5IUHA

Crystal structure of the anaplastic lymphoma kinase (alk) in complex with 5d
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
312
structure length
285
Chain Sequence
NPNYSFAGKTSSISDLKEVPRKNITLIRGLGEVYEGQVSGPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMACAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALK tyrosine kinase receptor
publication title Pyrazolylamine Derivatives Reveal the Conformational Switching between Type I and Type II Binding Modes of Anaplastic Lymphoma Kinase (ALK).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 99
structure length 285
sequence length 312
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5iuhA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5iuhA01
4RFYA 2X39A 3C51A 3EN5A 4OR5A 3LE6A 4E5AX 4Z16A 2FVDA 4ACDA 1TVOA 4UXQA 2OZOA 5LMKA 4K6ZA 1PXNA 2VTJA 3HDMA 3PJ3A 2QU6A 5AAFA 2YA9A 2VWYA 3OEZA 2WTKC 4ZMEA 3N51A 4X2GA 3TCPA 3R02A 4EOSA 4FIHA 4BCKA 3MH2A 2PUUA 3DJ6A 5EH0A 1WFCA 5A4TA 3NYNA 2W5AA 4WOVA 3U6HA 2OICA 5ETCA 2H34A 3ZOSA 5EHLA 4JIKA 3CD3A 5CAPA 4MXOA 1QPJA 2QLUA 3HNGA 3QZFA 2BROA 5AR8A 3BZ3A 3DBFA 4RIWA 2GS6A 4LRKA 1H07A 2R3OA 3R7VA 4N6ZA 1XHAA 2BRBA 2ZM3A 4FYOA 4IM0A 2GTNA 2XZSA 4FKOA 3ZH8A 3RMFA 4S32A 3QF9A 3PYYA 4I6HA 5IPJA 3ID6C 3RPVA 4FSRA 4MXAA 1TQPA 2YWPA 3RM6A 4A9YA 4WSYA 3OUNB 4ZSLA 4QMPA 3IW8A 4EH6A 3U9CA 4FSMA 2OJJA 4EZ7A 4MNEA 4IWOA 3KF4A 4B99A 3OMVA 1LUFA 1Q8UA 1W83A 3FMNA 3H4JA 4BIEA 3KXNA 3FQEA 2X1NA 4AU8A 3QUEA 1IRKA 1WBNA 3F88A 4L8MA 1LR4A 5HCXA 5HG9A 4YU2A 1ZOHA 3F5GA 4MHAA 5CSVA 3NVKI 5GJFA 3Q9XA 4LQMA 1BI7A 3CKWA 3O23A 4GG7A 1SZMA 3HL7A 2XJ1A 1BL6A 5AP0A 4CMUA 4KSQA 4G34A 4G31A 3FDNA 4GT4A 4IACA 3HDNA 4V05A 4DG3E 3LFCA 4EYMA 4FL1A 3HAMA 4F63A 3QRKA 3ZO3A 5EOBA 5IKWA 2P33A 2UZUE 2XKDA 1GJOA 4EZ5A 2BFXA 2DUVA 1PJKA 2UW4A 2VNWA 3NCZA 4IB3A 4Q9ZA 4EK8A 5L8JA 4A06A 3KK8A 1PYEA 3DOGA 1YHVA 5AR3A 3UGCA 3P7CA 1BL7A 5ACKA 4G5JA 3DV3A 1RJBA 3P1AA 1BUHA 3Q2MA 4FOBA 4IEBA 3CC6A 4AZEA 4P5QA 3OCBA 2OU7A 4U9AA 4ERWA 4U8ZA 3T9IA 3HX4A 2P2HA 3KB7A 4YMJA 3VUKA 3MDYA 2ITPA 3RGFA 4ZSAA 2VWIA 4XNEA 4NM5A 4KKHA 4CKIA 2WB8A 2QC6A 3M2WA 3ZU7A 3ZXZA 4A9SA 5I9ZA 5CAOA 5DA3A 1WBOA 1W84A 5HQ0A 4HNIA 3GUBA 1QCFA 4IVCA 2A1AB 4FEWA 4C33A 5G6VA 4FT0A 1IR3A 3H9FA 2FH9A 4B7TA 4EWQA 1P14A 2O2UA 5HG7A 4R7IA 1Y8GA 3DBCA 4FKPA 4V0GB 3OBGA 4EYJA 2C0IA 2G2IA 3ZYAA 4JR3A 3E62A 2XK3A 4IWQA 2JBPA 5DIAA 3EYHA 4UWBA 2IVSA 4ZS0A 5FEQA 3GP0A 3ENMA 3GBZA 5KNJA 4ZJVA 1L8TA 2DWBA 3KQ7A 3KXMA 3QCYA 4FSZA 4NM7A 4B9DA 3EQGA 3UO6A 2I0HA 2UZVA 4IB0A 4CFFA 5A54A 1FVRA 2VO3A 4BCOA 4FT7A 1DAYA 2NNWB 3Q4CA 5F94A 1QPDA 2C4GA 2OG8A 4QMZA 4AAAA 3MJ2A 4G1WA 3IDPA 4GFGA 2ETMA 4GK2A 4MH7A 2W96B 5AM7A 4XG2A 2WHBA 4EOMA 4FUYA 4YLLA 3FPQA 4LRJA 1R39A 3Q5IA 4CD0A 4UBAA 5HORA 2W0JA 4TRLA 2GS2A 5F9EA 2ZJWA 1VZOA 2PVMA 4F4PA 3QHRA 2OZAB 4BDGA 4G9CA 2XUUA 3BHTA 2EXCX 5AV2A 3WE8A 2OJFE 4PWNA 1H28A 1Q8YA 1OB3A 3EZRA 4MCVA 4ZK5A 4BKJA 3KRXA 2GU8A 3LPBA 5E1EA 3NUNA 4EQMA 4ENYA 4EOIA 4XOYA 1YI4A 5JFXA 4TYJA 3QQHA 4ZZOA 2WQMA 3KXZA 5T68A 2R3GA 1RQQA 5M55A 4CVAA 4DEHA 1H27A 3RNIA 2ITZA 4H3PA 2WGJA 4EBVA 1GOLA 1XBCA 2ZV2A 2I0YA 5H3QA 4FTMA 5BPYA 1EH4A 5J7HA 4QP3A 4QPSA 2C1AA 1MQ4A 5EK7A 3PXZA 2QG5A 4JAJA 4FV0A 2OJGA 2IZSA 3G51A 4KA3A 4J8NA 4MVFA 4WHZA 3FZPA 4GJ2A 2YCRA 3RPYA 3ZONA 4ASZA 1PXOA 4DEGA 4ZMFA 3JVSA 4BTJA 5CQUA 5CEQA 5AR7A 4ZP5A 2IVVA 4DFYA 1WZYA 3KRLA 2WMRA 2EU9A 4ZY4A 4O7LA 4HVSA 3AMAA 4K33A 4X7QA 3IDCA 4KIQA 5LCKA 5AJQA 3KN6A 3KF7A 3R28A 1JKKA 3Q9YA 3HZTA 2BTSA 3UVQA 3ZO1A 4IX6A 3HECA 1J7UA 5CLPA 2XIRA 3RAHA 3BBWA 2WELA 2V5QA 3KULA 3VWAA 3K54A 3QTIA 4KNBA 2XJ0A 4DFXE 2PULA 3Q4TA 4A7CA 3CSVA 2X0GA 4H1JA 4C4EA 3QGYA 1PMNA 4ZJIA 4I23A 2G2FA 3ZUTA 2RG5A 3KVWA 4KD1A 4KBCA 3ZRKA 4U79A 2FB8A 2VTQA 3V6SA 4F0GA 5CU0A 4KUJA 3VBWA 2REIA 2VAGA 4FKJA 2ZDUA 5AX9A 5KO1A 3ZLWA 4O0TA 2OXYA 3VBVA 4RIWB 2YEXA 3ORNA 4O96A 3GC8A 1Y91A 4PP7A 2B54A 3FQHA 2R3MA 3C4EA 3D5VA 2VGPA 1PMUA 4K1BA 4FSUA 2XNPA 3OTVA 3Q9ZA 4FNXA 4MKCA 4XLVA 5DRDA 1IAJA 4DEEA 2CLQA 2HCKA 4I92A 4IX5A 5FEEA 2R3JA 3SVVA 4FT5A 4E5BA 4QMNA 4MNEB 3F2NA 3C0GA 3UOJA 1R0EA 2PVLA 3A4PA 1IG1A 2YACA 1NVSA 4R3PA 3V5PA 4FOCA 4WRSA 3QRIA 3R2BA 2QHNA 2A2AA 1JKTA 4FZ7A 3ZFYA 3EWHA 2VWZA 3EQFA 4NWMA 4A07A 4EC9A 1YOMA 2G9XA 1KSWA 2WPAA 3FC1X 3H10A 3PRIA 2JDRA 2YDIA 3AC3A 3OT3A 5EDQA 4D2WA 2ZAZA 5CTPA 4BDHA 2HZNA 4GK4A 4QMOA 3COHA 4TYHA 4DBNA 4RIXA 4X21A 3U8WA 3GQLA 1J1CA 2OIBA 2Z8CA 5HE1A 1FPUA 3UQFA 3NUAA 4KS8A 2GSFA 1AGWA 5DBXA 4PP9A 4IAAA 4AT3A 1K2PA 2XEZA 3R01A 2E9NA 3ZDIA 5EQPA 5EYMA 2WTKB 5F95A 3MY0A 5GZ8A 5AP2A 2B4SB 3NX8A 3Q96A 3V5LA 2PZYA 5JSMA 2BKZA 2YABA 1M7QA 4QYGA 2QD9A 2YN8A 3VF8A 3PVBA 5D11A 3VBTA 4ALWA 3NR9A 1A9UA 1R1WA 4L6QA 2J0KA 3BEAA 3CP9A 5F20A 4CT1A 3A7JA 3R7UA 4DINA 5JRSA 3D9VA 1XWSA 2W1GA 2WAJA 2OKRA 3I6WA 3PE1A 5KMMA 5EM7A 2QG7A 1XBBA 4HYHA 4AGWA 1ZYJA 4D2RA 3DKGA 5AV0A 1ZOGA 4PL5A 4WD5A 2IG7A 1YDTE 2BFYA 2VNYA 3VF9A 3CTQA 3LFEA 4LOPA 4NM3A 3T8OA 3IS5A 4KIKA 2WMSA 3F5XA 4EOOA 5DLSA 5HX6A 3I5NA 5JFSA 3VUIA 2YDKA 4DF3A 2OGVA 2F7ZE 2YDJA 2V55A 1Q5KA 4YSJA 2YLEA 4BWKA 4RVKA 3TZ7A 4HZSA 4MQ2A 2RF9A 2GPHA 4CSVA 4DH5A 4J1RA 2C0TA 3R00A 5TKDA 4AN3A 2B9JA 1S9JA 3V5WA 2VTSA 3KRWA 4IM3A 3KMMA 4FKGA 1FGKA 4J99A 5J5TA 4IAIA 4FG8A 3O7LD 4BTFA 5L6WL 4MQ1A 2OFUA 5C1QB 2VWUA 4X2JA 1CKIA 3HMIA 4P5ZA 4AG8A 5FXSA 3CIKA 4H3BA 3GGFA 4EH3A 3BKBA 5EW9A 4G6NA 4D2PA 5IEYA 4YLKA 4AGCA 5JGDA 4EJNA 2WEIA 3UYTA 3RAIA 3FHIA 3DU8A 3NNVA 3JPVA 3RI1A 4WBOA 2PVYA 4AFJA 3UODA 3AGLA 4UN0C 1Q8ZA 3GU6A 3FLNC 3IOPA 4N70A 3BE9A 4RLLA 3ZEPA 4EBWA 2Y6MA 3VVHA 1YXUA 4FV1A 4MWIA 3TV6A 4E8AA 1W82A 3WZEA 3LM5A 4E7WA 1O6LA 4XV9A 2UZOA 3BE2A 4CLJA 3PDTA 5E8XA 3OCGA 5HZNA 3WOWA 4Y5QA 3MH3A 3UMWA 1PXLA 3FMKA 5KBQA 1OL2A 2PVNA 5I9VA 2OJIA 3FZSA 3PXRA 4U3ZA 4QP1A 5EM5A 4D5KA 1OVEA 3NMUF 4U42A 2WEVA 4AOIA 2WTJA 2XEYA 5CEIA 5HU3A 3PJCA 4EH4A 5ETAA 4W4YA 2QR7A 1VYZA 3FZ1A 3B2TA 5IA4A 2QONA 3MBLA 2YZAA 3E93A 5FBNC 2OH0E 3S95A 5M4IA 3FV8A 4BICA 3LMGA 1YOJA 3PZHA 5AP5A 2FGIA 1GNGA 4C34A 2OXXA 4QNYA 5DVRA 3QX4A 4QMMA 4RWLA 1P4OA 4DAWA 2PVJA 4FZAB 4GS6A 2OF4A 5BUJA 1CKJA 3DGKA 2PSQA 2PVHA 3KULB 1JSTA 5JH6A 4FKIA 3ETAA 4M68A 4JS8A 3JXWA 4GFOA 3TXOA 4FTTA 3ZXTA 3O8TA 2X81A 3PE2A 5IA3A 4H58A 2IPXA 3VUDA 2E9UA 5C8KA 2W1FA 4RSSA 5DT0A 3T3VA 1KE8A 5E90A 5FWKK 1XBAA 3BU3A 4XV1A 4NKAA 4CFMA 5LJJA 3QFVA 1UU7A 2XNOA 4CFUA 4QMYA 3A7HA 4GKHA 2XCKA 2JAMA 4D1ZA 4O7RA 1Q62A 5ITAA 4ANNA 4GU6A 5C03A 2YISA 5K0XA 5IQAA 4M15A 2JITA 3MGYA 3QBNA 3NSZA 2BDWA 2W1ZA 2W1IA 4CMTA 1WVYA 5HESA 3V8WA 3ANRA 4FV2A 1REJA 5EQYA 4IW0A 4HCTA 3MB7A 2VV9A 2XRWA 3LCDA 2Y4PA 4QP4A 5KZ0A 4TPTA 3CCNA 3R8VA 4Z55A 1YW2A 4BDDA 5GZ9A 4FKUA 3SD0A 3QQLA 3RAWA 3L9LA 2C68A 3FLSA 4JDHA 4ZTRA 3W32A 4CG8A 3BYOA 3G9LX 2R4BA 4RC3A 3V3VA 4AT5A 4C37A 4CTCA 4I6BA 5CZIA 2R2PA 5CSWA 3TV4A 4BDAA 4C3PA 4RLKA 4JBVA 4C4HA 3I6UA 3I81A 5M08A 3QD4A 4PDPA 2VUWA 4EZ3A 4IXPA 1OKYA 4L46A 4RJ6A 4C4JA 3HKOA 3LJ2A 4FEUA 3AMYA 4TYHB 3SA0A 4FEQA 4FBXA 4O0SA 3LFQA 4BDFA 1G8SA 1L3RE 1WBPA 3RPRA 4K11A 4B4LA 3C4CA 4W8DA 3C4WA 3HGKA 2GHMA 3P86A 2QOKA 4GJ3A 4N6YA 4TZRA 5D12A 4LV8A 3ZEWA 5K3YA 3QTZA 4ONAA 4XEYA 3DPKA 2Z7RA 2IO6A 4HVIA 3Q53A 4E6CA 1OUKA 2BVAA 4GUEA 3N4TA 4O6LA 3RNYA 4DT8A 5HU9A 2CN5A 3RP9A 4DGNA 1U54B 3H3CA 3NNUA 5LCJA 2VTPA 2GQRA 3NCGA 1URCA 3QD0A 1Q3WA 2Q0BA 2FSTX 5LVLA 2OIDA 2WU6A 4F1TA 5IA5A 2O0UA 1VR2A 4M84A 1J7IA 4GL9A 4V04A 5EM6A 5H2UA 3BGPA 2XM9A 3HLLA 4IANA 3UQGA 3PP0A 3OS3A 4I41A 4F9BA 1RE8A 3MS9A 3BQCA 3DK3A 4UALA 5AUVA 4DLJA 4FZDB 4BBMA 2O64A 3PY1A 3NW6A 5FDPA 3PTGA 4W9XA 3PWDA 3R7GA 3R9HA 4PMMA 2X2KA 3BGQA 4ACHA 2QKRA 3GB2A 3UP7A 1G8AA 3EQPA 1H1WA 1E9HA 4EK6A 3FXWA 2BR1A 4OTWA 4U3YA 4BDKA 2BZHB 4KKEA 4FV5A 3NWWA 4QNAA 4ANOA 4CG9A 4YJQA 4BZNA 2IZUA 2BALA 4AN9A 1PMEA 5C27A 3FLWA 5IZFA 5EOLA 4FNWA 4BCJA 3FKNA 4RC4A 3CQWA 3R30A 4JI9A 1ZY4A 5HO6A 3WYYA 4BDIA 5CEMA 3GOKA 4FSYA 5M4UA 5DR9A 1XH8A 4AA4A 4JG7A 4Y5HA 3QRUA 4H05A 4MXXA 4FKLA 3AQVA 3PJ8A 4V01A 3ACJA 4BDJA 4LG4A 2YM8A 5CU6A 4WO5A 4XCUA 4CCUA 3LLAA 3GXLA 3NUXA 5D9HA 3AMBA 3I0OA 5JEBA 2A0CX 2JIVA 4BBFA 5KHWA 3LMIA 3AOXA 1SVEA 2R7BA 3E3BX 1O6YA 4GK3A 3U87A 3O17A 5AP3A 5ICPA 1ZRZA 2BRMA 4JVGA 4D4YA 2FYSA 2XVDA 2PPQA 4RWKA 4I0RA 5AWMA 2VWXA 3UPZA 4O86A 4M3QA 3UJGA 3MW1A 4FV7A 4U41A 4XBRA 4V0GA 1HCKA 4GKIA 2VWWA 4FG7A 5AADA 2JDOA 1O6KA 2V7AA 5HNGA 4ASDA 2XMYA 4F08A 2Z2WA 4G16A 3KCFA 4QTAA 2VTTA 2IW8A 5JQ5A 5J9YA 4UB7A 2YAKA 4ALUA 2VZ6A 2Y4IC 4MNFA 4Z7GA 4YR8A 3ZMMA 1ZLTA 3R83A 5DT4A 3QHWA 2QOIA 4QPMA 4L45A 5ETFA 4IVBA 4OW8A 4IJ9A 3IQ7A 4R7BA 3F3TA 1Y8YA 4DCEA 4MXCA 5HBJA 3GCPA 2PMIA 3ZDUA 4MYGA 2ITVA 2C5NA 3DZOA 4LMUA 4XUFA 3MI9A 3PY0A 1DAWA 4DFLA 5LWMA 3DB8A 2CNVA 4CNHA 4NW6A 4C4FA 4I21A 3F66A 1YOLA 2OZAA 2YCFA 1KE5A 4JQ7A 4FR4A 3O8PA 3BLRA 3MIAA 1TQIA 4ZTSA 5C4KA 5H8GA 4IZ5A 4R3RA 4KIPA 2C6IA 3EQHA 3MY1A 4HGTA 3R8UA 4KABA 1I09A 4IX4A 3FKLA 4YSMA 5D10A 2WTIA 4QMXA 4YTFA 2WZJA 4LGDA 3QGWA 3E7OA 3O8UA 4BIBA 4J71A 5BVKA 4GUBA 4IB5A 4IVAA 4YZNA 4LRMA 4FV8A 3HV4A 2XNMA 2WTDA 1M17A 1FMKA 3F2AA 2BPMA 5I5ZA 1KV2A 5L4QA 4QP7A 4BCMA 5IUGA 2YM6A 4FIEA 3OROA 2VX0A 5DT3A 3R1NA 5EKOA 2JIIA 1M14A 4XJ0A 3O51A 4X2KA 4U5JA 3QRJA 2JKMA 3DFAA 3F82A 4FKSA 2HOGA 5H9BA 2HXLA 4U6RA 3PFQA 1NT2A 2YAAA 4UZDA 4FZFB 4WG3A 3G0FA 3DQXA 4M97A 4OAVB 3SGCA 4IE9A 1OPJA 3EQIA 3VAPA 4EHGA 1YHWA 3V01A 4RIYB 2YJSA 5A14A 3PVWA 5J1WA 4PNKA 3D5XA 5L6PA 2EVAA 1FOTA 1UU3A 4FT3A 4PNIA 4O0YA 5AP1A 3MJ1A 3L1SA 1RW8A 3Q04A 5FTGA 3QZGA 4K18A 3GOPA 3TKHA 2X2LA 4EKLA 2UZNA 3R7EA 2J0IA 3EQRA 1GIIA 3S4QA 4EH9A 3NW5A 3AG9A 2PE0A 3C4ZA 3KXHA 5CSXA 3SOAA 3ZUUA 4GG5A 4U81A 4O0VA 4YHFA 4C61A 4G6OA 1Y6AA 2GCDA 5E8YA 4O0RA 3ULIA 4Z9LA 4CKRA 2JFLA 4EONA 1LP4A 1NW1A 4AW1A 3HP5A 4FV3A 3MFSA 4IAKA 3TNWA 2VGOA 5IDNA 3OUKA 2CCHA 1SVGA 3QTSA 4P2KA 5IEXA 5FEDA 4WBBB 4TTHB 1KE6A 3ZRMA 2WIHA 5DYJA 2C6MA 4BCGA 4BVUA 2OK1A 3T9TA 5KKRC 4F64A 5EI8A 3VW6A 5CZHA 4CQEA 1QL6A 1A06A 4RJ8A 3L9PA 5LVOA 4DFUA 1KOAA 4PY1A 4YNOA 5HLPA 4D0WA 2W1CA 4C02A 2WMAA 3OXTA 5D7AA 2ACXA 3LIJA 2IN6A 3HV6A 2PUIA 2R3FA 5CT7A 2VTOA 3IW7A 3BHVA 5CSPA 2C5XA 2F4JA 5T3QA 4FTNA 1OIQA 3QA0A 1URWA 2CGUA 3UIUA 2QOLA 2BCJA 5EDPA 5I0BA 3LFDA 1ZWSA 4TY1A 5B7VA 4FODA 2NP8A 3FY2A 5FM2A 3PIZA 2WU7A 3PG3A 4E3CA 3TZMA 4TXCA 1ZZ2A 1BKXA 1AQ1A 3LFNA 1GAGA 4GW8A 3H30A 3JVRA 3LXKA 4O1PA 4QQJA 3DDQA 3DXNA 2Y9QA 3ORIA 3FJQE 4JBQA 5B2LA 1IASA 3P5KA 3LJ0A 3Q3BA 4AQCA 4OTHA 3E7VA 2DS1A 3IONA 2AC3A 4R5SA 3R9DA 2QHMA 5A6OA 4DGGA 3LFAA 5D41A 3QTUA 3NIZA 3KU2A 4O38A 1H1RA 5IH5A 4DTKA 3TKUA 1OPKA 2ONLC 1PF8A 1CSNA 3O96A 3QZHA 3GU5A 4MXYA 4UV0A 3VUTA 2Z7QA 3ZUVA 2XNEA 3QXPA 3LMHA 4EC8A 2EXMA 2X8IA 2W5HA 2UZTA 2PTKA 3CGOA 1YDRE 4LM5A 4AE6A 4IIRA 5EYCA 1WBVA 3II5A 4LI5A 3KEXA 3GT8A 5EYDA 4GRBA 2E9VA 5J8IA 4BCFA 5HLNA 4FX3A 1YI6A 1ZXEA 3Q60A 4I6FA 3QTRA 2YM4A 4UZHA 2BZJA 4C7TA 3CE3A 5EI6A 2G01A 3LCKA 4TNBA 3DQWA 3PXKA 4YJPA 2OW3A 3GNIB 3L8PA 4K77A 5A9UA 3OC1A 1Q41A 4I0SA 4O0WA 3UVPA 4EH2A 4Z3VA 2CKPA 2RL5A 1JKLA 3TI1A 4PMPA 4OT5A 4CYIA 3DXPA 3R1SA 4XRLA 4AT4A 3F6XA 1J91A 1E1XA 3LFSA 1JVPP 5FRIA 4C4IA 5LVNA 1J7LA 4S30A 3O2MA 4D2VA 2UW6A 2WQEA 4J53A 4C3FA 4R7HA 5C9CA 3OBJA 2BILB 3PA3A 2WOUA 4OTGA 4PMSA 2GQGA 4NM0A 1AD5A 4DBXA 5HIBA 4JRNA 3QA8A 4EKKA 2VTAA 3F3UA 1XH4A 2CKEA 2JAVA 3A61A 3NNXA 4GT5A 2E9PA 2ZYBA 2HZ0A 4CKJA 5IQCA 2XRUA 3ZRLA 4CYJA 4DFZE 3KKVA 4QT1A 3AD4A 3FI4A 3EFKA 3MH1A 4O0XA 5EHYA 2PZIA 5TF9A 3FHRA 4GEOA 3GCQA 3CEKA 3HRBA 5E4HA 4RJ7A 3HUCA 2PZRA 5HBHA 3HRFA 2QOOA 3QWKA 3F69A 2E2BA 2XIXA 3FYJX 4KBKA 4LUDA 3FXZA 4APCA 5TT7A 2QOFA 2BIKB 3QYZA 3OD6X 3QC4A 4J97A 3LOKA 3UOKA 3ATSA 4PDYA 3F3WA 3ORZA 3EN6A 3D0EA 3ROCA 4ITIA 3BYUA 4JG8A 4YTIA 3MPMA 5KUPA 4PQNA 3PA4A 5JZNA 4K9YA 4QQCA 4BCNA 3MPAA 1CKPA 2PL0A 2QO7A 4HZRA 2VU3A 5AM6A 3L8SA 3W2PA 4I20A 5J87A 3WIGA 1XH5A 4QYHA 4ACMA 5BUEA 3TM0A 2WQBA 2C30A 2Y4IB 3M1SA 3TIYA 4CRLA 1YXTA 2DYLA 5IQGA 4GCJA 3ULZA 4IAZA 4MF1A 2JKKA 4HYSA 4BI1A 4JRVA 4LOOA 4C2WA 2WTVA 5M4CA 3UZRA 3GENA 3BWFA 3UTOA 2XKCA 3ACKA 3ZSGA 2XJ2A 4BHZA 4QQTA 3TDVA 4Y95A 2P0CA 4C35A 3C4XA 2B52A 2ITYA 2ZM1A 3VW8A 4FC0A 1ERKA 2YERA 3EKNA 5DG5A 5HKMA 3S2PA 2PUNA 5AAEA 3R22A 4HGLA 4IHPA 1V0BA 5HIEA 3B8RA 3S3IA 4DEBA 2XH5A 4R1YA 4BGQA 4RQKA 4HVDA 3ZZEA 4E5WA 3QC9A 2C3IB 4CRSA 3MIYA 4WNKA 2HZIA 3AC2A 1SYKA 2CMWA 4S31A 3OHTA 3JUHA 1JAMA 5L6OA 5CEPA 1YWRA 4IM2A 3H0YA 2W9FB 4LGGA 1FQ1B 1FBNA 1ZYSA 3EOCA 5DWRA 4YJRA 4YZ9A 3ROYA 2JDSA 2WFYA 3UC3A 1JBPE 3QALE 3EN4A 2OSCA 2YM5A 1PXIA 3QCSA 4QRCA 3W2CA 2B55A 4FVPA 4HGEA 3UC4A 5EYKA 2HXQA 2QOHA 4KWPA 4DG0E 2RKUA 1OECA 2UVYA 3DS6A 4GVAA 1KOBA 3TZ9A 2OBJA 2VWVA 2J5FA 3ORKA 4QMVA 5I3RA 2R64A 1CM8A 1JPAA 3FLZA 3G33A 3SX9A 4JOAA 2BZIB 4JT3A 4E26A 5EFQA 4O7WA 4EOQA 3P08A 2DQ7X 2HYYA 3NAXA 4RMZA 5IQIA 5KZIA 4EI4A 1H25A 4YJVA 4DCAA 1XH6A 3OT8A 3CR0A 3BX5A 5C8NA 4KRDA 4RZWA 5L2QA 3W8QA 2XKFA 3FI2A 3GU4A 1U59A 3NAYA 4I22A 4AP7A 2BRNA 3R1QA 3K2LA 4N0SA 1G3NA 4JBOA 3VBXA 3NUPA 4ITHA 4BTKA 5JK3A 3SG8A 4D4RA 4AFEA 4FV6A 2ZV9A 3D14A 1XH9A 2O8YA 3MTFA 5DH3A 3V04A 2CNUA 5EM8A 4YZBA 2C6DA 4EOKA 2GQSA 4FEXA 5F4NA 2FUMA 1MRYA 5C4LA 3HRCA 1U54A 4I5HA 4X2NA 3JY0A 4RX5A 2XBAA 1JQHA 5CU2A 3B2WA 5FP5A 2V62A 3QQGA 1PHKA 3PPZA 3R04A 4OT6A 3D7TA 5CENA 4BWPA 5CF6A 1PXKA 4AXAA 3F3ZA 1GZ8A 1YVJA 5KKRB 2ZB0A 3F7WA 3PIYA 5AX3A 3SXFA 2XB7A 4GFMA 1NXKA 2RGPA 4AZWA 2XP2A 4IZAA 4O27B 3PLSA 1J1BA 4X3FC 1WBTA 1UU8A 4F9CA 3UNZA 4WIHA 2IZRA 3QZIA 3OY3A 4C57A 2GNIA 2XYNA 2GMXA 3R9OA 5A6NA 4WUAA 2BMCA 3LCTA 5CF8A 1YQJA 3DNDA 2VX3A 2C69A 2VWBA 3F5PA 3MVLA 4AGUA 2PVFA 4FV9A 4JBPA 3ZCLA 2IWIA 4C2VA 1DS5A 3RCJA 4D9TA 4I6QA 3UQCA 3E63A 3MVJA 5GIOE 3NUUA 3DY7A 3EH9A 3L9NA 4AUAA 5L3AA 3MB6A 4Q9SA 4NU1A 4R78A 2BAKA 2C47A 3K5UA 4O0UA 3W55A 3ZS5A 2HELA 4AZVA 1UNLA 3QXOA 2W1DA 2JC6A 3LJ1A 4MF0A 4DC2A 5KHXA 1DM2A 3P7AA 2F2UA 2I0EA 2R3PA 3PJ2A 3E64A 2AYPA 4O91A 4OUCA 4EH8A 3TDWA 3QLGA 3F2RA 2IVUA 1NA7A 3DDPA 3ZM4A 3CTHA 2KTYA 3BYMA 3S00A 4TWNA 1UKIA 1WVWA 3BI6A 3P7BA 5TR6A 4B6LA 1OUYA 2FA2A 1IA8A 3QWJA 4F7LA 2HY0A 4FIGA 4YUQA 5M51A 4CT2A 5FLFA 1UWJA 2XBJA 3O7LB 3THBA 4F9WA 3LXLA 3LXNA 4H1MA 4ZXTA 4BCQA 2O63A 5B0XA 5A46A 4BIDA 3MVHA 3GEQA 4XX9A 3IPHA 3CQEA 2J4ZA 4XG6A 5FBOA 2R0IA 4BGHA 5IQBA 3DA6A 3G6HA 2PHKA 2UUEA 3PRFA 4KBAA 5DNRA 5AUTA 4NYEA 3G90X 3M42A 2GNJA 5FXRA 3E5AA 4X3FA 5EG3A 3SV0A 5JRQA 3D5UA 2UZEA 4R3CA 2YIYA 3KFAA 3CPBA 4JAIA 5LARA 4FGRA 3R63A 1F0QA 1IA9A 3FZTA 2VD5A 4U40A 4ACGA 3TZ8A 3RKBA 4DE4A 3SRVA 4F9YA 4ZTQA 3VC4A 3OWKA 2W7XA 5E7RA 3POOA 2VTLA 3UNJA 2C3JA 5ANJA 2RIOA 3RHXA 3G15A 1FVTA 5BVWA 4A9TA 3EFJA 3MFTA 3BV3A 3RWPA 5CASA 2C1BA 3RJCA 2ZDTA 3C7QA 3TJDA 4DEDA 2R5TA 2J2IB 3KCKA 3QQUA 4I1ZA 4IVDA 2PYWA 2UZBA 5HEZA 5CAUA 4FSWA 4MD8E 3WF8A 4HCUA 1Q4LA 1XQZA 5GJGA 5I9YA 4QTBA 3ODZX 5HE0A 4CCBA 4OLIA 3FZRA 3QQFA 4JQ8A 3OFMA 3GI3A 3P9JA 3FMEA 4X6QC 1Q8WA 3EHAA 4KRCA 2LAVA 3I0QA 1ZMVA 4E4LA 2QU5A 3KREA 4JDIA 3QTXA 4P4CA 2BZKB 1H1QA 2C6KA 3ATTA 2R3RA 4P90A 2YWVA 5I9XA 3FL5A 3OCTA 2XNGA 5I9WA 4KINA 2J7TA 1R78A 3IW5A 3LZBA 3NS9A 3VRZA 5AUXA 3QCXA 5DE2A 3E8CA 4PF4A 4ANBA 3LQ8A 3O71A 4QMTA 2J50A 3LFFA 4RIYA 5F1ZA 3WZDA 4C8BA 3VO3A 3FMMA 3UIMA 4D2SA 4I4EA 1OI9A 3DKFA 4M7IA 3UG2A 4XP3A 2CDZA 4E4NA 4UMUA 3GFEA 4I0TA 3MWUA 3OG7A 5DI1A 2QOCA 3V5QA 3E92A 4ZTHA 3BYSA 3F9NA 5JGAA 3C1XA 4WNOA 3FYKX 3D5WA 5JMSA 3QYWA 4BHNA 1XH7A 2WMTA 4ZY6A 1T45A 4OTRA 5KMIA 4O7ZA 5JFVA 1U4DA 3R0TA 4M8TA 2IW6A 3OZ6A 4OTIA 3A7GA 4RG0A 3FI3A 3SXSA 4PL3A 4ZZNA 3BGZA 3BQRA 4O21A 4CTBA 4CXAA 5TO8A 5M53A 3EL7A 4WNMA 4NUSA 1Q24A 1PXPA 5EQEA 3CXWA 4OTDA 3EN7A 3TNPC 4OTQA 2QCSA 4O2ZA 5M06A 3IOKA 4E93A 4ZOGA 2V7OA 1QMZA 3ALOA 3FC2A 3QLFA 1SNXA 4FKWA 4MXZA 3VS2A 4RJ5A 2PUPA 2W99B 2BKKA 3EZVA 3ITZA 4RVMA 4FIJA 4C62A 4MD7E 4EH5A 1K3AA 3MVMA 4YNEA 1PY5A 2WO6A 2XCHA 3A8XA 2I0VA 2WMXA 4IFCA 3S1HA 4R6VA 3SKCA 5E8WA 5DHJA 3DZQA 2R7IA 3D7TB 4DYMA 3IKAA 3EYGA 3ORTA 2XA4A 3Q9WA 4D55A 4XG7A 3K3JA 3DKCA 4U44A 4AE9A 5AIKA 4HGSA 4RA4A 3C13A 3VJNA 2QQ7A 2W17A 3Q32A 3MY5A 1F3MC 2EB3A 3FMLA 4LGHA 3PP1A 4TKSA 3K3IA 5IA1A 5IG1A 5K5NA 3LM0A 5E1SA 1IEPA 1G5SA 2QVSE 2R9SA 5M44A 4FSNA 2A19B 2X9EA 4KAOA 4ZEGA 4EHEA 4OTPA 3AT2A 3QD3A 2PU8A 3KA0A 4APPA 3VIDA 4FGBA 2W1EA 1YXSA 3Q6WA 1YWNA 2ERKA 5FUTA 3FUPA 5A3XA 4FTQA 5HO8A 3TL8A 4XV3A 4EORA 2I1MA 3ZBFA 4CLIA 4I93A 3KC3A 4X0MA 3VS3A 4EUTA 3FSFA 4NCTC 4A4OA 5DN3A 5AUWA 3MA3A 3WF7A 4XMOA 4AA5A 4TN6A 1PKGA 2HK5A 4XRJA 4RX9A 5M4FA 4FZ6A 2G2HA 1Q3DA 5CF5A 4EOJA 3A7IA 3OW3A 5AR4A 5JN2A 5HLWA 5CNOA 4I5CA 5IA2A 4EK5A 3CBLA 2JIUA 2X8DA 4DGOA 3D7ZA 1Z9XA 3RTPA 4RVLA 4D28A 1OKWA 2A27A 3FLYA 5LVMA 4UX9A 3R7IA 5IEVA 4XYFA 5KE0A 3AC8A 4J98A 4YJNA 4L9IA 4BB4A 4JLCA 3HV3A 5HCZA 4GMYA 2QO2A 3BYVA 2Z7LA 4O2PA 2XNBA 3DLSA 3EL8A 3NDMA 2AC5A 4G6LA 4FUXA 2CJMA 2HW7A 2QR8A 2X7GA 3BU6A 4HPTE 4MBJA 4D4VA 3DB6A 1H4LA 3P78A 4C38A 5LMBA 3NNWA 4R8QA 2I6LA 4X3FB 1H8FA 4NTSA 4YTHA 4MK0A 4RWJA 3CTJA 2YM7A 3K5VA 2CNQA 4WNPA 4WG4A 4CQGA 1SM2A 4FKRA 4FTKA 3V51A 1T46A 4ZJJA 3VHKA 2J90A 4FTUA 5E8UA 2ZV8A 3BLHA 4O7NA 2P2IA 4GIIA 1UWHA 3NYOA 3SRVB 5J95A 4J96A 4DGMA 5CAVA 2R3LA 3HMOA 1OL1A 3DKOA 3GU8A 4LOQA 5BVEA 4USEA 5HNIX 3UZTA 4BDEA 1W8CA 3VS4A 3ORMA 2X6DA 3EIDA 5CANA 5I3OA 4LUEA 1LEWA 4BYIA 2PMOX 3C50A 2C5VA 2V22A 2B9HA 4Y46A 3Q2JA 4DN5A 4YJTA 4RGJA 2VRXA 4U7ZA 1ZZLA 3W2SA 3ZO2A 4E6DA 4XG9A 3LQ5A 2BAQA 2RSVA 4AOJA 4WG5A 2CGVA 2UVZA 5CVGA 3VS5A 2UW8A 1UVRA 4BN1A 2PVRA 2OIQA 3GC0A 3PSCA 3VS1A 3KVXA 2BUJA 2V0DA 2IW9A 2Z7SA 1H00A 5ACBC 4FK6A 2R3QA 3W2QA 2NO3A 4PPAA 4YLJA 4BL1A 4NW5A 5J79A 3DK6A 4YPSA 4IWPA 4FICA 4C36A 1O9UA 5L2SA 4M12A 4OBPA 2ZM4A 1ATPE 4BDCA 5FP6A 2NPQA 1JKSA 4HW7A 4EOLA 5KMOA 5M57A 2UZLA 3DTWA 5CSHA 5KX8A 1CMKE 2GNGA 4NTTA 4AN2A 4FIIA 2QURA 2VX1A 3A8WA 3AC4A 3RZFA 3ERKA 3SHEA 4HCVA 5JKGA 4BFMA 4ZLYA 3FE3A 3KMUA 4DTAA 4FYNA 4A4XA 4FKTA 3VHEA 3DBQA 5HOAA 3MTLA 2VTMA 3SAYA 4E73A 5I4NA 4AW2A 1ZY5A 3QUPA 3L9MA 5GZAA 3SLSA 3ORXA 2WNTA 2J9MA 2I7QA 3VS6A 2RFNA 3CJFA 2WMQA 1HCLA 3VQHA 1OBGA 3HAVA 4FTRA 5FD2A 3SG9A 4HJOA 4DFNA 3JYAA 2XK4A 3MFUA 5K4JA 2VTNA 4O82A 5E9EA 3FPMA 3LXPA 3OXZA 3UO5A 4GSBA 4L53A 3E87A 2UVXA 4QYEA 3QU0A 2GTMA 3V5TA 3DAEA 5HIDA 5KCVA 3TT0A 3MV5A 4IZ7A 2ITUA 4OGRA 4AACA 4BYJA 4RBLA 5DR6A 3IK3A 3ZM9A 3U51A 3H9OA 4AZFA 3A2CA 3PXFA 5E92A 4YO6A 4TT7A 4IDTA 2JDTA 4F1MA 3HYHA 2OF2A 2WMWA 1YRPA 2GNLA 4ZTLA 3JS2A 4DGLC 4WA9A 4MTAA 5GJDA 3N9XA 4PTGA 3DK7A 3H9RA 3Q52A 5DMZA 4TW9A 4F6WA 4MD9E 4BCHA 5BUIA 2F57A 4YTCA 4WKQA 4QOXA 3GC7A 3PVGA 4FNYA 3OWPA 2HY81 3B8QA 3RK7A 3RPSA 1H24A 3SXRA 4C3RA 1JWHA 5CYIA 2X4FA 2J6MA 3BCEA 1OL7A 5HHWA 3R1YA 2F7XE 4I24A 2BRHA 3BHHA 3G0EA 3R9NA 1YWVA 2NRUA 2XIYA 4W4XA 2Y7JA 3KN5A 5EDRA 4ORKA 2JBOA 2QI8A 4ID7A 3JY9A 4FTOA 3AT4A 4O83A 3QAME 4PX6A 1KE7A 1P4FA 1W98A 4L3LA 4R5YA 5ANOA 4L7SA 4ANQA 5HD4A 4J7BA 3QX2A 5KMKA 4YZMA 2GNHA 2HENA 3KXGA 2ITNA 1XKKA 2ZOQA 3ODYX 3HP2A 4PDSA 4E4MA 4L01A 3A99A 5HCYA 4NJDA 3AD6A 4EHZA 3W1FA 4C4GA 4DITA 1M2QA 3EFLA 3NYXA 3LVPA 2JLDA 2VO6A 2PMLX 4F65A 2XK6A 1OL5A 5BYZA 1NVQA 2VTHA 3RBWA 4NKSA 4LL5A 4BZOA 1Q99A 3NUSA 1E1VA 2E9OA 4Q5HA 3R8ZA 3PY3A 4F99A 3NVMB 5T6KA 5J9LA 2G1TA 2VTRA 2EXEA 4FV4A 4IADA 1PKDA 4PPCA 3I60A 1Y6BA 3KK9A 3RZBA 4CMOA 4JR7A 4L00A 4LV5A 5CNNA 3NPCA 4I5MA 3U4WA 4ANLA 4Y85A 3U4UA 4IJPA 4F0IA 4XS2A 4C0TA 2W9ZB 4DG2E 5A4EA 2YIWA 4Y73A 3QKKA 5LMAA 3R6XA 4G3DA 5LQFA 3LAUA 3I5ZA 3F3VA 5FDXA 4O22A 1I44A 3V8SA 3QKMA 3UYSA 2GS7A 3MFRA 3G9NA 3PWYA 4FI1A 4U80A 1ZYCA 3ENHA 5AP7A 2WD1A 3IECA 2B7AA 4RJ4A 2VO0A 1BLXA 4D9UA 4QD6A 2BTRA 3CPCA 3D4QA 5DOSA 5EW3A 5J5SA 3WBLA 4BY9E 4S34A 3EFWA 1JNKA 1WVXA 3OXIA 1SVHA 3TIZA 3UVRA 3U6IA 4EK4A 2C6TA 2R0UA 2C3LA 4FIFA 2O3PA 5G1XA 3OTUA 2H8HA 3IO7A 4PMTA 3PIXA 4PTCA 4G3GA 1TKIA 4PDOA 2YJRA 5CQWA 3W2RA 4UMPA 5A4CA 2CCIA 2XNNA 4ZSJA 5TE0A 2W4OA 4DEIA 4G3FA 5BVNA 2C6LA 4BZDA 3ET7A 1DI8A 2XK9A 4ZLOA 4QYFA 2J0LA 1H0VA 4TL0A 4M13A 3NEWA 2CKOA 2NRYA 2OXDA 1GIJA 1QPEA 4QO9A 1ZMUA 4M0YA 3VS7A 4O7VA 1OITA 1ZOEA 4D0XA 4QMQA 4QMWA 3WARA 3UOHA 1DI9A 1OIRA 4KKGA 4NEUA 4IX3A 3WF6A 4BWXA 3BU5A 3TUCA 4F6UA 5GIPE 2JKOA 1Z57A 4XV2A 4XG4A 2CKQA 4FSQA 5BVFA 1M7NA 1XR1A 2JGZA 2Z60A 4LYNA 4BKZA 5L2IA 3COMA 3LCSA 4QP6A 5AUZA 4IBMA 4GU9A 3L8VA 4Y8DA 5LVPA 4U45A 5HG5A 1OIYA 3KRJA 3SOCA 2ONLA 3BEGA 3PJ1A 1Q97A 3OVVA 1H1SA 4WRGA 3RPOA 4AZTA 3MSSA 2PWLA 2QNJA 3PZEA 4FF8A 4FNZA 5CX9A 3REPA 3RWQA 3PLAE 2Y0AA 4ZS4A 2HAKA 3FMHA 5M09A 3C0HA 1PXMA 3IGOA 4RVTA 2F49A 2XIKA 2W4KA 3NLBA 5L2WA 5K4IA 3BIZA 3VUGA 4NT4A 3P4KA 4F7JA 2W1HA 5CY3A 4B0GA 2UW0A 1OZ1A 3HV5A 4KS7A 3DBDA 5IQDA 3PUPA 3DJ5A 4RFZA 4CZTA 2WQOA 4TWPA 4DLIA 4ARKA 1K9AA 4WT6A 3HMPA 1Y57A 1P2AA 4II5A 5EI2A 1WMKA 4FVQA 3ZSHA 2QKWB 2YHVA 1ZAOA 2XK8A 3QL8A 2ZMDA 3HMNA 1J3HA 5D1JA 1UV5A 4XOZA 1GZOA 4IWDA 2YIRA 4QTCA 4WSQA 5HVYA 4AW5A 4EJ7A 5AA8A 2IZTA 3LQ3A 2GFSA 5LOHA 4NFMA 3ALNA 3FMJA 3RM7A 2WKMA 5AR5A 2B53A 3UO4A 5H8BA 4IC7A 3PVUA 2YFXA 3R8PA 1QPCA 3ANQA 1YDSE 2QOBA 4QMUA 4YBKA 5DFPA 2ERZE 4FL3A 4J95A 4NSTA 2F9GA 4DT9A 2GNFA 3ZFMA 2YIQA 3KL8A 3RALA 4TYIA 1OIUA 3V5JA 4FKQA 3W16A 4NIFB 4ENXA 4QTEA 2P4IA 2J5EA 2VTIA 4RZVA 3R73A 4M69A 3VBYA 4OBQA 5K9IA 2WIPA 4PRJA 3POZA 3HA6A 1FGIA 2X7OA 4NH1A 5AAGA 1JLUE 2GHGA 3NW7A 3ORLA 4G2FA 1KV1A 4NZWB 3VJOA 4RA5A 5GNKA 4AA0A 4CFVA 2ZVAA 1V0PA 4PPBA 5E8TA 3I7BA 4BDBA 5K0KA 3OWLA 4OAUC 5BVDA 4M0ZA 3DTCA 1KWPA 3I7CA 3D83A 1B6CB 2C6OA 1BX6A 3V8TA 4ZTMA 5AUYA 3UDBA 4Q5EA 2XF0A 1H1PA 3F7ZA 4KSPA 4XLIA 3PSDA 1Z5MA 3TKIA 4J8MA 5KMJA 3DBEA 3R21A 2J0MB 4ANMA 2UW7A 1NY3A 2HIWA 3Q4ZA 2ETRA 5LXMA 4B8LA 4OBOA 3FY0A 5HICA 3QD2B 4XBUA 4BCIA 5HTBA 4XP2A 4CFNA 2PE2A 3CLYA 2C5YA 2Q83A 4W8EA 4L68A 1OKVA 1F5QA 3D15A 4EQUA 4RC2A 5JT2A 3EQCA 4MAOA 2HW6A 2RFEA 3RAKA 5HVKA 2OH4A 2PVKA 4D5HA 3GFWA 5KBRA 4L52A 4I94A 4PTEA 4EH7A 5BX0A 5CALA 4DH3A 3VUMA 3U54A 3R7OA 4YPDA 2W4JA 3E8NA 2ITOA 5CU3A 3LW0A 5IISA 3FWQA 5M56A 1PYXA 5AP6A 2HWPA 4H3QA 2YIXA 4L42A 4D4SA 2WMUA 3CY2A 2W05A 4HVGA 5AFVA 3P23A 4DA5A 3KGAA 4YURA 5CI7A 4E6QA 2SRCA 5I9UA 5IMEA 3QKLA 5AMNA 4DFBA 3D2KA 1FVVA 4QPAA 4CFWA 3O0GA 2EWAA 4RJ3A 4E4XA 2R3HA 3EB0A 5ANKA 3SDJA 3RCDA 4WUNA 1KE9A 4AGDA 4NFNA 4D2TA 4BR3A 4YJUA 3MH0A 5FGKA 1YKRA 2ZMCA 4X6RA 1APME 4FEVA 1PW2A 3GC9A 5AIRA 1CDKA 2CHLA 3OP5A 2A4LA 4JDKA 3TNQB 3ZLYA 5JZJA 1WCCA 1GIHA 1GZKA 2B9IA 3BRBA 2B9FA 3OCSA 4CEGA 4F9AA 2C5OA 4R1VA 3COIA 3SC1A 3AC5A 3AGMA 3G2FA 4ZZMA 5BQ0A 4KIOA 4A9RA 1MRVA 5AV1A 5BVOA 2ITQA 1WBWA 2Q0NA 5CVHA 4GV1A 4L3JA 4USDA 5IQFA 3W33A 2QODA 3CQUA 4RX8A 4AWIA 3NRMA 4NK9A 4TNDA 3ZLSA 5CF4A 1LEZA 3EJ1A 3DFCB 4A4LA 3MA6A 1X8BA 2X8EA 5CWZA 3TWJA 4DHFA 3MESA 4LMNA 3QQKA 4QP9A 4TYEA 4BI2A 2OO8X 4IC8A 4GVJA 4MX9A 4ANSA 4CZUA 4MEDA 2CGXA 3RINA 2JEDA 4AX8A 5BYLA 1PMVA 1Q61A 4AOTA 4GH2A 2XK7A 4MBLA 3WIKA 3OF0A 4D58A 1MQBA 3U9NA 4ZSEA 4FA2A 4QP2A 1FMOE 3GVUA 2ZV7A 2Z02A 3NZ0A 4M14A 3U6JA 3UNKA 4G5PA 5GHVA 2QLQA 2RFSA 2BDFA 3U55A 3FXXA 2PMNX 4YC6A 5IF1A 4I5PA 5KMNA 2H9VA 5KMLA 3TUBA 3AD5A 3MPTA 3W2OA 4YO4A 3P79A 2UW3A 2WQNA 3ORPA 4FL2A 3VN9A 4N4SA 3A60A 1H08A 3SW4A 4AZSA 4ASEA 1BYGA 5IQHA 4EOPA 5JGBA 4F7NA 3CGFA 5ANIA 3FQSA 5DEWA 3PA5A 3WZUA 1OPLA 3ZSIA 5HTIA 2IJMA 5H8EA 2WTWA 3UZPA 1MUOA 1R3CA 2BAJA 3GQIA 4UY9A 3HV7A 3ZHPC 1GZNA 4QP8A 4UEUA 3GCSA 4FTJA 3DCVA 4IMYA 5CI6A 3VBQA 4BI0A 2KULA 5HNBA 3RHKA 3WI6A 1JSUA 4YHTA 4EWHA 1ZYLA 3BLQA 4IQ6A 4M66A 4ASXA 4YZDA 4U0IA 4BGGA 1STCE 2CLXA 3EQBA 2J51A 4BTMA 1M2RA 3M11A 1YI3A 2OI4X 4TYGA 1SMHA 1UA2A 3IW6A 3RK9A 1Q8TA 4L7FA 5HTCA 4BBEA 1JSVA 3SW7A 5HO7A 5B2MA 1MRUA 2CPKE 1YXVA 3HMMA 1HOWA 4O6EA 2X2MA 4YZCA 4YGAA 2WMBA 2ITWA 3ZZWA 5HX8A 3VULA 4JQEA 2GHLA 3BV2A 2HWOA 2PZPA 3BHYA 1OM1A 2FSLX 4YBJA 1W7HA 4GT3A 5CAQA 2PY3A 2PZ5A 3DJ7A 5EKNA 3G6GA 3N4VA 4G3CA 3EN9A 3QCQA 2O65A 2UV2A 3DAKA 2JDVA 4XG8A 4TWCA 5HI2A 5FXQA 3TEIA 4M69B 3ZC5A 4IB1A 4UWYA 4JNWA 4EK3A 3R7YA 4X2FA 1BMKA 1W0XC 2YZLA 3TNHA 3DT1A 4K0YA 3NUYA 2X4ZA 3JR1A 5BMSA 3OOGA 4XH6A 4U43A 5AP4A 5IDPA 2BRGA 5AEPA 4L67A 2QOQA 1REKA 3UIBA 2YCQA 3WE4A 3QTQA 3LLTA 3F5UA 5HGIA 5L8KA 3R2YA 2O5KA 3LCOA 2RFDA 3UPXA 2HZ4A 5JQ8A 3TJCA 2OLCA 3WYXA 3AC1A 3DXQA 3PXYA 2PK9A 5E8ZA 4ERKA 1ZYDA 3I79A 4PL4A 5C26A 3FBVA 2XKEA 4N57A 5IUIA 2R3KA 4HPUE 3R71A 4FT9A 5CXZA 4YP8A 2ETKA 4BKYA 3CKXA 3FMDA 3OOMA 3QRTA 2H6DA 3L8XA 4KB8A 4BRXA 4Z7HA 2B0QA 3EMGA 5BNJA 5CEOA 3IG7A 2X9FA 3BELA 2CSNA 4RX7A 2XS0A 1YXXA 4F7SA 2UW5A 4EL9A 5HVJA 5CXHA 3R8MA 5J9ZA 3LHJA 2B1PA 3GCVA 4RT7A 5CEKA 2QO9A 3KMWA 3WILA 2JKQA 3PSBA 5LWNA 4PUZA 5HBEA 2W06A 3Q4UA 4CFXA 3HEGA 4D1SA 2UZDA 4F0FA 2VN9A 4O7SA 4I4FA 3AT3A 3EKKA 5ANDA 3UOLA 1U5RA 2W5BA 4TWOA 4JXFA 4ALVA 3W18A 3CJGA 5IUHA 3CD8A 3A62A 3HVCA 4GIHA 5A4LA 5DPVA 4RPVA 3UP2A 1CTPE 3VRYA 4F09A 1A48A 2R3IA 3UBDA 4AS0A 5DRBA 4UMTA 4LL0A 3NGAA 4IAYA 4QYYA 5IMXA 3QTWA 4JL9A 2P55A 3WZKA 3VNTA 5IA0A 3W8LA 3AXWA 4RIXB 5ANGA 5IQEA 2ITTA 1B38A 4U97A 5FTQA 4FKVA 2C3KA 4YJOA 5AUUA 4UMQA 3A7FA 5FM3A 4HYUA 2UZWE 2EUFB 2F2CB 4EUUA 4O7TA 5C8MA 2BDJA 3S0OA 2WXVA 5E8SA 3IW4A 2FO0A 4MWHA 4JX7A 5HD7A 3A4OX 3FEGA 4DH8A 1R0PA 4G17A 3FLQA 3RVGA 2GDOA 2WTCA 4ZIMA 3OY1A 1IAHA 4QTDA 5K5XA 1V1KA 3LFBA 4O1OA 4FK3A 3I4BA 1V0OA 1XJDA 4FTAA 5AA9A 4ZSGA 5A4QA 2CGWA 4ITJA 4XG3A 5DEYA 4DH7A 2UW9A 4FE2A 4YHJA 5EW8A 4J52A 3P0MA 3C5IA 3D2IA 3TNIA 1OGUA 4K8AA 3N4UA 2WMVA 3BWJA 4KIKB 4E6AA 5IH6A 4Y83A 4USFA 2JFMA 3TV7A 2H96A 4GYGA 5E91A 3Q5ZA 3FSKA 4ACCA 4HNFA 4JDJA 2RG6A 3E88A 3ZTXA 5LMKC 3GCUA 2IVTA 1KUTA 4ZY5A 2YITA 4S2ZA 4UXLA 4DH1A 2P3GX 3FL4A 4XP0A 3D94A 2XYUA 1BI8A 4Y72A 4DTBA 3MN3A 4JX3A 4JG6A 3G5DA 1UU9A 4G3EA 3ELJA 2ESMA 4QMLA 1ZMWA 4W4VA 3WF5A 4F1OA 2VO7A 1XO2B 1OBDA 4R77A 2XIZA 1OL6A 1VYWA 3VS0A 4XHKB 3TACA 2X6EA 3GU7A 3BPRA 5BYYA 4BF2A 4L44A 3TUDA 4YJSA 5EHOA 3ZFXA 3C5UA 4FTIA 4M67A 1H01A 1UNHA 1WAKA 2OFVA 2YCSA 4AF3A 3C4FA 2FSMX 4FTCA 4YC8A 4EQCA 2LGCA 3BHUA 3TTIA 2R3NA 4I3ZA 2JD5A 5FQDC 4E20A 4RWIA 5J7BA 1UKHA 2OWBA 4L3PA 2I40A 2AUHA 4QMSA 4CV8A 3DAJA 1H26A 5AV4A 1B39A 3W10A 1OKZA 3FKOA 3ZLXA 1VJYA 1WBSA 1P5EA 3E8EA 4FG9A 4OTFA 4RIOA 5E8VA 5AR2A 3UG1A 1M2PA 5DR2A 3PXQA 3V6RA 3TTJA 3KY2A 4UYAA 4QQ5A 3C9WA 2F7EE 4D1XA 2BHHA 3TG1A 3UMXA 2YM3A 1VEBA 3FZOA 3MYGA 3IGGA 3PPKA 5D7VA 3SQQA 3DNEA 4B8MA 1PXJA 4JIAA 4FSTA 4CV9A 4X3JA 1FINA 4NCTA 3HA8A 4UMRA 4MBIA 1YHSA 4IDVA 5HG8A 3WZJA 2BHEA 4P7EA 4O81A 2EB2A 3ZC6A 3R8LA 4HOKA 2PE1A 4RQVA 4ZLZA 5JFWA 5M07A 4IZYA 2YLFA 5TOZA 2FSOX 3H0ZA 5CU4A 4S33A 4FMQA 2GFCA 4L43A 4G9RA 2X7FA 5C01A 4NJ3A 3PPJA 3OEFX 4UYNA 3ZO4A 3F61A 4ZAUA 2G15A 1H0WA 4H39A 1GY3A 2OJ9A 5J1VA 3IDBA 3T3UA 1S9IA 2WOTA 5HE2A 3VUHA 1NVRA 4PV0A 4BC6A 4UWCA 3FI8A 4NL0A 1ND4A 4HYIA 1U46A 3TN8A 2Y6OA 2CN8A 4BCPA 4CZYB 4EEVA 3QUDA 4RRVA 1U5QA 2C6EA 3FAAA 2ZB1A 4C58A 3KRRA 1JOWB 3O50A 4EHVA 3CS9A 3C0IA 4F6SA 4DEAA 3I1AA 4E1ZA 4F70A 5IU2A 5CS6A 3KXXA 4JJRA 5FG8A 3CY3A 4LFIA 2Y8OA 5ANEA 3UIXA 3OWJA 5CT0A 4O7YA 4YC3A 4AW0A 3EQDA 3R9RA 4A9UA 4W9WA 3NIEA 5GINE 3ZBXA 4IAFA 2C0OA 1OMWA 3E8DA 4GYIA 3OW4A 3RK5A 3NYVA 1MP8A 4RFMA 5FTOA 5BMMA 5L2TA 1SNUA 4IFGA 1PRYA 5DGZA 4C59A 2BIYA 5B2KA 1LPUA 3DLZA 3COKA 5ETIA 3HUBA 4ZTNA 1ZARA 3QQJA 4H36A 1RDQE 2ITXA 1M52A 2XM8A 5CVFA 3UE4A 3VQUA 3LKMA 1UNGA 4Q2AA 4O84A 3E3PA 5L8LA 3WF9A 4FTLA 4W4WA 1TQMA 4FVRA 3BBTB 5IH4A 3Q6UA 5AV3A 3PG1A 4CGAA 4K2RA 5HE3A 4HVHA 2J0JA 4NIFA 4IH8A
chains in the Genus database with same CATH superfamily
4RFYA 2X39A 3C51A 3EN5A 4OR5A 3LE6A 4E5AX 4Z16A 2FVDA 4ACDA 1TVOA 4UXQA 2OZOA 5LMKA 4K6ZA 1PXNA 2VTJA 3HDMA 3PJ3A 2QU6A 5AAFA 2YA9A 2VWYA 3OEZA 2WTKC 4ZMEA 3N51A 4X2GA 3TCPA 3R02A 4EOSA 4FIHA 4BCKA 3MH2A 2PUUA 3DJ6A 5EH0A 1WFCA 5A4TA 3NYNA 2W5AA 4WOVA 3U6HA 2OICA 5ETCA 2H34A 3ZOSA 5EHLA 4JIKA 3CD3A 5CAPA 4MXOA 1QPJA 2QLUA 3HNGA 3QZFA 2BROA 5AR8A 3BZ3A 3DBFA 4RIWA 2GS6A 4LRKA 1H07A 2R3OA 3R7VA 4N6ZA 1XHAA 2BRBA 2ZM3A 4FYOA 4IM0A 2GTNA 2XZSA 4FKOA 3ZH8A 3RMFA 4S32A 3QF9A 3PYYA 4I6HA 5IPJA 3ID6C 3RPVA 4FSRA 4MXAA 1TQPA 2YWPA 3RM6A 4A9YA 4WSYA 3OUNB 4ZSLA 4QMPA 3IW8A 4EH6A 3U9CA 4FSMA 2OJJA 4EZ7A 4MNEA 4IWOA 3KF4A 4B99A 3OMVA 1LUFA 1Q8UA 1W83A 3FMNA 3H4JA 4BIEA 3KXNA 3FQEA 2X1NA 2NYAA 4AU8A 3QUEA 1IRKA 1WBNA 3F88A 4L8MA 1LR4A 5HCXA 5HG9A 4AXDA 4YU2A 1ZOHA 3F5GA 4MHAA 5CSVA 3NVKI 5GJFA 3Q9XA 4LQMA 1BI7A 3CKWA 3O23A 4GG7A 1SZMA 3HL7A 2XJ1A 1BL6A 5AP0A 4CMUA 4KSQA 4G34A 4G31A 3FDNA 4GT4A 4IACA 3HDNA 4V05A 4DG3E 3LFCA 4EYMA 4FL1A 3HAMA 4F63A 3QRKA 3ZO3A 5EOBA 5IKWA 2P33A 2UZUE 2XKDA 1GJOA 4EZ5A 2BFXA 2DUVA 1PJKA 2UW4A 2VNWA 3NCZA 4IB3A 4Q9ZA 2AQXA 4EK8A 5L8JA 4A06A 3KK8A 1PYEA 3DOGA 1YHVA 5AR3A 3UGCA 3P7CA 1BL7A 5ACKA 4G5JA 3DV3A 1RJBA 3P1AA 1BUHA 3Q2MA 4FOBA 4IEBA 3CC6A 4AZEA 4P5QA 3OCBA 2OU7A 4U9AA 4ERWA 4U8ZA 3T9IA 3HX4A 2P2HA 3KB7A 4YMJA 3VUKA 3MDYA 2ITPA 3RGFA 4ZSAA 2VWIA 4XNEA 4NM5A 4KKHA 4CKIA 2WB8A 2QC6A 3M2WA 3ZU7A 3ZXZA 4A9SA 5I9ZA 5CAOA 5DA3A 1WBOA 1W84A 5HQ0A 4HNIA 3GUBA 1QCFA 4IVCA 2A1AB 4FEWA 4C33A 5G6VA 4FT0A 1IR3A 3H9FA 2FH9A 4B7TA 4EWQA 1P14A 2O2UA 5HG7A 4R7IA 1Y8GA 3DBCA 4FKPA 4V0GB 3OBGA 4EYJA 2C0IA 2G2IA 3ZYAA 4JR3A 3E62A 2XK3A 4IWQA 2JBPA 5DIAA 3EYHA 4UWBA 2IVSA 4ZS0A 5FEQA 3GP0A 3ENMA 3GBZA 5KNJA 4ZJVA 1L8TA 2DWBA 3KQ7A 3KXMA 3QCYA 4FSZA 4NM7A 4B9DA 3EQGA 3UO6A 2I0HA 2UZVA 4IB0A 4CFFA 5A54A 1FVRA 2VO3A 4BCOA 4FRFA 4FT7A 1DAYA 2NNWB 3Q4CA 5F94A 1QPDA 2C4GA 2OG8A 4QMZA 4AAAA 3MJ2A 4G1WA 3IDPA 4GFGA 2ETMA 4GK2A 4MH7A 2W96B 5AM7A 4XG2A 2WHBA 4EOMA 4FUYA 4YLLA 3FPQA 4LRJA 1R39A 3Q5IA 4CD0A 4UBAA 5HORA 2W0JA 4TRLA 2GS2A 4O4BB 5F9EA 2ZJWA 1VZOA 2PVMA 4F4PA 3QHRA 2OZAB 4BDGA 4G9CA 2XUUA 3BHTA 2EXCX 5AV2A 3WE8A 2OJFE 4PWNA 1H28A 1Q8YA 1OB3A 3EZRA 4MCVA 4ZK5A 4BKJA 3KRXA 2GU8A 3LPBA 5E1EA 3NUNA 4EQMA 4ENYA 4EOIA 4XOYA 1YI4A 5JFXA 4TYJA 3QQHA 4ZZOA 2WQMA 3KXZA 5T68A 2R3GA 1RQQA 5M55A 4CVAA 4DEHA 1H27A 3RNIA 2ITZA 4H3PA 2WGJA 4EBVA 1GOLA 1XBCA 2ZV2A 2I0YA 5H3QA 4FTMA 5BPYA 1EH4A 5J7HA 4QP3A 4QPSA 2C1AA 1MQ4A 5EK7A 3PXZA 2QG5A 4JAJA 4FV0A 2OJGA 2IZSA 3G51A 4KA3A 4J8NA 4MVFA 4WHZA 3FZPA 4GJ2A 2YCRA 3RPYA 3ZONA 4ASZA 1PXOA 4DEGA 4ZMFA 3JVSA 4BTJA 5CQUA 5CEQA 5AR7A 4ZP5A 2IVVA 4DFYA 1WZYA 3KRLA 2WMRA 2EU9A 4ZY4A 4O7LA 4HVSA 3AMAA 4K33A 4X7QA 3IDCA 4KIQA 5LCKA 5AJQA 3KN6A 3KF7A 3R28A 1JKKA 3Q9YA 3HZTA 2BTSA 3UVQA 3ZO1A 4IX6A 3HECA 1J7UA 5CLPA 2XIRA 3RAHA 3BBWA 2WELA 2V5QA 3KULA 3VWAA 3K54A 3QTIA 4KNBA 2XJ0A 4DFXE 2PULA 3Q4TA 4A7CA 3CSVA 2X0GA 4H1JA 4C4EA 4JMQA 3QGYA 4O4CA 1PMNA 4ZJIA 4I23A 2G2FA 3ZUTA 2RG5A 3KVWA 4KD1A 4KBCA 3ZRKA 4U79A 2FB8A 2VTQA 3V6SA 4F0GA 5CU0A 4KUJA 3U55A 3VBWA 2REIA 2VAGA 4FKJA 2ZDUA 5AX9A 5KO1A 3ZLWA 4O0TA 2OXYA 3VBVA 4RIWB 2YEXA 3ORNA 4O96A 3GC8A 1Y91A 4PP7A 2B54A 3FQHA 2R3MA 3C4EA 1OGYA 3D5VA 2VGPA 1PMUA 4K1BA 4FSUA 3O5AA 2XNPA 3OTVA 3Q9ZA 4FNXA 4MKCA 4XLVA 5DRDA 1IAJA 4DEEA 2CLQA 2HCKA 4I92A 4IX5A 5FEEA 2R3JA 3SVVA 4FT5A 4E5BA 4QMNA 4MNEB 3F2NA 3C0GA 3UOJA 1R0EA 2PVLA 3A4PA 1IG1A 2YACA 1NVSA 4R3PA 3V5PA 4FOCA 4WRSA 3QRIA 3R2BA 2QHNA 2A2AA 1JKTA 4FZ7A 3ZFYA 3EWHA 2VWZA 3EQFA 4NWMA 4A07A 4EC9A 1YOMA 2G9XA 1KSWA 2WPAA 3FC1X 3H10A 3PRIA 2JDRA 2YDIA 3AC3A 3OT3A 5EDQA 4D2WA 2ZAZA 5CTPA 4BDHA 2HZNA 4GK4A 4QMOA 3COHA 4TYHA 4DBNA 4RIXA 4X21A 3U8WA 3GQLA 1J1CA 2OIBA 2Z8CA 5HE1A 1FPUA 3UQFA 3NUAA 4KS8A 2GSFA 1AGWA 5DBXA 4PP9A 4IAAA 4AT3A 1K2PA 2XEZA 3R01A 2E9NA 3ZDIA 5EQPA 5EYMA 2WTKB 5F95A 3MY0A 5GZ8A 5AP2A 2B4SB 3NX8A 3Q96A 3V5LA 2PZYA 5JSMA 2BKZA 2YABA 1M7QA 4QYGA 2QD9A 2YN8A 3VF8A 3PVBA 5D11A 3VBTA 4ALWA 3NR9A 1A9UA 1R1WA 4L6QA 2J0KA 3BEAA 3CP9A 5F20A 4CT1A 3A7JA 3R7UA 4DINA 5JRSA 3D9VA 1XWSA 2W1GA 2WAJA 2OKRA 3I6WA 3PE1A 5KMMA 5EM7A 2QG7A 1XBBA 4HYHA 4AGWA 1ZYJA 4D2RA 3DKGA 5AV0A 1ZOGA 4PL5A 4WD5A 2IG7A 1YDTE 2BFYA 2VNYA 3VF9A 3CTQA 3LFEA 4LOPA 4NM3A 4O4EA 3IS5A 3T8OA 4KIKA 2WMSA 3F5XA 4EOOA 5DLSA 5HX6A 3I5NA 5JFSA 3VUIA 2YDKA 4DF3A 2OGVA 2F7ZE 2YDJA 2V55A 1Q5KA 4YSJA 2YLEA 4BWKA 4RVKA 3TZ7A 4HZSA 4MQ2A 2RF9A 2GPHA 4CSVA 4DH5A 4J1RA 3VONA 2C0TA 3R00A 5TKDA 4AN3A 2B9JA 1S9JA 3V5WA 2VTSA 3KRWA 4IM3A 3KMMA 4FKGA 1FGKA 4J99A 5J5TA 3TYKA 4IAIA 4FG8A 1G8JA 3O7LD 4BTFA 5L6WL 4MQ1A 2OFUA 5C1QB 2VWUA 4X2JA 1CKIA 3HMIA 4P5ZA 4AG8A 5FXSA 3CIKA 4H3BA 3GGFA 4EH3A 1ST0A 3BKBA 5EW9A 4G6NA 4D2PA 5IEYA 4YLKA 4AGCA 5JGDA 4EJNA 2WEIA 3UYTA 3RAIA 3FHIA 3DU8A 3NNVA 3JPVA 3RI1A 4WBOA 2PVYA 4AFJA 3UODA 3AGLA 4UN0C 1Q8ZA 3GU6A 3FLNC 3IOPA 4N70A 3BE9A 4RLLA 3ZEPA 4EBWA 2Y6MA 3VVHA 1YXUA 4FV1A 4MWIA 3TV6A 4E8AA 1W82A 3WZEA 3LM5A 4E7WA 1O6LA 4XV9A 2UZOA 3BE2A 4CLJA 3PDTA 5E8XA 3OCGA 5HZNA 3WOWA 4Y5QA 3MH3A 3UMWA 1PXLA 3FMKA 5KBQA 1OL2A 2PVNA 5I9VA 2OJIA 3FZSA 3PXRA 4U3ZA 4QP1A 5EM5A 4D5KA 1OVEA 3NMUF 4U42A 2WEVA 4AOIA 2WTJA 2XEYA 5CEIA 5HU3A 3PJCA 4EH4A 5ETAA 4W4YA 2QR7A 1VYZA 3FZ1A 3B2TA 5IA4A 3UDZA 2QONA 3MBLA 2YZAA 3E93A 5FBNC 2OH0E 3S95A 5M4IA 3FV8A 4BICA 3LMGA 1YOJA 3PZHA 5AP5A 2FGIA 1GNGA 4C34A 2OXXA 4QNYA 5DVRA 3QX4A 4QMMA 4RWLA 1P4OA 4DAWA 2PVJA 4FZAB 4GS6A 2OF4A 5BUJA 1CKJA 3DGKA 2PSQA 2PVHA 3KULB 1JSTA 5JH6A 4FKIA 3ETAA 4M68A 4JS8A 3JXWA 4GFOA 3TXOA 4FTTA 3ZXTA 3O8TA 2X81A 3PE2A 5IA3A 4H58A 2IPXA 3VUDA 2E9UA 5C8KA 2W1FA 4RSSA 5DT0A 3T3VA 1KE8A 5E90A 5FWKK 1XBAA 3BU3A 4XV1A 2XANA 4NKAA 4CFMA 5LJJA 3QFVA 1UU7A 2XNOA 2AEGA 4CFUA 4QMYA 3A7HA 2IEWA 2XCKA 2JAMA 4D1ZA 4GKHA 4O7RA 1Q62A 5ITAA 4ANNA 4GU6A 5C03A 2YISA 5K0XA 5IQAA 4M15A 2JITA 3MGYA 3QBNA 3NSZA 2BDWA 2W1ZA 2W1IA 4CMTA 1WVYA 2IF8A 5HESA 3V8WA 3ANRA 4FV2A 2XARA 1REJA 5EQYA 4IW0A 4AXFA 4HCTA 3MB7A 2VV9A 2XRWA 3LCDA 3AKKA 2Y4PA 4QP4A 5KZ0A 4TPTA 3AKLA 3CCNA 3R8VA 4Z55A 1YW2A 4BDDA 5GZ9A 4FKUA 3SD0A 3QQLA 3RAWA 3L9LA 2C68A 3FLSA 4JDHA 4ZTRA 3W32A 4CG8A 3BYOA 3G9LX 2R4BA 4RC3A 3V3VA 4AT5A 4C37A 4CTCA 4I6BA 5CZIA 2R2PA 5CSWA 3TV4A 4BDAA 4C3PA 4RLKA 4JBVA 4C4HA 3I6UA 3I81A 5M08A 3QD4A 4PDPA 2VUWA 4EZ3A 4IXPA 1OKYA 4L46A 4RJ6A 4C4JA 3HKOA 3LJ2A 4FEUA 3AMYA 4TYHB 3SA0A 4FEQA 4FBXA 4O0SA 3LFQA 4BDFA 1G8SA 1L3RE 1G8KA 1WBPA 3RPRA 4K11A 4B4LA 3C4CA 4W8DA 3C4WA 3HGKA 2GHMA 3P86A 2QOKA 4GJ3A 4N6YA 4TZRA 5D12A 4LV8A 3ZEWA 5K3YA 3QTZA 4ONAA 4XEYA 3DPKA 2Z7RA 2IO6A 4HVIA 3Q53A 4E6CA 1OUKA 2BVAA 4GUEA 3N4TA 4O6LA 3RNYA 4DT8A 5HU9A 2CN5A 3RP9A 4DGNA 1U54B 3H3CA 3NNUA 5LCJA 2VTPA 2GQRA 3NCGA 1URCA 3QD0A 1Q3WA 2Q0BA 2FSTX 5LVLA 2OIDA 2WU6A 4F1TA 5IA5A 2O0UA 1VR2A 4M84A 1J7IA 4GL9A 4V04A 5EM6A 5H2UA 3BGPA 2XM9A 3HLLA 4IANA 3UQGA 3PP0A 3OS3A 4I41A 4F9BA 1RE8A 3MS9A 3BQCA 3DK3A 4UALA 5AUVA 4DLJA 4FZDB 4BBMA 2O64A 3PY1A 3NW6A 5FDPA 3PTGA 4W9XA 3PWDA 3R7GA 3R9HA 4PMMA 2X2KA 3BGQA 4ACHA 2QKRA 3GB2A 3UP7A 1G8AA 3EQPA 1H1WA 1E9HA 4EK6A 3FXWA 2BR1A 4OTWA 4U3YA 4BDKA 2BZHB 4KKEA 4FV5A 3NWWA 4QNAA 4ANOA 4CG9A 4YJQA 4BZNA 2IZUA 2BALA 4AN9A 1PMEA 5C27A 3FLWA 5IZFA 5EOLA 4FNWA 4BCJA 3FKNA 4RC4A 3CQWA 3R30A 4JI9A 1ZY4A 5HO6A 3WYYA 4BDIA 5CEMA 3GOKA 4FSYA 5M4UA 5DR9A 1XH8A 4AA4A 4JG7A 4Y5HA 3QRUA 4H05A 4MXXA 4FKLA 3AQVA 3PJ8A 4V01A 3ACJA 4BDJA 4LG4A 2YM8A 5CU6A 4WO5A 4XCUA 4CCUA 3LLAA 3GXLA 3NUXA 5D9HA 3AMBA 3I0OA 5JEBA 2A0CX 3KIOC 2JIVA 4BBFA 5KHWA 3LMIA 3AOXA 1SVEA 2R7BA 3E3BX 1O6YA 4GK3A 3U87A 3O17A 5AP3A 5ICPA 1ZRZA 2BRMA 4JVGA 4D4YA 2FYSA 2XVDA 2PPQA 4RWKA 4I0RA 5AWMA 2VWXA 3UPZA 4O86A 4M3QA 3UJGA 3MW1A 4FV7A 4U41A 4XBRA 4V0GA 1HCKA 4GKIA 2VWWA 4FG7A 5AADA 2JDOA 1O6KA 2V7AA 5HNGA 4ASDA 2XMYA 4F08A 2Z2WA 4G16A 3KCFA 4QTAA 2VTTA 2IW8A 5JQ5A 5J9YA 4UB7A 2YAKA 4ALUA 2VZ6A 1XMLA 2Y4IC 4MNFA 4Z7GA 4YR8A 3ZMMA 4QDVA 1ZLTA 3R83A 5DT4A 3QHWA 2QOIA 4QPMA 4L45A 5ETFA 4IVBA 4OW8A 4IJ9A 3IQ7A 4R7BA 3F3TA 1Y8YA 4DCEA 4MXCA 5HBJA 3GCPA 2PMIA 3ZDUA 4MYGA 2ITVA 2C5NA 3DZOA 4LMUA 4XUFA 3MI9A 3PY0A 1DAWA 4DFLA 5LWMA 3DB8A 2CNVA 4CNHA 4NW6A 4C4FA 4I21A 3F66A 1YOLA 2OZAA 2YCFA 1KE5A 4JQ7A 4FR4A 3O8PA 3BLRA 3MIAA 1TQIA 4ZTSA 5C4KA 5H8GA 4IZ5A 4R3RA 4KIPA 2C6IA 3EQHA 3MY1A 4HGTA 3R8UA 4KABA 1I09A 4IX4A 3FKLA 4YSMA 5D10A 2WTIA 4QMXA 4YTFA 2WZJA 4LGDA 3QGWA 3E7OA 3O8UA 4BIBA 4J71A 5BVKA 4GUBA 4IB5A 4IVAA 4YZNA 4LRMA 4FV8A 3HV4A 2XNMA 2WTDA 1M17A 1FMKA 3F2AA 2BPMA 5I5ZA 1KV2A 5L4QA 4QP7A 4BCMA 5IUGA 2YM6A 4FIEA 3OROA 2VX0A 5DT3A 3R1NA 5EKOA 2JIIA 1M14A 4XJ0A 3O51A 4X2KA 4U5JA 3QRJA 2JKMA 3DFAA 3F82A 4FKSA 2HOGA 5H9BA 2HXLA 4U6RA 3PFQA 1NT2A 2YAAA 4UZDA 4FZFB 4WG3A 3G0FA 3DQXA 4M97A 4OAVB 3SGCA 4IE9A 1OPJA 3EQIA 3VAPA 4EHGA 1YHWA 3V01A 4RIYB 2YJSA 5A14A 3PVWA 5J1WA 4PNKA 3D5XA 5L6PA 2EVAA 1FOTA 1UU3A 4FT3A 4PNIA 4O0YA 5AP1A 3MJ1A 3L1SA 1RW8A 3Q04A 5FTGA 3QZGA 4K18A 3GOPA 3TKHA 2X2LA 4EKLA 2UZNA 3R7EA 2J0IA 3EQRA 1GIIA 3S4QA 4EH9A 3NW5A 3AG9A 2PE0A 3C4ZA 3KXHA 5CSXA 3SOAA 3ZUUA 4GG5A 4U81A 4O0VA 4YHFA 4C61A 4G6OA 1Y6AA 2GCDA 5E8YA 4O0RA 3ULIA 4Z9LA 4CKRA 2JFLA 3BL7A 4EONA 1LP4A 1NW1A 4AW1A 3HP5A 4FV3A 3MFSA 4IAKA 3TNWA 2VGOA 5IDNA 3OUKA 2CCHA 1SVGA 3QTSA 4P2KA 5IEXA 5FEDA 4WBBB 4TTHB 1KE6A 3ZRMA 2WIHA 5DYJA 2C6MA 4BCGA 4BVUA 2OK1A 3T9TA 5KKRC 4F64A 5EI8A 3VW6A 5CZHA 4CQEA 1QL6A 1A06A 4RJ8A 3L9PA 5LVOA 4DFUA 1KOAA 4PY1A 4YNOA 5HLPA 4D0WA 2W1CA 4C02A 2WMAA 3OXTA 5D7AA 4DDGA 2ACXA 3LIJA 2IN6A 3HV6A 2PUIA 2R3FA 5CT7A 2VTOA 3IW7A 3BHVA 5CSPA 2C5XA 2F4JA 5T3QA 4FTNA 1OIQA 3QA0A 3ML1A 4AQKA 1URWA 2CGUA 3UIUA 2QOLA 2BCJA 5EDPA 5I0BA 3LFDA 1ZWSA 4TY1A 5B7VA 4FODA 4AAYA 2NP8A 3FY2A 5FM2A 3PIZA 2WU7A 3PG3A 4E3CA 3TZMA 4TXCA 1ZZ2A 1BKXA 1AQ1A 3LFNA 1GAGA 4GW8A 3H30A 3JVRA 3LXKA 4O1PA 4QQJA 3DDQA 3DXNA 2Y9QA 3ORIA 3FJQE 4JBQA 5B2LA 1IASA 3P5KA 3LJ0A 3Q3BA 4AQCA 4OTHA 3E7VA 2DS1A 3IONA 3BL9A 2AC3A 4R5SA 3R9DA 2QHMA 5A6OA 4DGGA 3LFAA 5D41A 3QTUA 3NIZA 3KU2A 4O38A 1H1RA 5IH5A 4DTKA 3TKUA 1OPKA 2ONLC 1PF8A 1CSNA 3O96A 3QZHA 3GU5A 4MXYA 3W0OA 4UV0A 3VUTA 2Z7QA 3ZUVA 2XNEA 3QXPA 3LMHA 4EC8A 2EXMA 2X8IA 2W5HA 2UZTA 2PTKA 3CGOA 1YDRE 4LM5A 4AE6A 4IIRA 5EYCA 1WBVA 3II5A 4LI5A 3KEXA 3GT8A 5EYDA 4GRBA 2E9VA 5J8IA 4BCFA 5HLNA 4FX3A 1YI6A 1ZXEA 3Q60A 4I6FA 3QTRA 2YM4A 4UZHA 2BZJA 4C7TA 3CE3A 5EI6A 2G01A 3LCKA 4TNBA 3DQWA 3PXKA 4YJPA 2OW3A 3GNIB 3L8PA 4K77A 5A9UA 3OC1A 1Q41A 4I0SA 4O0WA 3UVPA 4EH2A 4Z3VA 2CKPA 2RL5A 1JKLA 3TI1A 4PMPA 4OT5A 4CYIA 3DXPA 3R1SA 4XRLA 4AT4A 3F6XA 1J91A 1E1XA 3LFSA 1JVPP 5FRIA 4C4IA 5LVNA 1J7LA 4S30A 3O2MA 4D2VA 2UW6A 2WQEA 4J53A 4C3FA 4R7HA 5C9CA 3OBJA 2BILB 3PA3A 2WOUA 4OTGA 4PMSA 2GQGA 4NM0A 1AD5A 4DBXA 5HIBA 4JRNA 3QA8A 4EKKA 2VTAA 3F3UA 1XH4A 2CKEA 2JAVA 3A61A 3NNXA 4GT5A 2E9PA 2ZYBA 2XAOA 2HZ0A 4CKJA 5IQCA 2XRUA 3ZRLA 3NFGB 4CYJA 4DFZE 3KKVA 4QT1A 3AD4A 3FI4A 3EFKA 3MH1A 4O0XA 5EHYA 2PZIA 5TF9A 3FHRA 4GEOA 3GCQA 3CEKA 3HRBA 5E4HA 4RJ7A 3HUCA 4AXEA 2PZRA 5HBHA 3HRFA 2QOOA 3QWKA 3F69A 2E2BA 2XIXA 3FYJX 4KBKA 4LUDA 3FXZA 4APCA 5TT7A 3PFYA 2QOFA 2BIKB 3QYZA 3OD6X 3QC4A 4J97A 3LOKA 3UOKA 3ATSA 4PDYA 3F3WA 4F78A 3ORZA 4FJVA 3EN6A 3D0EA 3ROCA 4ITIA 3BYUA 4JG8A 4YTIA 3MPMA 5KUPA 4PQNA 3PA4A 5JZNA 4K9YA 4QQCA 4BCNA 3MPAA 1CKPA 2PL0A 2QO7A 4HZRA 2VU3A 5AM6A 3L8SA 3W2PA 4I20A 5J87A 3WIGA 1XH5A 4QYHA 4ACMA 5BUEA 3TM0A 2WQBA 2C30A 2Y4IB 2ZFYA 3M1SA 3TIYA 4CRLA 1YXTA 2DYLA 5IQGA 4GCJA 3ULZA 4IAZA 4MF1A 2JKKA 4HYSA 4BI1A 4JRVA 4LOOA 4C2WA 2WTVA 5M4CA 3UZRA 3GENA 3BWFA 3UTOA 2XKCA 3ACKA 3ZSGA 2XJ2A 4BHZA 4QQTA 3TDVA 4Y95A 2P0CA 4C35A 3C4XA 2B52A 2ITYA 2ZM1A 3VW8A 4FC0A 1ERKA 2YERA 3EKNA 5DG5A 5HKMA 3S2PA 2PUNA 5AAEA 3R22A 4HGLA 4IHPA 1V0BA 5HIEA 3B8RA 3S3IA 4DEBA 2XH5A 4R1YA 4BGQA 4RQKA 4HVDA 3ZZEA 4E5WA 3QC9A 2C3IB 4CRSA 3MIYA 4WNKA 2HZIA 3AC2A 1SYKA 2CMWA 4S31A 3OHTA 3JUHA 1JAMA 5L6OA 5CEPA 1YWRA 4IM2A 3H0YA 2W9FB 4LGGA 1FQ1B 1FBNA 1ZYSA 3EOCA 5DWRA 4YJRA 4YZ9A 3ROYA 2JDSA 2WFYA 3UC3A 1JBPE 3QALE 3EN4A 2OSCA 2YM5A 1PXIA 3QCSA 4QRCA 3W2CA 2B55A 4FVPA 4HGEA 3UC4A 5EYKA 2HXQA 2QOHA 4KWPA 4DG0E 2RKUA 1OECA 2UVYA 3DS6A 4GVAA 1KOBA 3TZ9A 2OBJA 2VWVA 2J5FA 3ORKA 4QMVA 5I3RA 2R64A 2XAMA 1CM8A 1JPAA 3FLZA 3G33A 3SX9A 4JOAA 2BZIB 4JT3A 4E26A 5EFQA 4O7WA 4EOQA 3P08A 2DQ7X 2HYYA 3NAXA 4RMZA 5IQIA 5KZIA 4EI4A 1H25A 4YJVA 4DCAA 1XH6A 3OT8A 3CR0A 3BX5A 5C8NA 4KRDA 4RZWA 5L2QA 3W8QA 2XKFA 3FI2A 3GU4A 1U59A 3NAYA 4I22A 4AP7A 2BRNA 3R1QA 3K2LA 4N0SA 1G3NA 4JBOA 3VBXA 3NUPA 4ITHA 4BTKA 5JK3A 3SG8A 4D4RA 4AFEA 4FV6A 2ZV9A 3D14A 1XH9A 2O8YA 3MTFA 5DH3A 3V04A 2CNUA 5EM8A 4YZBA 2C6DA 4EOKA 2GQSA 4FEXA 5F4NA 2FUMA 1MRYA 5C4LA 3HRCA 1U54A 4I5HA 4X2NA 3JY0A 4RX5A 3UDSA 2XBAA 1JQHA 5CU2A 3B2WA 5FP5A 2V62A 3QQGA 1PHKA 3PPZA 3R04A 4OT6A 3D7TA 5CENA 4BWPA 5CF6A 1PXKA 4AXAA 3F3ZA 1GZ8A 1YVJA 5KKRB 2ZB0A 3F7WA 3PIYA 5AX3A 3SXFA 2XB7A 4GFMA 1NXKA 2RGPA 4AZWA 2XP2A 4IZAA 4O27B 3PLSA 1J1BA 4X3FC 1WBTA 1UU8A 4F9CA 3UNZA 4WIHA 2IZRA 3QZIA 3OY3A 4C57A 2GNIA 2XYNA 2GMXA 3R9OA 5A6NA 4WUAA 2BMCA 3LCTA 5CF8A 1YQJA 3DNDA 2VX3A 2C69A 2VWBA 3F5PA 3MVLA 4AGUA 2PVFA 4FV9A 4JBPA 3ZCLA 2IWIA 4QDEA 4C2VA 1DS5A 3RCJA 4D9TA 4I6QA 3UQCA 3E63A 3MVJA 5GIOE 3NUUA 3DY7A 3EH9A 3L9NA 4AUAA 5L3AA 3MB6A 4Q9SA 4NU1A 4R78A 2BAKA 2C47A 3K5UA 4O0UA 3W55A 3ZS5A 2HELA 4AZVA 1UNLA 3QXOA 2W1DA 2JC6A 3LJ1A 4MF0A 4DC2A 5KHXA 1DM2A 3P7AA 2F2UA 2I0EA 2R3PA 3PJ2A 3E64A 2AYPA 4O91A 4OUCA 4EH8A 3TDWA 3QLGA 3F2RA 2IVUA 1NA7A 3DDPA 3ZM4A 3CTHA 2KTYA 3BYMA 3S00A 4TWNA 1UKIA 1WVWA 3BI6A 3P7BA 5TR6A 4B6LA 1OUYA 2FA2A 1IA8A 3QWJA 4F7LA 2HY0A 4FIGA 4YUQA 5M51A 4CT2A 5FLFA 1UWJA 2XBJA 3O7LB 3THBA 4F9WA 3LXLA 3LXNA 4H1MA 4ZXTA 4BCQA 2O63A 5B0XA 5A46A 4BIDA 3MVHA 3GEQA 4XX9A 3UDTA 3IPHA 3CQEA 2J4ZA 4XG6A 5FBOA 2R0IA 4BGHA 5IQBA 3DA6A 3G6HA 2PHKA 2UUEA 3PRFA 4KBAA 5DNRA 5AUTA 4NYEA