5IUXA

Glic-v135c bimane labelled x-ray structure
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIESYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSCDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Identification of a pre-active conformation of a pentameric channel receptor.
pubmed doi rcsb
source organism Gloeobacter violaceus (strain pcc 7421)
molecule tags Membrane protein
total genus 91
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5iuxA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5iuxA01
2XQ6A 3IGQA 2XQ9A 2WNJA 5L4HA 2BG9B 5AFLA 3RHWA 3SIOA 4X5TA 2M6IA 4ZK4A 2BJ0A 2X00A 5BW2A 2BYPA 4QABA 2X00D 4ZJSA 1OEDC 2BYSA 3UUBA 5AFHA 1OEDE 3EHZA 4LMKA 3UU4A 4ZR6A 2LKGA 3ZDHA 3JADA 1OEDA 5IUXA 2Y7YA 3P50A 4BQTA 3RQUA 2W8FA 3WTMA 2WNLA 2MAWA 4QH5A 3UU3A 2XQ3A 2ZJVA 2WZYA 2BYQA 4ZJTA 5AFNA 3TLUA 2LM2A 1UX2A 2Y56A 3TLWA 2QC1B 2XQ7A 5JMEA 4ILAA 2XNVA 2PH9A 3JAFA 3GUAA 4UY2A 2YOEA 1UW6A 2M6BA 4B5DA 2UZ6A 4UXUA 3UU6A 4ALXA 2BR7A 5HEOA 4NPPA 1I9BA 2VL0A 2XNTA 5SYOA 4TWHA 4UM3A 4COFA 4IREA 3U8NA 3SH1A 5BRXA 4HFIA 2XQ4A 5HEHA 2XYSA 4QH4A 4NZBA 2XQ8A 4HFHA 3WTKA 2YMDA 2YKSA 4LMJA 5TVCA 5HEUA 3UQ4A 3PEOA 4ZK1A 3WTNA 2XQ5A 5AFMB 3UU8A 3RI5A 3C79A 4DBMA 3ZKRA 2BYRA 2XNUA 4XHEA 3U8KA 3JAEA 4ILBA 5BP0A 4F8HA 5LXBA 4UM1A 2BG9C 2LKHA 3LSVA 2Y58A 4TWFA 4QH1A 4IL9A 4HFCA 5KZUA 2BG9A 5HEJA 3TLSA 4HFDA 4TNWA 3TLVA 3UQ7A 4QAAA 4HQPA 3WIPA 4AFHA 5CFBA 2ZJUA 2BYNA 3U8JA 4EZ1A 3WTHA 1OEDB 3PMZA 2PGZA 3C84A 4HFBA 4A98A 5KE4A 2Y57A 3SQ9A 3TLTA 4XK9A 4Z91A 2BR8A 5J5FA 4FRRA 2KSRA 5AFKA 2XZ5A 3ZDGA 5CO5A 5AINA 4ZZCA 3U8LA 4AFGA 4TNVA 5L47A 3RIAA 2YMEA 5L4EA 4WV9A 3SQ6A 5AFJA 4BFQA 5J5HA 4ILCA 4Z90A 4A97A 4LMLA 2BG9E 4QACA 3RIFA 5FJVA 2C9TA 3T4MA 3WTIA 4PIRA 5HCMA 5HEGA 3UU5A 4AFTA 4TWDA 5J5IA 5HCJA 4UM3S 3EAMA 3WTJA 3EI0A 2W8GA 3P4WA 2WN9A 3WTOA 5J0ZA 2XYTA 5J5GA 4ZZBA 1UV6A 3RQWA 2WNCA 3U8MA 4HFEA 4UM3P 2LLYA 4ZRUA 5AFMA 2XZ6A 2XQAA 5LG3A 2Y54A 3WTLA 2YN6A 4IL4A 4D01A
chains in the Genus database with same CATH superfamily
3RHWA 5LMUT 3OJAA 2BJ0A 4DBQA 1MIYA 5BW2A 3HKDE 2W4XA 2XTLA 2KT9A 4YJ2E 3P4QA 5C8YE 4BQTA 3T1HT 3KV9A 2WZYA 4X20E 3Q5DA 4DV0T 4B3ST 4LF4T 3N2OA 4O8SA 3TLWA 4QXHB 4BJNA 3M65A 4P0BA 5AQPB 1V9DA 5SYOA 3PUZF 4TX5A 4UM3A 4IREA 2JQ9A 4JI5T 5HEHA 3E08A 4NZBA 3WTKA 2N1GA 2VKOA 5HEUA 2QVAA 1ZKEA 2XQ5A 3ZKRA 2ES0A 4ILBA 4X65T 3EUHA 2IC6A 1M62A 2W62A 4QH1A 4IIJE 2JIWA 4TNWA 2ZJUA 3L09A 2DCFA 4AKHA 1UK5A 1YW0A 2BR8A 2NR4A 4FRRA 2K9AA 4TNVA 3B5MA 4WV9A 2P9BA 1HR0T 5AQKB 5DQWA 3UULA 3ZYLA 4H63H 1WFDA 3P4WA 5FY1A 3W15B 3TKLB 3ZLIA 2YN6A 3RH3A 2XZ6A 3I9YA 3MA9A 2WNJA 5L4HA 5LOVE 4X5TA 3FXDB 2XQYA 3K1SA 5LG4A 2BS3A 2LSJA 3RQUA 5FMNA 3HR0A 2DL1A 5AFUL 3PUGA 1UURA 4O2AE 1ZP0A 5IYZE 4CI3B 3C4WA 3BQIA 3SOLA 1FIOA 4DR4T 3FBZA 5LCYA 3KDSE 3LK3B 3O4XE 4HFHA 3ANWA 4LMJA 4ZK1A 4U7IA 3WTNA 5BMVE 1KEYA 1BR4A 5BP0A 5LXBA 3BQLA 2LKHA 1MNDA 5CB4E 4CI2B 4IL9A 4HFCA 4U33A 2EHOA 4CZZB 3CMLA 2V6YB 4FI5A 2DI4A 2J47A 5FY7A 4ZI3D 3C84A 4UVBB 3GN5B 2IUBA 5F8PA 3CVRA 2DWKA 5AINA 3K3QC 3PUAA 5LGNB 4TUYE 2D9DA 4JLEA 4UVAB 3PJAA 3N9MA 4U72A 4UV8B 3T1YT 4GK0E 2C5KT 3N9PA 1BR0A 3C4ZA 3KBTA 3ZN1B 3RQWA 2UU9T 2E9XB 4ISSA 1XNQT 3OPCA 3VU7H 4ZRUA 2CPTA 3FXEB 2CXDA 5C2TA 2XQ9A 2WQYA 2FJAA 2VURA 4H9SE 1MMNA 4DV4T 2BKPA 1E2AA 3L39A 4UIGA 3JCFA 3ZJ2A 1NWMX 3ZT5A 4LF7T 1BR2A 1N32T 3UU3A 2ZJVA 2BYQA 3RKOA 4DUYT 4PFPA 5HXEA 1HNZT 3U78A 4DBRA 4UY2A 2IDOB 5KMGP 2X68A 3MACA 4COFA 3SH1A 3DJBA 5LHIB 4OYKA 2D0TA 4ANJA 5LJMA 4IDNA 3MZKB 4HFVA 5FXVA 2K5BB 1KNPA 5AQNB 2BBJA 1GQEA 4DV7T 4H9RC 1T98A 4YY3T 4O4JE 3FB2A 4GKJT 5CJ5A 4U7YA 3AVRA 4X1YE 3TLSA 3IA3A 3ZMVB 3QK6A 4OHFA 3I0OA 3A5XA 3NRYA 2Y57A 3PUSA 1T8BA 1Y01A 3BQKA 5AFKA 3UT5E 2YDRA 4DVDA 4YXDA 4LFCT 1LVKA 2YU1A 3J9X1 2WM9A 1IJ5A 4A5XA 5J5IA 5EK4A 3WTJA 3ZYKA 5LHGB 5F3JA 1HX8A 2X9YA 3MXZA 3UUXB 4ASKA 2H89A 2PJQA 2X00D 1OEDA 3AE9A 3NWIA 5LGUB 4MHCA 2BVMA 5J1GA 5AFNA 2M67A 4X62T 2Y56A 4ZHQE 3AEBA 2V26A 3ZC1A 4ILAA 4ISTA 4XBFB 2XNVA 2UZ6A 4EXTA 4EEDA 2VK9A 3AE8A 2LEHA 4TWHA 2XYSA 4WBOA 2H7VC 1T7SA 2ZM2A 2Y8DA 5J2TE 4UF0A 3C79A 3IF8B 4WYVA 3AAAB 1VRBA 2BS4A 3ZC0A 3H3MA 5HXRA 4AFHA 1XZYA 1KNZA 2B1EA 3SQ9A 4XK9A 4AI6A 2Z6EA 3AAEB 3I0QA 3LK42 3ONLC 1IBKT 1HCIA 5FVKA 3CIRA 5L3DB 3PV0F 5AQMB 1UX5A 3T4MA 3AA7B 2VWAA 3IBPA 4PIRA 4CN4A 4WBNE 3EVYA 2D2SA 3HKEE 3WTOA 5E0OA 4YFSA 3AE5A 2KMFA 2IMLA 2RP4A 2XASB 4HTEA 1FJGT 3RYFE 3KINB 3FZLB 5AFLA 4JI1T 1KNRA 2BYPA 3HI2A 4U74A 3RYHE 3KV6A 3AXJB 3JADA 4DNDA 4MBQA 3AVSA 1MNEA 4ZJTA 2EHOC 1BR1A 2X9XA 1D0YA 2J1DG 4B3MT 2BS2A 2ZM8A 4E7SA 1XDPA 3P7IA 4DMWA 2E9XC 3O1JA 4GIWA 2FJEA 1M7KA 1OXZA 2N9DA 5HXHA 4HE8A 2X66A 3RI5A 2XNUA 3QOFA 3FHNA 5FXZA 4OYJA 1LRZA 3OBVE 5JDMA 3UQ7A 2WS3A 1IAPA 4ERRA 4AQYT 4MFRA 4WW0A 4O2BE 3AB3B 2XZ5A 4PNIA 4BFQA 3DTOA 1LKXA 5ABHA 4AQGA 3JC6C 2WP9A 1Y64B 2BVLA 3T8OA 4ZZBA 3V5SA 2X9WA 3ZSTA 5AQIB 1ZV4X 2LT3A 2DNXA 3IGQA 4UELA 2RPAA 2M6IA 1U5PA 2J4GA 2X00A 1XDOA 3ETVA 4LF6T 4ZR6A 2X51A 3RYCE 3I1AA 3RYIE 5FY0A 2V7MA 4I4TE 1I6ZA 3SFDA 2E5VA 4PJNA 2XSAA 4JI2T 2YOEA 4HWFA 2M6BA 4DV2T 5HWXA 2XHEB 5TAOA 3UFGA 2VL0A 5JTGA 2QYWA 3FZMB 4HFIA 3VRAA 3IEEA 4MALA 4YJ3E 5LB7B 3HKBE 1XWMA 2NOXA 4ZEYA 3VRBA 3MK7C 5ADXL 3ZN0B 4B3TT 3LG7A 5EK2A 1Z0PA 3OYZA 2A9UA 3PUXF 3K3NA 1HG5A 1IBLT 2LSYA 3PMZA 4AXPA 2V1DB 2W66A 2KSRA 5CO5A 2VB6A 3AA6B 2DWGA 4DUZT 3RPUA 4NUVA 2X0LB 2YEVC 2XUEA 4Z90A 4IE7A 2YINA 1ZOYA 5FJVA 2FJDA 2Y6XA 2Q9QA 2ZM6T 2XAGB 3ONXA 3OKQA 4NIQA 1HNXT 1X79A 1UCUA 3ZDHA 3FZFB 3C98B 5AQVB 4ZK4A 3C50A 1FMWA 4IDOA 1SUMB 5AQUB 3RIUA 1SHZC 2BYSA 2NW7A 5JRCA 4KHPT 2JQQA 1QUUA 1FMVA 2X67A 2XQ3A 4ZXLA 2LM2A 2W00A 4JI3T 4YT0A 3O1HA 4YSZA 2CCQA 3RRWA 3AE3A 4UXUA 4KMCA 4PAGA 5FNVE 1DU2A 5H6QB 2JQHA 3CQGB 2YDQA 2VQET 3CQXC 5FVLA 4XHEA 3AE4A 1E1HB 2KLQA 3M3ZB 2VKDA 2BG9A 5AQQB 4HFDA 1XNRT 2IW5B 3OTOT 4QXCB 4EZ1A 4ZI2C 4AISA 5AQOB 5AQFB 4UV9B 4L0RA 4HWDA 3ZT6A 2WBLA 3RIAA 4GYSA 1J5ET 3R84B 2H88A 2BG9E 5HEGA 5F5WA 4CXXA 4HWHA 3ANWB 5KDMC 3PU3A 2W8GA 3ZCIA 5FYMA 1UV6A 4H9NC 3LK2B 5ABFB 3SRZA 3N9LA 3AE7A 3RGLA 1S94A 2CXFA 4EYYR 4JUYA 3P4RA 4L9IA 2EHOB 4NXNT 3R6NA 2CBJA 2LSGA 3VHLA 2VASA 3A8YC 2WB5A 3FZKB 2LOPA 2MAWA 2HH7A 4U2YA 5L2LA 3ZJ1A 4U3CA 3Q5XA 2XQ7A 3ZMUB 4EV6A 3CWZB 3UTKA 4I55E 4K0KT 1JNZA 4PW8A 2KWHA 5DABA 5CGMA 1US7B 5L3GB 3LBXB 2W63A 3PJAJ 4WNKA 1KK7A 3RX6A 4UVCB 2CBIA 3P8CD 4UXNB 4TWFA 3TLVA 2C5JA 4HQPA 4C91A 5JR9A 2GK9A 4H9OC 4H9QC 4JYAT 4YHHT 3PUWF 1YKHB 5DQVA 3TLTA 4Z91A 4AFGA 3L3PA 2G0UA 2KZ7B 1JNRA 1EZ3A 4DR5T 1E7PA 5FXWA 5HCMA 3UU5A 4AFTA 5AQJB 3VKGA 4IDQA 3F31A 2AXDS 4PJMA 4PFOA 2CLYC 3G06A 4CXWA 4M1PA 4LFBT 3RRCA 4DR3T 2LLYA 4CI1B 3CQCB 3U8LA 3AA0B 4H9PC 3SIOA 2XSBA 3RF1A 2JMKA 2YK0A 2NP9A 1YQ4A 2CE7A 2X0YA 2LKGA 3ZMSB 1X9BA 2K24A 5GONE 2A2FX 4PJLA 5CA1E 3F57A 5JDLA 2MBGA 4DO0A 5IWAT 1WRDA 4NXMT 2XZEA 1CUNA 3U8NA 2WDRA 5TVCA 5LP6E 4TN7B 3AAIA 5LJNA 5CA0E 1MIVA 4TV8E 2XJ7A 2KWIB 2Q9QC 4GKKT 2CEAA 3WI3A 2CXLA 1I94T 2DLRA 4HEAA 1OEDB 3EDUA 2HPLA 4A98A 4I0UA 4CQIA 5KE4A 3KV5A 4CXYA 4X64T 1UGOA 5JDGA 1YKEB 2PG8A 5L3CB 2BBHA 4DMVA 3RIUC 3KFWX 1D1AA 1HX1B 2XM2A 3WTIA 2XAQB 2CWOA 4UF0B 3C4XA 3E22E 1VCSA 4HFEA 2ACZA 5AFMA 3RC8A 2XQAA 2KINB 2VKJA 4EOZB 2SPCA 3UUBA 4JI0T 2IC9A 2WWUA 5HYAA 5L3BB 2A72A 3N9QA 4I43B 4JI8T 3N9OA 5HEOA 4J2CA 4NPPA 4H63V 3PTRB 3ZCJA 5C3JA 2LSKA 2XQ4A 5FL0A 3ZMZB 4KUMB 3UQ4A 4KP3C 3PEOA 2LE8A 3MJXA 4DBMA 5FP3A 4UM1A 2WMNA 2BKOA 3NRXA 2IAKA 2V5DA 5HEJA 4QAAA 1YD8G 5A1LA 3D0TA 3K3OA 3ZPOA 3WTHA 5LGTB 2ZLYA 3SFEA 4EB6E 5AQRB 5LMNT 4ZI7E 3UFEA 3NZPA 3SQ6A 4IDPA 4DV6T 3E0ZA 3NVOA 5KXJA 4JI4T 2CHOA 4HN9A 2LRKA 2X9HA 4NUUA 3LDQB 2FUPA 5HCJA 2OA5A 3C51A 2WMOA 3Q2MA 2K3WA 5J5GA 4GK5E 1D0ZA 4UM3P 4JI7T 3PURA 5LG3A 4IL4A 3PE0A 5FKYA 3SWHA 4Z8XA 3ZEFB 3EDVA 3Q5WA 2WU2A 3WTMA 4QXBB 3L8RA 4JBWF 4QH5A 1UX2A 4OX9T 1HNWT 1HF8A 1UW6A 3NKZA 4CN6A 4X1KE 3WAKA 1UUSA 4IHJE 2N2NA 1MMAA 2UUAT 2UXCT 1S35A 1Z8UA 2YKSA 3ETUA 4JEHB 2X0HA 4U2ZA 2ZMAA 2E9XD 3UUNA 2OLTA 1ZHCA 2RA1A 3ZSSA 4N78D 2V5CA 2I59A 2WZHA 4QX8B 1N33T 2LJLA 2VVNA 1KFYA 1WR0A 3ZDGA 2CLYB 2WU5A 4EEBA 5HXSA 5LYJE 3FZHB 4A97A 3N5LA 4DR2T 2WDVA 2HPJA 2CMRA 1WR6A 4DV1T 3P4SA 2WWVA 4TWDA 3V5UA 4X1IE 1N36T 3UUMA 4C90A 3JC6D 3EI0A 2L9QA 4YTMA 3B13A 4IE0A 3IHRA 4D01A 4F6RC 4LF9T 2LRLA 2ODUA 4UEMA 3LJCA 4EZ4A 3N2GE 5JVDE 1OEDC 2DHRA 3N2KE 4G2AA 2B76A 1SA0E 3EHZA 1U4QA 1O3XA 1WLXA 2Y7YA 3P50A 3PUYF 5JH7E 4LF5T 2JQKA 1R8IA 3KBUA 2YDSA 2QC1B 2MYSA 3CX6B 2XAFB 5IHYA 4B5DA 4JV5T 4ILUA 5BR8T 2Q9QB 5M4YA 2LHNA 3HL6A 4ZS2A 3ZMTB 4DIDB 5LBMA 3S4UA 1HFAA 2UXNB 2MOZA 2YU2A 3GA8A 3AEAA 3UU8A 4CN1A 1W09A 2BYRA 2I0MA 2J62A 3LSVA 2Y58A 4ZI3C 5JRCB 4O4IE 3I9WA 2QRXA 4KHZF 3KV4A 5JDNA 2L3LA 2MPKA 4QHOA 1YQ3A 4KX6A 2W2UA 3BK9A 3ABVA 5JDFA 5JDHA 2JPFA 3U3IA 2WNCA 3PUQA 4YSYA 5LXTE 1IZNB 5AQHB 5LBQB 2XAJB 3SS1A 4UR9A 2BG9B 2NTXA 4TV9E 4DR1T 4IE6A 4DR7T 5AFHA 2IHR1 2V6YA 2BDEA 4Q25A 4K0UA 1UX4A 3GN5A 5ABFA 1FEWA 3AE6A 2NW8A 4DV5T 3KVBA 3C64A 5L3EB 4TZ4C 2XNTA 4YHJA 3QNUA 3VR9A 2JMHA 2MTQA 2R6GF 4A56A 4B6XA 4IGUA 2E9XA 2I6HA 2NTYA 3VKHA 4QX7B 4PJJA 3JAEA 4F8HA 2E2AA 1WYBA 5HWYA 3X1DA 3EABA 3HKCE 2W61A 1SE7A 4ZS3A 4XZCA 4EIWA 3OVUA 2LM9A 5AQSB 3AEDA 4L5GA 3HA4A 2VKHA 5KX5E 4ZI2D 3N9NA 2CHNA 2AE9A 3LBXA 2WY2A 2FJBA 2CA5A 5LNKA 5L47A 2YMEA 1G73A 4EZHA 2QA7A 1W0AA 4ADZA 3P4PA 2D0UA 3ZT7A 4MLKA 2V8SV 2W67A 2E5LT 2WN9A 5J0ZA 2XYTA 5FXXA 1KF6A 4U31A 1MMGA 3QB5K 5EK3A 4AQFA 2V7IA 4XAXB 5JR9B 4LMKA 4V1Av 1W0BA 4EGWA 2W8FA 3O1IA 3H3AA 5LA6E 2PFVA 3TLUA 5JDQA 4ZOLE 3H37A 3MKDA 2PH9A 3GUAA 2IIUA 1ZEEA 5BRXA 3F2EA 2XQ8A 4QWNB 4KI0F 3B57A 4GOUA 4YTPA 1NENA 1H7CA 3QB5A 3U8KA 4AKIA 2JJ9A 2UUCT 3OYXA 4OFZA 3WIPA 1XMOT 1D0XA 3DP7A 2W0GA 1CHUA 2PGZA 4AIUA 1WCRA 4HFBA 3K8PC 4DR6T 4LFAT 4PK6A 2F4VT 5J2UE 4OK0A 1VCTA 5AFJA 4ILCA 3KVAA 2XY8B 2C9TA 2H3RA 2C5IT 3AE1A 4IE4A 4O4LE 5JREA 4X66T 5AQGB 2VL8A 4HWCA 3U8MA 2ODVA 5HXCA 3CPZA 3WTLA 2Y54A 2WZIA 3CX8B 3PU8A 1J1JA 3ONJA 3RKGA 2WCAA 5ABEA 2HN1A 5FL1A 1AJ3A 4B3RT 5LHHB 2A3DA 1D1BA 1OEDE 2CWYA 4BA9A 5L3FB 2BZBA 5AQTB 4PK5A 3RC3A 4YTNA 1QSDA 3AEEA 2VQFT 2D5UA 2VVSA 5JMEA 2JRKA 3JAFA 1W9RA 4GYRA 2UUBT 1B7TA 1J5WA 4ALXA 3AEFA 1QLBA 2Y48B 1G8XA 2ACXA 3ESLA 1LVFA 2YMDA 2CM0A 3J7Yq 5ABGA 2NW9A 2PBIA 4IT4A 5H6RB 3GMIA 5AFMB 4YSXA 2UXBT 3CKDA 2BG9C 3NBXX 4QKNA 1NAFA 2Q9QD 2WSSV 4P1NA 1T72A 3AXJA 3NZQA 5DJQC 3QUJA 4AKLA 5J5FA 3LFMA 3QC9A 5ETWA 2ZM0A 1L0VA 3ZYMA 4ZZCA 2WDQA 1N34T 1IJ6A 3O9XA 1WYCA 1IBMT 3AE2A 1HG2A 3PDYA 4LF8T 5AQLB 4G63A 4QACA 3RIFA 5EZYE 2K48A 4BAYB 2C0SA 2WAUA 4AKRB 4UM3S 3EAMA 4WZXA 3Q9DA 4FJOA 2E8IA 4BJMA 4HKAA 1D1CA 2BKNA 2XQ6A 3PUVF 5JQGE 4HWIB 3FBLA 1YXRA 1HS7A 4JEUB 4ZJSA 4QABA 2KNDA 1XMQT 3UU4A 4YLHA 5IUXA 4O4HE 2WNLA 3GWHA 2V7LA 2HHHT 1OWAA 3Q5EA 4HGAA 3AEGA 1MMDA 3RLFF 3WAJA 3UU6A 2BR7A 2PTFA 2XM1A 1I9BA 1HTJF 4E7ZA 4IDZA 2CRBA 3CX7B 4QH4A 3VR8A 4I50E 2H7OA 2KXPB 4PK4A 4DV3T 5KZUA 2UXDT 5JR9C 2OV9A 2LOSA 5CFBA 2BYNA 2EHOD 3U8JA 4P09A 2V6XA 4AKGA 2NWBA 4KBMB 4IE5A 2HN2A 1VOMA 2V7JA 2XPKA 3AA1B 5L4EA 1MIWA 5J5HA 4AQFC 2LSIA 4LMLA 4P0AA 2LHRA 2UXXB 3A7MA 4EAHA 3CK6A 4JI6T 1NEKA 2QGSA 3AECA 2XAHB 2V7KA 2L8KA 2FBWA 4EYUA 5HAXA
chains in the Genus database with same CATH topology
2XQ6A 3IGQA 2XQ9A 2WNJA 5L4HA 2BG9B 5AFLA 3RHWA 3SIOA 4X5TA 2M6IA 4ZK4A 2BJ0A 2X00A 5BW2A 2BYPA 4QABA 2X00D 4ZJSA 1OEDC 2BYSA 3UUBA 5AFHA 1OEDE 3EHZA 4LMKA 3UU4A 4ZR6A 2LKGA 3ZDHA 3JADA 1OEDA 5IUXA 2Y7YA 3P50A 4BQTA 3RQUA 2W8FA 3WTMA 2WNLA 2MAWA 4QH5A 3UU3A 2XQ3A 2ZJVA 2WZYA 2BYQA 4ZJTA 5AFNA 3TLUA 2LM2A 1UX2A 2Y56A 3TLWA 2QC1B 2XQ7A 5JMEA 4ILAA 2XNVA 2PH9A 3JAFA 3GUAA 4UY2A 2YOEA 1UW6A 2M6BA 4B5DA 2UZ6A 4UXUA 3UU6A 4ALXA 2BR7A 5HEOA 4NPPA 1I9BA 2VL0A 2XNTA 5SYOA 4TWHA 4UM3A 4COFA 4IREA 3U8NA 3SH1A 5BRXA 4HFIA 2XQ4A 5HEHA 2XYSA 4QH4A 4NZBA 2XQ8A 4HFHA 3WTKA 2YMDA 2YKSA 4LMJA 5TVCA 5HEUA 3UQ4A 3PEOA 4ZK1A 3WTNA 2XQ5A 5AFMB 3UU8A 3RI5A 3C79A 4DBMA 3ZKRA 2BYRA 2XNUA 4XHEA 3U8KA 3JAEA 4ILBA 5BP0A 4F8HA 5LXBA 4UM1A 2BG9C 2LKHA 3LSVA 2Y58A 4TWFA 4QH1A 4IL9A 4HFCA 5KZUA 2BG9A 5HEJA 3TLSA 4HFDA 4TNWA 3TLVA 3UQ7A 4QAAA 4HQPA 3WIPA 4AFHA 5CFBA 2ZJUA 2BYNA 3U8JA 4EZ1A 3WTHA 1OEDB 3PMZA 2PGZA 3C84A 4HFBA 4A98A 5KE4A 2Y57A 3SQ9A 3TLTA 4XK9A 4Z91A 2BR8A 5J5FA 4FRRA 2KSRA 5AFKA 2XZ5A 3ZDGA 5CO5A 5AINA 4ZZCA 3U8LA 4AFGA 4TNVA 5L47A 3RIAA 2YMEA 5L4EA 4WV9A 3SQ6A 5AFJA 4BFQA 5J5HA 4ILCA 4Z90A 4A97A 4LMLA 2BG9E 4QACA 3RIFA 5FJVA 2C9TA 3T4MA 3WTIA 4PIRA 5HCMA 5HEGA 3UU5A 4AFTA 4TWDA 5J5IA 5HCJA 4UM3S 3EAMA 3WTJA 3EI0A 2W8GA 3P4WA 2WN9A 3WTOA 5J0ZA 2XYTA 5J5GA 4ZZBA 1UV6A 3RQWA 2WNCA 3U8MA 4HFEA 4UM3P 2LLYA 4ZRUA 5AFMA 2XZ6A 2XQAA 5LG3A 2Y54A 3WTLA 2YN6A 4IL4A 4D01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XQ6 A;  3IGQ A;  2XQ9 A;  2WNJ A;  5L4H A;  2BG9 B;  5AFL A;  3RHW A;  3SIO A;  4X5T A;  2M6I A;  4ZK4 A;  2BJ0 A;  2X00 A;  5BW2 A;  2BYP A;  4QAB A;  2X00 D;  4ZJS A;  1OED C;  2BYS A;  3UUB A;  5AFH A;  1OED E;  3EHZ A;  4LMK A;  3UU4 A;  4ZR6 A;  2LKG A;  3ZDH A;  3JAD A;  1OED A;  5IUX A;  2Y7Y A;  3P50 A;  4BQT A;  3RQU A;  2W8F A;  3WTM A;  2WNL A;  2MAW A;  4QH5 A;  3UU3 A;  2XQ3 A;  2ZJV A;  2WZY A;  2BYQ A;  4ZJT A;  5AFN A;  3TLU A;  2LM2 A;  1UX2 A;  2Y56 A;  3TLW A;  2QC1 B;  2XQ7 A;  5JME A;  4ILA A;  2XNV A;  2PH9 A;  3JAF A;  3GUA A;  4UY2 A;  2YOE A;  1UW6 A;  2M6B A;  4B5D A;  2UZ6 A;  4UXU A;  3UU6 A;  4ALX A;  2BR7 A;  5HEO A;  4NPP A;  1I9B A;  2VL0 A;  2XNT A;  5SYO A;  4TWH A;  4UM3 A;  4COF A;  4IRE A;  3U8N A;  3SH1 A;  5BRX A;  4HFI A;  2XQ4 A;  5HEH A;  2XYS A;  4QH4 A;  4NZB A;  2XQ8 A;  4HFH A;  3WTK A;  2YMD A;  2YKS A;  4LMJ A;  5TVC A;  5HEU A;  3UQ4 A;  3PEO A;  4ZK1 A;  3WTN A;  2XQ5 A;  5AFM B;  3UU8 A;  3RI5 A;  3C79 A;  4DBM A;  3ZKR A;  2BYR A;  2XNU A;  4XHE A;  3U8K A;  3JAE A;  4ILB A;  5BP0 A;  4F8H A;  5LXB A;  4UM1 A;  2BG9 C;  2LKH A;  3LSV A;  2Y58 A;  4TWF A;  4QH1 A;  4IL9 A;  4HFC A;  5KZU A;  2BG9 A;  5HEJ A;  3TLS A;  4HFD A;  4TNW A;  3TLV A;  3UQ7 A;  4QAA A;  4HQP A;  3WIP A;  4AFH A;  5CFB A;  2ZJU A;  2BYN A;  3U8J A;  4EZ1 A;  3WTH A;  1OED B;  3PMZ A;  2PGZ A;  3C84 A;  4HFB A;  4A98 A;  5KE4 A;  2Y57 A;  3SQ9 A;  3TLT A;  4XK9 A;  4Z91 A;  2BR8 A;  5J5F A;  4FRR A;  2KSR A;  5AFK A;  2XZ5 A;  3ZDG A;  5CO5 A;  5AIN A;  4ZZC A;  3U8L A;  4AFG A;  4TNV A;  5L47 A;  3RIA A;  2YME A;  5L4E A;  4WV9 A;  3SQ6 A;  5AFJ A;  4BFQ A;  5J5H A;  4ILC A;  4Z90 A;  4A97 A;  4LML A;  2BG9 E;  4QAC A;  3RIF A;  5FJV A;  2C9T A;  3T4M A;  3WTI A;  4PIR A;  5HCM A;  5HEG A;  3UU5 A;  4AFT A;  4TWD A;  5J5I A;  5HCJ A;  4UM3 S;  3EAM A;  3WTJ A;  3EI0 A;  2W8G A;  3P4W A;  2WN9 A;  3WTO A;  5J0Z A;  2XYT A;  5J5G A;  4ZZB A;  1UV6 A;  3RQW A;  2WNC A;  3U8M A;  4HFE A;  4UM3 P;  2LLY A;  4ZRU A;  5AFM A;  2XZ6 A;  2XQA A;  5LG3 A;  2Y54 A;  3WTL A;  2YN6 A;  4IL4 A;  4D01 A; 
#chains in the Genus database with same CATH topology
 3RHW A;  5LMU T;  3OJA A;  2BJ0 A;  4DBQ A;  1MIY A;  5BW2 A;  3HKD E;  2W4X A;  2XTL A;  2KT9 A;  4YJ2 E;  3P4Q A;  5C8Y E;  4BQT A;  3T1H T;  3KV9 A;  2WZY A;  4X20 E;  3Q5D A;  4DV0 T;  4B3S T;  4LF4 T;  3N2O A;  4O8S A;  3TLW A;  4QXH B;  4BJN A;  3M65 A;  4P0B A;  5AQP B;  1V9D A;  5SYO A;  3PUZ F;  4TX5 A;  4UM3 A;  4IRE A;  2JQ9 A;  4JI5 T;  5HEH A;  3E08 A;  4NZB A;  3WTK A;  2N1G A;  2VKO A;  5HEU A;  2QVA A;  1ZKE A;  2XQ5 A;  3ZKR A;  2ES0 A;  4ILB A;  4X65 T;  3EUH A;  2IC6 A;  1M62 A;  2W62 A;  4QH1 A;  4IIJ E;  2JIW A;  4TNW A;  2ZJU A;  3L09 A;  2DCF A;  4AKH A;  1UK5 A;  1YW0 A;  2BR8 A;  2NR4 A;  4FRR A;  2K9A A;  4TNV A;  3B5M A;  4WV9 A;  2P9B A;  1HR0 T;  5AQK B;  5DQW A;  3UUL A;  3ZYL A;  4H63 H;  1WFD A;  3P4W A;  5FY1 A;  3W15 B;  3TKL B;  3ZLI A;  2YN6 A;  3RH3 A;  2XZ6 A;  3I9Y A;  3MA9 A;  2WNJ A;  5L4H A;  5LOV E;  4X5T A;  3FXD B;  2XQY A;  3K1S A;  5LG4 A;  2BS3 A;  2LSJ A;  3RQU A;  5FMN A;  3HR0 A;  2DL1 A;  5AFU L;  3PUG A;  1UUR A;  4O2A E;  1ZP0 A;  5IYZ E;  4CI3 B;  3C4W A;  3BQI A;  3SOL A;  1FIO A;  4DR4 T;  3FBZ A;  5LCY A;  3KDS E;  3LK3 B;  3O4X E;  4HFH A;  3ANW A;  4LMJ A;  4ZK1 A;  4U7I A;  3WTN A;  5BMV E;  1KEY A;  1BR4 A;  5BP0 A;  5LXB A;  3BQL A;  2LKH A;  1MND A;  5CB4 E;  4CI2 B;  4IL9 A;  4HFC A;  4U33 A;  2EHO A;  4CZZ B;  3CML A;  2V6Y B;  4FI5 A;  2DI4 A;  2J47 A;  5FY7 A;  4ZI3 D;  3C84 A;  4UVB B;  3GN5 B;  2IUB A;  5F8P A;  3CVR A;  2DWK A;  5AIN A;  3K3Q C;  3PUA A;  5LGN B;  4TUY E;  2D9D A;  4JLE A;  4UVA B;  3PJA A;  3N9M A;  4U72 A;  4UV8 B;  3T1Y T;  4GK0 E;  2C5K T;  3N9P A;  1BR0 A;  3C4Z A;  3KBT A;  3ZN1 B;  3RQW A;  2UU9 T;  2E9X B;  4ISS A;  1XNQ T;  3OPC A;  3VU7 H;  4ZRU A;  2CPT A;  3FXE B;  2CXD A;  5C2T A;  2XQ9 A;  2WQY A;  2FJA A;  2VUR A;  4H9S E;  1MMN A;  4DV4 T;  2BKP A;  1E2A A;  3L39 A;  4UIG A;  3JCF A;  3ZJ2 A;  1NWM X;  3ZT5 A;  4LF7 T;  1BR2 A;  1N32 T;  3UU3 A;  2ZJV A;  2BYQ A;  3RKO A;  4DUY T;  4PFP A;  5HXE A;  1HNZ T;  3U78 A;  4DBR A;  4UY2 A;  2IDO B;  5KMG P;  2X68 A;  3MAC A;  4COF A;  3SH1 A;  3DJB A;  5LHI B;  4OYK A;  2D0T A;  4ANJ A;  5LJM A;  4IDN A;  3MZK B;  4HFV A;  5FXV A;  2K5B B;  1KNP A;  5AQN B;  2BBJ A;  1GQE A;  4DV7 T;  4H9R C;  1T98 A;  4YY3 T;  4O4J E;  3FB2 A;  4GKJ T;  5CJ5 A;  4U7Y A;  3AVR A;  4X1Y E;  3TLS A;  3IA3 A;  3ZMV B;  3QK6 A;  4OHF A;  3I0O A;  3A5X A;  3NRY A;  2Y57 A;  3PUS A;  1T8B A;  1Y01 A;  3BQK A;  5AFK A;  3UT5 E;  2YDR A;  4DVD A;  4YXD A;  4LFC T;  1LVK A;  2YU1 A;  3J9X 1;  2WM9 A;  1IJ5 A;  4A5X A;  5J5I A;  5EK4 A;  3WTJ A;  3ZYK A;  5LHG B;  5F3J A;  1HX8 A;  2X9Y A;  3MXZ A;  3UUX B;  4ASK A;  2H89 A;  2PJQ A;  2X00 D;  1OED A;  3AE9 A;  3NWI A;  5LGU B;  4MHC A;  2BVM A;  5J1G A;  5AFN A;  2M67 A;  4X62 T;  2Y56 A;  4ZHQ E;  3AEB A;  2V26 A;  3ZC1 A;  4ILA A;  4IST A;  4XBF B;  2XNV A;  2UZ6 A;  4EXT A;  4EED A;  2VK9 A;  3AE8 A;  2LEH A;  4TWH A;  2XYS A;  4WBO A;  2H7V C;  1T7S A;  2ZM2 A;  2Y8D A;  5J2T E;  4UF0 A;  3C79 A;  3IF8 B;  4WYV A;  3AAA B;  1VRB A;  2BS4 A;  3ZC0 A;  3H3M A;  5HXR A;  4AFH A;  1XZY A;  1KNZ A;  2B1E A;  3SQ9 A;  4XK9 A;  4AI6 A;  2Z6E A;  3AAE B;  3I0Q A;  3LK4 2;  3ONL C;  1IBK T;  1HCI A;  5FVK A;  3CIR A;  5L3D B;  3PV0 F;  5AQM B;  1UX5 A;  3T4M A;  3AA7 B;  2VWA A;  3IBP A;  4PIR A;  4CN4 A;  4WBN E;  3EVY A;  2D2S A;  3HKE E;  3WTO A;  5E0O A;  4YFS A;  3AE5 A;  2KMF A;  2IML A;  2RP4 A;  2XAS B;  4HTE A;  1FJG T;  3RYF E;  3KIN B;  3FZL B;  5AFL A;  4JI1 T;  1KNR A;  2BYP A;  3HI2 A;  4U74 A;  3RYH E;  3KV6 A;  3AXJ B;  3JAD A;  4DND A;  4MBQ A;  3AVS A;  1MNE A;  4ZJT A;  2EHO C;  1BR1 A;  2X9X A;  1D0Y A;  2J1D G;  4B3M T;  2BS2 A;  2ZM8 A;  4E7S A;  1XDP A;  3P7I A;  4DMW A;  2E9X C;  3O1J A;  4GIW A;  2FJE A;  1M7K A;  1OXZ A;  2N9D A;  5HXH A;  4HE8 A;  2X66 A;  3RI5 A;  2XNU A;  3QOF A;  3FHN A;  5FXZ A;  4OYJ A;  1LRZ A;  3OBV E;  5JDM A;  3UQ7 A;  2WS3 A;  1IAP A;  4ERR A;  4AQY T;  4MFR A;  4WW0 A;  4O2B E;  3AB3 B;  2XZ5 A;  4PNI A;  4BFQ A;  3DTO A;  1LKX A;  5ABH A;  4AQG A;  3JC6 C;  2WP9 A;  1Y64 B;  2BVL A;  3T8O A;  4ZZB A;  3V5S A;  2X9W A;  3ZST A;  5AQI B;  1ZV4 X;  2LT3 A;  2DNX A;  3IGQ A;  4UEL A;  2RPA A;  2M6I A;  1U5P A;  2J4G A;  2X00 A;  1XDO A;  3ETV A;  4LF6 T;  4ZR6 A;  2X51 A;  3RYC E;  3I1A A;  3RYI E;  5FY0 A;  2V7M A;  4I4T E;  1I6Z A;  3SFD A;  2E5V A;  4PJN A;  2XSA A;  4JI2 T;  2YOE A;  4HWF A;  2M6B A;  4DV2 T;  5HWX A;  2XHE B;  5TAO A;  3UFG A;  2VL0 A;  5JTG A;  2QYW A;  3FZM B;  4HFI A;  3VRA A;  3IEE A;  4MAL A;  4YJ3 E;  5LB7 B;  3HKB E;  1XWM A;  2NOX A;  4ZEY A;  3VRB A;  3MK7 C;  5ADX L;  3ZN0 B;  4B3T T;  3LG7 A;  5EK2 A;  1Z0P A;  3OYZ A;  2A9U A;  3PUX F;  3K3N A;  1HG5 A;  1IBL T;  2LSY A;  3PMZ A;  4AXP A;  2V1D B;  2W66 A;  2KSR A;  5CO5 A;  2VB6 A;  3AA6 B;  2DWG A;  4DUZ T;  3RPU A;  4NUV A;  2X0L B;  2YEV C;  2XUE A;  4Z90 A;  4IE7 A;  2YIN A;  1ZOY A;  5FJV A;  2FJD A;  2Y6X A;  2Q9Q A;  2ZM6 T;  2XAG B;  3ONX A;  3OKQ A;  4NIQ A;  1HNX T;  1X79 A;  1UCU A;  3ZDH A;  3FZF B;  3C98 B;  5AQV B;  4ZK4 A;  3C50 A;  1FMW A;  4IDO A;  1SUM B;  5AQU B;  3RIU A;  1SHZ C;  2BYS A;  2NW7 A;  5JRC A;  4KHP T;  2JQQ A;  1QUU A;  1FMV A;  2X67 A;  2XQ3 A;  4ZXL A;  2LM2 A;  2W00 A;  4JI3 T;  4YT0 A;  3O1H A;  4YSZ A;  2CCQ A;  3RRW A;  3AE3 A;  4UXU A;  4KMC A;  4PAG A;  5FNV E;  1DU2 A;  5H6Q B;  2JQH A;  3CQG B;  2YDQ A;  2VQE T;  3CQX C;  5FVL A;  4XHE A;  3AE4 A;  1E1H B;  2KLQ A;  3M3Z B;  2VKD A;  2BG9 A;  5AQQ B;  4HFD A;  1XNR T;  2IW5 B;  3OTO T;  4QXC B;  4EZ1 A;  4ZI2 C;  4AIS A;  5AQO B;  5AQF B;  4UV9 B;  4L0R A;  4HWD A;  3ZT6 A;  2WBL A;  3RIA A;  4GYS A;  1J5E T;  3R84 B;  2H88 A;  2BG9 E;  5HEG A;  5F5W A;  4CXX A;  4HWH A;  3ANW B;  5KDM C;  3PU3 A;  2W8G A;  3ZCI A;  5FYM A;  1UV6 A;  4H9N C;  3LK2 B;  5ABF B;  3SRZ A;  3N9L A;  3AE7 A;  3RGL A;  1S94 A;  2CXF A;  4EYY R;  4JUY A;  3P4R A;  4L9I A;  2EHO B;  4NXN T;  3R6N A;  2CBJ A;  2LSG A;  3VHL A;  2VAS A;  3A8Y C;  2WB5 A;  3FZK B;  2LOP A;  2MAW A;  2HH7 A;  4U2Y A;  5L2L A;  3ZJ1 A;  4U3C A;  3Q5X A;  2XQ7 A;  3ZMU B;  4EV6 A;  3CWZ B;  3UTK A;  4I55 E;  4K0K T;  1JNZ A;  4PW8 A;  2KWH A;  5DAB A;  5CGM A;  1US7 B;  5L3G B;  3LBX B;  2W63 A;  3PJA J;  4WNK A;  1KK7 A;  3RX6 A;  4UVC B;  2CBI A;  3P8C D;  4UXN B;  4TWF A;  3TLV A;  2C5J A;  4HQP A;  4C91 A;  5JR9 A;  2GK9 A;  4H9O C;  4H9Q C;  4JYA T;  4YHH T;  3PUW F;  1YKH B;  5DQV A;  3TLT A;  4Z91 A;  4AFG A;  3L3P A;  2G0U A;  2KZ7 B;  1JNR A;  1EZ3 A;  4DR5 T;  1E7P A;  5FXW A;  5HCM A;  3UU5 A;  4AFT A;  5AQJ B;  3VKG A;  4IDQ A;  3F31 A;  2AXD S;  4PJM A;  4PFO A;  2CLY C;  3G06 A;  4CXW A;  4M1P A;  4LFB T;  3RRC A;  4DR3 T;  2LLY A;  4CI1 B;  3CQC B;  3U8L A;  3AA0 B;  4H9P C;  3SIO A;  2XSB A;  3RF1 A;  2JMK A;  2YK0 A;  2NP9 A;  1YQ4 A;  2CE7 A;  2X0Y A;  2LKG A;  3ZMS B;  1X9B A;  2K24 A;  5GON E;  2A2F X;  4PJL A;  5CA1 E;  3F57 A;  5JDL A;  2MBG A;  4DO0 A;  5IWA T;  1WRD A;  4NXM T;  2XZE A;  1CUN A;  3U8N A;  2WDR A;  5TVC A;  5LP6 E;  4TN7 B;  3AAI A;  5LJN A;  5CA0 E;  1MIV A;  4TV8 E;  2XJ7 A;  2KWI B;  2Q9Q C;  4GKK T;  2CEA A;  3WI3 A;  2CXL A;  1I94 T;  2DLR A;  4HEA A;  1OED B;  3EDU A;  2HPL A;  4A98 A;  4I0U A;  4CQI A;  5KE4 A;  3KV5 A;  4CXY A;  4X64 T;  1UGO A;  5JDG A;  1YKE B;  2PG8 A;  5L3C B;  2BBH A;  4DMV A;  3RIU C;  3KFW X;  1D1A A;  1HX1 B;  2XM2 A;  3WTI A;  2XAQ B;  2CWO A;  4UF0 B;  3C4X A;  3E22 E;  1VCS A;  4HFE A;  2ACZ A;  5AFM A;  3RC8 A;  2XQA A;  2KIN B;  2VKJ A;  4EOZ B;  2SPC A;  3UUB A;  4JI0 T;  2IC9 A;  2WWU A;  5HYA A;  5L3B B;  2A72 A;  3N9Q A;  4I43 B;  4JI8 T;  3N9O A;  5HEO A;  4J2C A;  4NPP A;  4H63 V;  3PTR B;  3ZCJ A;  5C3J A;  2LSK A;  2XQ4 A;  5FL0 A;  3ZMZ B;  4KUM B;  3UQ4 A;  4KP3 C;  3PEO A;  2LE8 A;  3MJX A;  4DBM A;  5FP3 A;  4UM1 A;  2WMN A;  2BKO A;  3NRX A;  2IAK A;  2V5D A;  5HEJ A;  4QAA A;  1YD8 G;  5A1L A;  3D0T A;  3K3O A;  3ZPO A;  3WTH A;  5LGT B;  2ZLY A;  3SFE A;  4EB6 E;  5AQR B;  5LMN T;  4ZI7 E;  3UFE A;  3NZP A;  3SQ6 A;  4IDP A;  4DV6 T;  3E0Z A;  3NVO A;  5KXJ A;  4JI4 T;  2CHO A;  4HN9 A;  2LRK A;  2X9H A;  4NUU A;  3LDQ B;  2FUP A;  5HCJ A;  2OA5 A;  3C51 A;  2WMO A;  3Q2M A;  2K3W A;  5J5G A;  4GK5 E;  1D0Z A;  4UM3 P;  4JI7 T;  3PUR A;  5LG3 A;  4IL4 A;  3PE0 A;  5FKY A;  3SWH A;  4Z8X A;  3ZEF B;  3EDV A;  3Q5W A;  2WU2 A;  3WTM A;  4QXB B;  3L8R A;  4JBW F;  4QH5 A;  1UX2 A;  4OX9 T;  1HNW T;  1HF8 A;  1UW6 A;  3NKZ A;  4CN6 A;  4X1K E;  3WAK A;  1UUS A;  4IHJ E;  2N2N A;  1MMA A;  2UUA T;  2UXC T;  1S35 A;  1Z8U A;  2YKS A;  3ETU A;  4JEH B;  2X0H A;  4U2Z A;  2ZMA A;  2E9X D;  3UUN A;  2OLT A;  1ZHC A;  2RA1 A;  3ZSS A;  4N78 D;  2V5C A;  2I59 A;  2WZH A;  4QX8 B;  1N33 T;  2LJL A;  2VVN A;  1KFY A;  1WR0 A;  3ZDG A;  2CLY B;  2WU5 A;  4EEB A;  5HXS A;  5LYJ E;  3FZH B;  4A97 A;  3N5L A;  4DR2 T;  2WDV A;  2HPJ A;  2CMR A;  1WR6 A;  4DV1 T;  3P4S A;  2WWV A;  4TWD A;  3V5U A;  4X1I E;  1N36 T;  3UUM A;  4C90 A;  3JC6 D;  3EI0 A;  2L9Q A;  4YTM A;  3B13 A;  4IE0 A;  3IHR A;  4D01 A;  4F6R C;  4LF9 T;  2LRL A;  2ODU A;  4UEM A;  3LJC A;  4EZ4 A;  3N2G E;  5JVD E;  1OED C;  2DHR A;  3N2K E;  4G2A A;  2B76 A;  1SA0 E;  3EHZ A;  1U4Q A;  1O3X A;  1WLX A;  2Y7Y A;  3P50 A;  3PUY F;  5JH7 E;  4LF5 T;  2JQK A;  1R8I A;  3KBU A;  2YDS A;  2QC1 B;  2MYS A;  3CX6 B;  2XAF B;  5IHY A;  4B5D A;  4JV5 T;  4ILU A;  5BR8 T;  2Q9Q B;  5M4Y A;  2LHN A;  3HL6 A;  4ZS2 A;  3ZMT B;  4DID B;  5LBM A;  3S4U A;  1HFA A;  2UXN B;  2MOZ A;  2YU2 A;  3GA8 A;  3AEA A;  3UU8 A;  4CN1 A;  1W09 A;  2BYR A;  2I0M A;  2J62 A;  3LSV A;  2Y58 A;  4ZI3 C;  5JRC B;  4O4I E;  3I9W A;  2QRX A;  4KHZ F;  3KV4 A;  5JDN A;  2L3L A;  2MPK A;  4QHO A;  1YQ3 A;  4KX6 A;  2W2U A;  3BK9 A;  3ABV A;  5JDF A;  5JDH A;  2JPF A;  3U3I A;  2WNC A;  3PUQ A;  4YSY A;  5LXT E;  1IZN B;  5AQH B;  5LBQ B;  2XAJ B;  3SS1 A;  4UR9 A;  2BG9 B;  2NTX A;  4TV9 E;  4DR1 T;  4IE6 A;  4DR7 T;  5AFH A;  2IHR 1;  2V6Y A;  2BDE A;  4Q25 A;  4K0U A;  1UX4 A;  3GN5 A;  5ABF A;  1FEW A;  3AE6 A;  2NW8 A;  4DV5 T;  3KVB A;  3C64 A;  5L3E B;  4TZ4 C;  2XNT A;  4YHJ A;  3QNU A;  3VR9 A;  2JMH A;  2MTQ A;  2R6G F;  4A56 A;  4B6X A;  4IGU A;  2E9X A;  2I6H A;  2NTY A;  3VKH A;  4QX7 B;  4PJJ A;  3JAE A;  4F8H A;  2E2A A;  1WYB A;  5HWY A;  3X1D A;  3EAB A;  3HKC E;  2W61 A;  1SE7 A;  4ZS3 A;  4XZC A;  4EIW A;  3OVU A;  2LM9 A;  5AQS B;  3AED A;  4L5G A;  3HA4 A;  2VKH A;  5KX5 E;  4ZI2 D;  3N9N A;  2CHN A;  2AE9 A;  3LBX A;  2WY2 A;  2FJB A;  2CA5 A;  5LNK A;  5L47 A;  2YME A;  1G73 A;  4EZH A;  2QA7 A;  1W0A A;  4ADZ A;  3P4P A;  2D0U A;  3ZT7 A;  4MLK A;  2V8S V;  2W67 A;  2E5L T;  2WN9 A;  5J0Z A;  2XYT A;  5FXX A;  1KF6 A;  4U31 A;  1MMG A;  3QB5 K;  5EK3 A;  4AQF A;  2V7I A;  4XAX B;  5JR9 B;  4LMK A;  4V1A v;  1W0B A;  4EGW A;  2W8F A;  3O1I A;  3H3A A;  5LA6 E;  2PFV A;  3TLU A;  5JDQ A;  4ZOL E;  3H37 A;  3MKD A;  2PH9 A;  3GUA A;  2IIU A;  1ZEE A;  5BRX A;  3F2E A;  2XQ8 A;  4QWN B;  4KI0 F;  3B57 A;  4GOU A;  4YTP A;  1NEN A;  1H7C A;  3QB5 A;  3U8K A;  4AKI A;  2JJ9 A;  2UUC T;  3OYX A;  4OFZ A;  3WIP A;  1XMO T;  1D0X A;  3DP7 A;  2W0G A;  1CHU A;  2PGZ A;  4AIU A;  1WCR A;  4HFB A;  3K8P C;  4DR6 T;  4LFA T;  4PK6 A;  2F4V T;  5J2U E;  4OK0 A;  1VCT A;  5AFJ A;  4ILC A;  3KVA A;  2XY8 B;  2C9T A;  2H3R A;  2C5I T;  3AE1 A;  4IE4 A;  4O4L E;  5JRE A;  4X66 T;  5AQG B;  2VL8 A;  4HWC A;  3U8M A;  2ODV A;  5HXC A;  3CPZ A;  3WTL A;  2Y54 A;  2WZI A;  3CX8 B;  3PU8 A;  1J1J A;  3ONJ A;  3RKG A;  2WCA A;  5ABE A;  2HN1 A;  5FL1 A;  1AJ3 A;  4B3R T;  5LHH B;  2A3D A;  1D1B A;  1OED E;  2CWY A;  4BA9 A;  5L3F B;  2BZB A;  5AQT B;  4PK5 A;  3RC3 A;  4YTN A;  1QSD A;  3AEE A;  2VQF T;  2D5U A;  2VVS A;  5JME A;  2JRK A;  3JAF A;  1W9R A;  4GYR A;  2UUB T;  1B7T A;  1J5W A;  4ALX A;  3AEF A;  1QLB A;  2Y48 B;  1G8X A;  2ACX A;  3ESL A;  1LVF A;  2YMD A;  2CM0 A;  3J7Y q;  5ABG A;  2NW9 A;  2PBI A;  4IT4 A;  5H6R B;  3GMI A;  5AFM B;  4YSX A;  2UXB T;  3CKD A;  2BG9 C;  3NBX X;  4QKN A;  1NAF A;  2Q9Q D;  2WSS V;  4P1N A;  1T72 A;  3AXJ A;  3NZQ A;  5DJQ C;  3QUJ A;  4AKL A;  5J5F A;  3LFM A;  3QC9 A;  5ETW A;  2ZM0 A;  1L0V A;  3ZYM A;  4ZZC A;  2WDQ A;  1N34 T;  1IJ6 A;  3O9X A;  1WYC A;  1IBM T;  3AE2 A;  1HG2 A;  3PDY A;  4LF8 T;  5AQL B;  4G63 A;  4QAC A;  3RIF A;  5EZY E;  2K48 A;  4BAY B;  2C0S A;  2WAU A;  4AKR B;  4UM3 S;  3EAM A;  4WZX A;  3Q9D A;  4FJO A;  2E8I A;  4BJM A;  4HKA A;  1D1C A;  2BKN A;  2XQ6 A;  3PUV F;  5JQG E;  4HWI B;  3FBL A;  1YXR A;  1HS7 A;  4JEU B;  4ZJS A;  4QAB A;  2KND A;  1XMQ T;  3UU4 A;  4YLH A;  5IUX A;  4O4H E;  2WNL A;  3GWH A;  2V7L A;  2HHH T;  1OWA A;  3Q5E A;  4HGA A;  3AEG A;  1MMD A;  3RLF F;  3WAJ A;  3UU6 A;  2BR7 A;  2PTF A;  2XM1 A;  1I9B A;  1HTJ F;  4E7Z A;  4IDZ A;  2CRB A;  3CX7 B;  4QH4 A;  3VR8 A;  4I50 E;  2H7O A;  2KXP B;  4PK4 A;  4DV3 T;  5KZU A;  2UXD T;  5JR9 C;  2OV9 A;  2LOS A;  5CFB A;  2BYN A;  2EHO D;  3U8J A;  4P09 A;  2V6X A;  4AKG A;  2NWB A;  4KBM B;  4IE5 A;  2HN2 A;  1VOM A;  2V7J A;  2XPK A;  3AA1 B;  5L4E A;  1MIW A;  5J5H A;  4AQF C;  2LSI A;  4LML A;  4P0A A;  2LHR A;  2UXX B;  3A7M A;  4EAH A;  3CK6 A;  4JI6 T;  1NEK A;  2QGS A;  3AEC A;  2XAH B;  2V7K A;  2L8K A;  2FBW A;  4EYU A;  5HAX A; 
#chains in the Genus database with same CATH homology
 2XQ6 A;  3IGQ A;  2XQ9 A;  2WNJ A;  5L4H A;  2BG9 B;  5AFL A;  3RHW A;  3SIO A;  4X5T A;  2M6I A;  4ZK4 A;  2BJ0 A;  2X00 A;  5BW2 A;  2BYP A;  4QAB A;  2X00 D;  4ZJS A;  1OED C;  2BYS A;  3UUB A;  5AFH A;  1OED E;  3EHZ A;  4LMK A;  3UU4 A;  4ZR6 A;  2LKG A;  3ZDH A;  3JAD A;  1OED A;  5IUX A;  2Y7Y A;  3P50 A;  4BQT A;  3RQU A;  2W8F A;  3WTM A;  2WNL A;  2MAW A;  4QH5 A;  3UU3 A;  2XQ3 A;  2ZJV A;  2WZY A;  2BYQ A;  4ZJT A;  5AFN A;  3TLU A;  2LM2 A;  1UX2 A;  2Y56 A;  3TLW A;  2QC1 B;  2XQ7 A;  5JME A;  4ILA A;  2XNV A;  2PH9 A;  3JAF A;  3GUA A;  4UY2 A;  2YOE A;  1UW6 A;  2M6B A;  4B5D A;  2UZ6 A;  4UXU A;  3UU6 A;  4ALX A;  2BR7 A;  5HEO A;  4NPP A;  1I9B A;  2VL0 A;  2XNT A;  5SYO A;  4TWH A;  4UM3 A;  4COF A;  4IRE A;  3U8N A;  3SH1 A;  5BRX A;  4HFI A;  2XQ4 A;  5HEH A;  2XYS A;  4QH4 A;  4NZB A;  2XQ8 A;  4HFH A;  3WTK A;  2YMD A;  2YKS A;  4LMJ A;  5TVC A;  5HEU A;  3UQ4 A;  3PEO A;  4ZK1 A;  3WTN A;  2XQ5 A;  5AFM B;  3UU8 A;  3RI5 A;  3C79 A;  4DBM A;  3ZKR A;  2BYR A;  2XNU A;  4XHE A;  3U8K A;  3JAE A;  4ILB A;  5BP0 A;  4F8H A;  5LXB A;  4UM1 A;  2BG9 C;  2LKH A;  3LSV A;  2Y58 A;  4TWF A;  4QH1 A;  4IL9 A;  4HFC A;  5KZU A;  2BG9 A;  5HEJ A;  3TLS A;  4HFD A;  4TNW A;  3TLV A;  3UQ7 A;  4QAA A;  4HQP A;  3WIP A;  4AFH A;  5CFB A;  2ZJU A;  2BYN A;  3U8J A;  4EZ1 A;  3WTH A;  1OED B;  3PMZ A;  2PGZ A;  3C84 A;  4HFB A;  4A98 A;  5KE4 A;  2Y57 A;  3SQ9 A;  3TLT A;  4XK9 A;  4Z91 A;  2BR8 A;  5J5F A;  4FRR A;  2KSR A;  5AFK A;  2XZ5 A;  3ZDG A;  5CO5 A;  5AIN A;  4ZZC A;  3U8L A;  4AFG A;  4TNV A;  5L47 A;  3RIA A;  2YME A;  5L4E A;  4WV9 A;  3SQ6 A;  5AFJ A;  4BFQ A;  5J5H A;  4ILC A;  4Z90 A;  4A97 A;  4LML A;  2BG9 E;  4QAC A;  3RIF A;  5FJV A;  2C9T A;  3T4M A;  3WTI A;  4PIR A;  5HCM A;  5HEG A;  3UU5 A;  4AFT A;  4TWD A;  5J5I A;  5HCJ A;  4UM3 S;  3EAM A;  3WTJ A;  3EI0 A;  2W8G A;  3P4W A;  2WN9 A;  3WTO A;  5J0Z A;  2XYT A;  5J5G A;  4ZZB A;  1UV6 A;  3RQW A;  2WNC A;  3U8M A;  4HFE A;  4UM3 P;  2LLY A;  4ZRU A;  5AFM A;  2XZ6 A;  2XQA A;  5LG3 A;  2Y54 A;  3WTL A;  2YN6 A;  4IL4 A;  4D01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...