5IUJC

Crystal structure of the desk-desr complex in the phosphotransfer state with low mg2+ (20 mm)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
131
structure length
131
Chain Sequence
MISIFIAEDQQMLLGALGSLLNLEDDMEVVGKGTTGQDAVDFVKKRQPDVCIMDIEMPGKTGLEAAEELKDTGCKIIILTTFARPGYFQRAIKAGVKGYLLKDSPSEELANAIRSVMNGKRIYAPELMEDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Regulation of signaling directionality revealed by 3D snapshots of a kinase:regulator complex in action.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords Sensor histidine kinase DesK
total genus 41
structure length 131
sequence length 131
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5iujC00
1LBIA 1XHEA 5DGCA 2GI4A 1DRJA 3C6QA 4RSMA 1Z17A 5DKFA 4XFKA 1RZRD 1LK0A 2E4UA 1DBWA 3KKEA 1MAVA 3RVLA 4YCSA 4KNYA 1ZITA 1A2OA 3FFXA 3F6CA 4QYMA 4OG2A 1A0OA 3LUGA 3OLWA 1QP4A 2M98A 3NNDA 4F3TA 3P9YA 4MS1B 2FMIA 2WWVD 4YWHA 5TQ0B 5JNSA 1PHRA 1Z26A 2JCGA 3HDVA 3E61A 3T8YA 1D4ZA 4RKRA 3EJWA 4KK4A 1GUBA 2PUDA 1BVHA 3H5VA 3RVKA 1USKA 3H6GA 2L19A 2F8TA 3ROTA 3BILA 3QLVC 1GLGA 2BGGA 5BR1A 3RVPA 4N0QA 4YRZA 1VKRA 3HK2A 4G86A 3VNAA 3GL9A 4IMIB 4EYOA 3EQ2A 5CNMA 1BA2A 5ABPA 1DCKA 2CHFA 6ABPA 1FSPA 3D02A 2LPMA 4Z4IA 4LRQA 4RK5A 3I45A 3M9WA 1EWTA 3SQNA 4OTZA 4RK4A 1APBA 3QLUC 3RVQA 3CZ5A 2PUBA 1NXPA 1URPA 2HPHA 4MGEA 5JNUA 1ZH4A 2FTKE 3JPWA 3T6KA 4HNSA 3RVJA 3LKBA 1A04A 3IDOA 3NBMA 4W5NA 2GBPA 3LUFA 1E6LA 4UHJA 3CKMA 3H5LA 2FEPA 2B1JA 4G0QA 4LDZA 4KPYA 4MS3A 5TQ2B 2HQBA 3TB6A 2LUOA 4WZZA 3QLVA 5BRAA 4CBVA 3GWGA 5D2CA 2FQWA 2NZVG 3KHTA 1ZVVA 3A0UA 1E6MA 4ZYLA 5JNVA 1E2BA 5CNJA 3EDCA 5HSGA 1GCGA 4Z9AA 3CTPA 2FW0A 4IRXA 3CU5A 5IBQA 1LJLA 1QQBA 3RVOA 1USIA 3D8UA 4NQRA 3HUTA 2LIVA 4MLDA 9ABPA 5I4CA 1U2QA 3O21A 1ISSA 4JAVC 1F51E 1NXTA 3MIZA 3LUAA 4N03A 1ABEA 3M6MD 3N75A 1QPZA 3ILYA 4HYEA 5F64A 2YHAA 3B2NA 4TN5A 2MSLA 4RDCA 4RY0A 1M5UA 3TMYA 4MLCA 3M9XA 4RZSA 3IP9A 2QR3A 1KGSA 3O2SB 4JB0A 5TE9A 3GV0A 5JS1A 4MQFA 4NCBA 1IIBA 2H3HA 2X7XA 2E4VA 3NHMA 4JASB 1FFGA 1JFTA 2IDMA 1JFSA 3LUJA 4G97A 4P98A 2JBAA 5FWXB 1TVMA 4RU1A 3IP6A 1L5YA 2YHBA 3TO5A 1AB5A 3OQOA 5FBKA 2PUCA 1C0EA 1QKKA 1Z12A 2PUEA 1PNTA 1GUDA 1P2FA 4OBBA 1ZN2A 4P1ZA 4MS4B 1D2AA 4FE7A 3JTEA 4LE0A 1EAYA 4D6XA 5IUNC 1QP7A 4YP9A 3KG2A 4RK6A 3N6VA 3Q7SA 3I09A 5IX8A 4KFCA 4RXTA 3HEBA 4Q6WA 5IUKC 1ZGZA 2FMHA 3DLHA 3I42A 1SD5A 3KJXA 3Q7TA 3OQMA 2CWDA 1JDNA 4E7OA 2TMYA 3DBIA 2HQOA 1QNLA 3VNBA 1S8NA 2MYTA 3KCNA 5TQ0A 4EYKA 2FSPA 1K68A 4DADA 1JBEA 4G0OA 2HSGA 4WWHA 2F8SA 1NXXA 4YV7A 4MR9B 1FFSA 3T95A 4Y9TA 4W5OA 3NNSA 2FN8A 1TJYA 1R8JA 4XAQA 1DCFA 5CHYA 3O2JA 4IMJB 3O1HB 4KREA 3F73A 4KVFA 1QO0D 4EVSA 3QK7A 1SRRA 2PKXA 3DGEC 1D1QA 2NT3A 3IP5A 3EGCA 4DN6A 1VPWA 1BDJA 3RQIA 4KQ9A 4WT7A 2VUHB 4KMRA 3GBVA 5T3YA 4JB2A 2WMYA 6CHYA 1ABFA 2IPNA 1JFVA 2L2QA 1QO0A 3N0WA 1NATA 2L17A 3MYYA 5CNKA 1P8AA 1YS7A 1WETA 1KMIY 2FMFA 3OLVA 4O1HA 4UHKA 5JS2A 4Z4GA 4Z4FA 3QX9A 2QSJA 3TD9A 3KLOA 3KS9A 4RKQA 2QW1A 2A9RA 3MQ4A 4L85A 4MQEA 5KQPA 4GPAA 4NCAA 1L5ZA 2FQXA 1ISRA 2Q5CA 1JYEA 4HNQA 4RY8A 1VRVA 3ILHA 3C3KA 5B3JC 4G0ZA 2ZAYA 4LE1A 4O1IA 1NXSA 3HVRA 2O20A 5HQJA 3TX6A 4F06A 4XASA 1GCAA 1DP4A 2A9OA 3Q15C 4RK0A 3MM4A 5KQGA 2KYRA 3CFYA 1PEAA 3L49A 2JBAB 2PLNA 1SXHA 2PAFA 4YO7A 5DLEA 1LJUA 2JK1A 3HV2A 5FWXA 3SAJA 4NICA 4QICA 3S99A 3W9SA 2LP4Y 2RGYA 1SXIA 1JX6A 1RXIA 1TMYA 5E3JA 5ED4A 4EVQA 1EHCA 3RVMA 3QELA 4WXEA 4O5AA 4G0MA 4Z99A 4QYWA 3A0RB 4ZMSA 5HKOA 1JH9A 1QP0A 4YR7A 2WJWA 2WJAA 3Q41A 2L18A 3H1GA 1TM2A 2R4QA 2PMCA 3C3MA 3BBLA 4MQEB 4PE5B 1TLFA 4Z0NA 4EUKA 2QV0A 1DBQA 2PL1A 2VYCA 3LUDA 4FE4A 4LZLA 5EWLB 3LMKA 5C5EA 1JF8A 1NXWA 2MYNA 2FQYA 2HQRA 3KYIB 4Z4EA 1LBHA 5FBHA 2GKGA 1MB3A 3FDFA 4XXHA 1EWVA 3SG0A 4MR9A 4OLAA 3HO1A 3URMA 3HZHA 3OMXA 3HUUA 3CG4A 4Z9BA 4IGAA 3SNKA 4YGXB 1DC8A 5BRJA 4E7PA 3BRQA 4RXMA 4TMYA 2H0AA 2IYNA 3H5IA 3MF4A 4L4UA 4M88A 4EYQA 1M2EA 1PEYA 1J56A 2FKAA 2OENG 3IPAA 4ZMRA 1BAPA 1B00A 4PICA 4ETNA 3OLXA 1NXOA 3N8IA 2NT4A 4MR7A 5B3JA 4N41A 3LUHA 1RPJA 4LX8A 2N9UA 3CS3A 2VUIB 3LUKA 4NV3A 4D74A 5T7BA 4ZPJA 3RH0A 2J48A 1Y1LA 4LE2A 2RJNA 1E6KA 2IPLA 3GRCA 2A9PA 4Q7EA 5EWMB 3ROFA 4MR7B 2E4YA 2E4WA 2R47A 3CHYA 2CHEA 4Q6BA 1XWWA 4G0YA 4MR8A 3Q7RA 3K4HA 1VLZA 3UK0A 4IF4A 3LKVA 5KWSA 2PL9A 3L6UA 1U04A 2A9QA 8ABPA 1YK0A 2FMKA 2RJOA 4F12A 1U0SY 1XHFA 2QXYA 1RXEA 5PNTA 1ZDMA 1W25A 4EYGA 3N0XA 1SXGA 1YVUA 2R25B 4WUTA 4MS3B 5TQ2A 2XDYA 1AB6A 1USGA 3C3WA 2NZUG 3QLUA 2DRIA 2FEWB 1JHZA 2R48A 4JP1A 4KK3A 5FWYB 4TLLB 3JPYA 2V0NA 3EULA 4TLMB 3H1FA 1H9CA 2JVJA 4F11A 2P9HA 1RNLA 5IULC 2FLWA 3IPCA 5KC9A 2MYUA 4MS1A 3O74A 1YK1A 3E3MA 5C5CA 1YTUA 3QLTA 4H60A 3OM0A 1YIOA 2QVCA 1FQWA 7ABPA 2FN9A 3H1EA 3HSYA 3O75A 1Z2EA 3GA5A 1YMUA 4KRFA 1BDHA 3OMWA 2JVIA 1NY5A 2QZJA 3KSMA 2GX6A 3OO1A 2P4UA 5EWMA 1JWLA 3IP7A 2FLKA 4G0PA 2RDMA 1QMPA 3GT7A 4EGSA 4RWEA 1M5TA 2IPAB 3FGZA 3LOPA 2MYPA 4MAAA 4ETMA 1ZH2A 3JS5A 3H6HA 4MPTA 4EY3A 5TPZD 1F4VA 1PUXA 4B09A 1ZESA 1KRXA 5JNRA 1JLKA 1DCMA 2JRLA 1JDPA 2HJ9A 4ZJPA 1ZAYA 1KRWA 2E4ZA 4IILA 3RVSA 3O1JC 5JNTA 2ID9A 4JOQA 4RY9A 1JYFA 1Z2DA 4FB4A 4Z4HA 2W42A 5GQSA 1DBPA 1T34A 3H5TA 3SY8A 5KQMA 5TPZA 4DQDA 3BREA 4QPJC 3FFTA 1ZHHA 2FEKA 3H5WA 3SM9A 4OATA 5DTEA 2CD7A 3FMVA 4JA2A 4RV5A 5TPWA 3LTEA 5TQJA 4W5RA 3CLKA 3CG0A 5KQLA 3A3KA 3OLZA 3N53A 3HM9A 4ML3A 4S04A 1Z16A 2E4XA 4XARA 4KV7A 3GBPA 4MQFB 1JL3A 5HM6A 2WB4A 4XLTA 5EWLA 3O1IC 3R0JA 2NUBA 3HJFA 3K9CA 2PUAA 3JVDA 4RS3A 1NTRA 5DCLA 4S05A 2FVYA 1PNRA 1DRKA 1FFWA 2AYXA 3DZDA 1OXBB 3HDGA 3QX8A 4LDAA 1HEYA 4PYRA 4WXMA 1DG9A 1U8TA 3CNBA 5IEBA 3CRNA 4N0PA 1K66A 1Z25A 3QEKA 4MS4A 4OLBA 3Q9SA 3OO0A 2FXIA 2QVGA 4PEVA 3T38A 1U2PA 3JY6A 4N76A 4Z4CA 3EAFA 2GWRA 3O2QB 5FWYA 3N0RA 3HXMA 2PUGA 4MRMA 3C97A 3DGFC 5IEJA 3JVIA 1EWKA 1DZ3A 4GNRA 1Z13A 4YLEA 5CNIA 1W9HA 2MSKA 1YS6A 2MSWA 2IKSA 4MRMB 1C4WA 1MB0A 2PJUA 3G1WA 1OXKB 3MA0A 4N47A 4EVRA 2LBPA 2JVKA 4H3HB 4F8JA 3HS3A 1D1PA 4W5QA 2JB9A 4PZ0A 2ZWMA 1EFAA 5KC8A 3KYJB 3OM1A 2I6FA 3QEMA 2VK2A 2IPMA 1CHNA 2WRZA 3BRSA 3FFWA 1MVOA 4W5TA 2PE5A 3F7NA 4ETIA 5BQ3A 3NHZA 1P6QA 4YS6A 5TPWB 3MMNA 1DC7A 4RXUA 2IOYA 3KTOA 5IUJC 2ID7A 3LUCA 5JNWA 1MIHA 2OQRA 1NXVA 5EWJB 3HCWA 1P6UA 3GYBA 4D6YA 3EODA 3RVNA 2WY2D 1M2FA 2AYZA 5GOTA 1I3CA 1QQAA 2B4AA 3NNNA 4KZKA 3I5AA 3OLYA 3UKJA 5EWJA 3OQNA 5IC5A 3G85A 2QU7A 3EQZA 4RK1A 1ZY2A 5KI6A 1BDIA 1DJMA 1CEYA 2M1ZA 4MYRA 3DLBA 1ZGGA 1RZRA 1YMVA 3A10A 3KLNA 4G0XA 4MR8B 4RK7A 1Z15A 3RVRA 3H75A 4HNRA 3H5OA 2PUFA 3UUGA 4KQCA 1Z18A 1D5WA 3F6PA 4H3KB 3CZCA 1CYEA 3LFTA 3QELB 3QEMB 1UDRA
chains in the Genus database with same CATH superfamily
1HTTA 3LVFO 5DGCA 4U3JB 1Z0FA 1GPNA 4OGFA 4EYEA 1IEVA 1OZ0A 3GDHA 3WNDA 1CDEA 4QOJA 3KKEA 1DBWA 3T41A 3WDKA 4MJ3A 4KE7A 2EKZA 5D5HA 5CDFE 4EHDA 1ADBA 3F6CA 3OIWA 4C4XA 4UE3S 3UW1A 4YJDA 3HSKA 3MJEA 3DZJA 5DWVA 2PNJA 1Q57A 2XJ4A 4UFOA 2ZRKA 5CVCA 1MBZA 2X1MA 2WDPA 4HN9A 4UHHA 3GN1A 4YT4A 3FH0A 5G2OA 2CLOB 2JHAA 2XUZA 3RK1A 2I7TA 1NFRA 1M0TA 1AUPA 2RK6A 2OILA 3RVKA 1USKA 2KBFA 4HFRA 3IT3A 3X1MA 2ZDHA 3LZDA 4MHOA 2H4HA 5IYZB 1JB9A 1QPBA 2WJVA 2ZJ0A 5AIBA 3EOAI 2X3FA 4KQMA 4UM8B 3L6BA 5M7EA 1MA0A 1GL3A 1ZJYA 1S3SA 3G9UA 3AUAA 3HB9A 4LRUA 1T15A 3LDHA 4US2R 3WWDA 1KAGA 3P9CA 4UM9B 1QK4A 5DVZA 4Z4IA 3W78A 3C3BA 2OBLA 4ENVA 5JCOC 1WZEA 3LGSA 3SQNA 3DEIA 1IZ7A 4LF5B 4H7HA 2WOJA 3W04A 2JNWA 1APBA 1W0KA 1XZ8A 2EFJA 3U1BA 3OCYA 3ETCA 3V8PA 2I4OA 4WY2A 2ECKA 2LDXA 2PH5A 4C2AA 1IZ8A 3AO0B 3Q3JB 3K0FB 3B52X 1FXWA 3KETA 5EIXA 2WVGA 3N2GB 4PONA 2VA8A 1IEXA 2ZANA 4MULA 2GBPA 3KZOA 3ONEA 4EJSC 1DLIA 2HJHA 4MUJA 4UHDA 2OXIA 3RABA 1GGVA 3GZJA 1AUQA 2QYTA 2C9DA 2LDBA 2YOFA 3FGOA 1VL0A 4WZZA 5CA1B 3BL6A 2G0TA 5K3EA 1MZPA 4TMTA 3KHTA 2NVUB 2WHXA 2YDXA 4OJYA 2ZUVA 1T9DA 3QQ5A 2H1SA 1OGYA 3E0XA 3ZY4A 1WRBA 3PDHA 2B8WA 3AFHA 2F7SA 5TC4A 4A5SA 2GXSA 2XZOA 3PQEA 4WLFA 4OQLA 1DFIA 5ALVA 3KKOA 1XO1A 1PX0A 4OBXA 1Z7EA 1SULA 3TQTA 3T3OA 1L3BA 1ZWLA 4P80A 2BFBB 3JD0A 5FBZA 3HYTA 1P1CA 1RWMA 3AR5A 1BG6A 2Q3JA 3V4LA 2OD9A 1CDZA 4NABA 4C43A 5FNVB 3MSCA 3HKBB 1MZVA 4ZT7A 3HYLA 2Y0EA 4FGSA 5FO1A 2SCUB 4RDCA 2ZB3A 1TUBA 2HLDD 3HLKA 3M9XA 1XJ0A 4A4DA 3EBPA 3M8KA 2H52A 3F9CA 3NI2A 3W5SA 3BORA 5I7UA 3P2JA 3EG5A 1MENA 3NHMA 4O59O 5CD9A 3UXHA 1DU4A 3BKWA 3R9KA 5KTKA 3L9XA 3X1DA 4KSBA 1JFSA 4MMYB 3EVBA 3D2AA 1IZ9A 4I5EA 2YHUA 3PR1A 3P0JA 2FE4A 2PUVA 2O14A 3FCYA 1C80A 4RPHA 3TO5A 3WISA 4Z9FA 1B8OA 4B46A 3JAWB 4RQAA 1BVYF 3ETEA 1TM5E 4TV9F 4DR4B 2RHHA 3MUOA 2BLLA 1KEZA 4PC1A 4GI3A 1PL0A 2ERCA 2F00A 3AB3A 5KOHB 2V7VA 1BOOA 4DLXA 3OF3A 4OO3A 2XQKA 3EWNA 4FYJA 6NULA 4Q6WA 5JZ9A 5EQFA 1KZGB 4DA6A 2RAPA 4E1VA 4NZPA 4FIDA 3JAMA 4FFPA 4GXTA 4Y6RA 3HQ4O 2RSLA 2HK6A 1WX1A 2PSHA 1NF8A 1P7YA 2EERA 3QPCA 5DI3A 5EKXA 3ZQ6A 2QBYA 5AUNB 2BE9A 4RE6A 1RFLA 2IUSA 2BH9A 3JWPA 2CVFA 3KZVA 4I9HA 1X7WA 2XJ9A 4QNRA 4V24A 4RPIA 3ZEAA 3AUYA 3EFHA 3ELUA 4FQ5A 5IWAB 5TQ0A 2VTVA 4TSRA 3SVTA 4HGNA 1BVUA 1I2ZA 4JGGA 2EU8A 3W06A 1SCAA 4BB0A 3ZW9A 1OW3B 2DHEA 2ZRNA 5DBGA 2N47A 3OOWA 2HSGA 4AMBA 4YV7A 3EAQA 2CV2A 3U7FB 3T95A 3BCUA 1YJAA 3GUUA 4TYPA 1YZNA 1ZBQA 4CI9A 4D57A 1WP4A 4PN3A 4YMUA 1H23A 1XLTA 3GG2A 1LTHR 3NRBA 3O2JA 1E6UA 1MG0A 2ZRDA 1I10A 4KO4S 4MUGA 3VX3A 4KREA 1V26A 3TQIA 5CGQB 2CXHA 3AESA 4CTNA 4CIAA 1PZXA 1D3AA 1H1LB 2Y0CA 1GFSA 2XCOA 1C0PA 4OQFA 1G2IA 1Z47A 3X43A 5KYXB 3CWZA 2JLVA 2RHGB 2VUHB 4U4AA 3AVWA 1NMXA 1HOTA 2H4JA 1ABFA 3IB3A 3GLHB 4MV1A 1W75A 2BKUA 3CLUC 2JH9A 4C6TA 2I91A 2M2IA 2PG3A 3G2IA 4K9RA 2NUTA 4DR7B 4JLMA 4DMKA 1IB0A 3FR7A 2QSJA 1WQ4A 5EY5B 3KLOA 4QULA 4RKQA 2A9RA 4CM4A 1C3EA 2OBMA 4J8PA 1EINA 5CRIA 3TTSA 5FV4A 5BV8A 1GQOA 1KPGA 3E9NA 4IGKA 1GU7A 2Q5CA 4JMLA 3FB4A 3ZV6A 4BKOA 1VCMA 4UTOA 4K6CA 4QKQA 4E12A 3EW7A 4IFTA 4JVLA 1V1RB 3LC0A 5CW1A 4B7CA 5K8TA 5TMEA 1EESA 5KNCA 3I61A 4BMNA 3LOUA 3BMOB 1L7DA 1GTZA 1QGUB 4OLFA 4QUEA 5LOVF 2A67A 2IZ5A 1FFCA 2P35A 2UAGA 2F1OA 3FWHA 4G23A 5AXAA 4PX5A 2BN4A 4C0QC 3G8DA 4KBGA 1TIKA 4D80A 3D31A 1D6SA 3IBYA 2WIDA 2QJWA 3K09C 3MHPA 4QSMA 2K5UA 4Z86A 5GGXA 5FTMA 5F4BA 2PUTA 4TT3D 4DEXA 1QX4A 2ZWIA 3ZKAA 2C98A 1ORTA 2Z04A 2O6HA 3CUSA 3LRXA 4BNUA 3HU3A 2DFDA 4CF5A 5F2EA 1J24A 2O3UA 5G1NA 2C2KA 4OXRA 2QSYA 3AYZB 3PZBA 2HA4A 2F8MA 2VUSA 4YDHB 2V98A 1C4OA 1JEOA 3QVXA 1S7CA 4II2A 1OVGA 5EMLA 1I7DA 1I6WA 2OV2A 4QYSA 3U0VA 1MX9A 2JK0A 4H27A 1GNSA 4PYMA 5DTQA 4Y2JA 1W48A 4WBNA 1O57A 2OZLB 2BH2A 3NVKI 3G0BA 2XDWA 4TMXA 3TL6A 4NBLA 5BUZA 2Q4OA 1O94A 3GJQA 3GT0A 4AMGA 1NVBA 1XZNA 2E7ZA 5ETJA 4OMCA 3KTAB 1IONA 2XBUA 4Q0MA 3H84A 1E62A 4HL6A 1GG8A 1A69A 2FY8A 2WZBA 1T3GA 2VSOA 4OJQA 4DUZB 3AL3A 3FCOA 1T2AA 2E1PA 2AR9A 3ZOKA 5EHNA 3FPKA 1EZ1A 4JWTA 2POCA 3ZWKA 2Z5VA 4MPJA 1L4FA 1M2EA 3IV9A 3IV7A 4NNOA 5SYMA 3I0ZA 3IPAA 1T2DA 4RFLA 3P26A 4AYWA 3OLXA 4PZYA 1Z35A 2OECA 5F78A 5B1DA 4LHEA 2A2ZA 4XJXA 2VJNA 4I1VA 1L7AA 4ND1A 4QPNA 1ZQ9A 1OAOC 4ZPJA 4BZXA 1P1HA 1MB9A 1X1QA 3PRKE 5MHTA 1UH5A 2ZQZA 1P19A 3IR5A 1LH0A 5FOUA 3DCYA 1RQGA 1E8MA 1R5NA 3OOJA 5K9ZA 1WDTA 1ZICA 2PCLA 4Q9AA 3DE2X 4LRXA 3UJAA 5KYWA 1YVRA 4A8JC 2DFLA 1Z6TA 2GZAA 5LDHA 1GR0A 5EHZA 4AT1A 4BBAA 1GG9A 1CB0A 4L2IA 4WCFA 4ZHSA 2CLSA 2R7MA 5AVYA 2D2XA 1W25A 2XKAA 4OHKA 5T5QA 1T91A 3RS4A 1OUMA 2OBFA 1XTRA 5HDBB 2FEWB 4A0HA 4DSAA 4JI0B 5CFOA 4WCVA 3TQCA 2VJMA 3AR7A 4NE9A 2H5EA 5CM9C 2P4QA 3ZNPA 3COSA 4DWJA 4HVLA 2FPPB 1YIAA 2MSCB 1U5BA 3SJBA 3CLRC 1RNLA 1XA0A 3FM9A 1K9SA 1AHNA 4EMSA 1WP9A 1Z07A 3LBYA 2Q1TA 3KR0A 1LLDA 3IALA 4IGFA 2IDJA 5IARA 4HO1X 4A2PA 5DBOA 1B3BA 2HMUA 3OKPA 4LXTA 2XUDA 1ZCJA 4EG6A 4YCLA 2JD0A 1K7EB 1S3GA 2OVFA 3KNZA 4QGSA 2XBMA 2ZRMA 2C03A 5E4FA 1RYZA 3NBZC 1EX7A 1CP3A 2YFYA 1CRLA 3IP7A 4TSFA 2XODA 2PS9A 5A0TA 4YA6A 2XWBF 5C31A 1H94A 2WDZA 5T4BA 2WT9A 4H6PA 4MPTA 2YINC 5TPZD 4ARBA 2VDKB 2OHIA 3EEBA 1HFKA 3SJCA 1YL5A 1IUOA 1JXOA 2HHCA 3PGKA 4G5RA 1BJRE 4ZHQF 2GM9A 3RTGA 5AKIA 1XDBA 4YRRA 2QQ5A 5IM5A 2W2TA 3G7NA 3WS7A 1EB9A 5KSPA 3MMZA 3MWDA 4JL5A 1N92A 2UDPA 3UG7A 4AYXA 2JASA 2Z8XA 4G37A 4URWR 3LPLA 4UU7A 2DU8A 4LCBA 4XPIB 5D3MA 5JVDB 2J85A 1T36B 3VPAA 1ZX1A 3B3QA 3ZBPA 5HR5A 5KHLB 2W42A 4GW3A 1U1FA 2B7CA 2I2BA 5BSUA 1DADA 1KSFX 1PGJA 2XQVA 4IEIA 1USVA 1H2YA 3SS8A 5C4MA 5IDYA 3QVMA 1DIAA 3SM9A 4OATA 3OJEA 3GMSA 3QEJA 2OCKA 3BD6A 2NP7A 3CVJA 1DWQA 3KC2A 1EFVB 2V0GA 2Y9MB 2HPZA 2PZEA 4MW1A 3BXPA 3HRIA 2JFFA 4C4RA 3DV0A 3IQIX 4E21A 4DTCA 3F8SA 1XVLA 1BOFA 4F9GA 5C35A 4S04A 1CUZA 1OY1A 1JL3A 4B3JA 1HX7A 2VRBA 1TUEA 1Q2XA 1Z0KA 2WB4A 1XD2A 3HXPA 3TZQA 4CU2A 4MVJG 2MWMA 1EK2A 1C3XA 4IHAA 2JFXA 4O4HA 5CT4A 3U4CA 4CHTA 5ITZB 3U60B 1XX6A 4K6HA 2B36A 1DQSA 1PNRA 1LCIA 1YRQA 4MTLA 1G5QA 3E48A 5D5PA 4NJMA 4Q48A 1BXZA 3TFOA 3T7JA 5IEBA 1K9VF 1ZOSA 4DLAA 5FOXA 2DWUA 3TGPA 3AR4A 1Q95A 4DCJA 1AA6A 2W58A 2IZ6A 4W63A 3S1AA 2NYVA 4WFIA 1JKJA 3CY6A 5BUCA 5FAKA 3JY6A 3CE9A 4P93A 3RSOA 3ZGNA 1I3LA 2V4ZA 2PD6A 4AZ0B 3CPSA 2FU5C 1F3LA 2R8YA 4EMUA 3HXQA 2I9PA 1JIJA 2YJGA 4HGPA 1WU8A 4ZU6X 5FEMA 2XUQA 3K0FA 3LSTA 3GEPA 3NIWA 4BGDA 1CF4A 5JMOA 1Q3HA 2VHTA 4PY2A 4TLDA 4ZXPA 5BOSB 1MRZA 3JAKA 1E3DA 5IBRA 2OYRA 3G02A 1GDTA 3DBRB 3TNDA 1CUBA 1VCOA 1O7JA 2FUG1 4BVBA 1GNRA 1Q0ZA 4D79A 3QENA 4DJDC 3IEMA 2D8MA 2LBPA 1NHWA 5LPNA 4XTRA 1UPAA 3DUFB 3EXHB 1V71A 3AHGA 3BE8A 3ZE8A 3DNFA 4B76A 2YMLA 3F4BA 1E77A 3N28A 2G6TA 4F1JA 1HORA 2KS6A 1NVWQ 3R44A 2RGCA 3UJBA 2FRXA 2BZ0A 1MVOA 1R0SA 2MINB 3G9XA 1R9NA 2FOLA 3ZY3A 2XCUA 4OQEA 3Q6NA 1CTQA 4A73A 3JYOA 5BQ3A 4KR9A 1L5QA 1XTUA 5BUQA 1K7SN 2CDAA 5ALOA 1MDFA 3L93A 1IM8A 1QC5B 3AR6A 4B4WA 1ODCA 4ZO9A 4QLBA 3PC8A 4K0KB 3MMNA 4G4JA 4UM5A 3WOHA 4HPXB 5AT1A 3TJRA 1R8QA 3DDHA 4IZHA 4P35A 4DAOA 2WA1A 4QUGA 1TK3A 2UZIR 4OIMA 5DT9A 2WJHA 5LBIA 3NALA 1RCUA 4DV6B 2EQAA 1MIOA 4YP6A 2UZAA 1GNLA 3VR5H 3MMXA 3PWSA 3VNQA 4IIVA 4CV2A 3PV0A 1QQAA 1N1DA 2CLDX 5HPYB 1WCIB 4INOA 3GJ3A 2F8LA 2OORA 4K3UA 4XA8A 3M2TA 4GI7A 3MJ4A 3KQPA 5EWJA 4P7JA 3WSTA 5I51A 3VR2D 3HY4A 1RMYA 3IMEA 4C03A 1O58A 4B4DA 1E9EA 2XKJE 4UVIA 5KX5F 1S3FA 2IXEA 3NHWA 5KBYA 3NOXA 5BW4A 1C7EA 2PEYA 1RAGA 1YMVA 2PLFA 3P9NA 3PNPA 1V0JA 2B1IA 3GPIA 4WV3A 3WNBA 1T0BA 3WRXC 4BV2A 2J0SA 1J07A 1EZ4A 1I1QB 1U0LA 4S0XA 4DMFA 4IDNA 4KWEA 2QF7A 2DT5A 2AUNA 3PZRA 1R27A 3AI7A 4GMFA 4DUGD 2C4VA 2IEBA 3X2SA 2ZM5A 4KVZA 1XZAA 4MB6A 4RSMA 3E4CA 4LNUB 1USUA 5BV1A 5EUQB 3GLGE 4I36A 3WV5A 1ZK0A 1HDCA 2JJ2A 2VT7A 1T5OA 4HFNA 3RVLA 3INGA 1I3MA 4OXIA 3TLYA 2G1JA 4AF8A 3FOAA 3L7MA 4JR0A 3BAZA 3CEJA 4FGLA 5IFKA 5JPDA 4HLCA 1EXMA 2QS9A 4F2HA 1SU8A 2HT6A 5IYZF 1QP4A 4MS1B 4PX2A 3IQDB 1WMBA 1ZGAA 2QHXA 3MT8A 3AB7A 4S35A 1XEWY 2IYTA 3RNLA 3S8YA 3BJIC 2O2IA 1UBHS 4D4MA 3VR5A 1U2TA 3PNLA 4EP1A 2AD5A 2RGXA 1XF1A 1KO7A 4BO1A 2PEZA 1LPAB 3PJGA 5KSOA 10MHA 1IXSB 1NV8A 1JUDA 5ERYA 4K9LA 3KWMA 2JKVA 3PPVA 2V6BA 3QLVC 5T4FA 3U9SA 1G8HA 4L72A 3GFSA 2ONKA 1PJTA 1S8OA 4NJOA 2Z2IA 4IJVA 3H5NA 4U00A 2F9LA 1RZ3A 4MYTA 3VZDA 1KBOA 3V7YA 3CKLA 4WZBB 5A7HA 3H18A 2SECE 2FXVA 4BC0A 1H8HA 2AXEA 1WF3A 2YMMA 1C0IA 4B3RB 3N7UA 3TTUA 1FRZA 2W6IA 3D0KA 3LWBA 4FXPA 2Q1UA 5BVGA 4HS4A 1KH3A 1E63A 1T4CA 1VJGA 2X2OA 3OCUA 5KOJB 1IAQA 4MI9A 4A3SA 5C7IO 1O0CA 1EXDA 5GAJA 3DKIA 1P6XA 3FPSA 2CZGA 3IXMA 3MT9A 5DNAA 4NI5A 3PF9A 1W8IA 2WE8A 3HO6A 4EVIA 3A11A 2J9ZB 4R0NA 3FZYA 3PNSA 2FF5A 5T57A 4D9MA 2REBA 3N2IA 1JDBC 1ZH6A 2SHKA 2XDQA 2B1JA 2OO7A 4QT4A 4BGUA 1H2BA 1CJBA 5LQRA 4HWOA 2W8ZA 1KKUA 1E1NA 3DFFA 3TUIC 2CHQA 1TT5A 3AQ4A 3A0UA 3PX2A 2UZ4A 3ET5A 1R0RE 1DIBA 1SB8A 1SBYA 1N2HA 1EGAA 3H9JA 2ZYAA 3ITKA 3ZTYA 5ALDA 3ZD8A 3NMUF 1ZM2A 4CMCA 1N6OA 3QLEA 2DY1A 2WIGA 4C21A 5L7TA 1Z29A 1N36B 3F7TA 2K2QB 4O0MA 1J25A 2NXCA 2O8VA 4ONEA 2X0DA 4C0WA 5DI9A 3EQ9A 1EFCA 2QN9A 4LFBB 2O8EA 2ROQA 3O2NA 4NIMA 4AUNA 4UW9A 1FU8A 5JT1A 1IBKB 2Y0DA 5CCBA 5BSGA 1M2VA 1RI3A 5KYTA 5DTJA 2YHAA 2IE8A 3GLIB 4XDGA 2QUBA 3GPCA 3TLEA 3FIUA 3JX9A 3LXRA 3CF2A 3N8KA 1TKBA 3NWOA 4LIPD 4NYMQ 3T7IA 5JVDF 3O2SB 2D0OB 2JI7A 4NCBA 1R2QA 4UXJA 2I6XA 1DDOA 1QQTA 4JASB 1X0VA 3LUJA 5EL0A 1HDIA 5EWLB 2WUWE 2XNDA 5HTKA 4D02A 5DCUA 3CSDA 4YUXA 4AKIA 4MUXA 3PCRB 3NM4A 2VJQA 4FDTA 4INPA 3IP6A 2AK2A 2W9XA 2IZOA 4M7OA 4WH0A 2X1LA 3SI7A 1DO8A 1Y82A 2QGFA 2ZYDA 2P41A 4FNMA 1X7XB 3FJYA 3STTA 4AO6A 2PUEA 5E2BA 3ZE7A 3GYGA 2VJLA 2PS3A 4N82A 5BVHA 5KKCA 4N7RA 2QR2A 3RAJA 3PHBE 1EQUA 3ND6A 1EFRA 5D8DA 3UATA 1JJFA 3EGXB 1BCRB 4X7BA 2YVLA 5DISB 2UVPA 3UIEA 3DVSX 2VF4X 4PSVA 4RLHA 3UCXA 4LYHA 4W82A 1AE1A 3OE5A 4KYTA 5B4UA 1F8YA 2Y1DA 4UHEA 1VXOA 3PICA 4E7OA 3HG7A 3DPSA 4R98A 1Q20A 1Z36A 2Y05A 3ISVA 1D09A 3PI6A 4GHWA 3SQDA 4M1OA 1EKXA 3B51X 3TOSA 2I3ZA 3KHSA 2A3RA 3QXGA 3AHIA 4JJ7A 1A5TA 1RIFA 4DXHA 3COYA 3H2SA 2YX1A 2CBZA 2QIOA 5BSKA 5CM8B 1A9XA 3P9PA 5A06A 4L9WA 3D6FA 2YY6A 1XTQA 1IL0A 1N7JA 2XW6A 3QPDA 4Y18A 5JASA 1XLVA 3RS9A 4D3YA 2YQ5A 4IMJB 1KFEB 2AZTA 4JI4B 3R4CA 5A4DA 1R9JA 1ZG3A 2XADA 1RPAA 1VMDA 4EVSA 1IOZA 3RSCA 4QT0A 1EX1A 1D1QA 2GZMA 1EVYA 3OPYI 4HWPA 2VK4A 3DHVA 3PJFA 1M9NA 1WZIA 2Y8EA 4RSHA 5M29A 1JLRA 4R2WA 3ZU6A 4DMRA 1F5NA 5AKZA 5KPDA 4KMRA 5JD6A 3KUXA 3JARB 2CLIB 4UTZA 5FBWB 2I78A 3RWOA 3U3DA 3V1NA 4PNEA 5CK4A 1IHXA 3JZIA 5IAGA 4F5ZA 4YCCA 5KNDD 4PHFA 4K3VA 4U02A 1T5BA 2AI2A 1U28A 2L17A 2XYHA 4A15A 3LC7O 1ID8A 5ALIA 4YONB 3WNQA 1WCYA 3R6TA 4Z4GA 2VOEA 4ZQGA 4LG1A 4FYVA 5K8IA 1YZKA 5K0SA 4GXQA 9GPBA 2G4VA 3H8JA 1G8PA 4L5CA 4ZIRB 4EF4A 1WE2A 3KYDB 1FXSA 1Y3HA 2YHSA 1X3LA 3AXTA 1UJ6A 5B3JC 5JSQA 1YJXA 5DNVA 1ECPA 3ZXIA 4NDZA 3JQAB 2D59A 3T1VA 1LPSA 2GXQA 4PC2A 1P7WA 3KYCB 4WECA 4NU6A 3SBOA 1DP4A 2FDRA 4OFZA 4ZRMA 5EC8A 3MM4A 5C8ZA 2KYRA 2ZUWA 4JKYA 1CQJB 3A32A 1SC1A 2DKNA 2NUPA 3Q8LA 2CW5A 4JQZA 3GOHA 2JBAB 1LJUA 1P2VA 2RAUA 1H85A 3AEZA 1L7PA 2ISCA 1DX9A 4B4UA 1N6PA 4AECA 2R11A 2K7FA 5KNCD 1PZNA 4N40A 4EVQA 3W6UA 2IUYA 4YMLA 3K05A 2VBFA 2ZYSA 1RWNA 3L4KA 4EPWA 1X14A 3TZ6A 4DV7B 1U0RA 4MQLA 3EZ2A 3UYKA 3ZY5A 5J4KA 3U4AA 1EK0A 1EDDA 1VPEA 3WSWA 3L0PA 4KAAA 1Z33A 3DVLA 4LF9B 2WM8A 3WLHA 1I5OA 1RQNA 2A0YA 5EEGA 4BVGA 3T5TA 4PN7A 2Z6QA 1SB9A 5JTTA 1YA8A 3MJDA 1EM8A 4TL7A 3UK6A 4UJ5A 3ZWAA 2HAEA 2PL1A 2D0DA 1UBCA 2QNIA 2RHCA 3JALA 1MNAA 4YP0A 1N2IA 3U09A 1DAKA 1ZLXA 2HQRA 1UP4A 1YZHA 1G3IA 2QD2A 3H83A 3PC4A 1VJ1A 1LXCA 2HMSA 2XUGA 2ZYRA 1IBCA 3JQFC 3A4NA 1Z56C 1TEHA 3BDIA 4XXHA 4RWZA 1G0OA 1VIYA 1VJTA 2ZYWX 3RS5A 1G5IA 1PWXA 2N3ZA 4E30A 3HZHA 3NAMA 3ADDA 3JASA 4M8KA 1A9RA 4MI3A 4JROA 4DWWA 2BGWA 1SCBA 1YI8A 3PEFA 1TXGA 4FGJA 5EIBC 2C9YA 1IHUA 1UIRA 4LTNA 4H18A 4JT4A 1M83A 4BMPB 5H80A 5J2UA 5LUBA 2Y6VA 4LVCA 4TRRA 2I3DA 2JAXA 3E53A 4RD4A 5EP1A 1U2ZA 4PG4A 1H6AA 4FJ1A 1GHTA 1KJQA 4EG7A 2QTRA 4RC9A 1XC7A 1ZINA 1NXOA 3IAS1 2QX6A 5HG0A 1J0DA 3HXKA 3R3XA 1K75A 4ICIA 4LX8A 1FQOA 4QFMA 4G4SP 2VYVD 5LB4A 5JD5A 4EHKA 2B4TO 3EF1A 3KQVA 4ISCA 1YS9A 3GJYA 4H3SA 4R2JA 1CE8A 3REFA 1ZMOA 2AZ4A 5HCUA 1SVNA 1Z5UA 2IDKA 4R3WA 3WHLA 2X0RA 5EKDA 1CQIA 4ESHA 3Q7RA 3IPRA 4HYQA 5D01A 1ZOOA 2WWYA 3I5XA 1JRLA 3I53A 4JGIA 4U6QA 4CMIA 1ZMTA 3IKMB 1FU4A 2R79A 1TZJA 3LA6A 1R66A 1C9JA 3SVZA 3HPQA 1CLEA 4RV4A 2NU7A 5FFMA 1XKXA 4PAWA 2R25B 5DYIA 4YLGA 5A9SB 5CDSA 5LKAA 4I4TA 2H1RA 5TJ9A 3BTSA 1MEEA 5AW4A 4KRXA 4FR2A 3HBFA 1BCSB 1ORHA 3UZUA 4F4HA 2GCOB 1AM4D 3EULA 4ZEMA 2D2VA 2GHRA 5LZ9A 2J3KA 1ULHA 2HJGA 3DA8A 5LXTA 1FUUA 4U7WA 5C34B 5CA0B 3HJUA 3PRJA 3K0AB 2HMTA 2GTIA 4B7ZA 2OHJA 3DOIA 2GVDC 5LA6A 4EGCB 1P9RA 5HKKA 2JIMA 4L8FA 1YTUA 4A36A 2ZDGA 4TVOA 4CTMA 4H60A 3TSOA 2R84A 5FI0B 3MWJA 1L7NA 3STYA 3MOIA 5DJ5A 4ALMA 1K4YA 4QDOA 2EFEB 3V8EA 3RRJA 1RZRA 3L46A 2G40A 2JVIA 1EE9A 4MZXA 1RZVA 2J7KA 1IN5A 2CXNA 2WFAA 1JB1A 5FOTA 5B37A 4Y9RA 2VCYA 1A1VA 3ZKWB 3GCXA 4ETMA 2EV9A 3JS5A 5CLGA 3W9YA 4E46A 4X62B 3DNMA 3AOGA 2JS7A 2V6MA 3A04A 1M7BA 4GOKA 2WJJA 4ZK6A 2R3SA 1JLKA 4C3ZA 4DT1B 3CXRA 4XJTA 4X95A 5JNRA 3K9NA 1RYDA 4QGHA 1AOXA 2ZR7A 4Z7OB 2VDUE 1WV1A 1VBKA 4DREA 2Q41A 1KOLA 4RVHA 4XVUA 5DGTA 4DQ0A 4MOWA 1OFUX 2EZTA 1WA5A 3O5AA 5CTJA 5D6NA 4GL2A 1JHQA 4PCAA 5BYJA 5TPZA 1XVAA 4DDKA 3QJGA 4JC5A 5GIOE 1JMYA 1S3IA 3C5CA 3BSYA 4JK3A 2EHJA 3IPXA 3SYLA 1A8QA 1JKXA 1WQ1R 2R97A 2XB8A 3FMVA 3ICWA 4IXWA 4MKIA 4AXBA 4A2QA 4DNPA 4J9UE 5KYKA 2O19A 2JFPA 2HDWA 1ZIYA 3BX1A 1LNQA 5WRFA 1ML3A 3ADKA 1K5DA 1PKEA 2J9FB 1V9LA 2IHTA 5AXBA 3ZIUA 4DA7A 1T3HA 3R75A 2P1DA 2A7QA 4UTXA 4NJMB 3CX6A 3HJFA 4RY2A 2CXXA 4HAUA 1SXPA 3JVDA 4K5QA 4TRNA 1TECE 3E3NA 4L8WB 4E2ZA 1D8AA 3AZOA 1TJPB 5EXEA 4PCVA 4UVEA 5G3ZA 2XB6A 3UHOA 5JADA 3L1UA 4BYMA 2TMDA 3O8QA 4PYRA 4WXMA 4E5PA 2FEOA 4GC9A 1UMDA 3K0EA 2GUGA 3DOCA 1DKPA 2C8LA 2V3WA 3A05A 4QUAA 3Q9SA 2JGRA 4JUFA 4MA0A 2QLNA 3NXKA 2KPOA 3IQHX 1NJGA 1OWNA 3FBGA 2JIOA 2WJ4A 3I2HA 2NTEA 3IBCA 3T38A 5ITWA 5CITA 2BY4A 3D43A 5H5JA 2CMDA 5AM5A 2FHPA 3N0RA 5DDIP 4ZAXA 3PC8C 4DIKA 4GP9A 5LZ5A 2QAGC 3R4VA 4Q18A 4IIGA 1ESNA 3DXFA 4ZC8A 1JA9A 4R2KA 2HL6A 4ZVMA 2NOAA 2IU4A 2QVXX 3BWEA 3T0IA 4Z1MD 1KP3A 2A8YA 3N1UA 4FGZA 4KMOA 3QVLA 4I4CA 3Q0IA 4NFSA 3BGSA 4Y6GB 1C4WA 4RGBA 2OXTA 2EFHB 4KBFA 4HDRB 4D8WA 1ILEA 1VIAA 1L2TA 2IP1A 1DKNA 2UYGA 4W5QA 1E1MA 821PA 4G5QA 5HTOA 1WDLA 1H3FA 1OPRA 1PI3A 2BFEA 3RFUA 3QEMA 3ITNA 4IVRA 5AI0A 3SGLA 2EBHX 2WRZA 1JI3A 3N2YA 5KAMA 3V80A 2ZT8A 4XX1A 5ESXA 2FSGA 4LPKA 5B2FA 3W4JA 4CDMA 1A72A 3LW7A 4Y2YA 1CHDA 2XUHA 5BN4A 4CL2A 3I0MA 3RWBA 4BLRA 1SXJA 3JVVA 3FKQA 2AL7A 4Y1FA 4B81A 3V4ZA 3C70A 3C4VA 4RANA 1PYGA 3DOUA 1GG5A 1LFAA 1RR6A 5BV7A 4I50A 2QUIA 2JGAA 4LX0A 3IAHA 2IBTA 4CYMA 3DL4A 1P4AA 4D9BA 3PUZA 5I7AA 2HO5A 4DDTA 1WPGA 4E32A 3THRA 4P4NA 1SIUA 1HYEA 2BMDA 4QGFA 5IAKA 3SXPA 1R88A 4J3JA 1IU9A 4OXYA 3CUUA 5A1TA 1H2AS 2P6UA 2Z1NA 3QVSA 3RSZA 3N8NA 4PBTA 3ZWMA 5CCEA 3ZLJA 4Q9NA 3T5GA 4K26A 2Q3HA 5HZGA 5F35A 3TTXA 5IC5A 4L4YA 2QU7A 2R85A 2F1KA 3P0EA 5LP1A 3G8YA 1LRKA 1LJ8A 2BFEB 4US1R 1DBVO 3TDKA 4URYR 4ZVPA 1ADFA 1Z9BA 2BFOA 2EX0A 1EIWA 1ZGGA 3LT2A 3BIOA 4HQ6A 4LHZA 1M34E 4REMA 5DNDA 3MJFA 3KLNA 1LI5A 5ADHA 1DKOA 3BXXA 3ASYA 3TI9A 1P0PA 1KI3A 2VLBA 5KYXA 5BWNA 2GZHA 1D5WA 3OU2A 1CYEA 4OQZA 3RRZA 1S2DA 1D7AA 4G26A 1U6KA 1UINA 5DKFA 3AKCA 2VBGA 1CJTC 1JEQA 1TGVA 1IHDA 2PFKA 5I7HA 5AKJA 1EIZA 4PLTA 5EIFA 1Q77A 1J0AA 4GSKA 4CM9A 2A94A 3OD5A 4EKEA 4BJ1A 5DWQA 1BEUB 2C00A 7REQA 5K0TA 2FETA 4QHTA 4DUPA 5JCXA 3IURA 5HIMA 3DZBA 4OHFA 4QYMA 4WK4B 4BZZA 5CGZA 5M2QA 3WLEA 1S1CA 4MEBA 2GK3A 3FPJA 4TSKA 1VMIA 4L8LA 4FS3A 1N3YA 3LI2A 4CT5A 2IV3A 3KYBA 4FYXA 2P27A 4OF4A 1PHRA 1SD1A 3EA0A 4E15A 3ND8A 1G66A 1I7QB 3I1IA 4IINA 2J6BA 4MAMA 4EPVA 3CV3A 1A3CA 3QE9Y 4AB1A 2Y1LA 1A9OA 1K8QA 3NTUA 5TMBA 4ZPXA 3S2EA 3VZRA 1XPRA 5FLEX 3VH4A 1FPQA 1VLVA 1ZRHA 2CVZA 2W6OA 5D3QA 4NE2A 1L5WA 4FK8A 4N3NA 3P4UA 3ESQA 3SKYA 3GT3A 4ZAYA 3WNVA 5TX7A 1F60A 5M5BA 3CVUA 2G71A 3CVVA 3BL8A 1W5BA 5ABPA 2W6ZA 3N87A 2IH5A 1ZEJA 2C8KA 2J46A 4O2BB 1M6YA 3OEYA 3KTDA 4Y0NA 4OI0A 1Y1TA 4Y67A 2XYQA 3QI2A 4RCYA 4TUYA 3FOFC 2JI6A 2F59A 2D5BA 3LCRA 4RK4A 1TA0A 3LXMA 4WESB 4HNAA 3HCCA 1FVXA 4XWGA 2HA2A 1G6KA 4F96A 1K6MA 2FTKE 2GVNA 2AH5A 2DUUA 4A1FA 4GQBA 4WCFC 2XDQB 5TS2A 2KMLA 1TF2A 4UHJA 3ZWBA 1TMOA 4DYHA 3WMRA 3L7NA 1NUTA 3ACCA 2A5GA 3C14C 4FN4A 2JBWA 2D4HA 3U62A 4F3KA 1PGPA 3VBEA 1IZZA 4GVLA 5KU1A 2P6RA 4AJJA 3BRCA 1ADJA 3WLIA 3W77A 3V8MA 1E3IA 3OZUA 4DR1B 5HSGA 3EIXA 3E22B 3GGCA 1WM1A 1CZUA 2IZZA 2AX3A 2YIMA 1RC1A 3DE1X 3L02A 3L8GA 1KYYA 1M6VB 5DYYA 1QQBA 1JLLB 4MRRA 2JFWA 4D44A 1BGXT 3OE1A 3EG9B 3PDWA 1LV7A 1NUQA 1SU7A 3CLSD 2G28A 3DCNA 3DMTC 1EFPB 3BDVA 5DEOA 3I72A 5AKKA 1RJFA 3I9OA 3UB2A 4R8SA 3KU4A 5BSEA 5CJJA 4BWGA 1RCTE 1WB4A 4QPCA 1QLHA 1V5FA 2GBGA 4R3UC 4BV3A 1W5TA 5H70A 2EWMA 2OCDA 3F9IA 2CYAA 4BNJA 2UVDA 4TN5A 1Y98A 4ZA2A 1DEXA 2P40A 2EW8A 1EYZA 4BNTA 2ZSBA 5TT1A 2ST1A 2AT1A 4ZYWA 2V6FA 4Z8YA 5BN1A 1JAYA 1SOMA 4GI5A 1FSPA 3FWKA 4F6LA 4YP5A 2PDAA 2IDMA 2ODPA 4XQCA 1WMDA 3FCCA 5TIIA 3FTNA 3IHKA 4ZQIA 5AK0A 4COOA 4FLFA 3L9WA 2Z1MA 2GN0A 3UA4A 1L5YA 3B6ZA 3NPAA 1H0KA 4JZYA 3VDNB 2OCAA 1GL6A 5KJCA 3ETHA 2VJCA 4OBBA 4MS4B 1WKVA 5HS4A 3M5WA 4OX9Y 1QP7A 2DAPA 3GK3A 1QFYA 4N18A 3FUCA 3L8DA 4MB0A 3BH0A 1B74A 1HMYA 4WZ6A 2XNDD 5IUKC 3SJUA 1QVRA 2I6QA 4L5YA 3V9PA 2IEIA 3LKZA 4EK9A 5IKXA 4MVJH 4YJ3B 1XMOB 2BTQB 2EGGA 1T10A 2YJ5A 2ZJAA 5KTRA 3E3LA 2RGNA 2J9RA 4N6OA 5JAPA 1N25A 1VKZA 2E85A 2HF2A 2WPDD 2COEA 2JFQA 3H7IA 3NB0A 2BEKA 4G89A 4JYBA 4CLRB 3VOBA 2A58A 3RBVA 1GPWB 2MMGA 2GO7A 3JAKB 4JQYA 4V39A 2P77A 3HCFA 4X60A 4HPJB 3RV4A 1TKAA 4GYWA 2BFNA 1MV8A 3KQWA 1K8RA 2NSYA 3FSGD 4H1TA 2RGWA 8AT1A 1K6XA 2WYOA 2PRIA 4OHRA 3GN2A 1PZFA 4E5DA 3OE4A 4BO4A 3WDSA 3BMQB 4Y9TA 1F8XA 3NNSA 3FSRA 4JP3A 4CG1A 4M1KA 2V45A 4D3XA 5C7OO 1WXGA 3WRWA 4JUAA 2YIVX 4KN6A 5REQB 3QV2A 2ZBEA 3ICQB 5TVGA 1V5GA 3GLFA 3Q1KA 5FF9A 3JQ8B 1SOUA 1GGEA 5H82A 5LXTB 4QVKA 1S4MA 4OIFA 4YJ2A 2H8GA 1NOJA 5JO9A 1BCSA 1U8XX 5T3YA 1FTNA 5DRYA 4JB2A 3SXUB 4AZ3A 2IXAA 3Q5DA 3Q5EA 5K6AC 4EIWA 1LSJA 1HOXA 2HK9A 4MB2A 1ISMA 4G01B 1LNSA 5CNKA 5DP2A 1IWBB 1W5SA 5EG5A 3MSXA 3RUAA 4WDQA 4F3YA 5L40A 2XR1A 2IZ0A 5JS2A 2Q6VA 1V7CA 1X86B 2AHOA 2CDBA 5FULA 1WS6A 4GLBA 2HMAA 3EB9A 4LY6A 2PZLA 3KBOA 2WSSA 1AXEA 2Z57A 5KVQA 2W98A 2Z95A 3L3BA 3NG1A 3L04A 3OZAA 4GICA 4JT9A 3HTXA 1XLTC 3PFNA 4OU5A 2I99A 2I5PO 2EG9A 5BN5B 3MGAA 3P0IA 5J43A 4L16A 4IQ8A 4OGKA 1JFFB 1Z5WA 2WT4A 4Q4AA 1Y7HA 3V8NA 4JJAA 1YE5A 1Z73A 3RUCA 1CIVA 3I32A 5CA1A 1EA5A 4WERA 5REQA 3UBTA 1MW9X 2C7GA 2JLQA 3ANXA 3H5AA 3I6IA 4KH0A 4X1YA 1RHMA 1KDOA 1XD9A 2EFGA 2YRWA 2YNMC 4JLBA 1E9RA 3SBEA 3H3XA 1U8FO 1XSEA 4HDMB 3B6EA 4OJKA 4L7QA 3SAJA 5JH7B 3NBQA 3V8QA 1RLIA 3S1AB 3KBBA 1G4UR 1WCV1 4Q4HA 5DGHA 3UB3A 3VKVA 3R1IA 2Z2KA 3QELA 3BKXA 3EWIA 4ARUA 3KR9A 3ZPXA 3B12A 3TTYA 1YRAA 1KVQA 1MB2A 3K6RA 3HKCB 4RZXA 3VKUA 1FQKA 1M7GA 2ZS9A 4V2IA 1QIJA 4NC9A 3M4JA 1N7GA 4NCHA 3LW8A 3CWCA 4OM7A 1U2SA 3NWEA 3SR4A 4EG5A 3KUUA 3OQHA 4NENB 5JG7A 5EXXA 1VI6A 2RKOA 3VM6A 2HZ7A 4NBVA 5HRCA 1VG9B 1HPLA 1DBQA 4LZLA 3D54D 4O4LA 1N9GA 5ALQA 5ARDA 3M5CA 3TB4A 1AY0A 2F90A 1IQRA 1Z6AA 4A8TA 2UKDA 2PR7A 4NZMA 2GKGA 3AOEA 3T15A 4AY2A 2HA7A 3D3WA 4R31A 4MO2A 1NOKA 4BP1A 4ZYXA 3V46A 5K5EA 1H3EA 5CB4F 1XPUA 1Z39A 2NUPB 4MR9A 1HGXA 2BEJA 1AQJA 4MKFA 2ZRQA 2XD9A 1WLYA 4TZKA 2GQ0A 4G1CA 1PT5A 1T1JA 2JGDB 3HYSA 3NO4A 3KZCA 2IL1A 2FWMX 1DC8A 4C08A 4N48A 2VYFA 3PFCA 3GGOA 3FNEA 4POAA 3K1AB 3ZJ5A 4EYQA 1RQ7A 3KFLA 1N6LA 1IM2A 2OENG 4ZMRA 1M6WA 3L6CA 3QXSA 1A88A 1L5HB 1VSBA 3GFPA 1HFJA 4URFA 5F2KA 3NP7A 2VH2A 4C3VA 1L6RA 1NP3A 2D5CA 1HYQA 3M6XA 4ZEWA 3VI3B 3PA6A 1OI3A 4LE2A 1FDSA 4FT2A 5JC8A 3PYXA 3QKIA 1O96A 3M34A 4DB2A 3NUZA 4O4JA 4K1XA 3EFOB 2VDRB 2BTQA 1EE1A 1U63A 1Y8AA 4AMYA 1N5LA 3MQFA 2F43A 4P08A 3UK0A 5KWSA 3A6DA 5A03A 2PZKA 1J9GA 3TGWA 4HWSA 3L6UA 4YRMA 1W4ZA 4CQNA 3SJ7A 4BN5A 4FYYA 4IXNA 1ZU5A 4XIFA 2CSXA 3PEVA 1K3FA 1LQTA 3BG5A 4KDEA 5ECYA 3IQZA 1G20B 4RH0A 3U3JA 1W581 2LXNA 3K31A 4KIWA 3RSLA 4KITB 4TWRA 1Q11A 3QFHA 5ALNA 1S89A 3WYBA 3P1JA 3DKKA 1JSCA 3GI1A 3VJLA 2I2CA 3L6DA 3FCEA 2OZLA 2I4MA 3DOFA 1STOA 3BHJA 3JQAA 5AI8A 1ECCA 1GAJA 1T0IA 4RF4A 4XDZA 1WZUA 4B3IA 2LCQA 4PQRA 2W4MA 2I1VB 4BVAA 1YR6A 2G4LA 2B8JA 2REQB 2XEXA 3IDZA 3LQKA 1HLDA 5TVKA 1T9HA 1MC5A 1VYHA 4BMXA 4C78A 3KLBA 2FN9A 5JDCC 3M4ZA 3VBCA 1PFGA 3O75A 1O5OA 1YMUA 1PR9A 1GRQA 3FVRA 2FPIB 2AW3A 2HCRA 1QR6A 3NWPA 1K5HA 3JU3A 1ZM9A 2J30A 3I4LA 4I4TF 2X8BA 3GT7A 1U1EA 4R9NA 2DH6A 4A2CA 1OWLA 4ZRNA 3KAKA 1SHUX 4PZEA 1HYBA 2VPTA 1FYDA 3CW8X 1GCUA 3IULA 2R1TA 3M6FA 1MNQA 1Z2AA 2HJ9A 5AFSA 4IILA 2BC9A 1N8TA 5CDYA 5KNCH 1N0HA 2F1IA 4Q34A 4UM9D 3UK1A 4CMHA 1TLTA 2WBLC 4K2AA 3ZHZA 3U7HB 4FB4A 3A2MA 3VTFA 3OF2A 3SY8A 1Q83A 4DG8A 1DINA 2A9KA 3HEMA 1QS0A 3TVDA 2Y76A 1GTG1 3K30A 3OTGA 4LXGA 1OYOA 3L7JA 5IT9A 3RYHB 2XUFA 3UMFA 5IVIA 4I1SA 4RV5A 4QE3A 1MAUA 1AS2A 4W5RA 2QTHA 4AF6A 2D62A 1F20A 2Z9CA 3QUQA 2NNWB 2XF8A 3MTJA 5H68A 3FUXA 5GV7A 3E0QA 4BRUA 3QFTA 4MQFB 3TR5A 4F85A 1BZYA 1CFJA 1VYVA 3GJ6A 3L84A 4ZXFA 1NJ8A 1WWKA 4GT1A 3R24A 2QN8A 2NUBA 1I0ZA 2E21A 2O05A 4PC3A 1TQ6A 1GCOA 2FVXA 1Y7IA 4RYLA 5TS3A 4O6VA 3UT5A 4PFJA 1G8AA 2EF1A 2FVYA 4TVKA 1JAXA 1F0NA 1N6NA 1PZMA 3R3WA 2BFCB 3KJNA 3DWGA 3SZLA 4DIDA 4DLLA 2IHZA 3EVDA 4R2MA 4A26A 3QY9A 5AUQA 2XRMA 2GFQA 5I48A 3TDNA 2GYUA 3QW2A 4GM1A 2IC5A 3L4EA 3T12A 1JIXA 5FTJA 3VAYA 3TCNA 2X9VA 1P81A 3ZJYA 3W8FA 5CM2Z 1RI1A 4II3A 1EH5A 2IPOA 3N2LA 2PUGA 4Q37A 4JUDX 3FFBA 4OAOA 3N6XA 4UBMA 3MJVA 3FGPA 5JC1A 3KQKA 3M4NA 4Q1DA 2CXOA 1C8BA 2Z8YM 1YHZA 2GJ8A 1Z83A 1YS6A 3ZD6A 1YZQA 3ZR4B 4D82A 2PO7A 3WLLA 1KXZA 3S4YA 4QBGB 5GIPE 5L4LA 4LI3X 4GE3A 1W4AA 4D8VA 3DOJA 4JI5B 4WKBA 3SC4A 5LJIA 3F71A 1RJ9B 1DWUA 1GGMA 3IH5A 2IH4A 3G2JA 4MO9A 1ZONA 4D25A 1YR9A 2PJZA 3OT1A 4YPVA 1E66A 2DWPA 4F1WA 3SWWA 5I01A 4P81A 2F55A 1KY2A 2VR1A 3D8SA 4BNVA 3HVJA 4ZVSA 4C88A 4E70A 1O4WA 1SUEA 1UKEA 1ZQ1A 3NCTA 5CLIA 2D1YA 3VNRA 1TGYA 2H9YA 3G7SA 4K6FA 4D45A 3E7DA 4KXQA 2ZR9A 2QSZA 2WW8A 3KOUA 4DY6A 1XZPA 1L7BA 2P2ZA 1DC7A 1MHPA 1WF6A 4BO7A 1C8VB 3PFGA 1U8AA 3R8FA 2C7QA 4FWTA 5DH9A 5A6SB 2XHZA 3GEMA 3ZHOA 1ODFA 5HWSA 1IVYA 3HCWA 2JGMA 4IVPA 3MS7A 1H22A 4NH4A 3A06A 5ES4B 1E7MA 1QHHA 3BXGA 3D3JA 3KKZA 1P39A 1PGOA 4X7MA 2DTEA 1JHRA 4DCGA 3OLYA 1ISPA 3PD0A 4CFYA 1AG9A 1EJ6A 3A7EA 3NLLA 3UWPA 4KI7A 4CVNA 4F84A 4J0GA 3PYLA 3F6RA 3G85A 4JT2A 5E7QA 3NDRA 5I7VA 121PA 4FD3A 3IDFA 2Z5LA 4Z3KA 1MRSA 1KI7A 4G8JA 2BM9A 1ST3A 2FP4B 4OM8A 4B9AA 2DPGA 2BGMA 5IFLA 1DJNA 2ONJA 2OYSA 4MX8A 4J0JA 7YASA 2NTVA 1PJ3A 2ODNA 3LL7A 3MQ2A 4BQRA 4CM8A 1CULC 3CO5A 3TLGA 2PFSA 1KDVA 1G2OA 2J07A 3EIFA 4LHYA 4LJAA 3C6QA 5HJ2A 1FFYA 1Z17A 4Q4HB 5AKYA 4GG1A 4DJ5X 3JD2A 1RPZA 1RACA 1VP9A 4TWJA 3K6KA 2VBIA 2Z9BA 3CZ9A 3ZIAD 1PR0A 4YCSA 4ER6A 1DI0A 1H2RS 1ZGHA 3C6KA 1VE1A 2FPGB 2CY0A 3VRHA 4NYJR 4B32A 2CE7A 5BSWA 4JLSA 3VSCA 4JLWA 1Q0HA 4M6WB 1BH6A 2E49A 4FP9A 4QTYA 2ZVQX 1OAAA 3Q2OA 1SXQA 1TJ3A 3E61A 4RHCA 5CX1A 5T4HA 3BE5A 5DFAA 5BWLA 3EVCA 3H42B 4KK4A 2D2FA 4YY3B 4GVPA 5BNFA 4N12A 1KR5A 1QC5A 3KKPA 1W59A 2NVBA 4HDSB 3A9VA 3ROTA 1V1JA 4EI9A 3ETNA 3KP1A 1QTQA 1U3UA 1W4CA 2C5EA 3JYNA 5BR1A 3EPLA 2C3UA 1VKRA 2VDWA 3NWJA 4I8XA 2GMWA 4ZDKA 4Z4FA 3NX4A 4EYOA 1DKLA 3QV1A 1SKQA 3EQ2A 3GVXA 4ZAGA 5AICA 5CNMA 4KR6A 4X3PA 2XRZA 3PNQA 5HKBA 2KHZA 1LS6A 4CMAA 2CHFA 4BO8A 5IYZA 1XROA 3AJEA 3D02A 1U3DA 4DRZA 1UDWA 1JR3A 4U63A 1HZZC 1JQ5A 3OT4A 1LEHA 4TYYA 4YIHA 1I5RA 1QZZA 4MW2A 1H05A 4WY5A 3GVIA 5J2TA 2FCRA 2WUGA 3U17A 4B2YA 4D81A 4BE7B 3KT0A 4K81B 3RC7A 1R5BA 4ZI3A 3DUFA 4HNSA 1BS1A 4XQGA 2QZSA 2G5TA 3E9RA 3SC2B 4IV8A 5DBFA 1E5LA 4WOJA 3EY9A 4LBYA 5CFMA 5K8CA 3OUZA 3VU8A 3AJ9A 2FQ1A 3IAEA 4OQMA 2H2FA 2VA9A 4BO6A 4IFIA 3OPXA 2ACKA 4XKJA 2XBLA 3AG5A 4MS3A 4OU4A 2LUOA 1S4QA 1QSGA 2RK4A 1XTKA 3PQ7A 4CBVA 1P2TA 2NZVG 1M5RA 1R3DA 1TTTA 5ALYA 2JL1A 1XYYA 3NKVA 1YUNA 1XDGA 4AUEA 4CCYB 1Y7PA 2WTXA 3EDCA 3GQBB 2UZ3A 3IMFA 4M7RA 3MK31 4W9RA 5A05A 2ZBQA 5GJVC 4IRXA 4C4YA 1DEHA 4FGWA 4R1NA 3RPEA 1DWOA 5KTTA 2C8VA 1E20A 4YNBA 2FSFA 1B15A 2GN4A 2NO9A 2WFLB 4KWHA 1BYUA 5CH3A 3VX4A 9ABPA 5U1PA 1YFKA 2B0JA 3O21A 1XFDA 3ZWQA 2PVCA 5T6MA 4GEGA 1ZHOA 4WLNA 2B1RA 3MTBA 3K5HA 3UY4A 3EFEA 3HCNA 1JU4A 1SOAA 1J8MF 2ZWOA 3CRMA 4OQXA 1UT5A 4OYHA 4MUBA 5I7SA 1KZ9A 4CG3A 2ZEJA 3BWBA 4XRGA 1U81A 1M5UA 3QVUA 2NO7A 4G6ZA 4OCZA 5BQFA 3GLIE 4W5OA 4MCIA 4RTLA 2BHRA 2XTAA 1BX0A 3ICOA 4FX2A 5LMZA 2GN2A 1D1TA 1LA2A 2H4XA 2H3HA 3HP4A 4EL0A 5KNLA 2I22A 3CH7A 3VKWA 3ZY2A 3UPTA 1T29A 2RIPA 3OETA 4W6QA 2Y1EA 4V02A 3VHXB 4K9PA 3EVNA 4G4IA 1RM0A 1SQ6A 3VJKA 3F1KA 4PO1A 2V03A 1L4YA 4IIFA 2O0HA 2R86A 4PNPA 3HR7A 4I4TB 4DG9A 4LOKA 3S1SA 4CM3A 1J8QA 1SCNE 1PQWA 1G98A 1FUIA 2C78A 2XQGA 3DMFA 3PNVA 3D1LA 5D51S 5A2QA 4FHZA 5BSMA 3I9V6 3C6BA 3L01A 3SDBA 3H4MA 3KSDO 3KJEA 4Q05A 1SZPA 2GPSA 2YN2A 1ZGZA 3T7EA 3AFMA 3WJ2A 3UGKA 1IB6A 2IE0A 2HRZA 1EVIA 1TA4A 3CPEA 1FRNA 1LPPA 1CG6A 4JT8A 4NR0A 3NM5A 1PEDA 2ZBVA 4R7GA 1AS0A 2ATIA 1OYWA 5FB3A 1WB5A 1O1YA 1QCZA 3ABSB 2Z98A 1SK8A 4J49A 1JQJC 3HM9A 3PQ8A 1I2CA 5DIFA 4ERXA 4P53A 4WXPA 5KJ6A 3EVAA 3FYUC 2XSZA 1K68A 2HOQA 1I9CA 4OKIA 1NAHA 1T9AA 3W9UA 3ZNQA 4AIIA 1MEOA 2Q3CA 2HX1A 3SM3A 3ZDCA 1HEUA 1XRLA 3IOCA 1Y9JA 3OPNA 4X8MA 1TVKB 2CNWA 1TAHA 2YJTD 2DBYA 2EXXA 1A97A 1L5GB 5D1NA 1SUSA 5J47A 2QD1A 3FSGA 5HFJA 3FKSA 1KJYA 1JTVA 2J45A 3OQ1A 5D3MB 4E08A 4YUAA 1G3UA 5COBA 1VPWA 4KQFA 4QBFA 2WAXA 4H1WA 1VBMA 1COWD 2V1XA 2H1WA 2VT2A 4DQVA 1OLUB 1XRSB 2Y99A 3ESCA 4AY4A 5A62A 3E4DA 3W3AA 3WMEA 5JISA 3RBZA 1UFVA 2NXWA 3C7CB 4HDNB 4NMHA 3DB1A 1XNQB 1VL1A 2DQZA 2QRLA 4IIEA 3S55A 1M2KA 2AFVA 2JI9A 3AJDA 3EWSA 1M33A 2HSDA 3EWAA 4G84A 4XWAA 2FMFA 3PEEA 2YJZA 5K6RA 3TRIA 5JS6A 4CLOA 3DR3A 3KS9A 3EG9A 1ELOA 3O47A 4L85A 5LN1A 5E8RA 2OFXA 2CL0X 2FZ5A 2I4NA 4DJJA 2CJWA 3UJ6A 4F3RA 2C2MA 3MCWA 4Z4QA 1VGVA 1H0RA 5T41A 1WHTA 2VSNA 3DE5X 4Y1GA 3LBNA 3VU9A 5ARCA 4IMRA 1KAHA 2H7VA 5H4HA 2JAHA 1XTIA 2BEWA 3AF5A 4QYIA 3LXUX 3WIBA 4B5LA 5IMSA 4RK0A 2UUPA 2Z1DA 1OKKA 3KWJA 4BZQA 2I9KA 1M54A 4HEJA 1U0FA 1F1JA 1HURA 4M1SA 5T4EA 3RSGA 3V8RA 3VO9A 2BSAA 3KTAA 4DLTA 2VHQA 1PEAA 1DKUA 4OL0A 3ZGOA 4WKNA 2JLSA 2QE7D 3TLKA 3QOYA 3GDWA 3N2ZB 1GT6A 2DPXA 3AHDA 2VCEA 3CNQS 4B8YA 4DMLA 5FL7D 4TKMA 4HOYA 1PQPA 2YICA 3I6MA 4IFBA 3EXFB 3KB1A 3U80A 1SZCA 3BB1A 4B2LA 2O8EB 1HXHA 1ZI6A 3OPMA 4MQ4A 4DR6B 4Q24A 1B0UA 2F1JA 2HA6A 1TVEA 1Y9DA 1VLMA 2QDXA 1SVOA 4ZD6A 3KSBC 4KODA 1JPNA 2OCBA 3U3XA 3KQUA 3FLBA 3VR6A 4HPWA 2DPMA 1SC9A 2GS9A 4KQGA 1P2SA 1R0ZA 1YHNA 1XL0A 4ENPA 3HRHA 2F3PA 1ODLA 1QE3A 1W29A 2EOAA 1JTEA 3DJFA 3MTDA 4EUKA 1CJCA 3AF4A 1X1BA 3DKPA 1IIRA 3CR7A 4H7DA 2XMSA 5BYBA 1Y3IA 4RH3A 2CUKA 1N0UA 1IY8A 1DJLA 3X1ZA 4E33A 3B7GA 2LE0A 4E94A 2JLRA 3NIGB 1V4BA 1B41A 2Z2XA 4QXAA 5C7YA 1H8EA 2VATA 5ALMA 3GARA 3NT4A 1QGOA 3PNYA 4UJ3A 4QLAA 2ZM6B 3T5MA 4YXWA 3HZOA 2NV0A 1VPLA 1SCDA 2PGJA 3WICA 3PTAA 1EUCB 1E5QA 4B3XA 4G81A 5K7SA 4WOPA 2D0IA 2H08A 4LOLA 1SPBS 1UOPA 4UCQA 5EJGA 3DS8A 5GJWC 3C4QA 3TW0A 3EY4A 4WEOA 3MF4A 1I51A 4P3PA 2EJWA 3PPYA 5TSDA 4CR6A 3TFWA 1J56A 5HF6A 3HVHA 4EZBA 4JYAB 1YI1A 1FP2A 2LD4A 4OKNA 2W70A 3ORFA 2IYPA 2A4KA 3FUTA 3M82A 3QUAA 4JQOA 3MJRA 5IKEA 1DQZA 1UPUA 2VUIB 4TYMA 2IXTA 2PYIA 1PBNA 2HCTA 3I23A 4EEKA 1DMSA 1JLMA 2WHQA 3ZVLA 2UYOA 5AESA 1L8LA 2ZIVB 1ZZGA 1ULTA 1FRFS 1DJQA 3ZWVA 1NAIA 2KLBA 4IHJA 2OCGA 2KSQA 3WQBA 3UT5B 3QYAA 4Y2HA 5C8DA 3IGFA 4LXUA 3O3MB 4ZHQA 1EGMB 2J3JA 4BQOA 1U04A 4IVQA 2ZB2A 4TM8A 2J32A 4E07A 2IWHA 1GU0A 3LLSA 3L8CA 2NUAA 3FHOA 3EEYA 4PBRA 5KU7A 1O8CA 4OB8A 5TQ2A 1FFXA 4TT8A 3PVSA 3C15C 2V6JA 1SVIA 1XELA 5AW8A 4L0DA 4LYGA 1SELA 5C80A 5AW6A 1OH7A 1GXSB 1H2ZA 2QAJA 2IHNA 1H9CA 2B7LA 2X5XA 1N8NA 2OAP1 3R0IA 3RM3A 2Z30A 3U9LA 2A5YB 1EMDA 5AYVA 2FOXA 2P9HA 5IULC 1V35A 3D1VA 2DQSA 5KVVA 1HYHA 2VL7A 4NL4H 1DDGA 3CLHA 1UBRS 3FYUA 4Q00A 4ER7A 4NS4A 4NBUA 1H2FA 4G1EB 3PQ2A 1QUEA 2C9ZA 3O8LA 2ATEA 3ETGA 2C3PA 3UOWA 3HSYA 2VEOA 4KRFA 2Z5GA 2QZJA 3KSMA 1QU2A 3TJZA 3RAEC 5GINE 2D2IA 4DHWA 3DULA 3ZOZA 1PJQA 2P3LA 3GRFA 2NO1A 1DPFA 2VRCA 1U9IC 4IIHA 4QBHA 2D1RA 2FZLA 1ZCAA 5DBEX 2I55A 4FW8A 2R8EA 1DCMA 2JRLA 4DLWA 1KRWA 5I4KA 3HJGA 2FP3A 4O33A 4UBLA 3NIBA 4X24A 2BEUB 3RVSA 3TYXA 3W8EA 2X58A 4CTOA 1WSAA 1Y48E 5JLAA 4LZNA 3T7RA 4I4NA 2JH8A 1HT0A 3F1LA 4JL8A 4RY9A 5C52B 4PQYA 3FTFA 3PQ3A 1N5RA 3HHEA 5GJBA 2CCJA 2Y71A 4HUJA 4JS0A 4WNCA 5DLQC 4U7DA 3H5WA 2FEKA 3IXLA 2OFWA 2BFPA 1H6CA 3H3FA 1OGIA 1D04A 4V0SA 5DTEA 2QOEA 5B5SA 5I7OA 5I4BA 1WV0A 5CBPB 2YVUA 2N42A 1P62B 1FDOA 3ABQB 3I1JA 3LHIA 3PHLA 1XAGA 1G4HA 3EEFA 1U65A 4JJKA 3R3SA 3L8FA 2E4XA 3ZZTA 4DDHA 2GEJA 2PUJA 1IUPA 3C3DA 2RGAA 3AINA 2OWDA 1KDPA 3DZCA 4YC7A 5CYGA 4AJEA 2I65A 4LS3A 4I14A 2HA5A 3Q3VA 4R2LA 2X2PA 2Q99A 3TSCA 4PFKA 2O7RA 5E0OA 2DY0A 3W3AH 5FHQA 2GK6A 1SCUA 2VJYA 4AROA 1F7VA 5LUAA 7MHTA 3EXHA 2JEYA 1D4AA 2BZGA 2WWRA 4O5OA 4HUQB 4IDDA 5IAEA 3T99A 4AUKA 1JG6A 1C1DB 3TF5A 1Y34E 3EARA 4RTKA 4KFSA 3IBSA 1Q1EA 2V7XA 1PT9A 1VRWA 1NQ5A 2C3OA 2VP3A 3OTHA 3LHSA 3HJBA 3WYAA 2GPWA 3HWX1 3CNHA 1O95A 3N59A 3UA3A 4GLOA 1U1DA 2UZ1A 3H65A 4IHKA 1YZUA 3OAAA 5L95A 5I9LA 1KK2A 4J7UA 1T2FA 2YN0A 4P83A 1V95A 2XVZA 1OLUA 2GK4A 2WM3A 3C0KA 2I4TA 2FFQA 2JPDA 4PGAA 4Z1OA 1JZSA 2WZCA 3C97A 4FBMA 4LK3A 1ONSA 2JI8A 1F38A 3L7CA 3TCXB 2AOTB 3NHYA 4H4CA 4N9QA 4DCPA 3R41A 1QHNA 3MLBA 1C7QA 3EIHA 4MXDA 4A0GA 5BNZA 1IJKA 1Q74A 2VVTA 2YDYA 4JP8A 1YXMA 4C87A 4YRNA 1V6CA 3F2IA 4X65B 4NFHA 3S1LA 3K0SA 3PQ4A 4AVYA 4MRMB 3PE6A 1I1HA 1XPJA 1VPDA 2WJ6A 1BYIA 2G3YA 2CUNA 1UK9A 3BE6A 3ONDA 4IJWA 2CDNA 1XAJA 3C48A 4ARAA 1PAUA 3A7DA 3D3WB 4DCNA 4U1RA 3GRZA 4BIMA 4RVNA 1N77A 1F14A 3KPJA 2QMUA 3WB2A 2IWRA 3MPUA 3PL5A 4LXHA 3SD7A 5I3ZA 3BRSA 3LLCA 4RZIA 2N1MA 5EJ8A 16PKA 4I8DA 4Q9LA 3R6DA 4IJMA 2ZJ4A 5T8KA 3SZUA 2W83A 3WWZA 1QYXA 4ODIA 2HD4A 3BXHA 3I1YA 1E9BA 4ZOLB 3SDSA 4ETIA 4B6RA 5JRDS 5B7PA 1NKVA 4D26A 2QIPA 1R6TA 4IHQA 2WVHA 3FVQA 3W0LB 1FLDA 4UU0A 5DXJA 1Y4DE 1P45A 3CX3A 1C7FA 1TA9A 3QJ5A 3TKYA 4RIIA 5J2UB 5KO2A 5E38A 4R1QA 3SZRA 4B3DA 2GYYA 5F7ZA 5ILQA 2ID7A 3LUCA 3E8MA 3PQ5A 4M1EA 4EZEA 1W94A 2B99A 2N1BA 4KGDA 4FZVA 1I3NA 3NATA 1KXJA 4ZRDA 1H69A 3WBBA 1QRAA 2OXCA 2AK3A 4FBGA 4F5YA 5FA5A 3GR6A 4J2TA 1A8PA 3I9LA 4HRXA 4RLFA 3KHKA 3NNNA 2G9QA 3O73A 1RYBA 4KZKA 5FUVA 4ZOLF 1J2YA 1B6RA 4GMXA 1FS6A 5AJWA 4HP8A 1N0WA 3KAJA 3ZZ1A 2H2IA 3SC6A 3HJRA 1GKUB 1SOVA 3HDTA 4KGVA 1CEYA 1EVJA 3IVAA 3LTNC 1C4KA 3I3OA 3NTRA 3P9ZA 1QHYA 2POQX 4IR7A 1A8SA 1NF3A 3ML1A 3O4IA 5CXSA 2ATXA 1CQIB 2PGNA 5K1ZA 5BORA 1Q0LA 2WP8J 3K9BA 1CUFA 3EIWA 4PHCA 4ZOLA 2ODAA 3KOMA 4D9FA 4DGQA 4GOOD 3B9BA 3FYCA 4UBJA 2OD2A 4L6CA 3SP1A 1PYOA 1QU3A 3WA6A 1KY3A 4F56A 1ZA1A 2O0JA 1H2HA 2FYTA 1EQAA 1QFMA 3SBDA 3LYLA 2CNBA 4PRYA 1DKMA 4TM7A 4LOHA 4HEA1 1ACLA 1NBMD 2I03A 3PFKA 5L8VA 5BUSA 3ICVA 1I5EA 2OUKA 5CDTA 3OI7A 3GRAA 3V7FA 3BWDD 1K98A 1PU2A 2CK3A 4OG2A 2PKYX 1KSJA 3P9YA 5FPYA 2NO4A 1H4QA 2O06A 1WU7A 4L2IB 4JQCA 4AO7A 4B40A 1ILWA 4KE8A 5M3BA 4UTRA 2UXCB 5F7JA 4OK6A 3H5VA 5FBRB 1G59A 4LV6A 3TOZA 4OH7A 5DHSA 2FSVC 1F2VA 4HLUA 1M1YB 4FDVA 1THZA 3O4JA 4L4ZA 4RCVA 1GLGA 3QVWA 3UAGA 2BLNA 3RVPA 4N5LA 2WWXA 4IDGA 5I9IA 3I9JA 4RH1A 4U3JA 2C5FA 3VHQA 4BX8A 3T0FA 2R62A 2F3TA 2HY7A 3FMIA 1V41E 1FNSA 1LF5A 3VSAA 1X42A 5CLLA 1NIPA 1NZFA 1N2CB 2C61A 2X0JA 1QRSA 5IDXA 1AHHA 2C4TA 5AHWA 3I45A 3WIUA 3QBEA 3USCS 5HYVA 1U7ZA 3LGXA 4DFDA 4UTPA 1AKQA 4I3FA 1E96A 4MA4A 1U2GA 4NH0A 3QLUC 4M76B 1GPBA 2YV4A 1PR6A 3G1UA 4KV9A 1F6DA 1M2JA 4BMOB 1H0SA 4KPUA 3GP3A 4V3BA 1SY7A 3WLNA 5NLLA 1BW9B 4BMSA 4DRXA 4YRGA 4ZEVA 1A04A 1JHMA 3ABRB 3EYWA 3WWCA 5E4JA 5HQ3A 3Q87B 3RT7A 3CKMA 2FWJA 2YZ7A 2B83A 1NRXA 4G0QA 5I9BA 4FQ8A 2UZ0A 1GADO 1LDYA 1GN9A 4CODB 1GTJ1 1E2JA 4KL8S 3ZV3A 1C81A 2ZJ3A 3CGWA 4QWWA 3KUKA 5IHXA 1XA4A 1P5FA 1NSYA 1NLYA 2H5JA 1T36A 2IYQA 2PGXA 1SRQA 3OFJA 3SQWA 4P0PB 5JNVA 1E2BA 2CF6A 4LBWA 2IF2A 2EEPA 4D9KA 2TMGA 1DV2A 1PNQA 2A4MA 4FEEA 5KJ1A 1CY0A 3LZCA 3LY9A 4NHEA 2GN6A 3K9HA 4AKGA 2ES4A 3M6IA 1RWVA 3K0HA 3X1YA 1OZHA 3I01A 3FLEA 4A9AA 4ZYYA 2CLMB 4HKTA 1OIWA 2RI6A 3IP3A 3SLKA 4GXNA 3V1LA 4HNVA 4HNGA 2IW3A 3IILA 4C0AC 3DLIA 2V8BA 1T0HB 3B89A 1GPDG 1CRPA 4W7HA 4L74A 2VNKA 3ZVNA 3W5BA 1MOPA 5K3FB 2ZAGA 5A6VA 4GDFA 5KYYA 4BCCA 4WN3A 2C4WA 2WFMA 3S2ZA 5IK2D 4AN0A 2O5CA 2G8NA 3WLKX 1QZTA 1CT9A 1FJHA 4PHGA 4OHXA 1NKTA 3AW8A 5I7EA 1Z0AA 4RZSA 4DL9A 3IL2A 1NW4A 4R8RA 5TE9A 4AWAA 1V4NA 2QM0A 4C9BA 2HSEA 4MDFA 1H9BA 2XA9A 1Z5GA 1D0IA 3DAFA 3IBGA 5T8KC 2I62A 3AEYA 1HC7A 3QKSA 4QUJA 2PU5A 2FKNA 4EDFA 3AF3A 2FMXA 4N7MA 2H16A 2J6CA 3VYVA 4CM7A 2VTKA 2ORYA 3VTZA 3NTLA 2CXTA 1UBTS 3KX2A 1Z12A 2IGBA 3L0IB 1P2FA 4HNAB 5FWNA 1B23P 2ZIAA 3QFFA 5K0ZA 2J7PD 2NACA 1NQUA 3QU2A 1UKZA 1UODA 4IG4A 5EE9A 3GLHA 1N7IA 1UK6A 3LOQA 4G0NA 5DX8A 1TCBA 3GZ4A 2LW7A 2PSFA 4D98A 1OHHD 2Q5LA 4RO0A 2DEUA 1G8YA 1VE5A 3MFQA 1AV6A 1JDNA 3FTPA 3AB8A 5CA0F 3WP1B 3KXDA 4Z7JA 4LCJA 4ZDWA 4CM1A 1HG1A 4CIVA 4RZQA 1ZKMA 2Z8ZA 3O8CA 1V1MA 4AS1A 4RHYA 4MV8A 2Q5QA 5HS6A 1VFPA 3JQ9C 3PFFA 4HXYA 1SU4A 4X45A 2Q28A 1FFSA 1QPGA 4OSEA 2EDAA 4CPDA 5HQ3B 4RPJA 2PNFA 5IT5A 4TTQA 3IVRA 1RRPA 3IJRA 4EAAA 3O1HB 4JUBA 2DFPA 2VLIA 1QGUA 2CLKB 4NCXA 4BQNA 4ZYZA 4HAXA 1F8UA 3HJHA 4MCHA 5CP8A 3FNGA 3KPYA 3EGCA 2VDQB 3AR9A 4NDAA 2BJHA 3MWEA 4EY6A 1NI3A 2BONA 4KDFA 4MW0A 1RYMA 1EVQA 2H6EA 2DFKB 1KOJA 3B1XA 3NOVA 3OX4A 2FX5A 3DDSA 3PB3A 1FLNA 1JPVA 4IEFB 2IOFA 4WT7A 2WB2A 1BHQ1 2GYWA 1IATA 2JFZA 3FTDA 4G5YA 2PTGA 3GXOA 2JJ8A 4PNZA 5D00A 4PO9A 1X77A 1GZSA 1RRVA 4ZJYA 1XQYA 1KI6B 4JJIA 4R0VA 1P8AA 1GPH1 3CISA 1E1CB 3HCOA 3RU3A 2CL5A 3LY5A 1PS0A 4X63A 5FTWA 1L7MA 3IMCA 3RC3A 1NR7A 1JKMA 3FPHA 4U2KA 2C2BA 1G8FA 2ZLBA 4DBLC 3RU7A 2B69A 1KJIA 2C9MA 1R4MA 1XVTA 1ZN9A 2A5FA 1UQTA 3ILVA 1J5XA 4G9GA 2HO4A 1T5TA 2M1XA 3AIMA 4D6PA 2B6HA 1KY4A 3DJYA 5EPOA 2TYSB 2C59A 2K6GA 1B43A 1RHRA 1YWGO 4O1IA 5INTA 3HVRA 2F64A 3ZHXA 4NOKA 5HQJA 4M22A 2YFHA 1NUPA 3TW4A 1G6OA 3U3KA 3KZKA 4G07A 3IEUA 5KX5B 1RS0A 4BCBA 3DZIA 2EBUA 4S1VA 2ASEA 4YAWA 3BWVA 2HWUA 5DHFA 1J9ZA 3KJFA 2PLNA 2A9JA 5B58C 4J0KA 3ABZA 1ARZA 1C4XA 1N5JA 1T9GS 1QH8B 1MX3A 3KT8A 1XU4A 5EPEA 5ER6A 5C53B 4JUCA 5JO0A 2GJKA 1EHCA 4DXDA 1Q7TA 3DDWA 1K7XB 4DRYA 3G0GA 4W5HA 1QP0A 2EC5A 2QLMA 3OCVA 3VC2A 4Q1EA 4KLCA 1C0KA 1J0XO 1GQSA 2AFIE 2ZP1A 3FI9A 2L18A 1J6UA 2PXHA 3GFOA 3I2YX 1P5JA 3PKJA 2QE7A 4HFJA 5DOVA 1IMJA 3NS7A 4V03A 5H3CA 4DVJA 1UM9A 4O25A 5MFZA 4PE5B 2QG4A 1R1DA 3T7KA 2GTHA 2I6GA 3MAJA 1JJIA 3OURA 3ZXYA<