5IVPA

Crystal structure of the peptidyl-trna hydrolase from vibrio cholerae in the c121 space group at ph 6.5
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
196
structure length
195
Chain Sequence
b'VSQPIKLLVGLANPGPEYAKTRHNAGAWVVEELARIHNVTLKNEPKFFGLTGRLLINSQELRVLIPTTFMNLSGKAIAALANFYQIKPEEIMVAHDELDLPPGVAKFKQGGGHGGHNGLKDTISKLGNNKEFYRLRLGIGHPGHKDKVAGYVLGKAPAKEQELDAAVDESVRCLEILMKDGLTKAQNRLHTFKAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
molecule tags Hydrolase
source organism Vibrio cholerae o1 biovar el tor str. n16961
publication title Crystal structure of the Peptidyl-tRNA hydrolase from Vibrio cholerae in the C121 space group at pH 6.5
rcsb
total genus 64
structure length 195
sequence length 196
chains with identical sequence B
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2016-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 5ivpA00
2Z2JA 4QAJA 2MJLA 3NEAA 3KK0A 5EKTA 4JY7A 2Z2KA 3TCNA 5IVPA 3P2JA 1RYBA 4JX9A 4QT4A 3VJRA 1RYMA 4IKOA 4FOPA 4Z86A 2Z2IA 3KJZA 4FOTA 4P7BA 5B6JA 2PTHA 4JC4A 2LGJA 3TCKA 4DJJA 4LWQA 4QBKA 4FYJA 4JWKA 3TD6A 4YLYA 4QD3A 2JRCA 3TD2A 5IMBA 3V2IA 4ERXA 5IKEA 2NAFA 1RYNA 4ZXPA 4FNOA 4DHWA 3OFVA 4HOYA 4OLJA
chains in the Genus database with same CATH superfamily
1MVNA 2XZPA 4FNGA 1CSEE 2JI9A 5F4ZA 5JCOA 3ZN2A 1Y6ZA 4KLAA 1GG8A 3VFDA 5K8UA 2H52A 3EIQA 2NP6A 4AWXA 1R16A 1EWQA 1U0NA 1U3VA 4DCPA 2XRMA 3THXA 4GUAA 4IJUA 5AVKA 1FFAA 1FS5A 3EUAA 2PWPA 5CNMA 1J9ZA 4FT2A 3WA6A 3AINA 1NUPA 3K9NA 3WLIA 1BQ3A 4H59A 3E5RA 3MINB 5K2OA 5D84A 2WAYA 3PNQA 5DNYB 1UK7A 2B3DA 3OU6A 1G8KA 3WZ2A 3FNEA 4Z9BA 1G8HA 4D8XA 1NN1A 2C9DA 5J43A 4GXRA 4ZAZA 4YC7A 2J0QA 3QOWA 2W2QA 2Z2ZA 1X1EA 1QMGA 3JVIA 4QQKA 3W6UA 2RARA 4BCBA 5CA1B 5LR6A 1RVDA 1DUIA 5IFLA 1DQZA 3GEGA 1NYTA 5JZBA 3CNLA 3VR4D 2XMPA 3W5CA 4IMRA 1AKRA 4UAVA 3IBSA 1JDNA 4PQYA 4EJFA 3V55A 4BBAA 1V16A 4D8VA 1PT5A 5EUQB 1UEJA 1EDDA 3PXAA 3VHLB 2HJRA 5H81A 3JQFA 2XH8A 2WA2A 4U39A 4D9HA 4YV7A 2OO5A 1NOIA 3AL3A 2CXPA 2R6GA 1J25A 1CRZA 3TD6A 1WDMA 2XE4A 2DTXA 1I30A 1QHHB 1Y7HA 1WB4A 5HNKA 4Z4FA 1LDMA 3AP2A 1W0KD 2OT3B 5TVKA 5JHHB 1KH1A 2VRWA 3A10A 3QU9A 4BZWA 2V7WA 5A0FA 3M7IA 5E6UB 7MDHA 2NU9B 1K06A 3WRXA 2CK3D 5IRCD 3T3HA 4PC2A 4TKMA 4ZVPA 3P20A 3HUUA 1AD2A 1KPIA 1N8SA 4F2HA 1WE2A 2VDNB 3L46A 4G4JA 4KC0A 3I6QA 1E69A 4NZNA 3ZJ4A 1YQWA 4QGHA 1CRWG 2PBFA 3MRSA 4G65A 1O03A 3MCWA 4RF5A 5B55A 5DGDA 3NT4A 2GT1A 2ZRLA 5KB3A 2C8JA 2SCUB 2JANA 5DSTA 3WWPA 2VSXA 1FDWA 3G82C 3HO6A 3MGCA 3S99A 1ZIOA 3EFOB 3K32A 4M1TA 4XB2A 1OWNA 2H63A 4B7UA 4RDCA 1GADO 1M1YE 1NNI1 1PQYA 1PX2A 2WMYA 4B4VA 1Z4PX 2GM4A 1CUBA 4LFBB 3L7KA 1U0GA 2QU7A 3FYUA 4LY6A 5F73A 2VYCA 4ZD6A 1BQEA 3WBFA 4HFJA 4WCDA 1VMIA 1L4LA 1FC0A 1JHUA 1A76A 1E4OA 1KIFA 2AWNA 3F2IA 3JQ8A 3VSEA 1Q7EA 4Z99A 4UBNA 5FFNA 1NL3A 3G2PA 4EI8A 3PQ4A 2AD1A 4EK9A 5KTMA 2W2OA 3HSSA 4U9IS 3ISVA 1T8WA 5JMWA 1OWMA 2TMYA 3EGIA 1PGJA 1W0KA 1B1CA 2Q9CA 3CLUD 3AP1A 4GZ3A 3U39A 1QWSA 5SZIA 4XIIA 1U8ZA 4Z2YA 5FT9A 1UAAA 3EG9B 1DXQA 3QF7A 1T0PA 5CT4A 4AM8A 3AI3A 3ZU4A 2XMGA 4UCQA 4DREA 3TIVA 5K3DA 1NJ8A 3EEFA 3HYLA 1E2PA 2H7XA 2V9ZA 2P9GA 2XNSA 3OA2A 4N7MA 3VSAA 4BN5A 5F5NA 1PR2A 1TA0A 1SKQA 1M67A 2OV3A 4D4MA 3ZCPA 4QBTA 2MT9A 3VGPA 5KSOA 2X6TA 3F4KA 2FDXA 3KEQA 5CB4A 1ABBA 1LS6A 2WUDA 3GLFB 2WSLA 2JJ8A 3CQ9A 1QGOA 3JPYA 1GKIA 1YJQA 3S5UA 3I5UA 3FPLA 4LV6A 1DADA 1ZIPA 2PGDA 2X15A 3QTBA 4NOLA 4LVCA 1EUQA 4G81A 4H9GA 2ZJYA 5EJAA 5BSEA 1UC8A 5TMPA 3RFXA 1ULAA 2HAEA 1RCFA 4QYIB 4F7WA 2OBNA 2QRNA 3QH4A 1XOIA 2JRCA 3BGIA 4E1BA 1NXTA 3JZAA 5B4VA 5CDTA 2VAVA 2FXVA 5CEFA 2OFXA 1ISMA 4M83A 1K1EA 1NPTO 2WOJA 3DKPA 1KMIY 4MGEA 3KT3A 5HA5A 3P2IA 5TNXA 2PSEA 2IHJA 2Y6VA 3UPDA 4UTNA 5CT8A 3IAHA 1I0ZA 3WB9A 1LLCA 2W2KB 3NALA 2PUHA 5AKYA 3ZKWB 4TV8A 5ALOA 1H0RA 1Q0ZA 4INOA 2A78A 1IUOA 4EW3A 3FCSB 4HPWA 1SEVA 3LUAA 5IARA 1P62B 5E3HA 1N2SA 3TCKA 1KL7A 1FZQA 4KGZA 3VPFA 1BH6A 1EFHA 3MJFA 2DT8A 4JC8A 4MQLA 3A06A 3H8VA 4RLQA 2QNRA 2ZZNA 2IE0A 1HETA 4XVRA 3U5TA 2Q8NA 4KK3A 2LCFA 1QKKA 1XCPA 4LK3A 2C4HA 5HMLA 2PSDA 3KKLA 4D9NA 5AW1A 3A6ZA 2LD4A 3CHYA 3RLFA 3H17A 1JU9A 4A26A 4IFTA 3G49A 3P0FA 4OFZA 4PONA 5GJWC 1ZOLA 3HBMA 4XWAA 2J3JA 2VZEA 1Y8RB 3EXEB 4WBNF 4YXWD 3TOSA 3DL4A 3RYHA 1A4IA 2JAWA 4CFYA 4HPJB 5DT2A 3CEAA 1I2AA 2AQ8A 3A9SA 1FW6A 2R6JA 1D7OA 4MPPA 5JTTA 3BGOS 4CM3A 3R0IA 5TMBA 5HJEA 1P9WA 4PLYA 4HFRA 1DE0A 2E5FA 2C29D 2FPRA 2HMSA 1PN3A 2O1XA 3QQPA 2P9QA 4IIVA 3P52A 4M54A 2ZR0A 3LQ4A 2DQ4A 5TVGA 3VA7A 4UNPA 4WXHA 3GNQA 5DNVA 4CCAA 2Z8YA 1MG5A 4NZOA 1FA9A 4V0SA 2N9UA 1BFKA 2P1ZA 4Z4HA 4NE9A 1E9DA 2YQZA 1P7CA 2L19A 1ZMBA 1YR9A 2GNOA 1DQSA 4P7JA 3ZIUA 1A9ZA 1NYRA 1F3LA 2GN0A 2FY8A 2I29A 3EVZA 5L6MB 1QVZA 1YZQA 2ZWAA 1MU0A 2OZLA 3F9IA 4S2EA 3M5CA 4TMFA 3X1XA 4AD8A 3G2OA 1LW6E 2P6OA 1SCAA 4G97A 1G38A 3F90A 4QNMA 2AMYA 4LE2A 2WAOA 4YCAA 5BV1A 4HDAA 3PDCA 1F2TA 3P9CA 1P1KA 3UJNA 4GICA 4IXWA 3TECE 5EY5B 1A9XB 4KVAA 3AERB 1J9GA 1N5LA 3L01A 3RC1A 1O97D 2PQ0A 4Q9DA 4BWFB 1N5KA 1MRSA 2QTRA 2GN4A 2VH1A 4FDAA 4FZ5A 1RWWA 4LZJA 5T41A 1XDWA 3MWDA 1OUMA 5D2CA 5BV0A 2VQFB 1JQBA 5DDIP 5CDFE 3ROZA 3KETA 4WBNB 3IQEA 2IS2A 1ETHA 3EZFA 3L7BA 2ZQZA 2ZWIA 3I45A 4DY4A 3K0AA 4OOEA 3WTCA 4HSGA 2PJRA 3K73O 3G0BA 5J2UB 5KU7A 4KWCA 2RI1A 3M2TA 3ZGLA 4DCVA 2WD7B 4AO6A 1TPYA 2RH5A 3GUVA 3GW8A 3UEOA 2JLBA 3OLWA 4RVSA 1W4ZA 3GJ3A 4HSEA 4PBRA 3PGVA 3RTCA 2F3SA 2XNDA 4Z7QB 2QXTA 3O3MB 3OZSA 1ABFA 1PLKA 1QYRA 3QLVA 3TOCA 2ROQA 4NCNA 3HCCA 3GCXA 1DG1G 4PR0A 4E03A 1VLVA 2I8AA 4PG6A 3V1KA 1ZL0A 1HTTA 1YS1X 1EEHA 1A5BB 1W36D 2H2FA 1D5CA 1TECE 2YVQA 3BJIC 3C7CB 3HL0A 4M76B 4PC6A 5JJ5A 4RTNA 1B6RA 1EWTA 1W581 4P35A 3U1BA 3FZNA 2VAWA 3LF2A 2EX1A 3WK8A 5A6VA 5MFZA 1U8EA 2EFEB 3GEPA 4X3PA 4N5NA 3FPGA 4ZALA 3KQTA 1E9SA 4MMXB 5EG5A 3KB8A 1MB3A 4GIBA 4AVYA 3Q40A 3TMKA 5KCZA 3O1LA 4KAXA 1JT9A 4DR7B 2BFDA 4FNAA 1V47A 4MUMA 4ZI2A 4QKQA 1RMTA 4HRXA 2B3TA 1MABB 3M5WA 1UOQA 2BHNA 1O5TA 3ENKA 1KU6A 4P86A 3RD5A 2DULA 4LRYA 4HNVA 1DS6A 1MTZA 3UHAA 5HXAA 3EEYA 3W2EA 3ZJUA 2IXFA 1QQ6A 5FWDA 3AVWA 3I8XA 2NUPB 4WA8A 1H05A 1KO5A 3BB3A 2G9QA 3EW7A 4NY1A 2FN4A 3I6MA 3QM1A 1EWKA 1E5QA 3PZRA 3F7OA 3KUKA 3UV6A 3VNSA 3VU9B 3PT5A 4Q03A 2GN8A 1IPEA 3UY4A 1FTQA 3D54D 3VPHA 2QRVB 2W11A 2WABA 2D1TA 2QY6A 3QVSA 1NULA 2WWXA 4JVNA 2NO1A 4QARA 4NLLA 5M5BA 1MW9X 1DBRA 1W52X 1YCHA 3BBLA 3JVDA 4Y2QA 5K7SA 1XCMA 5ALYA 3PVZA 1KK0A 1JGTA 2HI0A 1N8NA 3DTNA 3OIFA 1YKGA 2JAHA 4JJGA 1V5GA 3M5PA 3HB0A 4EHFA 1OFIA 2R65A 3SDZA 3EGEA 3LC2O 1A5SB 2BKEA 2HBYA 2CB9A 5JMTA 4FGWA 4R1SA 3WC4A 1G8YA 3QE0A 5I5GA 3ZS8A 4FC6A 2GBFA 3A4YA 3Q15C 4PS0A 4Y9RA 1DDOA 2QE6A 5FWXB 2W7TA 1YDWA 5BXQC 2IVFA 3GLVA 1Y0BA 3S7TA 4U7FA 1XTPA 1R0LA 1GPUA 1R1DA 2XCUA 3L1JA 4HQOA 4L75A 5U4QA 4AKTA 1P7ZA 1FUKA 3V6LA 3E23A 4ZV9A 5CJ2A 5BQPA 1QZTA 4ZJPA 2FW0A 5F7OA 1PSDA 3G7SA 2JLWA 1V5WA 1F60A 5JSFA 3VZSA 2X86A 5C7OO 2G5PA 2RGBA 3PK0A 3B60A 3RS0A 5KJ1A 2OBXA 4M9SA 4LVUA 3HVUA 1QVRA 1Z4NA 3FTEA 1LXCA 1S9DA 2J8ZA 2XPCA 3AESB 4ZOAA 1P80A 1XDBA 1IQ0A 1BGVA 1VBFA 1E9VA 1K8ZB 1SC4A 1ZX1A 4KPUB 5DM1A 5CA0A 3U56A 4K9KA 4C4AA 2H0AA 3OTOB 1JAHA 1XHFA 5BQFA 5KYXA 5LJLA 3T7JA 1M5RA 3NOXA 1EXDA 4DWOA 1J7KA 3ANYB 5ICFA 3V1UA 5ITZB 4EY7A 2WWRA 3K1TA 1XKXA 4HD8A 3GHHA 2IQIA 4DZRA 1EH5A 3PENA 3WLMA 3BTVA 4PPQA 1QOZA 4LI3X 3ZKAA 5BURA 1VE9A 1F8GA 1YQEA 1IEXA 2HNKA 3O2SB 4O6VA 3B53X 3K20A 5B7QA 3UWOA 4ZI7A 3AYZB 2CV2A 1YBHA 1NXSA 2BBSA 1HLFA 1TLTA 1AUVA 4DBZA 1TCBA 2PWAA 2WHEA 3EBPA 2XUDA 4A8JB 3IPXA 1MA0A 1VFNA 1M10A 3CMMA 1DFGA 1E9AA 4MV6A 4EPXA 3WLOA 1A9RA 3NRBA 1HYHA 2BGWA 3IBTA 4KJXA 1H93A 2BR3A 4QDZA 4Y7DA 3UKJA 3OFKA 4G8JA 1Z33A 1IY8A 1DARA 4NMXB 1VL2A 3DJFA 5CTAA 3ZXUB 4BNGA 2C2XA 2BELA 1VKRA 1NVTA 4DCOA 2OBYA 3EPHA 2G04A 4LHWA 3KTOA 4B74A 2IPLA 3COSA 1YU9A 4NDNE 3H83A 3I12A 1BAPA 1GLNA 2OCXA 2PKXA 4YGYA 4EFLA 5B1SA 4Q6BA 1TM4E 4IIEA 3UNXA 1YGPA 2GUGA 1HORA 4IIUA 3WIVA 4AICA 3AMVA 4G36A 3OM9A 4EPVA 5KOHB 3X0DA 1USWA 3KL2A 5AXBA 1ZUIA 1EVIA 3GPLA 1LBSA 3F7NA 1J2EA 4TN1A 5A9TA 4CM6A 3UAYA 3EY4A 1Q1GA 1LLQA 4LJ7A 3ETGA 4R1UA 3V3KA 7ADHA 5KTRA 1FS4A 1MEEA 1LH0A 2EERA 1TZ2A 2TS1A 3GJ6A 3DVSX 2FSVA 3MMXA 3NHKA 3PE4A 3PUJA 2J31A 4HMPA 4P83A 4Q1DA 4ZQGA 4DSOA 3EGXA 2E18A 3F67A 2UXBB 2AQHA 3JQ7B 1Q22A 2H5JA 2CMKA 2X2OA 1Z16A 3KUXA 3M1LA 4YO8A 4NPHA 5AK6A 2Y93A 3U1VA 4C05A 10MHA 5CLIA 4OLAA 4KLRA 2GBCA 3AO0B 4BBZA 2AN5A 3LDGA 2HREA 3BDVA 3IPYA 4PYMA 4WGGA 2L69A 5HJ5A 3THXB 1GPLA 1ESCA 3FUCA 2FZGA 2Z09A 1G1MA 4LYFA 3F6EX 1T15A 4ZO8A 1WULS 5E6SA 3ZDAA 1Q0QA 2DT5A 2X7XA 2HIHA 3C48A 3EXG2 2HIAA 1G64A 1V1MA 3LPLA 3WB1A 1M34E 1I7PA 3GDOA 1J8QA 2YV5A 2NZXA 3A6GA 3EFBA 4JENA 3QMPA 5IG2A 3N3AC 3W05A 2O1SA 2Y0CA 4GPBA 4S04A 4YJHA 2PS9A 2APJA 2G0AA 2AC2A 3AUKA 3K1AA 2R6FA 3V6MA 1V37A 2Q0SA 3MILA 3GGJA 1GJRA 5GWXA 2Q9UA 3PNLA 4DLUA 3OECA 4LDAA 1U7UA 4U7JA 3ZVMA 4AIIA 4CIWA 4G67A 1SXHA 1V3UA 2LNDA 1PNOA 3DKRA 1OAAA 1F0NA 4OXQA 6LDHA 1Y3IA 1SA0A 4AMBA 2G06A 2I99A 1XNJA 1HT3A 2OESA 1GG9A 5HCUA 3AVYA 1KEWA 2W2MA 3KAJA 1XZHA 2F1HA 5LYJB 1G16A 4WT7A 2QP9X 3KFVA 3RS5A 5INTA 2D5AA 3P0RA 5KC8A 3U7HB 3BE8A 1JQEA 4LCBA 4LXTA 1T36A 4LJSA 4MUXA 4LHSA 4ZO9A 1SXJE 5JSKA 1GQFA 2QE7A 4NK4A 1Z7WA 4I14A 4YRPA 3HXMA 3B1WA 4XIFA 3EMKA 3LX4A 4M1KA 3WIOA 2WFLA 2ZJ0A 4ZVUA 3QSGA 5C8DA 3HXTA 2M1ZA 4HMOA 1A2QA 1LPPA 1OV4A 4BV3A 1KMHB 2A5DA 2PYIA 4MA0A 1L7BA 4N8EA 5I7OA 2YVLA 3A2LA 4O2BA 4GBED 5BW5A 5L51A 3VNVA 1ML4A 3A9UA 1RCTE 4GMGA 1QKJA 4UU8A 3KU1A 4LYAA 1E20A 3SR0A 1JAIA 3ZV3A 4B3HA 5KPJA 1HMPA 1QS0B 4ERNA 5BUZA 1TW2A 2ZT7A 3HPQA 1ORRA 3GLIB 1MGPA 2EIHA 2ZKLA 1J1UA 3UUEA 2VJOA 3DEYX 4NF2A 5A3JA 3K3PA 1CY8A 3KEMA 1BC5A 2GPSA 4L27A 4NBWA 3ZWQA 4A8JA 5H9WA 3SVLA 4ALKA 1YNOA 4IVQA 3F74A 3LNCA 2F3RA 4MICA 1XVVA 1PU2A 3ET4A 1F4VA 4H27A 1FDUA 1L4HA 5FBRB 2NTYC 2G63A 1QQ5A 3NEJA 3RTAA 5JAZA 1EKXA 1J56A 3P27A 3HB4X 3RV3A 2FCAA 4EKGA 4G0UA 3ISJA 4YV1A 3TKYA 1A88A 4IZIA 4P4SA 3BMQA 3HB5X 2FDRA 4GECA 4GL2A 4QHYA 3BMNB 1I7LA 4QTYA 4DM7A 3RSCA 3ZGYA 3RC9A 1M34A 4F9FA 1Y48E 2DP4E 3L82B 3DOOA 2WZBA 5AESA 1FDTA 1CS0A 4N82A 4IQ0A 2B8TA 4V02A 1H65A 4LWZA 4HOYA 4M0CA 4LSZA 1T2CA 2EFJA 2Q4RA 3FH0A 1N2XA 1YRHA 3BCUA 4RYDA 3A3NA 4MRPA 4Y6QA 3UW1A 3ZQKA 4AT1A 3ZWMA 1N0HA 3H4IA 4LJRA 3HU3A 1FP4A 2XGOA 1NNLA 2FQQA 3ABSB 3QKRB 3SLRA 2AXEA 1YR2A 3H9CA 2PJZA 4MW0A 1DZ3A 4J4TA 1QKIA 2P1RA 4HX9A 2XQGA 4CKEA 3TR5A 3I28A 1E1KA 4MQMA 1PFVA 4FX5A 4BAGA 5JV5A 2GTHA 1ULUA 1QAQA 2D4HA 5DP2A 3M82A 3R0JA 4N3NA 4UFNA 4D96A 1RPNA 1M7HA 4MW9A 5HCNA 1JHQA 3H4VA 2O52A 5I7UA 2BFWA 4V38A 4YI3A 4A0FA 4ZV4A 3GUYA 3EASA 1HFWA 1WZCA 1A3CA 2H06A 3ZX4A 3PKZA 1G4UR 4YI5A 1JXMA 1RJFA 2YJ6A 1MIHA 4AMGA 1KY3A 3B7WA 3H2SA 4UNIA 1GCGA 5BSRA 3TIXB 5JXJA 2C0CA 3HM2A 2XCSB 2WILA 1YAHA 4KR7A 4DLTA 5FBHA 3GG9A 2A57A 1IHXA 3A70A 1OTHA 1DFHA 3GJZA 3LU1A 4IS2A 4E94A 4F5DA 1RHJA 3OPQA 4HCJA 2XUZA 4QREA 2PUFA 1G0NA 3MD0A 3H75A 4IOKA 4R9UC 1ZCAA 1KO7A 1DBIA 2IHZA 4DYDA 5AOCA 5IC6A 5LQCA 3HKBA 4LOIA 3O03A 5E4JA 1FSPA 3X1YA 1VKJA 4RTRA 3R3SA 4R1QA 3TZKA 1ZOOA 4BPRA 1E6LA 2C5EA 2C9BA 3CN9A 1OCEA 3PIRA 3R5KA 1E7RA 4GBGA 4GP7A 2B2CA 1E77A 1YI8A 3V7YA 3D4BA 5DXFA 1L7NA 4LHEA 1M8PA 4GGOA 4P3NA 1ONNA 1UMBA 4YASA 2O05A 2VP0A 3VKVA 4EHNA 4HUQB 2Z0MA 3B2NA 3M6UA 5FUYA 1B76A 2ANCA 1MJNA 1SXIA 3KKZA 4GMHA 1RI5A 3SSOA 3UWMA 1S0UA 2RAFA 4XGQA 4CM9D 2P5YA 5L7TA 3FPBA 3ZV6A 3HKDB 3FNRA 2AJLI 2NT4A 4LK2A 1M0WA 1XEWX 4JBIA 4KLNA 4YREA 3MSXA 2AGVA 4G1EB 3UUFA 5JYBA 4N39A 4K9NA 2PR7A 3E35A 1JN0A 4DVGA 2DJIA 1ADGA 1CPYA 4PLTA 3U49A 3PWZA 2FR8C 2FEKA 4PHHA 2C7PA 5E1MA 4E2ZA 1DJQA 1H8ED 1TRHA 4GLJA 1SD2A 4E32A 2A1TR 1GDTA 1RJ9B 3GPIA 5FTKA 3B1VA 1Z83A 2JI6A 2G80A 5IXJA 2OG2A 3DXZA 1A8SA 2ATCA 2CXTA 3ZOKA 4FPXA 1M6VA 4LZWA 4YV0A 5HKOA 4KRXA 4P2BA 4R8LA 1I0IA 1AZSC 1R5JA 2UZ4A 4Q18A 3WLJA 1ZAKA 2XSZA 4JVMA 3W3AA 4L74A 3T9BA 3URKA 4OXKA 2H1IA 1AZLA 3L8EA 5LSAA 4R2HA 1I2CA 1I4DD 1L3IA 1RXSA 3H9EO 4DB2A 4L5IA 1W9MA 5J2UA 3OX2A 2WP8J 3EVEA 2QMHA 3TQHA 2I6GA 2XOEA 4B31A 2JHFA 4ZPXA 1Q77A 1P0FA 2CFIA 4F6RB 1XTZA 1ZSNA 2R85A 3FR7A 5K3FB 1HEIA 1P60A 3TG8A 1QBKC 4FI3C 2FPGA 4H7PA 3KKKA 4Y1RB 2GD1O 1GITA 4C0AC 3CWCA 1VG9B 4V0KA 5B7NA 5JS6A 1XLTA 1X87A 3CA8A 5JYEA 1JALA 2NUAA 4U7HA 3O9ZA 1ADFA 2H2IA 3FTQA 3NQ41 2IYWA 5J5AA 1EX1A 2HCFA 1E3LA 2OBLA 1EFVA 2HGZA 2OYRA 5BN3A 1ZCFA 1SM4A 2ZWOA 3DGEC 3H1BA 3R4VA 4P2GA 2PA3A 1CZOA 1ZDMA 3CE6A 4UNSA 3D0QA 4UVGA 5CFNA 3OJXA 5E6RA 3U40A 1VLJA 1RQNA 4J7XA 1T2VA 1NE2A 1AO0A 1I1NA 4R0VA 1APBA 2CNWA 1YWGO 2P9FA 1P8JA 3C39A 3E8MA 3SY8A 2IYFA 3V8PA 2XAUA 2WIKA 4K7JA 1Z0UA 4BN4A 3HBLA 2O48X 1ISRA 4QYSA 4MQFB 3JYOA 2BIFA 1P1HA 4RXMA 4UVIA 3ZCVA 1PNRA 1IOZA 4PNEA 1Q57A 3IBFA 3MWJA 3OMXA 1Q1NA 4RKQA 4RVGA 3RRJA 2JIMA 1C8VB 4XWOA 1AGPA 2BW0A 5IDWA 2QSZA 1TGVA 4ZREA 4GSYA 2D2FA 5ECDA 4BLWA 3NO4A 2G77B 1YB5A 4G5OA 1CCWA 1Z0DA 2VDQB 3AFIA 4ZEXA 4KQCA 1IUPA 2VS1A 4RZUA 4MDHA 1HE8B 5FP0A 3ZE0B 5FOQA 1FYXA 1D5WA 1GLVA 1XCGB 2EX0A 2XKBA 1FSZA 3JCZA 4MOWA 5EFOA 1L4NA 3LVQE 3LW7A 4O59O 3X1DA 5B7GA 5D01A 3PCRB 4HAOA 4DLBA 3ODPA 2YNMD 3GMDA 3AR8A 1WD7A 3FRJA 1MABA 4NJEB 3B1FA 3COWA 1PNQA 2GRJA 2WTBA 3PFHA 3FFWA 4Y9TA 4M1ZA 3C8DA 4V0NA 2OKGA 4W1PA 2FPPA 4UMEA 1RKBA 3CJQA 1GXSA 3FI9A 2FF5A 5K05A 2ZZMA 3LKDA 4UXHA 1JXAA 1EWYA 1K5HA 2RJNA 2VEOA 3PHGA 1P45A 1T9GR 4OHFA 3MOSA 4F2GA 5L3RA 3Q9NA 4WOBA 5TT0A 4TTJA 3O91A 1JLLA 4BO4A 5A0VA 4N9WA 4INAA 3GARA 4MQ6A 4JLWA 1AUQA 2HSGA 3WLNA 4D9EA 3FETA 3BC1A 1X9GA 3F3SA 2WZQA 3G3EA 1AUPA 2Z5FA 3DXFA 2CD7A 3KAPA 4CF4A 2YOHA 1UOPA 1XO1A 1CQWA 3P9PA 3EF1A 4GQBA 1Z2AA 2E3JA 3OLQA 4X3CA 4B82A 4FGZA 4WY8A 4TM8A 1HQCA 5JCZA 1PWEA 1VCIA 5KVSA 1D09A 1KJYA 2XOKA 1MB2A 3AU9A 3EGXB 4DR3B 1XDUA 3D2CA 3IP3A 5ECYA 3EZLA 4Q48A 4MGIR 1ZIXA 1K98A 2O2XA 2BFEB 4JC4A 2V8BA 1EWVA 1XLWA 3O95A 3R7AA 1C7FA 1F4LA 1SVMA 1W73A 2R62A 1T1IA 3IIKA 1A4RA 1OBFO 3HDTA 3T7AA 3DVQX 1ZZEA 1JHAA 3TUJC 3W2HA 3HJFA 4F3KA 3QPAA 2DUJA 1JYEA 2FHPA 3K9BA 2DBRA 4F45A 2XTAA 5JXWA 1KO1A 2GSDA 4FB4A 1A7JA 1R0ZA 1QPZA 5KNDH 1U2RA 4Z2AA 5JS1A 4NBRA 4BQPA 2R6ZA 3EQZA 1HE4A 1UCFA 4DLWA 4NBKA 1J2YA 4TV9A 2SNIE 2WM3A 5BT8A 2X0FA 3W8FA 1D6JA 4C2TA 3S5JA 3W6NA 3DAGA 1IN4A 4TMYA 3G9QA 4MW6A 4D46A 5H16A 4GR4A 4RQBA 1N9GA 1H2FA 4MB2A 4C04A 1CULC 3IUQA 4C4YA 3M1AA 3OD1A 3F78A 4IWYA 3HVRA 1GSOA 4YACA 1E3QA 4BMYA 1B2RA 3NCHA 3M1IA 2ZJFA 2G9RA 1NMQA 3GGDA 2IPXA 1VKOA 1SXQA 2ZE8A 1CUAA 1U65A 4R8VA 5TQVA 1IZ8A 2Z58A 1E3IA 1DDIA 1QG6A 2G7MC 4NV1A 1HNWB 1D04A 1PVDA 5HUQA 4Z4EA 2B99A 4WXMA 4QGFA 3ZHRA 3OURA 5C8YF 2D8MA 1TI7A 1L5GB 3BHNA 1ZMXA 4MGZR 2D7DA 4R1MA 3GL9A 1YR8A 3WHLA 4A6DA 3LWDA 5F3DA 4YT2A 1XDDA 2HLPA 4WVLA 2DFTA 1WIWA 2IC5A 3VKUA 3QOYA 3RJTA 5KU1A 1YDMA 3ZH2A 1BU5A 1GYPA 3KXPA 4JLNA 3C5WP 5G1PA 4UVHA 1JG2A 1X7XB 4LDJA 5JO9A 4DLRA 3E22B 4NQZA 1PDOA 1QOQB 4CZ2A 5FL3A 5IJZA 4EKDA 1T3GA 2AEJA 2VKQA 4BQRA 1RLMA 4AUKA 4MYRA 3EGOA 5ADUS 1H2RS 2QY9A 4I6GA 1XALA 1U28A 2BMEA 5FL7A 2I62A 4KNVA 2P9TA 3I4CA 3DO5A 4FYWA 5TMEA 3TLYA 1OY1A 4HH3C 3RH0A 3D5EA 4IL5A 1RYEA 1QRUA 2Q9AA 3PHLA 4EG8A 1Z5GA 4RO0A 2PRSA 1FNSA 5BYBA 4PSDA 3UGKA 3NVKI 2KPOA 1YQUA 5L4LA 4UEWA 1ZUNB 3MGAA 3OQOA 1QO7A 1KIAA 2OXTA 2GESA 2RHHA 5TC4A 1YZYA 1AV6A 1ZJ6A 2ODTX 1WABA 3QX8A 2GCEA 4BEWA 2X4GA 1DQRA 1NPYA 3L8DA 3O9MA 1FEZA 4JLUA 1BEZA 1WXFA 2VSQA 3KQLA 4DV6B 4HWKA 5G0VA 4ZVTA 3KFXA 1UT5A 3R1IA 4EMSA 5GIOE 1OX4A 4B9EA 1CNEA 3QLJA 4FYXA 4WRRA 2HRZA 3UMVA 1GL9B 1R88A 2JARA 5AOBA 2BMDA 3BXOA 5DX0A 2RDMA 2WFLB 4YMHA 3I04M 4PZ9A 4PN3A 2HYIC 1G1AA 3VH1A 3BG5A 5BMOA 1XP8A 3G2LA 5LCXA 3SVZA 5AXAA 3SS9X 1NI3A 3PEFA 4IDAA 4CT4B 1ITZA 4EY3A 4TMVA 1G63A 4JEHA 1IB6A 3H1EA 4A36A 2IZ7A 4QYMA 1Y8AA 5KNBD 4H0FA 1D8AA 4IH4A 5JCJA 3WLQA 1OLXA 2XWPA 5BMVF 1GUFA 1HNXB 2AEEA 2CDBA 4WKNA 5EMNA 1EGHA 2QJRA 4PX3A 2BZSA 1SBZA 5CFLA 1WSBA 4G0NA 1V7CA 1AQIA 4NWIA 5GZ3A 3ST7A 4EFKA 1NYQA 2A9QA 3DXYA 4X41A 4KK4A 2VXCA 4LYJA 1W76A 2MDTA 5BO5A 1S2MA 3JYLA 4HDCA 3RVRA 3TE6A 1AS0A 4FSHA 2GVZC 2AG8A 4HDRA 2VHWA 4UHKA 3MTGA 3JWIA 2H4XA 4CKCA 4ZVKA 4DDWA 5EUCA 2WF9A 3RGWS 1THGA 4D41A 2M2IA 4N48A 3GRCA 3DBLA 3EDOA 3Q7QA 2FXIA 4WNAB 3VHRA 4B3IA 3V1MA 2HQOA 1FY2A 1I4OA 4IGIA 3SR3A 3FHJA 2IYEA 2XGMA 4QOGA 2R0QC 3DVLA 4LYYA 3E48A 3WL8A 3QA3E 5JRDS 3PNPA 4XIJA 2BLLA 3GEDA 1PEYA 2BMVA 1VL8A 5HRCA 3EVAA 3SG0A 3BGSA 1XVAA 4BIIA 5ELLA 4IX9A 4AJEA 4OHKA 1LI7A 3I0MA 2X19A 3OVMA 3AKEA 4OJYA 3F1KA 5CM9C 2XYQA 5HK8A 2XA9A 4PZAA 4CKCB 4DRZA 3RJZA 7REQB 4W9NA 3R9XA 3DEHA 1JS1X 1SHUX 3CH4B 3L1VA 4AFNA 3LKZA 2QL5A 2QA5A 3CPSA 3QVJA 3KLBA 2X0NA 4KVGA 4C3OB 2B7LA 3DP7A 4LXGA 4YYEA 5LXTA 1ZG3A 1ZRNA 2GPWA 2OCGA 3ETNA 4KHPB 4DYVA 3V7FA 4BJ1A 1WR8A 4H31A 2BGLA 1J24A 2W2LA 2P9JA 1JF8A 1VHLA 2ZTUA 2ZSHA 3G89A 4RXTA 3ZHYA 4LV8B 4HVCA 2RGXA 4X54A 3UYKA 2HNBA 1W4LA 2M6LA 1JEQB 3R2JA 2WR8A 4UHEA 1I80A 1PWZA 4NQRA 3NPAA 1SRQA 4GOXA 4B2LA 2ONZA 3HJUA 2CLCX 2HCBA 3IOMA 1DG9A 5I7VA 2Y76A 4H0NA 4LC9A 5E0OA 5FULA 4TWZA 4CFZA 1PJ8A 1UBCA 1Z2CA 2R00A 1WNFA 1HK7A 2ZM6B 2I9KA 2QN3A 1Z08A 5ILOA 5IZ4A 1QGZA 1TUBA 2IX9A 3IA2A 4R1NA 3ZVNA 1OLOA 2O8NA 4H77A 4CBVA 1OGJA 3BJEA 1E0SA 4AJJA 4GVPA 4KLCA 1IN6A 2H54A 1NNUA 1WQ4A 2OOKA 2IHKA 4IZ6A 1K0UA 3IDZA 4KRYA 2FMKA 2BJWA 4NABA 5DNAA 5EZYA 1GD1O 3W5UA 3VR5A 1YB4A 3X43A 5JATA 3QHAA 3R0VA 3FLAA 4PC7A 4DBLE 2BFFA 2JK1A 5K09A 2GARA 1OIWA 5B6PA 4JYBA 9ATCA 3QX9A 2P9YA 5H1YA 1NN5A 5JCJD 2H0QA 3E27A 2X23A 4KZPA 4FMCB 4C6HA 1Z06A 5B6JA 1L4GA 2WV7A 4I9GA 4XGIA 2OO7A 2PCLA 4DEYA 5J1SB 2C07A 3FOEC 1GGFA 3LTEA 5D6NA 3TI9A 1MQAA 2YX1A 3T9CA 4EP1A 2PBRA 3MOGA 4FN5A 3GLGA 1C3VA 4GMFA 3E5NA 1SK9A 5HHTA 3JQQA 4Y2VA 3VUFA 3KKNA 2UZ1A 1TIKA 3BSYA 1Z8DA 3M89A 2WI8A 1YB1A 4JLOA 4AJ4A 1EX6A 2CDAA 4F71A 4G0YA 9ABPA 4I5DA 2JJ2D 2J30A 3F3KA 3IFSA 2B1QA 4ZTZB 3EVCA 3UT6A 3QGMA 3FY4A 1L3CA 4PLWA 4A1OA 3PQ2A 2I71A 2NSYA 4HUQA 4U8GA 1B41A 3ROTA 1IWOA 3T3OA 3W5BA 5DNWA 4L0QA 1YIOA 1R4AA 2XD4A 4FYMA 1GTJ1 2CEAA 3NHYA 5LZ2A 2G5GX 3KOMA 2JJMA 5B58T 3A3KA 4PW0A 4W5TA 4PGHA 1N0VC 5DSZA 3DAOA 3WIDA 1JSRA 1PO7A 4D81A 2E37A 5IDQA 1U0BB 3R7SA 3T7IA 3PC6A 5CLJA 3EJ6A 3BCSA 1XAGA 2B30A 3KCQA 1AQUA 4K46A 1NY5A 2XCLA 2Y1KA 3EARA 4P8RA 4HEHA 1E2EA 2WNIA 4OKIA 2DLDA 3TSWA 5L7WA 3TQIA 2Y1EA 5CYPA 4KPFC 4L76A 5DT9A 1X7WA 2FOXA 2C00A 2NZ8A 1L5QA 3BHJA 4NARA 3WWCA 1TKBA 1YR3A 3C6MA 5GINE 5G0TA 2YQ4A 1NXOA 4ZZ1A 2PV7A 3AZPA 4Q47A 1TE2A 6AT1A 4D9JA 1JHXA 1P74A 3TQSA 2C2GA 5EJGA 3LWZA 3SX4A 1WPXA 4LJ4A 5BP7A 2FVXA 3A8TA 3N2IA 2YS6A 1PF7E 3EIUA 4QATA 2CCJA 3CZQA 1LPMA 3D81A 3LX5A 4QT0A 3WGOA 4DSAA 3IUNA 4MZDA 3B9RA 3VDXA 5FWAA 1WX1A 3DLIA 4W82A 3ZNOA 4KFSA 3CURA 1G2OA 1HYEA 3WMWA 1UANA 4WSOA 5F9HA 2QEQA 4OI4A 3I1FA 1CR0A 4B5KA 2ZB3A 1UAGA 4BASA 3X1WA 2Z43A 4RSGA 4YJKA 2Z1MA 4IUYA 2V8OA 3GG2A 3OHMA 1QQTA 2C3YA 2CMDA 2ZTHA 5IDVA 5A6SB 2QAJA 3RV4A 1RRGA 1E3SA 1SCKA 2BFEA 4KJZA 1GU1A 5TMDA 3S2UA 2FZ4A 3DMRA 4OXIA 3B3AA 3MA0A 2ID8A 1V5FA 5KINB 5H4GA 1WKVA 3UOGA 5IDXA 3KCNA 3VJKA 121PA 2CYAA 4R7GA 4L9RA 2OYCA 5AJZA 1DWUA 1RRMA 1NFQA 3EQ9A 3TMYA 4PNHA 1DIOB 1K2VN 2A9RA 3ABRB 4R8KA 1ZVVA 3L4BC 5BSFA 1W87A 4GD3Q 4AXBA 2A5LA 3P4UA 3MUEA 1OZAA 4HDQB 4PVCA 3SKVA 4B7CA 1WW3A 4ARAA 1HI9A 3HFGA 4IUDS 2LXNA 4LJLA 4DJTA 1LQTA 2VRBA 3RRMA 4DC9A 2WT9A 5L7YA 2A4KA 1GKYA 3TRKA 4A0HA 1BWPA 1NN0A 4J3NA 3AEUA 4BYMA 4ZQIA 3MPOA 2ONYA 2ZRFA 1Q19A 1NDHA 4I0WB 1QTQA 3N8KA 4LZPA 1CBUA 4QEDA 3ANTA 4XASA 2EC5A 3CWQA 4DCJA 4MKRA 4F06A 2JH8A 1VE5A 2C8LA 3L7OA 2G36A 3PUYA 4HATA 4MCIA 4RWEA 2B92A 2ZRMA 1DKMA 4Z0TA 1ZR2A 4YP9A 3HCOA 2WG2A 2EOAA 2P27A 5HEKA 4QVKA 1R6AA 2FJ0A 4KH1A 3HXOA 1B43A 1KRXA 3ILXA 2P69A 16PKA 1PCXA 3TW4A 1F1BA 3LHFA 3IAFA 5EKDA 1W6UA 4YT4A 2BI7A 2HH9A 1NJGA 3OUZA 3GVPA 2RK3A 1U81A 1XQXA 1Y1SA 3L6UA 4DQLA 1OLSB 2AYYA 2HEGA 4MI3A 3CUWA 1SOWA 4FP9A 4P92A 1TAQA 4O4HB 4NJMA 4IHJB 4URFA 2W4IA 5K8CA 1O6ZA 2ATEA 2BSAA 2P5SA 1DO0A 3LFTA 4G56A 5F2OA 4BKUA 2FK7A 4ZAGA 4JP8A 3Q0EA 2ZJ7A 1TTQB 3QPDA 4K1XA 1Y82A 4E2YA 2Z5LA 5F64A 2YNMC 3ESBA 1X1RA 4Q9HA 1KQFA 4QOHA 4PBSA 4XAQA 4JI7B 1JJAA 3TRFA 1NSYA 3HFRA 1WY5A 2Z4SA 3WWEA 1YDHA 4FWTA 2P6RA 4IWXA 4KFUA 2XUPA 2RHWA 4ZCIA 2CVZA 5ALHA 5BW8A 2D5BA 4B4UA 2DQSA 4MUYA 1ND5A 1PV4A 4C43A 1T43A 1IRXA 2ZXFA 1J4AA 4W99A 1V16B 2PIDA 1OBVA 4TRJA 3EMVA 4B6QA 2CLIB 2OFWA 4YJ3F 5C8ZA 2OV8A 4OB7A 5IKXA 4QG7A 1WKBA 3FSGA 3B1YA 3H6HA 2R5NA 4RFVA 4F5ZA 2OEPA 3VJLA 5C35A 4F85A 2C7RA 1H3NA 4MRRA 3D6VA 1GZUA 4I8DA 3QZUA 1U2EA 1PFUA 1PL8A 1PR5A 5CGQB 5KKAA 3B82A 4OD0A 3N6RA 5C46F 3E1SA 2R96A 5T67A 2JGMA 2N1MA 2IYUA 4DIFA 1CJUC 2W6QA 1IU9A 1HH4A 2IIVA 4DJJA 1EM6A 1AK1A 3KR0A 1CJVC 2NT3A 4AZSA 3O4HA 5TGDA 4LPSA 2H5IA 4RBNA 1U0EA 4K9OA 2E4WA 2RAUA 5KO2A 2X4LA 2FN7A 5DBIA 1GA4A 2O8DB 4EKYA 1YBFA 4TPKA 5LYJA 4A9AA 3GUUA 4L7VA 5EWMB 1N6OA 4K9LA 2B21A 3DBHB 2DXIA 4ZEWA 1R8JA 1P2DA 4MGYR 4MWEA 3H2JA 1E2LA 1ZVMA 3AY0A 4GPAA 3VPBA 4EBFA 1GNTA 1VDMA 1I9GA 1Z5ZA 2WUVA 3JSAA 3NWEA 4NRDA 2DKOA 4NZ9A 3O9VA 3ZX5A 4NZYA 1RLUA 2DB3A 1X74A 2AIRA 4EMTA 1KMHA 4JT2A 4CF5A 3RKUA 1BS1A 3Q12A 4TN5A 1WCV1 4L8GA 4G0VA 4N8SA 4CDRA 1Y5MA 1MIOB 1TU4A 1U4SA 4I50B 4IDDA 3T9EA 5LMNB 5BY2A 2FMTA 2WJVA 1WZEA 2Q29A 2BMFA 3C4JA 1DMRA 1P6UA 2QAGC 4S2UA 5B2ZA 3EZGA 3I72A 1S02A 2UUPA 4C7KA 2BEWA 1GUBA 2YRXA 1X80B 3R6TA 3BXHA 4P82A 3C85A 3UHOA 3NI2A 1XVUA 1ZM7A 4HXYA 3AUXA 3E9ZA 4BE7B 3CVVA 3C3YA 3UAXA 1VBMA 2ZYTX 4E33A 1IN1A 4HVAA 1UPCA 4IX1A 3PPIA 2P0YA 4JBWA 3CTMA 4J94A 4TT3A 4FE4A 4QSHA 4QU0A 1DP4A 2HY7A 4TGLA 4DLZA 3L18A 3ELUA 4CTMA 2QPAA 4EB3A 2LGJA 2Y05A 2GD6A 1Z15A 2VF2A 4QRHA 4FMPA 2FWNA 1VHTA 5DOZA 4R51A 2X6RA 5FA5A 2H29A 3GZTB 1C41A 2NU8B 1SKBA 2GRAA 4EEXA 1E2QA 1CQJA 2R8PA 3HZRA 1J6UA 2PKWA 3NB0A 1DV1A 4H1VA 4KWIA 3WWZA 5CT5A 1XA3A 3QWBA 4QXAA 2EP5A 2V6MA 3I6YA 3VOAA 3AR7A 3ZHQA 2NSDA 2VUUA 3DSRA 4BU0A 2EFDB 5JDIA 1GT6A 2GMWA 1HZZC 1IQUA 5KYNA 3DFZA 2WM8A 2WYWA 3M6WA 4Y6GB 3OQVA 2PZ8A 3W1WA 5KTKA 4DRXB 1YGYA 5C81A 3KB6A 1WMEA 3OJCA 1SNYA 3QKRA 3ZWPA 2DEUA 2CNDA 4FJ0A 4FSXA 3N7TA 4X8LA 2FMHA 2DM6A 2PXXA 2PE5A 1H6DA 4G0ZA 3F6PA 4DT1B 2F59A 3HCPA 1Y6QA 1PFGA 4JH0A 2WIAA 4A23A 2EBHX 3MELA 2JZNA 4ZGWA 3ZWYA 3IR5A 1EVJA 1PNVA 2J3MA 4MLZA 1E1RD 2PZFA 3DOCA 1DXYA 3CH6A 3KHTA 2V5UA 4QBHA 2XIQA 4YAEA 2CNNA 4FW8A 1YT5A 3DOUA 5CVVA 5DGHA 5FTJA 5K2MA 2C2KA 2XUJA 5IANA 4M55A 3AETB 4ECAA 2G9NA 2YZ2A 2VPYA 4MUFA 4HEA1 2MSNA 5DPMA 1Y37A 2XI4A 3O74A 5ILQA 3TVTA 2V7UA 3JD2A 1T8YA 2YVKA 2C58A 3IHKA 3JX9A 3M4YA 3PGMA 5HIIA 5IBPA 3V00A 5C1IA 4DFDA 2HSWA 1YBAA 4WL0A 1UBMS 4AWAA 1O6GA 221PA 4L9SA 4PYJA 3UXYA 5MGNA 4U2CA 4YBRA 4HY3A 4TTVA 1FFBA 3HXKA 5DEIA 4EVRA 2BYTA 5EQFA 3U4QB 4AZTA 4CMCA 1A77A 1RMQA 1ZUNA 2C03A 3J7AC 1RABA 1ZAYA 2EKDA 1JH8A 1NHWA 3K2BA 1GHTA 2JBAB 3GFSA 4OQQA 4YP6A 4M9RA 4F12A 5BUSA 5TPZD 5BORA 2WLSA 2YHAA 3GLIA 4Z3OA 3Q9UA 3MEQA 3P0EA 2WWVD 5DSXA 4HQFA 4DV2B 2G6BA 4BO5A 2JKVA 1RPZA 3LDAA 4ZCSA 4B81A 1OX4B 3GIWA 3SOPA 4WD3A 3WOHA 4B6GA 1W36B 2YXNA 4WK2B 1I4TD 3A32A 4UOEA 1SCJA 3ZKWA 3IE2A 1MP0A 1IN5A 4ZHQA 1X3SA 1ZD8A 2WIFA 2BGUA 4ER7A 2X42A 4DMHA 4YRJA 1V39A 4R9RA 4CKBB 3PQ6A 1AF4A 1N7JA 3A11A 3TGPA 1HV8A 4GM4A 3W7AA 1H42A 1AGNA 2L42A 3HA5A 4Y9SA 5FBKA 3AQ4A 1R5NA 1HXHA 2WUFA 2PX6A 4M98A 5AJTA 3TD2A 4EW2A 3A6EA 1XHEA 2CZQA 4X95A 2V97A 1N75A 3W8RA 1XZMA 2YJNA 2PMFA 4NCKA 2CLLB 4G25A 2W0MA 4WZBE 1E7YA 5K51A 3G6WA 1XZPA 1LEHA 1W2WB 1W47A 2Z1NA 2H1RA 3DTYA 4L95C 3CF6R 3ZD9A 1MOZA 1EFLA 1XLVA 1ZICA 3UICA 4WK4B 4E7PA 4ZHQB 3HU2A 1G9XA 4IUBS 2TMGA 2ZTSA 2IUUA 1UKEA 2GN6A 3E18A 1UUFA 3AL0C 3EDCA 1I13A 1WOMA 1KS2A 3TXXA 4ZZ3A 2GXQA 2I4MA 1IHUA 2WYOA 4K6MA 1S1CA 4U1RA 3WDLA 1I7NA 3ZTWA 2E87A 2PVPA 2A0KA 2ATVA 1B74A 2YWGA 1LS1A 3ORRA 4TUYA 1NBHA 4Y2GA 2J5KA 2GERA 5JVDB 4L3VA 2GAFA 2IF0A 1V6SA 3QJ5A 3WJ7A 3ADCA 4ER5A 5BVHA 2WU1A 4U7DA 4XWGA 2JVKA 3HZOA 4V0ME 4NS1A 2WTEA 2V6JA 1KFJB 2OHHA 3CE9A 1T8PA 4R16A 1RJEA 2BCJQ 3G0IA 3BWMA 3GLKA 1OHHD 2RG7A 3OZEA 4G2NA 5CM8B 5KJ6A 2PZKA 3HBAA 3L41A 2OFFA 1ZPDA 3MS4A 3ZDXB 5U9CA 1FVHA 2HDNB 1Q7TA 3A7DA 2C5BA 4CIAA 2FMFA 3QV2A 5EP3A 2D1QA 4PRZA 2I4RA 3ZE8A 4J0IA 4OHUA 3DMGA 2EBFX 1XT6A 4ZQEA 2DLCX 2C88A 3B6EA 4NYMR 4ALIA 2WWYA 4TYMA 2EHJA 2UUAB 1S2LA 4MLDA 1E2HA 3AUJB 1JIKA 3STHA 2IJGX 4DNXA 3SJBA 3IQFA 5KZMB 4UM5A 2HGSA 2BM1A 3D2LA 2XUQA 1RAEA 1PX0A 3RIYA 2R1ZA 3K0EA 4O63O 4FSDA 1XRNA 2WINI 3DFMA 4PAQA 3P5BA 1IVNA 2C4WA 1EB9A 1ST2A 2X5JO 3I9V1 3D8SA 4ID3A 5A4DA 3F6CA 1W88B 4MWGA 1A5ZA 5IM4A 1N2CA 4DIUA 1LCIA 4JNCA 4FUQA 5DWDA 3UC5A 1R50A 2OCDA 4Q4JA 2JHPA 2XQIA 4Q9JA 2FR8A 2GPTA 1TQDA 1TYAE 3QYPA 1JEAA 3F96A 1ZH8A 2ZSIA 3PDWA 3CZ5A 3RK4A 4B47A 2H08A 3STYA 4BNVA 4BNTA 2QNIA 1FMJA 1M8KA 4MW7A 5JY1A 4Y2YA 2R6CA 4UCWA 1F2DA 1B8UA 3HN6A 3OZ7A 1QVWA 3IQWA 2FPXA 3HO8A 1YASA 3U0VA 1P18A 2CYCA 3N76A 4MKZA 2CNOA 4Q12A 3MGGA 2XT9A 2YXDA 1G7RA 2M1XA 1XVIA 3D6HA 1U5BA 3ES9A 3DDNA 3RVBA 1W4CA 1OH8A 3GGSA 4RD3A 3DYVA 4IICA 3IUYA 5A4IS 1BX0A 1U9IC 3ZCQA 3IUJA 3KNZA 5KVVA 4MWOA 1IRIA 3WP1B 5EJ5A 1WMDA 3PHIA 4LCJA 1WMSA 2QJOA 3CZCA 3F98A 5TQ2A 3VDMA 3K4QA 2Q3MA 2WJJA 1Z0ZA 4Q1VA 5TGZA 4ZFNA 1OXTA 1J99A 4NONA 1KZYC 5CDGA 1RJWA 4V3BA 1NQAO 2H1CA 2V96A 3CEHA 2V03A 5HILA 5LZ9A 1C9EA 2CUZA 4KQWA 1CZHA 3ETLA 4B83A 2LPMA 3GFFA 4OH7A 1Y63A 1BDMA 1OKKD 5C5CA 1G7SA 5EYPA 2P62A 2WMNB 1NVVQ 3K6SA 1OWOA 2D1SA 2XMSA 3GCDA 4XSHA 2WSSD 3RYIB 4D4HA 4YPOA 1DL5A 1JE1A 2WMDA 2GXUA 1ZJYA 3B3GA 3IBCA 4GM0A 4YIKA 2PL3A 2NU7B 4LBZA 1U5AA 1PT7A 4CRWB 3II6X 2OLJA 5BRAA 4BFUA 5F2NA 2PSHA 2RAVA 3NYIA 5EWLA 2ZR9A 4Z4QA 2VSFA 3A2KA 1BMTA 3O31A 4FOTA 1QF6A 1TYDE 1Z22A 2HXGA 2Y1GA 2WWWA 5LOVA 1MXFA 1XJQA 2A84A 4P5DA 2WEKA 4UU1A 1A9SA 2LVBA 3E3LA 3RFTA 5EC8A 2HJGA 4QWWA 2FW7A 4ZVLA 1ZJWA 1UDCA 2YIMA 4RQTA 4TUYB 5BUQA 5C5IA 3KOWA 5JVDA 3TDNA 3FVTA 2VAMA 2WHPB 2C57A 2OP1A 1KQ3A 3B3JA 3DCIA 1ZD3A 2FNAA 4PSAA 1GPJA 2OCLA 4LE0A 3RYIA 4NPAA 1EMDA 3ZDBA 2DR3A 3O3NB 1BCSB 2Z6VA 2BKLA 3GEHA 4RVOA 4WKCA 2Q7OE 2NU7A 2M9MA 1VHWA 1EAMA 2VJMA 3DPSA 4KR0A 1CY2A 4QPJC 4AJKA 2VP4A 2H2WA 1GAEO 3HMQA 3MWDB 3EF3A 3PKIA 4ASUA 1IDOA 1OA0A 4BMDA 1RM3A 3KQKA 1QIIA 3GROA 3COZA 3FTNA 3ZLJA 1TUEA 2ODWA 4NPCA 2IBMA 3AEUB 3E15A 4NBUA 4L22A 3AM1A 1T13A 1GTSA 1N2GA 2QX7A 4DZZA 1WW8A 3BXEA 5IK2D 2W93A 4M89A 2MYNA 1KY5A 2L17A 1NRWA 2O8EA 1EIWA 3CB2A 3O73A 4JOCA 1D2GA 4R2KA 3Q1KA 3AVXA 1YOBA 2ERYA 1Q74A 1KKUA 1KP2A 4KXFB 5FPYA 1NG1A 3R5FA 2QP4A 3MC1A 5KYXB 3F4LA 4LZLA 5HDBB 3BRWA 1YH3A 1TTHA 3NUQA 2CNKA 2BKAA 2G9UA 3BMCA 3ENQA 1EJ6A 4INPA 3SD7A 4C06A 4DWWA 2NVOA 4FJ2A 1P2FA 2CJYA 2K4MA 3M3HA 3GNLA 3NR2A 1YTUA 2PDAA 2W9XA 3C97A 3HZHA 2IK8A 1L7RA 4FTWA 4MRMB 4BNLA 3K9WA 1ZM2A 4ICIA 4RZHA 4ZO7A 5ALDA 3W06A 1JDPA 4G1FA 7YASA 3QFRA 4A6EA 2ZXUA 1FQWA 3GJSA 4NU6A 4Z0HO 4D57A 1JKJA 4L7QA 5IFKA 4BE4A 4KIFA 5P8WA 1VE6A 1I6KA 3RBAA 1PG5A 1QH0A 3F1LA 1L4MA 2BGGA 4J29A 2IOHA 3FOFC 2PGJA 3Q7IA 2MTBA 3RHFA 1KVQA 2CBGA 3V1YA 4B48A 6PFKA 1FQOA 2JLCA 3LY8A 4UTXA 1YKSA 3VR3D 5KYTA 1UH5A 1X7ZA 2FKAA 2FX2A 4DBVO 3FXAA 4ND1A 4QSMA 2CXHA 3A26A 2QUHA 4GSKA 4S12A 2BLNA 3TNYA 1J8DA 3VTKA 2DWPA 3OQIB 4TRMA 2XHEA 4E6EA 3L92A 2NQTA 1M73E 5JRJA 3O8QB 4H3SA 5J2TA 4ARCA 2HD4A 1C4OA 1LQ2A 1ORDA 1BHO1 1FYWA 3AONB 1QFSA 4V0QA 2BN4A 4GYKA 1E1RA 1D6SA 1TJYA 2Z3VA 3DQPA 1T0HB 4HZIA 5EXSA 3SMVA 2PO7A 4F9TA 1OB2A 2O8DA 5DP1A 4LY0A 3S8YA 2RB4A 2CNLA 1REQB 3HDVA 3D4OA 3DMFA 2Y92A 2MSDB 1N3IA 3RADC 2BZGA 2OAQ1 3GLQA 1BJTA 2HXSA 5JQGB 4MSUA 3K6JA 1Z2DA 2AHOA 3KEFA 1FFXA 1T1RA 2X22A 2Y99A 3DZDA 3G8CA 5KAMA 3UJ8A 5IJ9B 4HDMB 3O2JA 4GMDA 4IIDA 3U9LA 1VG1A 4ARIA 3FLMA 1TVMA 4YCCA 3FDXA 1NYLA 2ZYHA 3V4RA 4P4NA 3NDPA 1BE8A 2AUMA 3IOBA 2GZ3A 1A7AA 4Y67A 1T24A 1DJNA 2CFTA 2W71A 3AHDA 2GN1A 4XLZA 1J0AA 5CMLA 4IDPA 3U3KA 1H69A 3CMCO 2NW6A 4OGWA 4Q7LA 1K75A 1LX7A 4HQ6A 4OH1A 5F1KA 4A0SA 4E31A 4OQDA 3ZLUA 3SICE 2JLUA 4Z0PA 1QIFA 3CLSD 2WTNA 3I0NA 4BTEA 4EMBA 4O4HF 4I55B 1B14A 3THWB 4LRTB 1W25A 3DLHA 4KMMA 3KAQA 4LCEA 1W1IA 1QBGA 3UW3A 1TA4A 3TOXA 5ITZA 1VLQA 4RMJA 5JTUA 1ZI9A 1Y1LA 1L4YA 2DPGA 3IRUA 5BSHA 2NTEA 1ZP6A 5AJHA 1UPTA 4AZ3A 1V45E 2RHOA 3ILYA 3OIVA 1Y3HA 5K1ZA 5TDHA 3ILHA 4Q9LA 3E2IA 2VATA 1THZA 1N5MA 2CN1A 2Q41A 2YHUA 2KI5A 4B3BA 4L02A 4E3ZA 1X9IA 1F8FA 4RGYA 5HQ3A 3G8DA 4J1TA 1HKHA 3MHPA 4D0SA 4G4SP 1E1MA 4NCAA 2GWRA 4KQXA 4PIMA 4GYWA 2W2VA 5EP1A 4RU1A 1OREA 2PGOA 2V45A 2VR1A 2X9NA 2BCGY 1BZYA 1EG7A 1N8KA 1RADA 4II2A 1U9CA 1ZXXA 1UK6A 4MB0A 4V0OA 4CF7A 4B3MB 5KNBA 3VNRA 4K1LA 3SEZA 2PH7A 2ZAIA 2BVNA 4M38A 1Y1KE 1D9XA 2NSLA 4OK5A 4CF6A 3VDNB 1JKJB 4L85A 1NTOA 4RHCA 3E9RA 1CW2B 2PGAA 3D7NA 3FOWA 3HCFA 3JR3A 3MBIA 3MN1A 3ZTTA 4L2IA 3UGJA 3MJHA 4TZ6A 3N1UA 5FPTA 2VTDA 4ZXPA 4OHYA 1R0BA 4JC5A 4ZCPA 4NBVA 3DV0B 1F1JA 2Y1WA 4JDPA 3V4SA 5H3HA 2J9GA 3B13B 3GJXC 5IM5A 3T4XA 3T5CA 3AF3A 1PAUA 3TLGA 4B6OA 3H6KA 1HE5A 2WP0A 1KJJA 4J76A 3H2GA 4YEDA 1RJGA 1XMSA 3WQSB 2VF7A 5CDYA 4M0LA 4U63A 2X8LA 5CB6A 4AUEA 4MV5A 4OSEA 3BQMB 4UXJA 3ZU6A 1Z68A 3CO0S 1G7TA 2LCQA 4GKVA 3OPYI 1FNMA 1W59A 4WKOA 3UH1A 2A4MA 1UMDA 3K71B 3L4KA 1U4NA 4YB8A 1JG7A 2Q49A 4I4IA 4AN0A 2ID9A 1E63A 2VHUA 3GZNA 1OJLA 2BCEA 4GGMX 1ZCZA 3S4YA 5L40A 3H9BA 4TVSA 4GL4A 5E4YA 2Y67A 3WYNA 2D3WA 1SIUA 2CJXA 1VIVA 2I1VB 4C4OA 1NQ5A 1Y3BE 2JAPA 2VZLA 1V1MB 4IHAA 4TWIA 1WJGA 2C5GA 4BKRA 2YVAA 1IQRA 4PYOA 1WB5A 2ZPUA 3KT6A 1AS3A 4BZQA 4F97A 3A3PA 4YJ2B 4EQ6A 4HAZA 1V11A 2ZBFA 2XB4A 2YL2A 5KIAA 2Q3JA 2V7XA 3ABOB 5IJ0A 3JALB 2GM3A 1XU9A 3FBTA 3KR9A 2O7NA 3CGWA 1V0JA 3KVRA 5FFMA 4HXGA 1XWFA 4DMGA 4R31A 2ZUEA 1WVMA 2XT0A 3IEIA 2XGJA 3K0AB 1KJNA 3EOZA 2QW8A 3DEAA 4Q7QA 2J3KA 3BJRA 4K6CA 4U0JA 5FOWA 3WKBA 1T4MA 5JQGF 1W93A 4OXXA 4G37A 2WHRA 1Y9AA 1IXSB 3AFHA 4KIGA 2QNBA 1L9KA 5YASA 4ALMA 3H2ZA 1S6YA 4JC0A 1GGNA 5HJ7A 4CQMA 1RRPA 2BM9A 2OSVA 4GXTA 1P1BA 1FB5A 4HRVA 1QCCA 2QI9F 4TLCA 2VHTA 4B43A 4L8WB 4EBBA 3H4MA 3HCDA 1DCKA 1HKUA 1KJQA 4RWZA 1MH9A 1BHJA 1N2IA 1DRJA 1XL0A 1ZJZA 2NQ2C 3O8OA 3RKSA 1SHKA 5C34B 2PT9A 3CLUC 1PV2A 3JWPA 3M8KA 4EG5A 1JI0A 3FNGA 2IYQA 1UPAA 1G60A 2WB4A 3KQHA 5EXDA 3TB6A 1IFXA 1WKCA 4P7FA 4IQ4A 3P71T 3Q7EA 2GBGA 1H8HD 2IYNA 1Z36A 1IE3A 2BGKA 1FP6A 9LDBA 4BL5A 3GGOA 1F38A 1FSFA 1W85A 4MITA 5FHRA 3MGKA 2FWJA 5ALUA 3GZJA 3ZIAD 4MUKA 2CD9A 2R47A 4L15A 4HWPA 1T6XA 2RC5A 4CIDA 1CT9A 5JI3E 4AJPA 4JT9A 3INNA 4TSRA 1I10A 1OI3A 3QVUA 3ZWOA 5K6AA 1KOGA 2JFBA 3I5MA 3DW1X 3RT9A 4N3AA 3SM3A 4KRGA 2AYXA 1Z6ZA 2QD1A 3U7EB 2YXLA 1YR1A 3FCAA 4AS2A 2IS1A 1UJ4A 1VJ5A 2EHDA 3HTXA 1R18A 3RVNA 1RAIA 1S8AA 3FGPA 3WYAA 5E95A 4CKYA 3JTEA 4XTRA 2RFLA 5CYFA 3QVMA 2HHLA 4DLPA 4PTYA 5C18A 5I4KA 1GL7A 3V9AA 3B2EA 4G09A 1SG6A 2IW3A 1MJGM 4AMZA 3UMMA 4QBKA 2AFRA 3NNDA 3O2QB 3UBMA 4R98A 3B7GA 3DBOB 4DWJA 3ZDQA 3R3HA 2E4UA 4D79A 1D2MA 2YY5A 1ZCBA 5SY4A 1ZINA 2QRGA 2X7JA 2BP7A 4DL9A 4RMNA 3ZW8A 2DBZA 4DARA 5L95A 1C9KA 1K3FA 4RHUA 2MSCB 4MGKR 3RS9A 2VT7A 3A4MA 1I3LA 3T6KA 3SQXA 2FOIA 3I5AA 1L5FA 1L2TA 3T3EA 2AQKA 1U99A 4X97A 5AKZA 4ETIA 3HB9A 3MTAA 1N2CB 3WFIA 4JJKA 3STVA 1LBEA 1WPGA 3WGZA 4WLFA 1RAGA 5EIBC 4ZOEA 5SYAA 1V7ZA 5LBTA 4CMIB 4C03A 4BPBA 4ZI7B 1ZS9A 2AK3A 2OZPA 1L5YA 4FYJA 2HMVA 4YFVA 4G5HA 5LZ8A 3I6BA 2WB2A 3AB3A 3M4NA 2YZNA 1DCMA 4CEJA 4GWKA 1RYDA 1BD4A 2QTBA 3PVSA 4JKIA 1QIKA 4REQA 3ZE2B 3L1IA 1WXEA 3NT5A 1IEVA 1CEEA 2B4RO 1YCDA 1X1CA 2NGRA 4NHEA 5ULLA 3PPWA 4D8UA 2CZGA 3KO8A 1WETA 2P77A 1C7IA 3GQVA 3IQDB 4NFHA 4I19A 4I5GA 1U02A 2B0CA 3CTPA 1RTKA 3R09A 1U31A 4DCTA 5HIAA 1AKMA 4PYRA 2AXPA 4I1VA 1PR0A 3L79A 3MLBA 1T8TA 4JEUA 3KB1A 4G07A 3V8RA 3V8VA 5A4AA 3K1JA 3PYLA 4W5OA 4A10A 3IILA 5TPWB 3SLGA 1CR4A 2AS0A 2Q0XA 3IKLA 2AG1A 3CISA 4NCJA 1OW3B 3LVRE 4PANA 4Q19A 4DUPA 1VOTA 5FWYB 3SXJA 2K5UA 2OPBA 1HOXA 5JSQA 3AF6A 3HBJA 1OILA 3ZGZA 1II8B 1TYEB 3ZEIA 2REXB 2OCKA 5J63A 3DDOA 4ZU3A 3T7RA 1L8QA 2FAXA 2CXUA 3DNPA 4K3UA 2VZ9A 4Y1FA 3AM4A 1T9DA 4II7A 2OZKA 3BS4A 5I8PA 5JD6A 4UHDA 1UF9A 5EIOA 2A3RA 5L3VA 1FZTA 1YVRA 4KLZA 1N92A 2XXAB 2QPTA 2Y1OA 2F48A 3AIOA 3GUCA 2X9VA 3OLCX 5JZVA 2DHCA 4H7IA 1ZGZA 2V1UA 1WF3A 5FUQA 2ODQA 3HP4A 4CM9A 1F3OA 3L6BA 4ZQHA 4E2FA 4G4GA 3ADBA 3UUWA 1E1QA 3PLNA 4XGKA 1SIOA 5AYVA 2FFAA 1JQJC 2Q8QA 1U8XX 2AQIA 1EBUA 3RJ9A 4GDFA 2FJPA 3BH0A 1IAQA 3ZV5A 3X3HA 5FHQA 2A2ZA 4B6RA 4TTRA 5SICE 4BLSA 1G5RA 4DSZA 3VO8A 3OAAA 4MIEA 1FTGA 4BJ5A 3FDJA 1DEXA 3W0LB 2HLNA 4FYVA 4GLOA 5IT9A 4OHVA 3UJ7A 2R1UA 1YFZA 2VNAA 2ZBRA 3HH8A 4N03A 2PGIA 4CT0A 3NX4A 3HJBA 2XWBF 1VXRA 5LLDA 3SM9A 3HM9A 3ESZA 1PGPA 1JDBB 3ZBPA 3WA7A 1KAGA 2XYRA 3OLXA 2PH1A 4EI7A 1LC3A 2G9VA 3A6HA 3CVJA 1D2HA 1IUKA 4JLVA 5EXPA 4DXDA 2HCJB 3OU7A 4EAQA 1A1SA 5JBIA 1WHTB 3N2EA 4MRSA 3TYXA 4QQRA 3RC7A 4FGSA 5TB5A 1BKSB 3GYGA 3LV8A 2HADA 4DCMA 5IXYA 4QU5A 4PZCA 1O4VA 4PYQA 3L1UA 1WUJS 2RBKA 3QIAA 1CTQA 4HEJA 4BAUA 4B7ZA 1QTNA 3C8ZA 1ODSA 1EXVA 2OO3A 2H51A 1XKLA 4U2GA 3QRWA 3I04A 5KWJA 2JIQA 1KH3A 1EFVB 2O7VA 1GT91 3BWEA 2G76A 4JJFA 3FBGA 5EI5A 3L6EA 3WZMA 4F2PA 2CB0A 1USGA 5EWJA 1G66A 3SJ7A 4W9MC 4UUAA 2W70A 3IIEA 1M1NB 3BL6A 3DLBA 1DRUA 2JBWA 4JAVC 2SECE 2ZAYA 2ZSJA 4HYQA 1R8YA 4KDEA 4O4LF 3RGGA 1RRVA 2C4TA 3PSAA 4K9RA 5M2QA 3A37A 4R83A 5C2JB 5K20A 4JUAA 1N2HA 2I34A 4YIHA 2FPSA 1COWA 3V2HA 4EL0A 3E22A 2HHAA 2OUIA 4GQIA 5TJHA 4CR7A 5JSZB 2HO4A 1ZL2A 1MC1A 1JLMA 2WA1A 1X14A 4HFNA 3ZCTA 1KI7A 4UTVA 3DKVA 3IC5A 3B3QA 1XZJA 1E79D 2C4NA 1HEUA 1O77A 4N12A 5BQ5A 4M0EA 3I2JA 1LF5A 1DC5A 3TLXA 1E6WA 1XTRA 5AXCA 1DBPA 3SF0A 3EODA 3TSYA 3USES 3DEIA 4ZYUA 2PUEA 1CF9A 2C4MA 3EYWA 3KZOA 2UV8A 4HPXB 1JIQA 1JZQA 1RWOA 3RFUA 5MN6A 3N8NA 1YXMA 3OJWA 4TKVB 5EVJA 2X2EA 2PWZA 4W1QA 3AHEA 2ON6A 4IJMA 4RV5A 3HJHA 4LC1A 2P2ZA 3B9PA 2IGBA 1SFRA 3C7DB 2NXNA 5JASA 2CXNA 3SHWA 1KA9H 2L2QA 3G5UA 1PZGA 1PJ2A 4IOLA 3U4MA 4KN5A 5D3MA 1QU3A 1WV0A 2YW2A 1XSEA 4X62B 4E11A 1ZNZA 2LP4Y 4GLFA 1C9MA 4KQMA 3UFXA 4KL8S 3GLUA 2FPIB 3LQ2A 1O57A 2I22A 2HWYA 5B58C 4KNYA 2HLHA 1C0IA 1F51E 4GP6A 4HDMA 3S81A 1G17A 4W7HA 3ZWWA 1FQJA 4AJ1A 4F11A 4C2UA 5FPPA 4J90A 4YJ3B 4WPGA 1PL0A 1J07A 3NBXX 3GMSA 1PG0A 2C2YA 3GQBA 1SH7A 1GNLA 3DEKA 3H19A 3OZUA 4E4TA 1RZVA 4I50A 1QP7A 4QPDA 3PKJA 4HVLA 3EPKA 5DE3A 3C3XA 3B70A 4D3ZA 1IIRA 1XEFA 4KMSA 3U4DA 1U2SA 1N5IA 3UFXB 3I62A 1OXSC 3EQ2A 4UBOA 2AZTA 4DB4A 1YFLA 2BEKA 5CFZA 1CP3A 1GDHA 3MUFA 4Z0NA 5CFRA 4QHSA 1SGWA 1X19A 2GNPA 1KPHA 2J3EA 4BYGA 4NVRA 3ETDA 2G4VA 2HDWA 4IJKA 5HPYB 3LQFA 3WMXA 2PUBA 1XTKA 1P9LA 1CR1A 2A86A 4OJMX 4RK1A 4D9GA 1YJXA 4BVKA 4GOLD 3NP9A 1NC1A 1N34B 2C4UA 2RAPA 4KUHA 5C37A 1UMBB 2RBGA 1U2GA 2OC4A 5DOVA 4JZYA 2QYOA 3GRYA 4DNOA 3BBPA 3JQBC 2ZT6A 4EF5A 4NE7A 1P17A 1QE5A 2C1ZA 3LX6A 3OWXA 3Q6MA 4LPKA 4JASB 1A7KA 1PSWA 3A1UA 3HDHA 2HM7A 2L82A 3L7JA 5T3UA 3ZOZA 2DFNA 3ZHUA 3WHIA 4ZOLA 4PLFA 4BNWA 1IQPA 5B5SA 3BVPA 3LT2A 4FFRA 3B1KA 4J07A 1S2DA 1N0IA 2R7LA 4PS1A 5K4AA 2GLUA 3AK4A 2EKBA 4O2LA 3HJGA 3D8NA 4X1IB 5COAA 4BUJA 1TLLA 2RGAA 1YRYE 5ED0A 721PA 4KSBA 2JFXA 4ZRDA 4RVFA 2B4KA 4REMA 4NENB 1YF3A 1JVNA 1M2GA 1WDTA 2JD2A 3DV0A 3IAUA 4BNFA 1KK3A 2NTVA 2XLBA 5HE9A 5A1TA 5JFTA 3EIWA 3PFFA 3O93A 3FOCA 3IV9A 2QVXX 4KDCA 1TIBA 4XYLA 3TL3A 3FWYA 1ZNQO 2LCIA 4AMUA 1J5PA 1J70A 3K72B 4FFWA 4C20A 3KBBA 3SZGA 3T1QA 2C92A 1X92A 1CP2A 1DC3A 1DKPA 1OT3A 1S96A 1ZA1A 4X1IA 5KOIA 5DXJA 3IULA 4B46A 2EATA 1KK1A 1DAFA 1KJZA 2WAAA 1YTLA 1GY8A 3DOFA 1E2GA 1XX6A 3EZ2A 3OQPA 3GO4A 1MB0A 5DNDA 2RGYA 3O8RA 1EAYA 2XMBA 1UBFA 2AFHB 4D74A 1PHRA 4E15A 2MSEB 1X1QA 1XL1A 2EKZA 2EGGA 2PL5A 2ECOA 3KV1A 4LOHA 2NX2A 4LJ9A 3VBEA 4RD0A 3I9NA 4CTOA 5LL6P 4R81A 3UOWA 3HN2A 3QMVA 1OX5A 4WXRA 5A5DA 1RP7A 2J59A 2BGTA 3ONFA 5B12A 8GPBA 4UKDA 1YO6A 2VP6A 1KQNA 3U3OA 1N5OX 1QH9A 1YDEA 4PSVA 1PW7A 4ROTA 1Z17A 3QEOA 3FCYA 5CFMA 3IT3A 1Z0SA 3QY0A 5H83A 3UTDA 5AJXA 2QX6A 1J06A 4L5YA 5TXGA 4OA5A 1H23A 3L49A 2K6GA 1D07A 2QI9C 4CMJA 5ENDA 5KOJB 4S3MA 4Y0AA 3P32A 4GT1A 2NNWB 5AVJA 1VPWA 2GEJA 3AIMA 3UF0A 4Y1RA 5G53C 2AC4A 4ZICA 5EGSA 4CLRA 4QZVA 3MIIA 3NNNA 5CCBA 1FSGA 2ALJA 2IDJA 4NV3A 4NG4A 1F0PA 1TAGA 1IC6A 5CFPA 4JOQA 4TQGA 3DJYA 5AWFC 2PFGA 1CJKC 5KJFA 3DVRX 1NBWB 3AX6A 2H4HA 1P4AA 9GPBA 3I34X 1NBME 4OKNA 1JA9A 3RYTC 3IIMA 4K0KB 4HDOB 1X8JA 3H9JA 4YP7A 5SY6A 5CEJA 5F52A 3UN1A 2AJ8A 2DX7A 2QENA 4ZWNA 3TM5A 2EDAA 3CVOA 2PKEA 4KN9S 5IMBA 1AQNA 3C3EA 1MPXA 1JZTA 2V55B 4GP9A 4N18A 3VU1A 3BKXA 1U0TA 2E6KA 3LBYA 2QMOA 4M0UA 1ZHOA 4P0QB 2WVJA 4ME6A 3OKFA 4MS3A 4OJQA 3OLZA 1WPRA 1EHIA 1C2YA 1E2FA 2KQUA 3PF9A 3K53A 4I4TA 4KACA 4LSGA 3U7RA 2JGDA 4UBMA 3LF1A 1I24A 1SQGA 2GHRA 3N8GA 4O2AF 1KI6B 2CUNA 3OTWA 5K0FA 2P91A 4WCFC 2NZYA 3K1YA 3RU2A 1DVRA 4WLNA 4YCSA 2CGEA 5FRDA 3EAFA 2D1FA 5GGXA 3KYCA 4R2LA 1KC3A 4ER6A 4EUKA 1OROA 1QONA 2VBGA 2WG1A 3U7FB 4BRSA 3ZDFA 3CZRA 2QQ5A 3L2OB 2A9VA 3HNPA 3OCZA 1CY7A 4G8BA 1A8PA 3MQ2A 2VOJA 2J0EA 5K0TA 4IYJA 5EIXA 3UMRA 1VB5A 3RUIA 1IM5A 5HOEA 1N6IA 4K28A 2GEKA 4G5SA 5JADA 4BOYA 1ZOSA 4ND5A 2DYKA 4R3NA 1PGQA 1YFKA 1S3GA 3PRYA 1RS0A 4X24A 1ISPA 1ZD9A 3GFPA 2R60A 2KW5A 4GPZA 4I66A 5FV4A 5KX5A 3KKOA 2JI8A 3KEOA 3VC3A 1K7XB 1OX6A 2YWFA 4N3GA 1XTSA 4ADSG 2EQAA 5ITVA 2Z9BA 3DD1A 2WT4A 4OM8A 5CW1A 2BM8A 4Z5XA 3O1IC 2JI7A 4ND2A 2X1LA 4D1YA 5GZ1A 5F9FA 2JI4A 3G9TA 1H1DA 3QKTA 4J43A 4ASUD 4K87A 1Y3AA 3EOAI 3NU1A 4RIHA 1JILA 5EMHA 5F78A 2EZ4A 4TKZA 3NIWA 4WCFB 2R79A 2W0SA 3F4BA 4X5OA 4QT4A 1FX1A 1R0SA 2I3DA 2PD4A 2O3RA 3JQGB 3P96A 5CNJA 3T9AA 5F3WB 3DMTA 3QUTA 3LUPA 2W4QA 4X44A 4PWYA 1DX4A 3WI7A 4E70A 5JC8A 1P2BA 4CW7A 1YA6A 2IEAA 4UREA 2OHIA 5LIPA 4P4GA 2PX5A 4CMAA 2VI5A 3C3BA 3IERA 4ZPJA 2RD2A 4FBMA 4X92A 1OKKA 2YWEA 1H6BA 1TC2A 1G5TA 4OI2A 4EG4A 2BEVB 1LSJA 4YONB 1TUBB 4WTOA 4DPLA 3A9VA 3M3DA 4UVEA 2AZMA 3IAS6 3S7ZA 1F0KA 5EGNA 4CE6A 1QXSA 1QV6A 1Y6JA 4ZOQI 2FCRA 1BCRB 4V2UA 4V24A 3AHJA 1U0SY 2REQA 2PMKA 3ETEA 3QPVA 4US2R 4LVOA 1KZGB 1Q6YA 1NW5A 2XOKD 2ZRPA 1M6VB 3WICA 3DKIA 3S55A 3WWYA 4TT8A 3KJGA 1M2KA 2O8BB 4UUBA 1DT5A 3EWSA 3JQ9C 5AKHA 4A6PA 2P2SA 4TMWA 4OFWA 4BVJA 5KQMA 1VL0A 3TUIC 2WSBA 2A5FA 3WS7A 4IW3B 3FUUA 2L0XA 4AJOA 4J4BA 1SVLA 3DP9A 1YNSA 2HQBA 1UWCA 1X7YA 3B5IA 3B48A 5CNIA 1A5AB 3COVA 2CHEA 4HWOA 2B0JA 4YMGA 3AILA 1U5CA 1Y3FE 3GLHB 4EPYA 4FE3A 2C95A 3MRTA 3RK1A 5LLTA 1E58A 3NCTA 3R77A 3WLHA 4ZEMA 2GKOA 1WL8A 4XQ0A 3VKWA 3LGXA 1CQZA 1RHMA 5CVCA 2W8ZA 3EOBI 3PEVA 4OK6A 1CUWA 4UZFA 4CEIB 2YFHA 3HYCA 1UBKS 5LQAA 3VU9A 1Z45A 1GRCA 4WV3A 2P9BA 2UYQA 4FM9A 4CKZA 2M32A 3E8SA 4PLZA 1DRWA 2E48A 4X3OA 5CLQA 4RJIA 1MO4A 4P93A 4UZSA 5LZ4A 7MHTA 5J1TB 2X1MA 1OYOA 3NDBB 4FKBA 3AEKA 2XD9A 5DASA 1UC4B 1IVSA 2YJTD 1SVSA 5CIWA 4BMNA 2UZAA 4D43A 4UBJA 2X9LA 1ADYA 1K27A 5LKRA 5DM0A 2W6OA 4PO1A 4N9QA 5EIEA 2AC7A 5FPKA 2ZYUX 4Q7MB 1EUDA 3GLTA 4RF4A 2VAXA 3BIJA 4I99A 2FRDC 4FCVA 1XUOA 3HHPA 3AR6A 5B30A 5I48A 1HSZA 1ORVA 4YDHB 2X8WA 4HBGA 5BYKA 1AKNA 5DM70 3VAYA 1UIRA 3O92A 4I3FA 4ZT2A 3DE7X 3JQAB 4OLJA 4B79A 2IU0A 1OZHA 4KIJA 4ZIRA 6YASA 3OFND 4G26A 2CL7X 3I0ZA 2AD5A 5EKUA 4BNKA 1F6BA 1A2BA 2YWJA 3WSVA 3L7DA 3C43A 2ZDHA 4DEVA 4C88A 1HDGO 1E4YA 1C80A 2J3DA 2Q07A 2NVWA 1CEYA 4CMEC 1SQ5A 1SJ9A 1DRKA 1LNSA 3DHEA 3OH8A 1DX6A 5I9BA 3I64A 4C0XA 5ELXA 3OFVA 4I9NA 3IBYA 4ALJA 3QEBZ 4M8SA 1U7TA 4RSRA 3PUIA 2DQYA 2CXXA 4DLKA 4QXOA 4C21A 3RS3A 4OGLA 3F7MA 3ZY6A 4BP3A 3ROXA 4MS4B 1ATIA 5EAIA 5ABPA 4PLPA 3B12A 1Z63A 1ELOA 1I51A 1DUVG 4P81A 1XZLA 2JIRA 3KKMA 2VA8A 5IAEA 5H0IA 1ZK0A 3STXA 2Q5JA 1LD3A 2NXEA 2P2YA 2QR5A 4B2IA 2PM8A 2FP4B 5K4HA 1XZNA 3G8YA 4CETA 3A14A 3DZFA 1KOFA 3W5VA 1A50B 2W90A 5FCDA 4P32A 1H0HA 1SVIA 1N9ZA 3FJYA 4AJNA 4DY6A 1M1NA 3G2IA 1YB2A 2ZRBA 4CL2A 2QUJA 2QLMA 4RGQA 3GPCA 1SBTA 3BE5A 2PQ2A 1N8TA 5LNK6 3OCUA 1PR1A 5G1OA 1OLXB 3E61A 5AVXA 3QEKA 2B5OA 1Z13A 3V9PA 4I1UA 2F1KA 1JHVA 2AE1A 3PEEA 4HDKA 4IDQA 5E7MA 1FYFA 4LHVA 1TJPB 3WYEA 1SQ6A 1U3WA 3N75A 4DMKA 4LGYA 1JEJA 4YRZA 5KWIA 1FTYA 3T7SA 4RC9A 5E4TA 3I9OA 1N1MA 1L8XA 3CG4A 2XRYA 1PEDA 1ZNXA 4Q9NA 1XRMA 3W6ZA 1AX9A 3H42B 2FRVA 2CJWA 1F8YA 3UAZA 3L6CA 3ECCA 3K92A 5C8YB 1QCDA 2Y0EA 4I9HA 4FNOA 4FEAA 4HKTA 2PS1A 5EWMA 1H2WA 1N3LA 3OZXA 2E7ZA 3VNAA 1TTTA 1BROA 1E5LA 1LK0A 2D5IA 2DRIA 2QMQA 3AHIA 3DH0A 3H16A 1HOTA 1NW6A 3ASYA 3NTQA 4KEAA 4LNAA 4BQSA 5IVKA 4B0OA 4LXYA 1DIBA 3K0CC 4ZOCA 3R7WB 3UJHA 3CLSC 4W5NA 5KTYA 5TEWA 4DMCA 3FLEA 3RC3A 2PT6A 4B17A 5CU7A 4ISCA 4BY9E 3AUSA 3C4QA 3B1XA 1JFTA 4KO1S 3DB2A 1XTUA 2P5TB 3QXJA 4O02B 5CK5A 1Q7RA 3WQRA 5BSMA 1EK2A 2DG2A 5CCXA 1Q21A 2GPBA 2ZS9A 3R5HA 2ZROA 4G1UC 2FOLA 3RABA 2VCYA 1Z62A 2VFAA 3E2MA 3IHLA 1EP9A 3A4IA 3STTA 2D00A 4RVUA 1Z0JA 3H8SA 1G59A 3BMXA 2JCYA 5LN1A 1E4VA 3W79A 1YS9A 1JMVA 2O1WA 2QRHA 1NF9A 4JL6A 1MAAA 1QTIA 4ONEA 1SQ0A 1QZUA 1ZQ1A 1U7WA 4EABA 1BMDA 2XWSA 3DT8A 1Z4MA 2HBRA 1Q1AA 4D4LA 1Z6PA 1F12A 1VGVA 3NDJA 3D8HA 4M99A 3AIIA 2J33A 2J08A 4H3KB 2DERA 1JKXA 2H6EA 4IVNA 4HNHA 5AVSA 3BHIA 4I4NA 5JPIA 1UXOA 1XYYA 5H7XA 3D7LA 3IJRA 3EXAA 3FAKA 3LOQA 4IR7A 1XV5A 1P4RA 2OCAA 4L4RA 4W63A 2ANBA 4KE8A 3FOBA 1IG0A 5EIAA 4CFSA 4JUIA 4F92B 3C6YA 3MCTA 5IAOA 1QSGA 1EP1B 3OF3A 4KUGA 4L4XA 4XQ9A 1GR1A 1PTJC 5E3JA 5CDSA 2CNWD 2FMUA 3AC0A 4BQIA 5EZYB 1HSOA 2NPOA 2OVBA 6NULA 2RGNC 1OB5A 1KR5A 1P19A 1CYEA 4XFJA 1K66A 4CWAA 4ZT7A 3KYDA 4MO2A 5LUBA 1CB7A 3TLGB 3QE4A 4MLPA 1VGQA 3UMYA 2ZJ3A 2VIIA 3EULA 5FTWA 2YWCA 1ZEMA 2R1TA 2HU7A 4RKWA 1BVYF 4YRLA 5TT1A 1TU0A 3GR6A 3KJHA 1E2JA 3LY7A 4D25A 3KSUA 1T26A 2IUTA 3PPYA 1JIIA 4G9BA 3UC9A 2CHQA 1UEXC 2WWIA 4KB5A 1J1IA 4R05A 4RY8A 3GK3A 4E5NA 5B4UA 1TCVA 2RHLA 1SHLA 3K8QA 4M9UA 4FT4A 3UT5B 4PO9A 4CTJA 4RPGA 3UUGA 1K7YA 5DHQA 1VBKA 4JB2A 5JWRA 2C2HA 3CKKA 1T2DA 5JCXA 1O8CA 3DOHA 2F2TA 4C76A