA 2YCSA 4AOIA 1KOAA 4TYJA 4DFNA 4ITHA 4DH5A 5E8WA 2F57A 2YJRA 3QL8A 3CTQA 5CNOA 2PULA 4NJ3A 1GNGA 2RIOA 4MTAA 3GFEA 4PP7A 4J71A 4EEVA 1LEWA 4K18A 4RJ6A 5AV4A 4QYFA 4DT9A 1WVXA 2FYSA 3R28A 4B8MA 4R7HA 2BPMA 2WMWA 3FHRA 4K1BA 3UQGA 4V0GB 3PFYA 3FI4A 5B7VA 3VS1A 4KNBA 4I6LA 2J4ZA 4IFCA 3FLZA 4WBOA 4MWIA 1IAJA 4LDTA 3CTHA 3ORIA 4UXLA 4EH7A 1STCE 4ZP5A 4BVUA 4E93A 4DA5A 3BLHA 4TNBA 4WNPA 1O6LA 1M2RA 3E8CA 3O8UA 3ORLA 1YXSA 3F82A 4QP1A 1H25A 4C36A 3VRYA 2UZWE 3UC3A 2QHNA 2CGXA 3AC8A 5EW8A 4AZTA 3PYYA 1ZLTA 4WOVA 4XH6A 3LQ3A 4LQMA 3EN7A 3NUSA 5EM6A 4DG0E 3ZS5A 3QRJA 2WEVA 4EC9A 4FKLA 2WMBA 3Q9YA 5CANA 2YFXA 4RBLA 3DQXA 3UZPA 3HRFA 4KABA 4O7ZA 4ZSEA 3BYMA 3LFEA 4RC2A 4RIWB 2QONA 3FZPA 4XRLA 4I0RA 1ERKA 2JKKA 2C5XA 3C4FA 3MVJA 4I94A 4AXCA 4BIDA 3QYWA 4F0FA 2CN8A 4IWQA 5EYDA 2XBJA 4IDVA 4M14A 5HVJA 3LMIA 4KD1A 3O96A 4FNYA 2W9ZB 2XKCA 3VUMA 4CQGA 1Q41A 3POZA 2GDOA 5CAPA 1PW2A 3W2PA 4DGMA 3NUUA 3GC8A 3PXFA 2ZYBA 2JDRA 3A7HA 3DKCA 5E1SA 3ZSHA 4A07A 2OIBA 2RG5A 2UZVA 2V62A 4UMRA 5HLWA 1YHSA 1G8SA 4O82A 3NWWA 3OBJA 3MW1A 4DHJA 4ANOA 4LMUA 2P2HA 3ZM9A 2GNGA 5J9ZA 4Y8DA 4DH7A 4EYJA 3OCBA 4BFMA 2PZRA 1LR4A 2WQEA 3EQHA 5AP1A 4BZDA 3E62A 5HU3A 4QMLA 3UDBA 1FVVA 4RG0A 4BBFA 4EKKA 4F1OA 4YO4A 4CLJA 5KMLA 3UZRA 3P5KA 4YLJA 4YO6A 3SDJA 4AX8A 4CFUA 1RE8A 3OD6X 1JNKA 4XHKB 3UQFA 2QR8A 3P1AA 3LJ1A 1WVWA 2C5OA 1UV5A 3LCKA 2UZOA 3I6UA 1YDSE 4IC7A 4U3YA 3FKLA 3S95A 1WZYA 3KN5A 4CFFA 5IA2A 5IQFA 2O8YA 4QMTA 4D2SA 5E91A 4ERWA 4GKHA 3SC1A 3UIUA 4AZSA 4AP7A 3ACKA 1BX6A 2C3JA 2IVSA 4O6LA 4TYIA 2DS1A 5CF5A 2XIYA 5HX6A 4NEUA 4RIXB 3SOAA 1W8CA 3OS3A 1LEZA 3C4CA 4GT4A 4HYSA 2GNHA 3PRFA 3I1AA 5LXMA 1TQPA 2LGCA 4XG2A 3R1SA 3W0PA 2IO6A 2VWBA 2IVVA 3NUYA 4NKAA 4L67A 4GFGA 5JRQA 3KQ7A 4YLLA 1YRPA 2IZUA 4RX9A 3V51A 3BGZA 4BB4A 4O0TA 4BDCA 1OL7A 4NIFB 4C4JA 3F66A 3D15A 5H3QA 3LMHA 1QPDA 3EH9A 1XH7A 4C57A 3QWKA 1R3CA 2VTNA 3G51A 3DNEA 4II5A 4AXEA 3KFAA 1J91A 3MH3A 5CVHA 3OXTA 4P4CA 5BMMA 2HW7A 3DOGA 4BWPA 2HZ4A 4L43A 1ZYLA 3LQ5A 4ALWA 3NMUF 4ZLOA 3O0GA 2O3PA 2EB3A 1F5QA 3D2IA 4H3QA 4YP8A 1XWSA 1BI8A 2HY0A 2X39A 4CVAA 1GZOA 3OXIA 2IW6A 4GSBA 1PXJA 3DCVA 3FMNA 4I41A 2HAKA 4PL4A 1REJA 3AD6A 4M68A 4N0SA 4LRJA 1JQHA 4EH8A 2C6MA 2IEWA 3JXWA 5ACBC 2W5BA 3V5TA 5DYJA 4FOCA 5CF8A 2BMCA 3EQGA 5IUIA 3DGKA 3LM5A 2YABA 2HK5A 4G5JA 2FUMA 3GC9A 4IM3A 4HGTA 3PWDA 1Z5MA 4F9AA 2BKKA 1SNUA 2B55A 2WTVA 4P90A 3RALA 4Q2AA 2BR1A 3VS3A 5CU2A 3PJ2A 3NSZA 5FXRA 4HCUA 3LZBA 3T9IA 4D5KA 4H1JA 4I4EA 4X2KA 4FKPA 3ZDIA 3WF5A 5HCXA 2ZV2A 4A4OA 4AGCA 4F9WA 4U6RA 1ZWSA 3OY3A 2XNOA 4I93A 2BIYA 4PF4A 3R9RA 4CG9A 1YWVA 3HVCA 3FLNC 5GZAA 3F3TA 5B2LA 1VLRA 3KEXA 3G90X 4H39A 4Y83A 2X81A 3D5VA 2YM6A 5B0XA 2GS6A 1PJKA 4H58A 5AV0A 4FJVA 2JD5A 2JEDA 3KMMA 4KIKA 4DHZA 3NIEA 4X7QA 3NUNA 3PY0A 4GL9A 4D2PA 4F09A 1XMLA 1SYKA 2PVHA 1KE5A 2WO6A 4QMWA 4A06A 2ITZA 1ZMWA 4WHZA 5ACKA 1VYZA 2ZMDA 4FIEA 2XM8A 3F6XA 3FMEA 4C3PA 3MESA 3CIKA 4CFXA 4FKWA 5CENA 5FRIA 4JDKA 5KUPA 5BUEA 4QP9A 4BDGA 3MV5A 2GQRA 1UU9A 4C4FA 2VRXA 4E8AA 2QCSA 3P5JC 5L6OA 2X6DA 4FKQA 4JRVA 4PTCA 1G8JA 4QP6A 3ORKA 5HIEA 3F2RA 5IZFA 2ERKA 4MD7E 4KKHA 3RVGA 4ZTQA 4N70A 4CT1A 5EDRA 5HX8A 4FIGA 4OLIA 4ANLA 4QYGA 4EQCA 2DQ7X 2HWPA 3KK9A 3E8DA 3RAHA 4PDPA 5A14A 4W4XA 4EOIA 4F65A 4YZDA 3QCSA 3ZSIA 4KKEA 3HYHA 4ARKA 3PPZA 4FG8A 1KE9A 3R7GA 2FSLX 5BYZA 4LOOA 4U3ZA 4F4PA 4PL5A 2IPXA 4TYEA 3QUEA 3PSCA 4FV4A 4IZ5A 2W05A 4PMTA 4FTQA 5CVFA 4AOTA 2YCFA 3JVRA 5TOZA 4QPAA 2HCKA 4CXAA 4FV8A 5A46A 4R1VA 4O7WA 5KO1A 4CRLA 4AAYA 2IN6A 2GCDA 4MXAA 2OZOA 4MQ2A 5AFVA 1ZYJA 4FZ7A 4Y5HA 5LVOA 1FINA 3ID6C 4YZNA 3MPMA 3BYUA 5HBJA 4H3PA 3WIKA 3MJ2A 4IAYA 3T3UA 4A7CA 3RMFA 3QTZA 1UNGA 3ZRMA 1Q3DA 4BI1A 4DH8A 3BCEA 4FTMA 2R3IA 3VC4A 3VF9A 4DBNA 4E7WA 2WELA 3KY2A 1NVRA 3HECA 4QP8A 4FT7A 3P7CA 2J2IB 2PVRA 5EG3A 2XZSA 3E63A 4MH7A 5L2IA 1CSNA 3DB6A 3IW5A 3PE1A 4JQ7A 5CEKA 2ITOA 4FT5A 4GU6A 3WYXA 1XH9A 4M3QA 4AOJA 4DTAA 5KHWA 3VHKA 2VNYA 3AT3A 4XCUA 5CAUA 4R1YA 3ELJA 3FPMA 3VW8A 4C0TA 4OAVB 3R7IA 5AAFA 4WG5A 4AW5A 4YTHA 3ALOA 4UYAA 4L3PA 3P9JA 2PMIA 3HRCA 3JY0A 3RKBA 2VTJA 1JPAA 2XH5A 4DEHA 4EOMA 2I0HA 4EK8A 4BCPA 3DBDA 4NM0A 4DITA 3DKOA 4ZTSA 3OUNB 4K9YA 4TNDA 3LHJA 2UW6A 3QWJA 4HZSA 5E8YA 2X0GA 4GMYA 2Q0BA 1JSTA 2CGUA 2HWOA 1EH4A 3U6HA 2PY3A 3NR9A 4FSUA 3QTSA 4FGBA 3W0SA 3QD2B 4R6VA 2XNMA 1B39A 4HGLA 4AW0A 2C6DA 4U81A 3VS2A 4IVBA 5AA8A 4RVTA 4TWCA 4KRDA 2UZNA 3AC1A 4O7TA 3I0QA 3NDMA 3D5WA 3JVSA 4IFGA 4IQ6A 4WKQA 2WKMA 4O81A 1CMKE 1OMWA 2FVDA 1PXIA 3AMYA 3O7LD 4IX6A 3V6SA 2WAJA 4DGGA 3GCQA 5K5NA 2X9EA 2YLFA 3TZ7A 2WB8A 4DFYA 5D1JA 5C8KA 3GCPA 5HE2A 4N4SA 4USFA 1V0OA 3QU0A 5E8UA 5IU2A 3VULA 5EH0A 3WYYA 4RA4A 3WZJA 4FKIA 4D1SA 5K9IA 3TL8A 3TNHA 3DZOA 3FZ1A 3Q9XA 5IISA 4WA9A 1OB3A 4L45A 5DLSA 2YM4A 1V0BA 1MQBA 3BEGA 3P0MA 4LI5A 3KRJA 4IWPA 3ITZA 3W2OA 2UVXA 2UUEA 1WBPA 1H07A 5A54A 4YZMA 4BDJA 2GNLA 2E9PA 3DBQA 3EQBA 4MD8E 4PX6A 4GUBA 4ENXA 4BR3A 4IACA 3UYSA 2REIA 5AIKA 1JOWB 3U9CA 4DBXA 5IEVA 3MA3A 4HGEA 3TUDA 2W1FA 4FSQA 4RVMA 4APCA 3UPZA 4LV8A 2OFUA 4LOQA 2ZB0A 3RNIA 3LW0A 3MIAA 3DXPA 2BCJA 1FPUA 4C38A 4BI0A 2R0IA 5L2TA 2WMAA 3KKVA 2XNNA 5M4FA 3VBVA 1LUFA 4EH2A 4NT4A 3RPRA 3VS6A 4HPTE 4BIEA 3GU5A 3A2CA 2JFLA 3DKGA 5HNIX 3W2QA 3I7CA 3SAYA 3VWAA 1PRYA 3IGOA 3PG3A 1XJDA 3AG9A 5DT4A 3ZTXA 2VTOA 3FBVA 4TN6A 2C6OA 1UU8A 1VZOA 2E9OA 2VU3A 3OOGA 4FX3A 2W96B 2YM5A 5L4QA 3PWYA 5JFWA 2R3OA 3ZMMA 3R8LA 4TRLA 3ZUUA 1UU3A 4RFMA 1DS5A 1OI9A 4DH1A 5AAGA 2GHGA 2XIXA 5BX0A 5HG5A 3QC4A 2JIVA 3EYHA 4YTIA 4BYIA 3GEQA 4RA5A 5A4TA 3R30A 3N9XA 3HMPA 3GXLA 4TYHB 5AP6A 2WTDA 4A9RA 4EH9A 3PUPA 3QCYA 3Q4TA 3WF9A 3N4UA 5E4HA 5L2WA 4I3ZA 3UC4A 3A8XA 3RK5A 1XHAA 1A06A 3FPQA 3K3IA 4FI1A 5E8VA 4ZY5A 5I5ZA 2F2UA 5C01A 4C37A 3PUFC 3TKUA 3IOPA 4TWNA 4IAFA 3I60A 1PMNA 2XNGA 3MH0A 4L7SA 1WBVA 5IA3A 2NPQA 2H8HA 2UW5A 5M4IA 2RGPA 4ZTNA 3ZRLA 3AKJA 2PVFA 4Z55A 2RL5A 3MY5A 4UEUA 4CD0A 5M4UA 2GTNA 3SW7A 5FTOA 5J95A 3LLTA 3HV4A 1YWRA 2GS2A 4BWXA 2PZ5A 3W2SA 5E9EA 2PZIA 2R3LA 2J51A 1OITA 2OZAA 4TKSA 1I09A 4U40A 4IJ9A 1Y6AA 2A98A 5AR7A 3ZM4A 4AG8A 2XK7A 3RINA 3MN3A 3IPHA 1UNHA 1XKKA 3C0HA 2YJSA 4AFJA 1U5QA 2VTAA 3FC1X 4FIFA 3FY2A 2Y7JA 4IXPA 5GJGA 4BJJB 5GINE 1X8BA 3CE3A 2HZNA 2Y4IC 4J52A 4G3EA 2B9FA 4O4FA 3WBLA 3GFWA 5E8ZA 5J1WA 3NNWA 1JKSA 3SXFA 3PLSA 3DDQA 2HZIA 3ACJA 4ZIMA 3PIZA 3UVRA 3UIMA 3NYVA 3UYTA 4I24A 1YI6A 2X7FA 2VWVA 5ANJA 4CFNA 2RF9A 4RSSA 1H27A 4CQEA 4I6BA 3HX4A 4X21A 4E5BA 3HV5A 3OCSA 4FTLA 5AMNA 1ZY4A 3PJ8A 2QC6A 3CC6A 2XP2A 2IZRA 3U9NA 5EYKA 2CJMA 3F5GA 4JDJA 4RWLA 3QC9A 5JN2A 5HLNA 3TN8A 3FQSA 4IAKA 3F5XA 4UY9A 3CGFA 3I7BA 4A9SA 3AC4A 3OY1A 4F0IA 5IUGA 1Q8ZA 4QP4A 5FUTA 3TWJA 3BHHA 5JSMA 3R1NA 3AOXA 3FMKA 3WZKA 1Q8TA 3NX8A 3O2MA 3ZU7A 3V5JA 3UQCA 3HP5A 1NW1A 1XBBA 2W4OA 4O0WA 4FYNA 1M2QA 3ROCA 2C5VA 3W1FA 5LOHA 1YHWA 3VJOA 4ACGA 4E4MA 2CKPA 2JAMA 4FTNA 3TI1A 4S30A 2HXLA 3KF7A 4M0YA 3C4XA 2F9GA 2X0OA 3GVUA 1HOWA 2OKRA 2OJGA 3HV6A 4W8EA 2VTRA 1YI3A 4RWIA 5L2SA 1M14A 3EQCA 3Q96A 3NNXA 1OKVA 3A62A 2F49A 3OEZA 4JVGA 4DTKA 3TDVA 1ZZLA 5DI1A 2ZV8A 2OGVA 1RQQA 3S0OA 1OIUA 4UMQA 3MH1A 1P14A 4BGQA 4GIIA 4IM0A 3GBZA 4F9CA 1DAWA 4JBOA 4LMNA 4Z16A 1UWHA 4DINA 2XYUA 2JDTA 2XKDA 2Z2WA 4IB0A 3E88A 4TWOA 3R9NA 3RPYA 5IG1A 4CFMA 5EQPA 3QTQA 5M07A 3I0OA 3LCOA 2OH0E 2VWZA 4OBQA 4XV2A 2FSTX 3DTWA 2E9UA 2C6TA 3QTXA 4G17A 4IJPA 3EFLA 2JDOA 2XYNA 2V55A 3IW8A 3MWUA 3D14A 5CU3A 5L6PA 2PU8A 3IS5A 1ZMVA 4J95A 4RZVA 5CT0A 2F7ZE 4BTFA 5H8EA 4D1XA 1QL6A 3DLSA 3G6HA 3GQIA 3DB8A 1Q62A 4BDAA 4IMYA 5HTCA 4YHFA 4UMTA 3VW6A 2PVJA 3VS0A 4G9CA 3NUAA 3H9FA 3NYXA 3FY0A 3LFAA 3RPVA 3VIDA 2WEIA 3TMOA 4E4XA 3OZ6A 2YDJA 4JXFA 3BHUA 4L68A 5CY3A 5LVPA 1QMZA 3IG7A 5AP4A 3RGFA 4QD6A 4I6QA 4HGSA 1YOJA 4O0VA 5I9UA 3ZBXA 3ULIA 2F7XE 3A4OX 4FICA 5ANKA 4QOXA 1T45A 4AW2A 1M17A 2VX3A 4MBLA 1ZY5A 3MPTA 5HEZA 4JG8A 4Z7GA 1BYGA 4X6RA 2W1ZA 2EB2A 3ZSGA 3VUDA 5CQWA 1OVEA 2BDJA 5HTBA 3Q2MA 3QALE 3W8QA 3RM7A 2WFYA 2WMVA 2B7AA 2GTMA 2UW9A 1PYEA 2YIQA 3ALNA 3L1SA 4FYOA 4U79A 5D9HA 3WZEA 5AUTA 2XJ0A 5KBRA 3EHAA 4XG4A 5DRBA 3F5PA 4FKOA 4AE6A 4XMOA 5JGAA 4JMQA 3PA3A 2R3PA 5EOLA 2OJFE 4FVRA 4W4WA 1APME 3C5IA 1CM8A 2BRGA 5CU6A 3IW6A 3R8MA 4BYJA 1PMUA 2Y4PA 5KCVA 3LLAA 4MKCA 4IAIA 5AADA 4EJ7A 1BMKA 1OIYA 3VAPA 2E2BA 2OBJA 4U42A 2J5FA 4N6ZA 2GNFA 3UMWA 3ZZWA 2YWVA 2W1GA 3HKOA 3BHVA 5TF9A 3MFSA 2XS0A 2A4LA 3AGMA 2FA2A 3UO4A 5CVGA 2VN9A 5CZHA 4YSJA 2Z02A 2CLQA 4GT3A 3BWJA 1YDTE 1R1WA 4AF3A 4G6LA 1FMKA 1IA9A 2OU7A 4TW9A 4J53A 2VWIA 3CQUA 3M11A 5BVEA 4BCMA 4E6AA 4UN0C 4Z7HA 2O2UA 1QPJA 3SXSA 4PTEA 3EOCA 3FXXA 5EM5A 4J97A 2JGZA 4PNIA 4K77A 1KE6A 2WMRA 4XP0A 4O4DA 5F95A 3W2RA 3S1HA 4AZWA 3D7TB 3DKFA 3G2FA 4FSMA 3O50A 4D58A 5I9XA 2WQOA 5CI6A 3FJQE 3WARA 4K0YA 1FBNA 3CEKA 3VBQA 4G6OA 4O0UA 3PPJA 3DFCB 1JWHA 3QLFA 4EHEA 5AUWA 5F94A 3ML1A 1VYWA 4H05A 2ZOQA 4JX3A 2H34A 5HGIA 2BRBA 3LVPA 3ZHPC 1OGYA 3R0TA 4G16A 3W18A 4BCNA 3PVBA 3PLAE 4AT4A 5IF1A 4FL2A 5JZNA 2YISA 3W32A 3VUIA 1UNLA 4FEVA 3TCPA 5JGBA 4EOLA 5I9YA 2ERZE 3NPCA 3ZFXA 4FTOA 2WQMA 4Y95A 3PXYA 3ZLXA 4KIKB 4YJOA 4CLIA 2YIYA 4BWKA 3V8WA 3WF8A 3L8PA 3LJ0A 4ZXTA 2VNWA 2QKRA 5IMEA 5EHOA 4O4BB 3SQQA 2C5NA 1OPLA 3IDCA 3T3VA 3AKKA 3SW4A 5GNKA 4RJ3A 5AP0A 4QMOA 3V6RA 3ZYAA 1O9UA 2VWXA 5EFQA 4FKGA 2R3GA 2CKEA 4FV7A 1Z9XA 3ODZX 4M7IA 4S34A 4WG3A 1QPEA 2PUIA 3LKMA 5LWNA 4FSWA 2X2KA 4AA5A 2G01A 4DYMA 4DG3E 4YU2A 2Y8OA 4P2KA 4W4YA 2YAKA 5K0KA 1IR3A 2J5EA 3UPXA 4D1ZA 5GZ8A 4BCJA 5DR6A 4JAIA 4B9DA 3M42A 4YSMA 2OJJA 1ZARA 4FKVA 3DK3A 2QNJA 2XCKA 4B6LA 4XV9A 1F0QA 5HE1A 4MAOA 4EOKA 2Y6MA 3SG9A 5FXQA 5I3OA 4C2WA