5IVPA

Crystal structure of the peptidyl-trna hydrolase from vibrio cholerae in the c121 space group at ph 6.5
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
196
structure length
195
Chain Sequence
VSQPIKLLVGLANPGPEYAKTRHNAGAWVVEELARIHNVTLKNEPKFFGLTGRLLINSQELRVLIPTTFMNLSGKAIAALANFYQIKPEEIMVAHDELDLPPGVAKFKQGGGHGGHNGLKDTISKLGNNKEFYRLRLGIGHPGHKDKVAGYVLGKAPAKEQELDAAVDESVRCLEILMKDGLTKAQNRLHTFKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title Crystal structure of the Peptidyl-tRNA hydrolase from Vibrio cholerae in the C121 space group at pH 6.5
rcsb
source organism Vibrio cholerae o1 biovar el tor str. n16961
molecule tags Hydrolase
total genus 64
structure length 195
sequence length 196
chains with identical sequence B
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2016-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 5ivpA00
2Z2IA 3TCKA 5IVPA 5EKTA 2Z2KA 4QBKA 2MJLA 4FNOA 2LGJA 4Z86A 4QAJA 3KK0A 3V2IA 4DJJA 5IKEA 3OFVA 1RYBA 4ERXA 3P2JA 4FOTA 3TCNA 2NAFA 4JWKA 4IKOA 5IMBA 4DHWA 2JRCA 3TD2A 4P7BA 1RYMA 4FYJA 4OLJA 1RYNA 2PTHA 4JX9A 4ZXPA 2Z2JA 4QD3A 3TD6A 4YLYA 4FOPA 5B6JA 4JC4A 4QT4A 3VJRA 3NEAA 3KJZA 4LWQA 4HOYA 4JY7A
chains in the Genus database with same CATH superfamily
1ZIDA 3F6EX 4E5YA 3GVHA 3E6AA 2ZJ5A 4JITA 3UK1A 1L5ZA 5J5AA 3URMA 2BJHA 2QRGA 5TDHA 4M53A 3SCZA 3SJAA 3L93A 1I0ZA 4NCXA 2VTBB 4I55B 1V7QA 2YXLA 3HEBA 3PDHA 1VHJA 2OCBA 4QFBA 4YRBA 3U13A 5K99A 3QBDA 10MHA 4D9NA 2J3DA 3JTMA 4JWKA 2WKPA 1AK2A 1XTTA 3QVKA 1UL1X 2EFJA 4Q16A 1CZNA 5A5FA 4YCBA 5K3FA 2H1HA 4A26A 3H1EA 2OYRA 2PCLA 1DRUA 2HMAA 1H42A 4D3FA 3BD9A 2FG5A 5H3CA 2Q9BA 2BHTA 5ICEA 1USUA 2RH8A 4EPVA 5HOEA 4YPFA 2C5FA 1NZDA 4J0KA 3AUYA 4IHJF 3WMXA 1KP2A 1SVNA 1T5TA 3M4ZA 1EFPA 1E2IA 1Y5IA 3DO6A 3UJ3X 3PZRA 3KIPA 1RR6A 1ITZA 1P29A 1B3BA 3UV3A 1K68A 2G04A 4GMHA 3PNLA 1L4FA 2XEDA 5KVVA 3BTSA 4DQVA 1ZP6A 3O9VA 4B6JA 2IIVA 1YBVA 3H0KA 3HBNA 4CL8A 1KYWA 3EIXA 3R7FA 4AKGA 1TVMA 1NXXA 3PLNA 4IBOA 2Z9DA 1KOFA 1ZCZA 3HKDA 3GLKA 3GRFA 3DAFA 4PVDA 3W8FA 4NBNA 4Z7QB 1DG1G 4GL4A 2XGGA 4KR2A 5DP1A 3D6JA 2YRFA 4EG0A 1X8LA 1SG6A 1EE2A 5TARA 2UVPB 2AN1A 4R8MA 2FH5B 3RC9A 3UJHA 2PBLA 1RWOA 2WLSA 3CWCA 5LQDA 3TR6A 1UH5A 1Y80A 2HOQA 4QREA 3E8MA 1GG9A 2VI5A 3GNLA 1AKRA 1G8KA 4G56A 2JF0A 3STXA 4CKWB 3SR3A 4CHGA 1T2CA 4Y9SA 4TT3D 2EJWA 4F12A 3WYAA 3D4NA 4Y2HA 4YI5A 1PDOA 2XRFA 1ENPA 4PQRA 4Y6PA 4A8PA 3VR4H 2EP5A 2VHJA 5IBCA 1N1MA 4HWKA 3F8TA 3H19A 2YV4A 1QH8A 1HWYA 5LM3A 2RJOA 2L2QA 4BO3A 2ONZA 1YIOA 3GAAA 4LRYA 2L42A 3ZGVA 1JYSA 5HHTA 3AVOA 4LKOA 2GM4A 1G21B 1V5FA 4NIMA 3I01M 1FNSA 3HGQA 4B3JA 4QYIB 1W88A 2TECE 3L84A 4I3FA 5GZ6A 2N3ZA 4NPHA 2EATA 2WZQA 3W6ZA 3C6QA 1FUIA 3NYQA 3WXBA 4NL4H 3RWBA 5AESA 2I7DA 2AKAB 5SZKB 1T9KA 3LUFA 4X1OA 5HSGA 4G86A 3G8CA 5IH7A 2EYQA 4ZT2A 3LT4A 2BSXA 2V7PA 3KQUA 1JKXA 2PGJA 1CIVA 1CY6A 2VK1A 3FBWA 1A9XB 3GLUA 3GEEA 1BD4A 1C7IA 1JQLB 3KUKA 3PXCX 4MITA 1HDGO 1QIEA 4BMXA 2NP7A 1NJSA 2BEUB 1WOMA 2B35A 3QMVA 3SLRA 1NU6A 1W9MA 2DPLA 3MTBA 4MP6A 3D81A 1Z28A 2QL6A 3LO5A 4MV9A 1YBAA 1SC6A 1YI0A 1YVEI 2IYZA 3W7AA 4L0QA 1NLUA 5T67A 4Y2QA 3MWDA 2WYIA 3DW3X 4KBGA 3D6VA 5CDHA 1TO2E 3WE7A 2Y9MB 3G2KA 1IB0A 5DMXA 2V3CC 1QKJA 4MMXB 4ECEA 1XMJA 2DWOA 4DXAA 3Q3IA 1PJ3A 2C7OA 4GQIA 1LDMA 1YNSA 1KDRA 3FYUB 1GM5A 1TIPA 3RAJA 3S2YA 1L7QA 3W9SA 5CRIA 1KMHA 3QXCA 3N1UA 3EGDB 4Q3EA 4UTVA 1SBHA 4ROTA 3EBPA 4AT1A 5EMKA 2GVDC 1NI3A 3BCRA 3PPWA 1UUFA 2R60A 5KNCD 5K8TA 2QT9A 1G20E 3WO0A 2ZAMA 5DYTA 2Z0MA 4DCSA 1APBA 3ZWMA 3SP1A 4L4XA 3VR5H 2O0JA 3GZ4A 4PYRA 5DDIP 4E1BA 2CUZA 1NW6A 4RCZA 4UXIA 1OI7A 4AJKA 3VDRA 3I3OA 3ZKAA 3OZBA 3EYWA 4FOSA 4MVYA 4N4AA 3RANA 3LL4A 2DTDA 4LECA 2WEKA 5B3KA 2XF2A 3FPAA 2QMOA 3IAHA 1XJWA 2C1EA 4GBGA 1KXJA 3FYSA 4CJXA 4UHDA 3ADKA 4TV9B 4BNNA 2PX6A 1L4KA 1DE0A 2A1UA 1S9HA 3E1GA 4I36A 4P33A 3PL1A 1I4WA 4JI1B 5L3QA 3VU0A 3V4RA 3MLBA 1W5EA 3M5CA 3R7SA 2R8OA 2FTKE 3ZLTA 2XQIA 4BO6A 2BGTA 1ODTC 4IZIA 3M1YA 4LI0A 5JALA 2C98A 1SKMA 3MD0A 1IXZA 1UOEA 2B5VA 4HI0E 4HVCA 5A4DA 4IUBS 4IQ0A 1E96A 5E3IA 1RI2A 3E8SA 3OY7A 5IABA 4PYLA 1V2HE 2D8AA 4A0QA 3HCFA 1YDMA 4CEHA 4JU9A 2FMHA 1NMZA 3I5MA 5C46F 5MN6A 5FD8A 4RULA 1H0SA 1OSNA 5C5CA 5H5JA 2I9KA 3AF4A 3PFIA 1XJQA 1QQ5A 1N4AA 2CKMA 3PDUA 1Q1AA 2JZOA 3M70A 3WZLA 1T4CB 1MX9A 1M66A 2BFEA 3QU9A 1H8HA 2OCYC 2YQ4A 1KJ9A 2WQZA 1L5HB 4EFKA 5BOVA 3R09A 1U63A 3OHMA 2O8DB 3TSYA 5EHGA 5GGXA 3GAFA 1K86A 3O1LA 4Q6BA 1KMCA 3RIGA 1YA4A 1JTFA 4E6EA 2GT1A 5PNTA 3X1YA 4AUNA 4RTRA 3V33A 5B4VA 3F7OA 4Q7LA 2QQEA 3TNFA 4C7BA 5A0TA 1NP3A 5D87A 5CA0B 4FOLA 1FTGA 4EL5A 3PFKA 1UDBA 2VCYA 3UCXA 5BRAA 3JATB 2GXAA 2OORA 3K9NA 1GTVA 1N3IA 2YW9A 1GPAA 4TKUB 2FSGA 3VR6D 1KFCB 3PKIA 5JBQA 2WNHA 3IPYA 3UT0A 4EBFA 3LZDA 2WJJA 3MUFA 4JUAA 2JEYA 1GFSA 1MJNA 4M99A 3UGKA 2JLUA 1P7ZA 3AHGA 3BJZA 3OZVA 1QO7A 2GPWA 3P2MA 4GU5A 4I4TB 1QGAA 4RGBA 4YUZA 4BMPB 3KR0A 1UZUA 3V32A 3IOBA 2XWJI 3WK5A 4JR0A 1SVLA 3TW8B 3JQ8A 2BTQB 1KAHA 4LGVA 2QRVA 4RXUA 4YJ2F 1QYRA 3EMVA 3LQ2A 3L8EA 4JP1A 5HK9A 2I6FA 4AZVA 2IEAA 3A70A 4I4NA 5LA6B 5SYNA 4KRFA 1HMYA 4AJ4A 3DEZA 3ORHA 4O6VA 2H65A 3OLYA 4QJBA 1B6RA 1ZLXA 3MFYA 3N2IA 2RHDA 3Q98A 1NW9B 2GZAA 2Q1XA 4GMKA 4Q4HB 2B82A 2I1VB 3FR8A 3OFVA 3FOAA 3T7SA 4E6PA 2P6RA 1DDIA 5JD5A 1ZNQO 2PNFA 1OLUA 3JS5A 1UWLA 3QVWA 4BATA 5C8DA 4JI8B 5GJBA 1XZDA 2Q3MA 3H2SA 3HA3A 2CXXA 2HIHA 1JTVA 4QL3A 4R0MA 1NOJA 4D3SA 4D9CA 3R0IA 3H84A 3L8MA 2A58A 1ENYA 4JJZA 3VNAA 3O4GA 2B7LA 4JYAB 1UJBA 1J0EA 1JP7A 1X2BA 2OFXA 3DUFB 4UUBA 1EHIA 2EJBA 4NXNB 1LFDB 4BNLA 5AOCA 2HPHA 2YYAA 2A84A 2I9PA 3KPWA 2NZVG 1QHFA 3QPAA 4PZAA 5ALZA 1YB6A 1QZZA 3CF2A 4DSOA 5C4GB 2FRVA 3L7AA 1S02A 1QAMA 3G5UA 2HXSA 3OOWA 2JFHA 3K8ZA 1UBKS 1KYZA 3I04A 2ZYAA 3D4OA 1HL3A 2IYWA 2ZIEA 1OZHA 4DMHA 1R0CA 2H59A 3NASA 1JB9A 3JQ7A 4HEQA 1B0PA 2WVGA 3RVSA 3ZXYA 2QAGB 4MDYA 4OJYA 1E3EA 1Y81A 3I23A 3DVAA 1T2FA 2CF6A 1WETA 5F9FA 5K3BA 5I51A 1OILA 4NMWA 3CH6A 2RKBA 1CV2A 2A30A 1GZ3A 2BUCA 2Z1DA 2KSQA 4HT3B 1QXSA 3MJEA 3AWIA 4CHTA 3UWSA 5BPFA 1U5AA 3IUPA 2LGJA 4GX1A 1DRJA 2YMPA 3K1AB 3IR5A 4LYHA 3YASA 5AT1A 4BO1A 5L3VA 2HU5A 3KAJA 4D4GA 2X4IA 1U7XA 4NTZA 3RK1A 4TT8A 3B82A 1K2WA 1VG0B 2VNAA 1PYGA 2XA2A 5CTJA 4AMUA 1X7XA 1KZ9A 1A7JA 2BKEA 4ALNA 2VHYA 2VRCA 2OAGA 4LOAA 4OYLA 4BGVA 4BZWA 3JQRA 3SS8A 1GTRA 1UC8A 1NULA 4HRXA 2VYFA 2AW3A 5BN5A 1WXHA 1AURA 1SKUA 2QIOA 3E5RA 4Q02A 1E5LA 4EG3A 1GGEA 3R24A 4RK7A 1R9NA 3HHPA 4K3VA 3G23A 3PYMA 1BEZA 4LZJA 3ICQB 1FP7A 1GN8A 1IE3A 2YRWA 3GNQA 4XCVA 5DWVA 4POOA 1YRBA 4R71A 3A4LA 4FBLA 4MRAA 2FMTA 1UMBA 4AKHA 2J9RA 2XQKA 2ZR0A 1QUEA 4K9LA 4B2PA 3AQIA 4NULA 3A2MA 5EN4A 2E9SA 4WKCA 3LHFA 4DSTA 2GAOA 1I6WA 2NVUA 4J4HA 4RIHA 3X2EA 4EB3A 4BB5A 2X2FA 4G3XA 2OM2A 2Z1NA 1ABBA 1JQAA 1CJCA 1EPUA 1JHMA 1R9JA 3SQMA 4EG8A 5LZ9A 1JHQA 1F8XA 1XKLA 1UP7A 3U3RA 2EJCA 2IXAA 4NEGA 3H9UA 5I47A 3RU9A 2DP4E 1R0YA 3FW1A 2YHIA 1VL5A 1RJEA 5I7HA 1ZR4A 2XNCA 4IGFA 1JALA 1PL8A 3KVVA 5J1SB 4IJ6A 5EIAA 4BVBA 3KB2A 4U8GA 4EVSA 4OREX 1PS0A 4KIFA 5IARA 4Y1FA 4RSMA 2H9AA 1QM5A 5FTMA 4D81A 5I7EA 2FPIB 4OLHA 1GPLA 3AY0A 2VOJA 4O5OA 4ZA2A 3LYHA 3F73A 2QY6A 2ASEA 5IJZA 1RAEA 5C35A 2QYTA 2BSQA 3R6GA 1WLYA 2BMAA 1KU6A 1MIOA 1CC1S 1OU0A 2Q2QA 2V98A 3R3YA 3EJWA 4N6OA 5LDGA 3GLIB 1NBHA 3UK7A 1MD9A 3BWXA 4BP1A 1ZFNA 1K3UB 3WMWA 3TK1A 4UBMA 5KSZA 1ZH0A 3OPYI 3DLTA 3HPQA 3HVKA 1XC7A 2WPDA 1RXIA 3DMDA 4JBYA 1E5DA 2WBLC 1ZU5A 3QUAA 1QPBA 1RFGE 2XXAB 1TX4B 3Q7IA 4H17A 1LJ8A 2R00A 2ZU6A 3SQNA 2XUAA 3AFOA 2D0IA 2R84A 1Q0PA 3HVIA 3EHEA 4R7TA 3NAQA 4NV3A 3W78A 4RTOA 4R9RA 1IHXA 2GLUA 1OYWA 4GKAA 3WLLA 5JY6A 1RJGA 1EVZA 3GP8A 3G8BA 2O8FA 3V4LA 4YLGA 4DNOA 3G9XA 3IIKA 3FOCA 1W6UA 1NNSA 2XYGA 5K6RA 2BGWA 4BNZA 5J43A 2VUUA 2IP2A 1ZYUA 4G8JA 2JGKA 1SMKA 3WTBA 3HV0A 1M75A 1Q7EA 2IE8A 3OLQA 4IH9A 4PGFA 1WBBA 3GDGA 4DDKA 4BRZA 4RY9A 4KREA 3TQQA 4C6TA 3QBTA 2GCEA 4U8HA 1PQUA 2CBGA 1JLMA 3IVGA 5AW6A 2WF9A 1L7DA 2FU5C 3J80A 3LQ1A 3EZGA 3KJFA 5DN6A 1TYCA 3CNEA 2VHVA 2YN2A 1TU4A 2XIQA 4KOAA 1ST2A 1U8TA 4I50B 3S6JA 3TUJC 4BKOA 4IDFA 3ZHZA 4J8PA 4ZV7A 4HSGA 1DU4A 5G1OA 4CTMA 2RB4A 2JK0A 3SX4A 2QZZA 3ZLBA 4E1AA 3JYHA 1PVVA 4UUQA 4BAUA 3IOMA 1HZZA 1ZVMA 2CZQA 2O06A 5BSFA 2BIFA 2VQFB 2AC4A 3BRCA 4MWOA 4B09A 3FB4A 5BURA 3W5DA 1DFGA 2WZCA 1W4BA 3WLEA 4CMCA 2VT3A 3B78A 3NT4A 3PIRA 1DKOA 1Z25A 4FE3A 2XQJA 1D2NA 3GMDA 2WWYA 2M1ZA 2J7PA 1UJ4A 3I6YA 4DUPA 4JLNA 1YCHA 3AEZA 3RJMA 1NVFA 6ABPA 2YIDA 1JG3A 2X76A 3GUYA 1GCIA 2FRDA 4CV1A 3JQGA 1ZH6A 3D5EA 3OIDA 1UMCB 2IYEA 3IP3A 2ZYUX 1L9KA 2VDLB 1ZHOA 4Z6KA 1TUBB 1EJ0A 1PL0A 1FLVA 1XQYA 3DBHB 3GD7A 3IR7A 4G01B 4A6DA 4BYGA 1JT2A 1OV6A 4FYIA 2GCNA 1SR8A 3MIZA 3Q15C 4AZSA 2FI1A 3MLEA 2CVZA 1RQ2A 3FM9A 1ETHA 5KTRA 3QEOA 2CVQA 1SHUX 2ZJAA 2XDWA 3DZCA 5GOZA 1O95A 2W6NA 3IVXA 1FSFA 3AI2A 1D0IA 2DUNA 3Q9LA 4ENTA 3HJFA 1DKQA 2PSSA 4YWHA 4HBZA 3EA5A 3KS9A 4ZKEA 3R6TA 2AYXA 2JIDA 3T35A 1K4KA 5G53C 3OF2A 3U81A 1DQRA 3U1BA 2ISCA 3ED1A 3LCMA 1J8DA 1J9ZA 2JRLA 5DMHA 4AY5A 2ZULA 3H9JA 1IHPA 2B2CA 2BEKA 2O07A 2QRNA 3A4YA 3I1JA 3PGXA 4S1PA 5CGZA 5AVOA 3T3IA 4OMFG 3V55A 2C04A 2G82A 2DTEA 1OA1A 1VHQA 3LMKA 4I2NA 2F3TA 2HF7A 2ONJA 1E7WA 3ND9A 4C22A 2CL0X 4CI9A 3JALB 5F9HA 1L7XA 3ABRB 1DAGA 4PW0A 4IHQA 4QVKA 3FDZB 3ODGA 3RF7A 3W3ZB 3NLLA 1ML4A 1YL7A 2J9YB 3IT1A 2MSLA 3GFVA 4KFUA 5IC5A 3T0GA 4CUJA 1M1NB 1KQOA 5E0KB 2EFGA 4P3YA 4UBLA 3WHIA 1XEAA 2WVAA 2ID4A 2XZDA 1TT5B 4JQYA 1DC7A 4IZ6A 5DV9A 2QMZA 3RK4A 2R11A 1JKIA 1Y8AA 2IZ7A 2RBGA 4R2WA 1Y6RA 1WEKA 1YRWA 2G0NA 4HH3C 4TXLA 2QE6A 4MX8A 5E6RB 1VKHA 3SOZA 4OHZA 1GGKA 2QDXA 1MV8A 2E55A 3CRZA 5FOUA 2VDKB 4HS9A 4BIIA 4G07A 4LAFA 2HHAA 1GU7A 4V2IA 1W1IA 4NBSA 3RUDA 3N7AA 1ZNZA 2EDCA 2PMWB 1Z8HA 2R85A 2DPMA 2VDUE 2SKCA 2X15A 2ZIUB 2VRBA 4YMIA 5E1DA 3TZCA 1EP2B 1IRIA 1KY3A 3BQMB 1TYZA 4GLFA 4H6WA 1QQ6A 2P1RA 1HDIA 4Q24A 5FOTA 4ARCA 2I54A 1J8FA 4O2LA 4D6PA 4NBWA 1OWMA 4ND8A 1XXHE 2HQ1A 1XO1A 4LRUA 4JJIA 1DCKA 4TWZA 4X8HA 4A23A 4F46A 3FPJA 4ZI2A 1WUKS 1AHHA 1AQIA 4DUZB 3U09A 4Z49A 3IDOA 3P0RA 2DUMA 1IJBA 3UATA 4BO4A 3ZHSA 4N40A 2ZWOA 2Z98A 4UNRA 2AFVA 1HFKA 1GL3A 1JF8A 3ASYA 4EKYA 3VVLA 4ZKDA 1LBSA 3GW8A 1PGOA 3A05A 1FYWA 3TXAA 5LA6A 4Z4FA 2FWPA 1WM1A 3GJ4A 5THQA 3WJ7A 5EFZA 2PUEA 4TT3A 5CIQA 2IY7A 1CD5A 3GA5A 4A1FA 4CQMD 4ZYZA 1LZKA 1RXCA 4G37A 4BHTA 1ULZA 1JLLA 4NOLA 4QLAA 2IH5A 3AP3A 4BC1A 5HTOA 1OBCA 2YJZA 4X3PA 3C6XA 3H4VA 3SQLA 3AOEC 1J39A 1TJPB 2F8LA 2GHQA 2ORWA 1RCTE 1RTTA 3BZBA 2X7JA 3C3KA 4BWFB 1EUYA 5KI6A 4DVJA 1SHJA 1P80A 3VU8A 2D8MA 1T24A 1XB2A 2RGNA 4UZFA 3CLKA 5IJ9A 2XCOA 4RKRA 1NRIA 3E23A 4PQGA 1A9OA 1JA1A 4YUWA 4WRRA 1HOXA 2GPAA 4C1NA 4NHOA 1ZDMA 4BKUA 5KTSA 2B4KA 2X5JO 2IJGX 4B83A 5IT5A 4Z5XA 1T5LA 4MWGA 4X54A 4PG4A 2B69A 4B17A 1Z29A 4IILA 4ID3A 4J3NA 4A0SA 2AL7A 2IXBA 1UT6A 1AZSC 2FX3A 2G0AA 1DLJA 2XB8A 4JX8A 4RMNA 5GVRA 5HR5A 4NJEA 3B7PA 4PPQA 1EM8B 4Q3KA 1EB9A 5E4TA 2PLRA 4DNXA 2X19A 4PLHA 4Z7OB 2BI4A 2JCVA 4RIIA 4XYLA 1GDDA 2JI6A 2DQSA 1ZCBA 1Z6QA 3NEPX 3T7DA 2CCJA 5DHAA 3U62A 2PGLA 4B44A 1TKRA 2YV3A 3ZHUA 1QTNA 3CLRC 4OP2A 3Q8KA 2H4FA 4LUCA 4X41A 2OHOA 3GXOA 4MLCA 2UU9B 1UM8A 3VX3A 5FLYA 5AYVA 4BNDB 1DNPA 4KXVA 1YB5A 2QTMA 4GZ6A 3V4FA 5HUQA 2ZIWB 4HAXA 4JYPA 2MWMA 5KU7A 1VPVA 3HKCB 3OCZA 4B48A 1SCJA 2GCIA 1RYMA 1C9EA 3BBPA 4FOOA 1IMOA 2QD2A 3LKDA 1N5LA 4M76B 5LQSA 2O23A 721PA 5CT9A 1T4BA 1NW5A 3IFSA 3NC0C 4K1LA 2M6KA 3RODA 1GSOA 3BN3A 4FMCB 2DJIA 4UD2A 3RRXA 3K96A 4QFMA 4HS4A 1AKEA 2XADA 3A37A 2BKVA 3MB8A 2G1UA 2X41A 4RGQA 5IRCD 2HJRA 5K0GA 4DREA 1ZM4A 1ZJ6A 2O7VA 2RGUA 2Y1FA 1C0PA 4H3HB 5BQFA 5CA1B 1NKTA 2B9EA 4JUIA 3WHKA 1YQEA 3HXPA 1ZXXA 2OK7A 1HYBA 2OUKA 4D6YA 4G5FA 2Q3BA 3S2GA 2FGJA 1OFGA 1DIBA 2ZRIA 1D3AA 2GRAA 5B6PA 3JYQA 2DF8A 3RJ5A 4C9BA 4S1WA 1PTJA 1MT3A 3OUZA 3Q85A 4GM0A 1VCMA 4PAGA 5CTAA 4NOMA 1E0SA 2WW8A 4XPIA 2LXNA 1G4AE 1MO2A 1EK6A 3LHIA 5FPSA 4BFCA 4DMUB 2QT0A 1MVOA 2RBEA 3KLMX 4FEAA 1QGUB 4B1FA 3IJEB 5I4CA 4O5AA 2EKDA 1BXRA 2NZWA 1OXKB 2X2PA 3I58A 4URYR 1CHNA 2O3UA 2BN4A 2Q49A 3N74A 3HYLA 3ZCUA 4ZYYA 1HBJA 5B58T 3JQ9C 3I1YA 4MV0A 3CF4A 3IPCA 5AM4A 4HLDA 5J1TB 4EYQA 1JZQA 1WXFA 2FR8C 3FVQA 4HX5A 3E7WA 5FO0A 3TI7A 6REQB 3DYIA 4RE5A 2Q0XA 2K7ZA 2NVOA 4GYJA 4MRVA 4DRXA 4M54A 2LV8A 3PUZA 4Q37A 4EHNA 1KVRA 1YI8A 3QMWA 3SVLA 2D5IA 3T9EA 2Y0CA 3ICEA 5GAJA 1O9BA 3O0TA 4RHTA 2RGXA 3DAYA 2WJ4A 1ZOOA 1LJUA 2C2XA 3AEXA 4WKGA 5DW0A 3ZEAA 3HC7A 1PDWA 1SXJC 3RU2A 2AKEA 2ZUUA 4ZVLA 5EIFA 3P4XA 2X0RA 1QKIA 3L7OA 2FPKA 1RKVA 1ZD5A 2O5EA 5CNIA 1MJHA 5ER6A 4CQLA 1KR2A 1V5GA 5E38A 5TE9A 4RESA 5BQOA 1UKCA 2JBAA 3JWIA 4URWR 1CRPA 1A5AB 1E9DA 5FTNA 5FH9A 1JVBA 3BMQB 1T29A 5HJ2A 3TPZA 3Q7PA 3U4QB 1JPVA 3R0XA 5CNMA 3STHA 2IYXA 4AZ3A 2Q8NA 4PIPA 2Z8XA 5JNWA 4IOMA 1LWNA 4L4SA 1P39A 5ALXA 1DAIA 4WOCA 1ZZEA 4F9EA 1DL5A 4HVLA 2QN6A 4KTTE 1YDGA 1EXMA 1QVWA 3QZUA 2E4UA 3LCRA 5GY7A 3AUSA 1UAGA 2FSVA 1YB2A 4TKMA 3VOBA 4DWOA 4OBWA 3I0ZA 4D8TA 4BN5A 3ENVA 1MJGM 1GA6A 5KZMB 1GCAA 1GCUA 2A33A 2ODQA 4OQ4A 3DO5A 1P5JA 2EIHA 3ELWA 3MTGA 3QIVA 3MVEA 3ZLUA 4EUNA 1V8OA 1CJUC 2AI3A 2PIAA 5A9SA 1XLTA 1E1MA 2IDKA 4WOPA 5SZHB 2BUBA 4FT4A 2VBGA 1IN8A 3QWHA 5BWLA 2I6GA 3SZ3A 3QOWA 2Z5VA 4JUDX 5EHQA 5FTLA 1LBHA 1KXZA 5H83A 5TF4A 4B31A 5FOSA 2PRYA 3C7TA 3CX6A 3DGFC 3SHVA 1DV2A 4UU7A 3ROXA 4QG3A 5I3CA 1ESEA 2CWWA 2IYQA 4CF3A 4K8OA 2OQVA 2WAMA 4D6XA 3F0TA 3H2YA 2YY7A 2IXTA 1THTA 2QM3A 1LW7A 1WHTB 3C5HA 3JVVA 5FBQB 4M0MA 5DNYB 2ZZNA 2OB1A 4GPAA 1OFIA 2FY8A 2QWXA 1GGHA 2G28A 3DDCA 3QPUA 1W75A 1ZD2P 1ZX1A 3L7CA 4FHCA 4H1WA 3FWYA 5HQ3A 3ORQA 4FZ3A 5IASA 1FU4A 4HRAA 4UQOA 2QP3A 5ICMA 4LWQA 3OCCA 2ZJ4A 1DDOA 4PYKA 2IH4A 2A8YA 2RBKA 3F74A 3L41A 1EFHA 1JX6A 1IXKA 4Z0HO 3VO2A 3K94A 4HUQB 1EUQA 4L22A 3HG7A 1XQ1A 2GTIA 3KHSA 1TJ4A 1JQ5A 1Y8RA 3M6UA 1YMVA 1E3WB 2DM6A 2ZWPA 3NTVA 4L5JA 4R3NA 1BN7A 4CF4A 1T2VA 3DE7X 4ABYA 1GU0A 1IHUA 3H2KA 1T0HB 3Q12A 1DVRA 5DTEA 5F33A 4J0FA 1KI8A 1VG8A 2PWAA 3RS2A 2HSGA 4BV8A 4YDSA 1CULC 1P62B 3HP1A 4PLTA 4B76A 1WP9A 3RVDA 1QFYA 1ZC4A 9LDBA 4X24A 1UK7A 1AV6A 1O97C 1Z8DA 2EGHA 1MRSA 5SZJA 2O57A 1PR5A 2ZIAA 3PNBA 4I19A 3TD9A 3B20A 4MUGA 1ADYA 3AB7A 1IY1A 1Y6QA 3VTAA 3OOEA 4DF3A 4R84A 3H2HA 3H8SA 3KL2A 4F5WA 5BUSA 4WBNA 1MZPA 1UF9A 1ZLYA 4CU5A 1TPYA 4XWWA 1Q15A 2R3SA 1TCUA 4IJQA 2HM7A 3VDXA 2EP8A 2OBBA 4IY1A 3CVJA 1QHHA 1DINA 3HN7A 4O1HA 4QDTA 4LF6B 3JWJA 1NUHA 3R4VA 2P1ZA 4Q0MA 4X20A 1WSWA 3PGMA 1XFDA 1E61A 3RRNA 4XQGA 1K06A 3PXBA 4B7XA 1G8FA 1SOAA 1AJEA 1UC5B 3FHOA 3IE1A 1GPBA 2FEOA 2E5FA 1YRHA 3AR4A 4YGYA 4N3CA 4JI5B 3VNSA 4ESOA 3LT0A 3W5CA 1B41A 1GITA 1J90A 1Q0SA 4B87A 3BEOA 2QZJA 4GICA 4YAIA 4RKFA 4IH1A 1N6NA 4AK9A 3HDTA 2FE1A 1C0EA 3PENA 4AIIA 4JKOA 2ZB4A 4Q4JB 3AW9A 3KFXA 4AM8A 2PKYX 3PHGA 4UOEA 5FA5A 4MR7A 2CV2A 4X64B 4O4LA 3KD2A 3HBLA 3FSGA 2Q5FA 4IGIA 1YJ5A 3GLGE 3KB6A 4TVKA 1S3FA 2Z3ZA 4B3MB 3NATA 4TGLA 5EY5B 2WA1A 2XE8A 4CIVA 4YN3A 4EKIA 1SBTA 5ITZB 1QB8A 4D9MA 3WTCA 3SXUB 1JE1A 2MMCA 3NM4A 1FSGA 1CY4A 5A7GA 4C0AC 1QG6A 1LK5A 3KQTA 4LNAA 2GYUA 3GRCA 4MEJA 5C1PA 5JH7B 1I7DA 2O05A 4U2BA 4HXYA 4YS6A 5CXQA 4G0WA 2PLFA 2IS2A 4GEKA 2L82A 1RXUA 2G6BA 4CNBA 1TE2A 1TCAA 2O3TA 4FLMA 3C39A 2AF4C 3P2YA 4UUMA 2CY0A 2GWHA 1P45A 4YC7A 1WMAA 1AGYA 1JVSA 2JBHA 3L18A 1CDOA 1GGMA 2Q4DA 3BKXA 4YT5A 4K9NA 3QKSA 4RHUA 3HXKA 5AD1A 3DBRA 1SUPA 5JQWA 4XIJA 3GJQA 4CTJA 3PT5A 4MQFA 2X0IA 1R6UA 3NDRA 4GLBA 4MA5A 4B0OA 3TSZA 3EGVA 4EGSA 4QODA 4HUTA 2BLLA 5KOYA 2J87A 3NHAA 4LCEA 3VR0A 3I2JA 2RHBA 2J59A 3MXOA 4A27A 1YR9A 4JC4A 2DPGA 1N0UA 2FG6C 3K5IA 4E51A 2A86A 1P4RA 3C6ZA 3HJTA 4ACAA 4ERNA 2QTBA 3GNTA 4M1ZA 4XYEA 2VUHB 3L1KA 4A1OA 2QTTA 3SS9X 1Z5OA 3NS7A 4RGVA 4RM2A 1QJCA 1O6CA 2PTGA 4DZTA 3HLYA 1QS0A 5KVCA 5CM8B 2FUCA 3ELYA 2DFNA 4JJKA 4Q4DA 3LDUA 3X44A 4EO7A 2O8EB 4MVJA 1JVNA 1P9RA 3C4JA 4L02A 5IZCC 4P3KA 5LNK6 1KFKB 4FKBA 4CM7A 1M1YE 2FOLA 2R1UA 3LZ6A 3RUPA 3DQZA 4YJ3B 1F2TB 1Q0RA 4O2BB 3FKSD 1XRJA 5L6MB 3P9RA 1A5ZA 4OGGA 2W2TA 5AHWA 2AD1A 2ECFA 4QG7A 4X44A 4E2FA 3CPHA 3EOBI 4I55A 2N9UA 1XTRA 3FOWA 4LC9A 4AP6A 4EJFA 3EIOA 2F90A 3VC1A 2B7BA 3N05A 5DCLA 3RE1A 2Q0SA 1XZJA 5K2MA 4MDHA 4HZIA 4GI2A 3KCNA 1NDQA 1SVKA 2OD9A 4BWVA 4L28A 3WRWA 4Q15A 4OXXA 2OM6A 1CRWG 4DBZA 2C1XA 3G0DA 5JV5A 4E2YA 1NX9A 2DPHA 2X9NA 2V54A 1XR3A 1Y7HA 1XQXA 3K8OE 4WCFB 2ZZKA 4COOA 2GBIA 3DDNA 1X15A 4U7GA 4XR9A 3COZA 2EV9A 2W58A 4B80A 2WFLA 4BP8A 6PFKA 5KDLA 5G0UA 4K1XA 4Y1GA 1B0UA 1WCV1 4ZWNA 3SIXA 3UPDA 3K9FC 4I8DA 3DV0A 3V8QA 1Y1SA 2HUNA 2ALJA 1QUFA 1VIYA 1GQ2A 2QEQA 4BFZA 1DGQA 1J5EB 4LC0A 3NNSA 4MWDA 1IIRA 1WV0A 4TTSA 1TD9A 2JIRA 3HB9A 5F35A 5BT9A 5M29A 1K6JA 1LFAA 3AF2A 3X1XA 3A1TA 3ZCXA 4W9RA 1LD3A 1J2RA 4QHTA 2FHSA 5DX1A 3OM8A 5HTKA 2GK6A 4RSHA 4EW3A 2C7GA 1CWUA 2LNDA 2ZJBA 3J7TA 3D3EA 4BRUA 1QOQB 3CRNA 3OIVA 1Z36A 4GMDA 3PICA 4PLZA 4Q05A 4QXRA 4XEHA 1H2XA 3BD6A 3U7EB 1DUVG 5HIIA 2VNKA 3NBZC 4FI3C 4CKWA 1UBRS 3SR0A 4HGZA 3BWEA 3O8CA 3QUTA 3HUFA 1UCFA 3VBEA 4UTOA 4DJDC 1W52X 5DNDA 4RO0A 2CN1A 1A98A 3JPWA 4UM9B 2IYTA 3HCAA 3GV0A 1HTWA 2ZANA 2P62A 3SF8A 1WSBA 5F23A 2YWJA 3KJQA 3ER9A 1T9BA 2DKOA 1NVEA 5KNBA 4OPMA 1IN7A 2X8WA 2AXQA 7AT1A 4G0VA 4GWLA 2R7KA 5K6TA 1Q5PA 1G21A 4YREA 5DGIA 1N2CE 1CP2A 2ZI9A 4MW4A 4Q7EA 5CIWA 1GV0A 821PA 1Q1BA 2JARA 1QGYA 3FJYA 4TXMA 2YASA 2H5IA 2MSDB 3H9GA 4XJSA 3RC7A 5JCJD 3U4HA 2J48A 2WYVA 3V4VB 2Q9CA 5E7QA 1ZUNB 1W85A 4EZIA 1ABFA 1NT2A 2A0WA 3K30A 3MT9A 3NOXA 4LJRA 3WK6A 2AFIE 1AO0A 1A9XA 5A4KA 2JI8A 5KB3A 4L4ZA 3DD1A 3FNIA 5JNSA 2YJTD 5CH3A 2BEUA 1BA2A 3LBIA 2AUNA 2QRJA 2UKDA 2HPAA 4HH1A 3WJ2A 2FVYA 4OIFA 3A6FA 4ICIA 5A3JA 5JSZB 2ZRKA 2I87A 2XQVA 4YP6A 4IUCS 1CNEA 3STUA 1I2DA 4DCCA 1FQWA 2RHMA 3QE3A 1SUEA 3VVCA 3H6GA 2X7XA 3GJ3A 4HJXA 2GLTA 1Z2EA 2FJUA 1GNQA 1D03A 3AHEA 3VR2D 3TD6A 4BEVA 1R0WA 3DFIA 3PR3A 5JSHA 3FYUA 2GHIA 3WHPA 2IYPA 4BPBA 5AJVB 1W1WA 1OX4B 3EGDA 2GYWA 3AEQB 1P5RA 1HL7A 3HRIA 3L0IB 3AHJA 4YRGA 5BV1A 1EAMA 4MUHA 1ZVVA 2XCIA 1XZCA 4JVMA 1XTUA 4JLPA 5H70A 2CD9A 4XDYA 2GJAA 4AB1A 4BNVA 2MYPA 4ZCLA 3JVDA 1UZMA 3IUBA 5FPQA 1DRWA 1Y7PA 2EZUA 2FPWA 5B4TA 5B6JA 2O2SA 1C80A 1XAGA 3C7DB 4HRYA 4IJ5A 5JZBA 1X2EA 3P0EA 1PNRA 1OZ0A 3JD3A 1TU0A 3RV4A 4A8JA 3IBYA 5L51A 3RSZA 3WK4A 4DBLC 1BJTA 2L17A 3FRIA 1JDBC 1ZK3A 3U5ZB 2ZSAA 3UUFA 1NBMD 5IVDA 1ZD9A 3CTPA 1T5SA 1V2GA 5H4HA 1P2VA 4B35A 5K7SA 4IDDA 4EFLA 4TV9A 1KK0A 5EQTA 1PZEA 4DJFC 5IVPA 2CFCA 2V65A 2XIJA 5FFFA 1M5UA 4LCJA 4Q3NA 5KHAA 3VSEA 4RS4A 1RWBA 1E2FA 1XZAA 1JG1A 4J2OA 1A8HA 4ALMA 2JS7A 4CQMA 2CE7A 3A2NA 3FY4A 1X0VA 4IIDA 1CEXA 2XUPA 3RBZA 1PV4A 1D4OA 1WUYA 3HBMA 4C6SA 4GPBA 5CPBA 1I10A 3QENA 3V8RA 5B6IA 4GQBA 4OLJA 1XA0A 3KG2A 4S1OA 4UMDA 5D3MA 3IKTA 3AJDA 4MAFA 3TINA 1PFKA 4YRKA 1T43A 3ZJ4A 1KKLA 1LBQA 4Y2GA 4ZOAA 3BE5A 1VBNA 5LP6A 2FEMA 2NUAB 1Q20A 1VHWA 5T3YA 2GNOA 4HVAA 4DQDA 3E18A 2ZJ8A 3FUUA 3EEYA 1LV7A 1L5HA 3ZDAA 4UREA 2O8DA 4P83A 5FBHA 3DDOA 1WX1A 1WZIA 2OCKA 1I30A 3LYLA 4Q34A 4NJMB 3TIIA 2IOFA 3EMKA 2CZGA 1PZGA 2X1LA 3DDSA 3HA7A 3INGA 1SCAA 4EGJA 2IPAB 2C7QA 3WIEA 5AK4A 1QH0A 4LYJA 4UXJA 1DUSA 1L7MA 5CT5A 1QH9A 1T13A 2EWVA 3GO4A 4WH0A 4BMOB 4DADA 5JD6A 4K6KA 4FI3F 2XF8A 3D2AA 2OHXA 4RIFA 3QX9A 4YFYA 4RZ3A 4EECA 4F72A 2B92A 2HIAA 4NZ9A 2ILTA 4INOA 4X91A 2NO4A 2AF3C 2QY9A 1YZTA 4J0DA 5AR1A 3B2QA 3NIFB 2R97A 3RYIB 2CHQA 2BGMA 4URZR 3RSSA 2ZBRA 1WXQA 4I4TA 4NE9A 5F7ZA 4KXNA 1KRWA 2ZYTX 1KDPA 4GOMD 3ZE0B 1JWAB 4F7WA 2IHYA 3TW8A 2RHCA 4HB2A 4ZGWA 2AZXA 2BTQA 4OFZA 4IOLA 3UNXA 2WM2A 5B3LA 3N86A 3AR6A 2DFDA 3O9ZA 4G1BA 4LIPD 1XMSA 2H8GA 2JZCA 4H9GA 4GYWA 3VNUA 5FI1B 2ZUVA 3EGIA 5ADHA 4RADA 5NLLA 3WGHA 2IXFA 5L9AA 2WVJA 3HR8A 1RLIA 2I62A 4MVJF 2A9JA 1G2QA 2H1FA 5FV4A 4KYIB 2ZPAA 4DA6A 3ZHCA 3A25A 1E62A 2AVDA 4XM1A 1AKUA 5JZ9A 4PAOA 1GXSB 1HO3A 3IHLA 1HF3A 5TX7A 4EITA 2GZMA 4I55F 2CZCA 2C77A 2WOJA 4BXOB 1QX3A 4PPFA 1V47A 4OHXA 1C1YA 1GKYA 2PV7A 2RI1A 5J4HA 3W1EA 4Z1MD 1N1DA 2GN9A 2NUPB 3ORSA 4N47A 5JJKA 3CUSA 3IC5A 5FQNA 3P8ZA 4WACA 4CV2A 4LE1A 4BMZA 4EFMA 3R0ZA 3DUFA 1KJQA 2YIJA 4JLAA 2VP9A 4HPJB 4A6XA 4C20A 2YINC 2Z5FA 4EPTA 5AW9A 5KYKA 1DLIA 1E20A 1JHOA 3QOXA 3TO5A 4FMDB 3UHAA 2V4MA 3D3QA 1C3OA 3N6XA 3AYXB 4YO8A 1C3XA 3VPGA 2GEBA 3E9DA 4G1VA 1ISHA 1W5TA 2PDAA 4HDAA 4HOYA 2P79A 5K3OA 2PFKA 1SNYA 4M1WA 3ZHVA 2OXTA 3SEAA 3OQIB 4E5PA 4KH1A 2ZJ7A 5K0LA 4RVCA 2CHUA 5MF6A 2LW7A 5JAHA 3UAWA 4GRDA 3DNMA 2DULA 4YJGB 4YRNA 2OPBA 1L5QA 2WKRA 3H5IA 1FXWF 1FX0A 3U61B 1WZ2A 1PSDA 1KDTA 1RPNA 1U2GA 1SZJG 1UJ6A 2GPTA 3IH5A 4UPDA 2AJDA 2CNWA 2IUEA 1BHQ1 1C7RA 1FRFS 2YMQA 3PGLA 4HWGA 3QPVA 4NZNA 5AJZA 621PA 3M1IA 4U7WA 4B2IA 1CS4C 3OEWA 3QU2A 2OFPA 4IDOA 2ORED 3ZKWB 5A2QA 2W00A 1N77A 3EAFA 2APJA 1H2HA 2IVFA 5F12A 5ERGB 4BUCA 2HA7A 4F3TA 3FDJA 4UCXA 4WXPA 2WYWA 1DC8A 1QTQA 3NDIA 2ZIFA 1PP4A 3VXKA 5E1MA 3B9QA 4YBRA 3TR0A 3GLHB 4M9RA 1YJCA 5DLPA 5TQVA 4MVCA 5CX4A 5GJCA 1AUQA 4PM4A 4BLSA 4JODA 1KEZA 3KWLA 1DEOA 1NJ6A 5SYAA 1SHLA 1OGIA 4FJ2A 4JGGA 2F4NA 2JPDA 3PRJA 3T12A 5KREA 1E7SA 2GVZC 1HY3A 1JBEA 2ODPA 3IVCA 3JQQA 4RF4A 4B3IA 1UPTA 1OH8A 3JX9A 1WWKA 3RO7A 1PGPA 3N39C 1Y8CA 1AS3A 4NCKA 3FGNA 1YK1A 3RUHA 1Q74A 4BCCA 1Z4JA 1J42A 3X0DA 1Z5WA 1JQBA 4O02B 1P91A 3EFHA 3OIUA 2BR5A 4E5MA 4UE6A 2X58A 2Z4SA 3E35A 2FPLA 4N0EA 1KI7A 2OBLA 4WY2A 5DP2A 4PN3A 4MRNA 1WKBA 2DHEA 1MKYA 3CVUA 2VXOA 3UTCA 2OV1A 3ENNA 1R8XA 2C9ZA 4ZV9A 1NSTA 3QYPA 3T3EA 4F04A 1GR0A 5FUVA 3LCJA 3H8WA 3D3WA 2WU4A 3HDGA 2ZM5A 4PPYA 4EF5A 5EQJB 2R96A 5TC4A 1LH0A 3LC2O 1G8GA 1BU5A 5K6AC 3X43A 1Q6ZA 2QZSA 3JPYA 2J5RA 4TKZA 2YYSA 4DC1A 1NQXA 5LD2B 1KERA 4F8YA 3U4MA 1E9CA 1JAHA 4QUGA 1K92A 3T1VA 5JDIC 4FFVA 3WZMA 4FEEA 2A5GA 2CBZA 2OUIA 3VRHA 2NSJA 2EJVA 2GCPA 1Q3TA 4C14A 1QO9A 4ABTA 3BWDD 3H1GA 5EE1A 4V0MA 2WM9B 3CZCA 2O2EA 4FZVA 3HDJA 4CIDA 3O75A 1QWOA 1A8UA 4DZZA 1J07A 3I4FA 3ANSA 4K40A 5BV0A 1NBME 4RQUA 1IEVA 4UM8B 3MILA 4P6VF 1ESNA 4XB6B 1A97A 5FHQA 4G8DA 2ZTVA 3UANA 2J1LA 2RE8A 1QQAA 5C1DA 3UCFA 2DRIA 4FZJA 4C5BA 3GLIA 1U04A 3CLRD 2PRZA 4BFSA 5J5CA 4H3KB 3OJEA 3LAWA 4MVJP 1L5LA 3TIVA 5FWXB 5CFLA 4C0WA 4XM2A 4FB4A 2B25A 2O14A 1L6IA 1AG9A 5DB4A 3A7DA 3M5WA 1E9EA 1DIAA 2AG8A 9ATCA 1RYEA 2F43B 2VDVE 1ECJA 1SC4A 4S35A 1YQQA 4U3JB 3GUUA 1JMKC 4WAUA 3ANYB 1FRZA 5IAOA 2GBLA 3RAGA 1G3RA 4WPGA 2Q3EA 2QIPA 3BD7A 3BL5A 3NBUA 3ILHA 3PCTA 1IONA 5A4JA 2ZPUA 3RYCB 1P4GA 4YJHB 2IBTA 1TA4A 3VH2A 1E2GA 2JVJA 4TV9F 3VBCA 3R7WB 5E2IA 5L4LA 3B8HA 1IN6A 1U7WA 4NV1A 3N75A 3D4PA 4O2AA 3KT0A 3NKVA 4WXHA 4X1KA 5IN5A 5KQGA 2JCBA 1VGQA 4QXOA 2QD3A 5BNWA 5B37A 1KETA 1NW4A 1PK8A 4CTKA 5KAMA 2XE7A 1O3YA 2RB5A 4AJHA 1E6UA 2PZGA 3LL7A 4J6EA 4II3A 3R9XA 4Y30A 2I1WA 4F96A 1JH9A 5DSTA 2W22A 3ENZA 1YQUA 4TUYB 1MO5A 3EXHB 3RARA 3WLIA 5GJVC 1B00A 1Z5ZA 2HUPA 1WU8A 2O1EA 4H2DA 4HWSA 4OK6A 3S27A 3TEFA 3UC5A 1V7ZA 1FS4A 1X7WA 2VBCA 4Z53A 4J6FA 1P4SA 3AJ8A 3CX8A 2XT6A 3DNPA 2XOXA 3F96A 3PQ7A 1WDTA 4DLYA 1WZNA 4XUDA 3GEIA 2PBFA 3GJRA 2HHCA 4IUYA 4B4VA 2J8ZA 4B6QA 1TUEA 2VG8A 3NP7A 3QF7A 4PX9A 4C6RA 3RBXA 1SKYB 1E2PA 5EMJA 3ZEIA 4L9RA 1G60A 5TS3A 2RGAA 5B1YA 2O2GA 2PBZA 2WD9A 2NTJA 2QLMA 4US1R 3ZGYA 4EDFA 5CA0F 4A82A 1SXJD 2P6OA 3KZVA 3T5CA 2HDWA 5KTOA 4K03A 1KDZA 1G64A 4UMVA 1QNFA 1UMCA 2ZP1A 4X6YA 5IUJC 3N2YA 4RJ2A 4RTNA 2C9MA 1OI2A 4NPAA 3WRYC 1TUBA 3AY7A 2WV9A 1C50A 3DBHA 3R5FA 2GYYA 3IUJA 2AG6A 1UEXC 4KXMA 4CRWB 3C2QA 2DBZA 2FJ0A 2SHKA 2BFDB 2VJBA 3M6AA 4MUIA 5T8KC 4DMCA 1P1HA 4I4TF 1ZNYA 4IXWA 5AI4A 2ZBEA 8GPBA 4N8DA 2HAEA 3GIDA 1J06A 4LBYA 3VZBA 1Z82A 1BOOA 1QRRA 1J0CA 1KMQA 1ISFA 3L01A 4BAGA 4AMZA 2NV2B 1VMAA 3NIWA 1YKFA 5DHPA 3FYTA 2G9ZA 2IT1A 2JD1A 2VHCA 3CTMA 2VP0A 4ZZ2A 1WJGA 5LA6F 3TRFA 4N9QA 3S2ZA 3EZ6A 4B3DA 3CVVA 2NWQA 4DTCA 3H9BA 1MO3A 1NQTA 3M3PA 4RJKA 4JA0A 5AUQA 2L19A 2UUPA 4WXEA 3IV7A 1OFUX 1WW3A 3FKSA 2PQ0A 1PQ4A 3FROA 3QY9A 4IIGA 4Z86A 1XLWA 2CXRA 3FDZA 4FCCA 3GLFA 4MA4A 2H4XA 1KRXA 4QJ4A 3UVEA 2J4CA 1T6NA 2BCGY 4IV0A 3G5LA 3U19A 1IQRA 5IAKA 1KBZA 3TXYA 4ND7A 4DB2A 1TT5A 2QLBA 2WD7B 3SBXA 1U3CA 3SG0A 4IYRA 1A5SB 2O5VA 1RYNA 3G2HA 1UXIA 3E7FA 2JJ2D 3QVMA 3R0JA 4UCWA 5DVZA 4CZ2A 1ECPA 1QO0D 4MKRA 4Q1DA 3RUEA 4ZEXA 1O0BA 3DLBA 1NKSA 1T36B 4WQMA 1QLHA 4ZVOA 1A9QA 2OCAA 2ZJOA 5HCIA 4A0FA 4IWXA 8MHTA 4Q9AA 1HA3A 1UWVA 3WJAA 1TZBA 1CG6A 2ERCA 3EF0A 3SM3A 2Q6LA 4P2GA 1D6MA 2HT1A 3LLMA 1VDZA 3RJZA 3UGTA 2HI0A 3L92A 2BC9A 4NCHA 2Z5GA 1UAYA 4OTZA 1MABB 1HFJA 4O4JB 1N7JA 1AB6A 1D0SA 1JEAA 2E4YA 3LY5A 1FRNA 3EMDA 3OIFA 3EVFA 4E12A 3RVPA 4G0UA 2OLEA 1VL1A 1G5RA 3DM9B 4CMEC 1Y1PA 1HYEA 1N8SA 1UQTA 2GWRA 3ESBA 2PQMA 3P9XA 3WNVA 1S01A 3NW9A 3TL3A 1RJ9B 4DSUA 4WMLA 2AB0A 3BDIA 5JWHA 2EOAA 4A7PA 1YD7A 2FAXA 4WTOA 2EGUA 3OTIA 2MYNA 2OV8A 3B89A 5KYNA 2O2CA 2Y4NA 4NMHA 1H3NA 1O97D 4FR2A 4R9NA 3QBJA 1HDYA 4C3OB 4WK6A 1R9MA 1L5KA 1WQ1R 4R51A 1F06A 2ZCJA 3L8FA 4XTCS 2WWIA 3OEHD 1H9CA 1S8AA 4B4UA 2O7SA 4OOFA 4MS3B 1Z62A 2QR2A 1TD1A 2GI4A 2FDCA 1WZUA 1E3SA 3JVEA 1O9HA 1GCOA 3BWMA 1E4EA 2RC6A 3KKPA 5CVDA 4CN9A 3KLBA 4YRJA 2UAGA 3K6SB 2FE4A 4X7MA 3IPXA 5E9AA 5B5SA 1IU9A 4M87A 1EXDA 1LW6E 1U0EA 4N0DA 4ZMSA 3EEIA 2C4HA 2Z6UA 2QBYA 2B37A 4QBFA 1S7CA 5JCJA 1HSZA 2ZSDA 2JGLA 3OECA 4REQB 2B8JA 2O48X 3B6MA 1WB5A 4INZA 2ZTLA 2PSJA 3OPQA 3EGWA 2CSUA 1EM8A 1G41A 4P35A 1J56A 3ZWXA 3C97A 1NW8A 3GH3A 5B36A 3KBOA 4PC1A 1HKUA 1KEEA 1PE0A 1M0SA 5ESRA 1WHSB 2Q2WA 4ENSA 2QUKA 4OJKA 1GQOA 2DR3A 1NATA 3QVOA 4OHCA 5AQEA 4WA8A 3NH6A 3IAXA 3S0JA 4ENUA 1Y98A 1RWKA 4AJLA 4XH9B 2PRSA 2HMVA 2O2YA 3PQCA 2XUDA 3RFUA 5KYXA 3AF3A 2ACWA 4PAMA 4WJKB 1CEYA 1ZISA 4L0DA 3OSZA 3VR2A 2WHPB 4QDXA 4Z0NA 1GKLA 3IDQA 1LWOA 1YJAA 2GCOB 4IV5A 4QUIA 3SX2A 1M8PA 1LRKA 2P5UA 1BMFD 1GY8A 4IIJA 4JQZA 4QQFA 4KMMA 2IYFA 4HF7A 3WMGA 1C3JA 5CFNA 3LDHA 3DCJA 5AVYA 2H4JA 2BGGA 3AVWA 1XLUA 3A1EA 3IAS1 5EEGA 1EI9A 1LDBA 3JY6A 2XWBF 3PP8A 5BMVA 5KWJA 4JBIA 3ROEA 5F7XA 5KPDA 4HQRA 3PNQA 4TTIA 2VPPA 2WNIA 4DL9A 3IEXA 4B75A 2HCFA 2OCXA 3R3HA 2BJWA 3X3HA 4ODIA 3OETA 2BP7A 5CFRA 2XKAA 2CL6X 2XR1A 5AVZA 2Q3DA 3QKIA 1V9LA 3PTZA 4OJNA 3V7WA 4X1YA 3ZYZA 3U7FB 1NTRA 1Q14A 2PZAA 1QGUA 1N9GB 2FF5A 3B1KA 2WFMA 3OG9A 3DBLB 2EEZA 1TZMA 1GUYA 1Z6GA 2F3UA 3OZXA 1FK8A 1H2WA 3ROQA 3KZCA 1JFVA 2NAFA 2WI8A 1SAYA 3HCEA 3RSGA 3I72A 3LHDA 1K8YB 4RK5A 4UDYX 2FEPA 4CCWA 2D6FA 4X8LA 4EB8A 1LBTA 4Q9NA 4CLHA 3CW9A 5LQCA 4ZO7A 4JN6B 1Z6ZA 1UMDA 3I9NA 5D8DA 1PLJA 4NMLA 4TYYA 2MU1A 1VGVA 4UHFA 2FQQA 5J2TB 3ZVLA 4D97A 5TIIA 4ZVKA 1RHJA 2WINI 3NRJA 4P86A 1SXJE 3G0BA 1Z63A 1YIDA 3SFZA 3LT1A 4I50F 1GAXA 1BW9A 3BZWA 1WF6A 2X8AA 1J5PA 1G8MA 1Z2CA 3K0CA 1VLZA 1QFSA 3BMQA 3ZWBA 4QYXA 5EJEA 5E6UB 3O31A 4GUAA 4BCBA 2WG1A 1C8BA 5AHOA 2C20A 3TFOA 4D5EA 1P81A 2WYHA 3UM9A 3ZQUA 3IOYA 1ZJWA 1SVMA 4ASUA 4UZEA 1DBVO 1R15A 1HEIA 5HILA 4NAUA 4FINA 3UF0A 3D8BA 2WUWE 2ZIVB 3FMFA 4BLTA 5LQJA 1MC1A 4J29A 1Z73A 3WADA 2JIMA 4U9IS 4LPKA 1DCMA 3FAKA 3BBLA 1K63A 4WZZA 1E32A 1THMA 4RM3A 4BGUA 2NSDA 5KYVA 1T1SA 1PGJA 4H3SA 4NX2A 4ZC1A 3RQSA 5C18A 1AN9A 4JA2A 2O3QA 4LK2A 2PEZA 3C8DA 2O8CA 3IVAA 2HTEA 2BAGA 3ICPA 5DI3A 5J47A 4QE3A 2Q1TA 5CG2A 3FNRA 2VWQA 4R2MA 4HXEB 1B0ZA 5FPKA 1IJKA 2FW7A 1YOVB 1CUSA 1E1CA 4XZ3A 2Z2YA 2HJSA 4GE3A 1VCNA 3GGOA 3GVXA 3C6KA 3PNYA 4NYIQ 5TB5A 2EG9A 3UWMA 1Z0JA 4UM7A 1BNCA 2A0XA 2E4XA 5UKDA 4UMEA 2LZ0A 4XW2A 1U99A 2ZRFA 2JK1A 2NO9A 1AX9A 3FNGA 4O8CA 3G6KA 1G0OA 1K8RA 4TWBA 3K4HA 2H17A 3ZWCA 2RD2A 2OOKA 5HYVA 3O2JA 3G1TA 2YJGA 3AT1A 4B43A 4HZGA 1TM5E 3FPHA 4TSKA 4X8MA 3F71A 5FKJA 1P2DA 3S2SA 1L8AA 5GIPE 1RYZA 2XQGA 2P4SA 1R8YA 2BFOA 4RVGA 4KR7A 1E3WA 1NV9A 2HA6A 2IU4A 2IYNA 1M1XB 3HR7A 2GK7A 4MMYB 4Z1MA 1AQJA 4GECA 3O8LA 4DABA 1MOQA 1M72A 1A9PA 1N75A 3MPOA 4Q4LA 1EK2A 1YE5A 2BGIA 2IKQA 3GT4A 3EK2A 1WNTA 3ODPA 2NIPA 4UVIA 2GPJA 4JEMA 3QTTA 4J4TA 4P84A 4ZVRA 4W82A 5LYJB 5F1KA 1YJQA 4URVR 2G9UA 3U0VA 4MB0A 1HM5A 1FRQA 2PL9A 1TW3A 3H7IA 3LWBA 5IC6A 1BVHA 1BXKA 4HB0A 4DHWA 4E4RA 3LXUX 2O8BB 3CCFA 3P7MA 3HVJA 3HZOA 4ZO9A 4BO2A 3O6VA 3BMXA 3ZQJA 1MQAA 1TLTA 2D1RA 5CB0A 4K0KB 4HBGA 1SU4A 3D59A 3JAWA 4IFTA 2ODAA 5L3SB 3MHPA 1T9CA 4IDGA 7MDHA 1M2WA 1MQ9A 1B26A 1FE8A 1ISJA 3KALA 5HW0A 1LK7A 3VR4D 1JWLA 1VB3A 4ZCIA 3W8EA 1CERA 5FB3A 5DEOA 5C7LO 3M4XA 1ZMBA 3QLVC 3A4VA 1SBNE 1C9NA 4RD2A 1BCSA 4KRGA 5TT0A 1A7KA 2KMLA 4ISCA 4JJ8A 4NQRA 3RC8A 2ZYWX 2HIMA 3DMFA 4Q4JA 1NLMA 4ZOBA 1GDTA 1GGJA 3O4IA 1N3YA 3IKVA 3EEFA 1UK8A 3B5JA 3GCZA 4JJ6A 4MGEA 5I4BA 3KO8A 2OFWA 1N6LA 1AUPA 3UV7A 4BJ3A 1M34E 2PZMA 1JJ7A 3CWZA 4RDIA 1GZ7A 2ECKA 4J0JA 4WKPA 2OPHA 3UJBA 3F5DA 3QOYA 1H1LB 1T3GA 2HSZA 2J6CA 1RKQA 3Q9SA 4MVWA 5JS2A 4TMTA 3WL3A 4D8XA 5AKYA 1T8UA 4B74A 1IN5A 2WWXA 1FFBA 3ET5A 2E5WA 3M7IA 3V9AA 1GNVA 4LQDA 5CHEA 5LZ4A 5K3CA 1DT5A 1UBUS 1MXFA 3M2TA 1FNBA 4KIJA 3OCWA 3QV1A 1K97A 1Q0QA 4FHEA 5JH7A 3C3DA 4KR9A 2PLNA 4PBTA 5JTTA 3EZ9A 1Z47A 4ITVA 2HRBA 2VJCA 2ZEJA 2XMSA 3O8QB 1BMDA 4YP5A 4A6PA 2P5YA 2R6R1 1F6DA 1FOEB 1HDXA 3D5QA 5JVDB 1UXJA 2NPIA 3PUKA 4ZCQA 4RNDB 3GFFA 3AOEA 1H2FA 1W93A 1GL7A 4HQFA 1U2PA 2J5XA 3DTNA 3KRTA 3AIIA 1LEHA 2QL9A 3PI7A 5H68A 1MDFA 2Q5EA 3B60A 4QXPA 4CFSA 4E5NA 2VF4X 5BW6B 1YVPA 5G40A 1Z5UA 3BS4A 4HRVA 5ALOA 1NWCA 3LX6A 3ENQA 1S2MA 4S1VA 1ODSA 4MIOA 2I7XA 4RGYA 3HJAA 4YAEA 1QFZA 4CL3A 1SUDA 1LCIA 2NXCA 3HFJA 1CUEA 1N2OA 3A4TA 3CT4A 2ENUA 2NXWA 3KC2A 3QVUA 4K0RA 3UHOA 4DMMA 4WN9B 4J0IA 4G1EB 4EW1A 1A69A 1R8QA 4FMCF 4GUDA 3NJ4A 4RPIA 3VPBA 4V2UA 5EIHA 1KIMA 2PS0A 4AN0A 3VJLA 4NG4A 2I3AA 1WXDA 2AJCA 3B6KA 3FZYA 2DQKA 4Q21A 1Z08A 3OX2A 5EVJA 1BN6A 5JMPA 5CA1F 2O8EA 3RS5A 4AMBA 3F90A 2LUOA 1SWWA 4JP5A 4G09A 2QUAA 1IUOA 4O2BA 1A5BB 4QKQA 3VV3A 4D4MA 2MR5A 1N0IA 3OX4A 4QJIA 4H16A 4Q18A 3VC3A 4BX0A 4Z2AA 2OMEA 5G0WA 2V7QD 3PX2A 1N7HA 3HO8A 1JQKA 5EP4A 4E3WA 1NI4A 1E79D 2G72A 2M6SA 3SQXA 3PITA 3HHEA 4I46A 3MJVA 1N57A 1VGRA 3WLMA 5HS4A 1YZNA 1H3EA 1JR3E 1XMPA 1RRVA 1E64A 3K9GA 4P4SB 5K8IA 2OL4A 3PFFA 4YRIA 2JW5A 1H0KA 4J7XA 4NPCA 1NFQA 1TFRA 2GKGA 3FNBA 1F48A 1V5IA 3INNA 3DCNA 4WCFA 1JDUA 3A4MA 2XGJA 1JBQA 2B30A 3GFRA 3KZMA 3PXUA 4ADSG 4OUDA 3GJYA 4HMQA 1N5IA 3JWEA 4HLNA 1Z9BA 3AM5A 2B1IA 5LCXA 2C5SA 3DYVA 3VSDA 1P3JA 1OY1A 1TYDE 2CLKB 1RT9A 2CWDA 1W76A 4PTYA 1R4NA 4WNAB 3OPMA 3EXG2 5HX7A 4HO1X 3KAPA 1BQ4A 4HN2A 2E2WA 1ZJ4A 3TPFA 4RE6A 5J58A 2B94A 3PLRA 4YQFA 4L27A 1O0CA 2Y1CA 1Y8QA 5EHIA 4CMBA 1XHFA 5IJ0A 5LDHA 2R8EA 5HKOA 4AUKA 2HV9A 2FP3A 1QTRA 2DTXA 1F0NA 2W9XA 1PNVA 1QGED 3HNPA 4HZUA 2DBVO 3PA6A 1Z4MA 5AMXA 3ZWNA 2Y0PA 3KZXA 5J3JA 3WMEA 2FW6A 4UJ3A 1Y1QA 4PZDA 2G40A 3RHSA 2ZRMA 5CB6A 1W4RA 1ZWKA 4C7OA 1JDVA 2NAPA 1K7CA 4HWPA 3PGKA 3WWCA 4RD0A 1E8MA 1J20A 1XKXA 1OH5A 1Y9AA 2NPOA 3C24A 4YAFA 2OCLA 3KB8A 4AKEA 1HQDA 4BRWA 1PR6A 3HY4A 4EAQA 1XTQA 1SJ9A 4H7IA 4DCOA 3VOTA 2WLTA 3PCXA 3SJCA 1KFEB 1XZMA 3THSA 2HO4A 3UGQA 1Q57A 1L4HA 3D31A 3PC3A 2JFQA 2PU5A 1X8KA 1NJGA 4P4GA 4YPVA 3AVXA 3FFBA 2W48A 3Q6IA 2UZ1B 1PV1A 1RLTA 1Q3HA 3K71B 2R8ZA 2XB4A 4MVJG 1SQ5A 4AMYA 3IP7A 2EBHX 1UXOA 2P3LA 2IELA 1LPMA 1T9GR 1XTPA 1D1QA 3QHAA 3VI3B 3W5SA 2DU8A 2C8LA 5CLQA 1Z88A 2DYKA 1D7OA 1PV2A 1SY7A 3JV7A 1Z2AA 1H9BA 2PVCA 1ULSA 2GOYA 3M83A 4R41A 5J4YA 5JROA 3FA2A 1QK4A 2PL5A 1PZMA 2I2XB 1RM0A 4EPRA 2XVAA 3ZBQA 4YAOA 5I7RA 5H02A 4DC9A 3KYJB 5F52A 5G4KB 2LRHA 3PX7A 1ZONA 1IN4A 5K8UA 1IZ8A 3MT7A 2AG0A 2OMKA 4EYEA 2QG6A 5E4FA 5JSZA 3KSBC 4PVCA 5LC1A 4Y0VA 1Y33E 1QONA 1UM9B 4NU6A 1FX1A 4ZT5A 3BRWA 3PB3A 4LA4A 4OHVA 1RBYA 5HS6A 2ZKIA 4RABA 3RD5A 2GGSA 3SZMA 3GP5A 1IG3A 3H16A 3WA7A 3SGLA 5ES4B 1QO0A 1VI2A 5TGZA 2SECE 4BZQA 1J9GA 1SXPA 2X6TA 3ZIDA 1L7AA 1NUQA 4WLEA 4CIAA 3FPSA 2OWDA 4D9GA 2XKKA 1Y37A 1T5IA 2A1TS 2QM8A 4DR4B 2IPNA 1RPJA 3M82A 1C1DB 2CXSA 2JH3A 3G2LA 2D5AA 3D1VA 3AEQA 4RPCA 4CLEA 1A4RA 1GAWA 2D7JA 4DY6A 4EA7A 4H77A 1BJKA 1JFRA 4K5QA 4B4DA 4L7QA 3NHUA 4G9EA 4OHWA 4UMFA 4R2KA 2C7RA 1Z7EA 1YZLA 4HB4A 5MGNA 3FWKA 4ESEA 2IBMA 3V2GA 2JG3A 4R31A 4BUJA 2H5LA 5ECWA 4ETNA 1R10A 2HSWA 4P31A 3D8RA 3AVYA 3M6IA 4QVGA 1S9DA 3REQB 2QSUA 2W2MA 4AF7A 1K27A 1NVGA 1U7HA 3TX2A 3AEKA 3WGZA 2B9VA 3HJBA 2NTYC 1L9XA 2WIBA 3QE9Y 2Q5HA 4EHHA 1IZ7A 1N6IA 3NKLA 3QLUC 3QUSA 4QIHA 2BMFA 5LFAA 4U2CA 1KE2A 3TW6A 1A9SA 1VIDA 4JHLA 2IEBA 2BKUA 2P91A 4Y2PA 4DXDA 4MW9A 5EJAA 1XHEA 1AE1A 4LYGA 3CLSC 3MA0A 5I9IA 3EPPA 1AMOA 2XYPA 3LFUA 3R5JA 3THXA 2JJQA 2AHRA 3UFXA 1T2UA 3NAZA 1GSAA 3HM2A 5EMLA 3H5TA 2PRKA 4S2EA 1AH2A 3TIGA 4P4UA 1XCGB 2X8BA 1HG1A 2ZB7A 3PNVA 1I24A 2XUFA 3EBLA 5CUQA 1YJBA 3JZDA 5D5PA 4TYWA 3OZIA 1PWXA 1U0RA 3L02A 4HDSB 4YR7A 3NEJA 4X6XA 2LTAA 4IDPA 4WVLA 3SK0A 4OL0A 2EBWA 4CG2A 1MORA 4XQEA 421PA 4OFXA 1DQZA 5A7FA 4U0KA 5EYPB 3C43A 3ZV5A 1Z39A 4RLFA 3DOOA 5CG1A 3GCDA 5JH7F 3VPDA 3HB1A 3ZHBA 1XIVA 4D8UA 4V0LA 2A9VA 4PICA 4DUGA 1BA3A 2A57A 2JHFA 4ZAVA 1G19A 4TPKA 3D1LA 3QUQA 1VBFA 2IC5A 5EP1A 3WLQA 4LX0A 3EW9A 3FPLA 3G13A 3S44A 2D3WA 2KYRA 1KHHA 2WU3A 4KGZA 4BE7B 5CFZA 4LX8A 1U1IA 1KEKA 3P9KA 2B8NA 2ZBPA 3F47A 3F3KA 1P7VA 5THXA 1KP3A 1MCZA 3DEKA 1A9TA 1K5PA 2GBCA 4MHSA 4B46A 1I80A 2HDOA 4TQUS 1E4VA 1M2OB 5HCNA 2XI4A 3IV9A 3NYIA 3P5SA 3VAYA 4TMXA 4D98A 4ILKA 1E3QA 4DLPA 3GUVA 4AAYA 1G7CA 1P9LA 2OBYA 2V74B 4JY7A 2Y67A 3WGOA 1BMFA 4Y1RA 3G59A 2JFGA 2F4VB 4YUVA 5G0VA 1V3TA 2CE2X 5M04A 4INAA 1W30A 4QHYA 1X39A 3BJMA 2HNBA 1D2EA 3K9QO 2G9QA 1YZFA 2CYAA 3FMGA 2R6AA 4D9IA 2IYVA 3R8FA 1YQWA 2Q3FA 1YI1A 4OM7A 1I6LA 3VYVA 4UD6A 3U4GA 4YJ3F 3RUFA 3N6RA 5FWAA 1FTQA 4O2BF 4GM1A 2NLOA 2PWYA 4LHVA 1FBNA 2XRMA 3TTWA 3F78A 4BGDA 2BYTA 3A58B 4HLCA 1GXSA 4MUKA 4B4WA 1V35A 1CY2A 4CKZA 4Z8XA 1JILA 4ZI7A 3A28A 5LZ7A 3FAZA 2H4WA 3NT5A 4EHAA 1OT5A 2EKPA 4ER5A 4FB5A 2XMRA 1LV8A 1EDBA 5J2UB 4DR7B 1G3IA 4DQLA 4IHAA 4KVGA 5KVSA 4DPKA 2B7CA 2NUPA 5DLYA 4EJSC 1A1VA 1E6MA 3E0QA 4JL8A 5CM9C 4YV7A 3OC6A 1QU3A 2VEDA 1LQ2A 2NO1A 3MRSA 2PHZA 4RK0A 4YNBA 5BWMA 2AQHA 4CE6A 3CO5A 1NIPA 4DBVO 4E14A 5IZCA 4KMSA 4BQSA 2COKA 2D0PB 2V5VA 1UIRA 2VNIA 3IULA 5CEJA 2QW1A 5AM5A 2DSNA 4AY4A 1B8UA 4W6ZA 5FBRB 3C5VA 3DEHA 4LQ4A 3TFWA 4AWBA 1LLDA 1O03A 1TKAA 1RHRA 2ZE6A 3PUJA 3B38A 3FMVA 4XGKA 1G8SA 2IOFK 3CUKA 2QN2A 4K88A 4O3FA 5ALUA 5FEUA 5JAOA 1MW9X 1J2YA 4D1YA 3H5RA 1I1NA 4M1YA 4MYUA 3B12A 3QKRA 2GM3A 3OO0A 4I3HA 3C5CA 3EVEA 1JI0A 3OLWA 4R8KA 4DV0B 1NC1A 3QFRA 3R23A 4ZRMA 4YJGA 1M1ZA 2C4WA 5LQMA 2QB5A 1TK9A 2HNAA 2R6FA 3MOIA 2F17A 3EGCA 3H17A 3ONVA 3TG8A 4JJ4A 3EBOA 4DUYB 1A76A 2ZR7A 4C76A 3O47A 4ZXFA 3PIIA 4OAPA 1T5BA 3I53A 4NMMA 1UDRA 1ZXBA 2QA5A 3D6HA 3H42B 3IBGA 4HDMB 1NHWA 3QG5A 1PSWA 1XG5A 2AN5A 1TQ6A 4G0XA 2EW8A 2W6QA 3UC9A 4DLTA 3ZDYB 4IV8A 4B6SA 4IJMA 4UUNA 3WNZA 2BMWA 4P58A 2EBUA 4AJ9A 3KKQA 4PGHA 4Q7JB 3RLFA 1MAUA 2HRQA 2IY8A 3R7BA 2CNOA 3WBJA 5IH3A 3VAZA 4B8WA 2REXB 2F2TA 3REOA 5D6OA 5KINB 4R7ZA 3UAOA 3MYRA 4R4JA 3Q10A 2GN0A 1Z2NX 2V4UA 1IZYA 5CGQB 3ZZ0A 3QP9A 4I5EA 2C0PA 3KFVA 2PXAA 4U00A 3VVMA 1YBMA 2ZIXB 1DWUA 2Q5LA 3BCUA 2P9HA 3MBOA 4IVPA 4JXKA 3ZTTA 2NU7A 3COPA 4OM8A 1VJ0A 4ME6A 1E6WA 1TCCA 1QHNA 2QVYX 1L3CA 2R8YA 4NECA 5C8VA 5JHHB 1YDFA 2DHDA 2IUSA 1PJBA 2WJYA 3FPCA 5EE3A 5LBUA 1RLMA 1S8FA 3WL7A 4E13A 3B36A 1F6BA 2MHCA 3HGMA 4EVIA 3RT1A 3CQ9A 1CUFA 2NO7A 2OO5C 1AKVA 1FP4B 2D1SA 3QWAA 4JH0A 1A27A 4E30A 1GRRA 1GSHA 1WCXA 1LDGA 1QGOA 4JJEA 2ERYA 1NBOA 3G5TA 2G88A 3AVQA 4FWBA 5E2BA 5J9FA 2CVHA 3CF6R 3F7TA 4PF1A 3UW3A 1AMUA 1M73E 1VA5A 2MJLA 1F2UB 2HQBA 2JLRA 3DR3A 4P53A 4KQ9A 2AMJA 2ZUBA 3I39X 1EWTA 1F3LA 1D4FA 2CNLA 1PWYE 3OPNA 4UEJA 3AF5A 1XU4A 4RV4A 4QYTA 5K4AA 3T94A 3LSYA 3HKEB 3U49A 5B12A 1TLFA 1YV9A 3VC2A 3LV8A 4GP6A 4H7EA 4UVEA 2V0CA 1CVLA 1VKNA 3TZEA 4TVSA 2WF8A 4LSWA 1QV6A 4CIWA 1EZZA 1TF7A 4K05A 4PNHA 3I1IA 3FF4A 5D3ZA 4F11A 4AY2A 1B23P 2ERXA 1UWKA 2W2LA 4Q01A 3R8XA 4WOJA 4QT4A 4FXPA 3VDQA 4KQ6A 5HG0A 2AJLI 3M2PA 3VNBA 2RG1A 4L9SA 5E9WA 2P67A 4ZK6A 1US8B 4MS1B 1GG5A 4R1UA 4MP8A 2G6TA 3VH4A 3ASUA 3GMTA 4IIXA 4YECA 3AHFA 1B1AA 2QAJA 3RREA 5AW7A 2TMYA 4CV0A 2UYOA 2X40A 3KDSE 3SDSA 3LQYA 3B5IA 3HWSA 4MVJI 1BZYA 4L8FA 2ZOSA 1PTKA 5A4IS 2F43A 4JP3A 2ETVA 5DSZA 5B2FA 1ISRA 3QVJA 1RP1A 1N78A 2AOTB 1K3FA 1UBOS 4L8VA 3P94A 2PS3A 3K3PA 3AUJB 3OCUA 3SJ7A 3T06B 2C03A 5SV2A 1JIUA 2YWXA 2JIZA 2XB2A 1R3UA 2W2PA 1GTL1 2DE0X 3CSDA 2H7VA 4PGAA 1DS6A 4XGRA 4J9VA 1G9TA 2CC2A 2D13A 1DRVA 3L9XA 3R7WA 5E9JA 2FFRA 2J7KA 4YMHA 1L4EA 5KTYA 2FDRA 5IK2D 1REQB 4BFTA 5IAEA 1KGSA 3IIJA 5T64A 2ZBDA 4MWBA 2QLTA 4AZWA 1CF2O 1TO6A 1E9RA 3E2IA 4LRSB 1PEAA 1VYVA 2FUKA 3S2UA 4N3GA 2Q4EA 1W4CA 2W90A 2IHKA 2IOYA 4X92A 1ND6A 2A5LA 1WUTA 3WB1A 1O87A 1QOPB 2P2LA 3LPLA 4PO1A 4EUSA 2NYVA 4KPEC 2QRPA 5BWCA 4P8RA 1ORTA 2P68A 3EFOB 3AOGA 3LPNA 2XCLA 1TMYA 2I3GA 4TUYA 5ALKA 3VHLB 3EXHA 3MJFA 3AM1A 2VUIB 4X3CA 2E21A 4F1KA 3NHLA 3NQ41 4RQAA 3HWWA 1Z07A 2Z2ZA 3D4LA 2W0MA 3W6OA 2JGDB 3FNHA 4LRXA 4BN4A 1X86B 4RWZA 1T1JA 5I8WA 3OICA 4WLFA 4GGOA 4Q3BA 4HPWA 3P19A 4OB8A 3KDAA 3RS9A 1LPNA 4B7AA 5DT9A 2XUQA 5AUOB 4EFDA 4YXFA 5L45A 2PH1A 1PEKE 1E2DA 1HETA 2CMDA 2FPRA 1DO0A 3BH7A 4CMHA 3GRPA 3T3MB 2PZKA 3U4AA 1DQNA 4ZU1X 4HL6A 3SY8A 4A8HA 3A9RA 1CVIA 1UMKA 3OTQA 1N92A 2Z8YM 1EWYA 4HGRA 4P9NA 2C83A 1CVRA 4JS0A 1TM3E 4S05A 4RD6A 3OQOA 5T3UA 3V7YA 3BL8A 4HQOA 2QGFA 1Z6XA 2XUKA 4IKEA 4FGJA 4OBBA 1JA9A 4F45A 5BSWA 2WKSA 2XMCA 1OE0A 2RI0A 4I6JA 5EZQA 3AF6A 4G81A 3EXFB 3BT7A 2ZYRA 1PYDA 1E7MA 4EB6B 1L1EA 2ZSFA 1DBWA 3JQEA 4IX1A 3AFHA 3KOUA 4X63A 4OX9Y 3U7HB 4ITRC 4JJ7A 2WWVD 2C29D 1Q0UA 4F4HA 3ZD9A 1U3GA 2QLJA 5C81A 3MJTA 4ITUA 1BTOA 2ZYVX 4M1OA 1TL7C 3KJHA 3QWFA 4U7HA 2PANA 4MYSA 3Q1KA 3NPMA 1FDSA 1BROA 4HC4A 3ZI7A 1E99A 2FA9A 2Q3HA 2YNMA 4FNMA 4KE9A 5JD4A 4XIIA 1YF3A 3A1DA 5AH0A 2VUSA 2X0FA 5IKXA 3AC0A 4D44A 3E9YA 4XX1A 1SCNE 5GTDA 5BQ5A 4MW7A 3DJFA 3K4QA 2O59A 2V7QA 3PJDA 4A6EA 5D85A 1L2TA 1H8ED 4KQCA 2UVDA 1YL5A 1CW2B 1SB8A 2Z43A 2P9JA 3F4LA 3T7JA 2JDIA 2Q07A 2W2XA 3A11A 3HSYA 5DBFA 5M5BA 2WTXA 4LDAA 1VCOA 5B7QA 3RH0A 3UJ8A 1KYYA 3BB3A 1CNFA 4A4DA 4LFCB 2CD7A 3DDZX 3QF4B 4XR4A 4EGQA 4BPRA 2Z56A 2XX3A 4BOYA 1G55A 1M8JA 3I9LA 2ZAGA 5JMWA 3CLTC 1JHAA 3E61A 3AHHA 2PUJA 1YASA 4PYJA 1KC1A 1SQSA 2ES4A 3IP9A 5DTIA 3C98A 5GQSA 1G42A 1V1MB 2DFLA 2X4DA 1X1TA 4FMDF 4I4IA 4MKHA 1U31A 3EOAI 4J2TA 4LOHA 3LP8A 2I5PO 4XQ0A 1DFIA 2E4VA 2R7LA 3N2KA 5AXAA 2A0FA 5U4QA 4GMGA 1MABA 2RGRA 4O4JA 3TMAA 4UHKA 2B8TA 2IXGA 4JVOA 2CFOA 2PQ2A 2Q5JA 4DLUA 4J7CA 4LJ7A 2QAIA 3H4MA 4XB1A 2JNWA 4YASA 3WWDA 1NPYA 2YH2A 2AW5A 1JTEA 3HFGA 3FTDA 1GPUA 3NX4A 3H1BA 4GC5A 3RASA 2H1CA 2AUMA 2JGNA 2PKQO 1SVSA 4YHBA 2FWAA 2FW9A 1IEWA 2RGBA 3E8XA 3H6KA 4F2PA 1NBIA 2BKXA 3K1JA 3QK7A 1HLGA 1N6KA 3SHFA 2FX2A 3NO4A 1R4ZA 3CPJB 4OBXA 2QTZA 2QV0A 1FPQA 4ZTZB 1J1UA 4ER0A 2WIKA 1BGWA 1Q1NA 4NAHA 3AR5A 1G8AA 1SC1A 2XDAA 2WSLA 1COZA 3MOSA 5SICE 3WMFA 4CMAA 1ADGA 3K2QA 4FYHA 2SNIE 5CFQA 3NHPA 4JSRA 4MQLA 2BJVA 1ICEA 4MS3A 3LXMA 2DPXA 1E1KA 5K3FB 3T61A 1R0BA 2IDMA 1M2NA 1MO4A 1TUGA 4OQZA 3PXXA 2I6UA 4REOA 1R12A 3SJUA 4UW9A 4N41A 4LJSA 4DE5A 3W5IA 3OD1A 4DMGA 4JQSA 4NEHB 5B1IA 1S6YA 3CZ4A 1HURA 3AKDA 2REBA 1DWOA 5KTPA 1OYOA 2ZJ6A 3JYLA 1S2GA 4LMPA 1N2GA 3M8KA 1SKQA 1V41E 1W2HA 2FW8A 4M7RA 1QKKA 4REQA 4RBNA 3COWA 3HP4A 1KHTA 1L1RA 1OYYA 1HUQA 3BB4A 2ZROA 3HKDB 3IHWA 1WV1A 3Q8XB 1SK9A 5IBRA 3V7UA 4BDSA 3R74A 3OCJA 2WIAA 2JFUA 3PQEA 1AGPA 1UKVY 1V39A 3BTOA 2OHVA 1JHPA 4H4DA 3HDQA 4FGKA 4E11A 3FVVA 2VHQA 3K32A 1T2NA 3O91A 1YH3A 4HQ6A 4BVAA 4BBJA 4I5GA 1BDIA 4HNHA 5FL3A 4OHYA 2Q28A 4GF5A 3TJZA 3P2IA 3EWSA 3ZDRA 3RUIA 5BYAA 3BYZA 4Y6RA 1PEDA 5T4BA 1X8XA 2VQ6A 1D0VA 4NFHA 1HDCA 3TQCA 2UVQA 4EYKA 1L0BA 1HNXB 1LDYA 6CHYA 4AYWA 5FUMA 1RQPA 2VXBA 3L6DA 1QH8B 2EKBA 2X42A 2ZE8A 1JUDA 3I5UA 4QICA 3C16C 5AKZA 3LUPA 2VJYA 3HFRA 4BQPA 2CLEB 1P7PA 3U2QA 4LWOA 1PFVA 1Z5GA 1ADBA 4GWGA 2K87A 2RH9B 2QRHA 4DM7A 2VDRB 4O33A 5E7JA 1W88B 4AN4A 1RRGA 3OZRA 2K5UA 1YBFA 2NU9A 3Q4GA 4IIYA 4MROA 3QWIA 4C89A 5K6AA 3TCNA 1FNMA 1P77A 5JDIA 1R5JA 2J9GA 2EHJA 2QZ4A 4QUKA 3HDYA 1E9SA 3BFXA 4EI7A 1QIMA 2BZSA 3GHHA 4XDZA 1P18A 3UA4A 4BV3A 1E6CA 1LDEA 2OEPA 2P75A 2C92A 2JLBA 3OE5A 4XJXA 2JJ1D 3L8YA 4FGUA 1U5BB 4OGLA 2QTGA 1SD5A 1IJEA 2H2GA 3SXJA 3ZGOA 3KPUA 2PUVA 4MCAA 3FCOA 3GVIA 5GM2A 3IUMA 4XB2A 2B99A 1I9GA 3GJ8A 4JNCA 5CLIA 4XOUA 2IQIA 3UAVA 2R8PA 1A2KC 1EVJA 3ESXA 3H3XA 3L4BA 3H0CA 2OXIA 3WG9A 2A35A 2ZW9A 1ULTA 2B3TA 2XZOA 3RGGA 5TMPA 4IKOA 1X74A 1VXRA 1USKA 3H2IA 4FSDA 3UXEA 3BGVA 3N7TA 4MKIA 1BHSA 1JXAA 1RAFA 1AHIA 4PZ9A 4YV1A 1KMHB 2RGWA 1P1BA 2VYQA 1V5WA 2YX1A 4L51A 5B3AA 2QGNA 4TUYF 3TIFA 1ABEA 3NTRA 1BEEA 4MINA 2N1MA 3QMMA 4CCSA 2QE7D 1Z06A 4F92B 4GDFA 3RKUA 4INPA 2Q2OA 2VL7A 4J07A 2GEDA 1JIVA 4B9EA 3I42A 1QX4A 1YMUA 2JC3A 1DBPA 2CLOB 2IGBA 5I9TA 1TFUA 3W2EA 4RV9A 2DBYA 2ZYIA 4DANA 2JLYA 2H29A 1UODA 4JI7B 1W94A 1ZRHA 2Z30A 3CSUA 2FZLA 3DTVB 4TQAA 1CJVC 3WX0A 2ODNA 4RLHA 2LP4Y 4J49A 3O74A 1F4VA 2CNNA 4KXYA 3P20A 1GGVA 3AP2A 2ECOA 2A1UB 1N8TA 4KQGA 4RVNA 3WY9A 1IN1A 4OQQA 4W8HA 2ORIA 4LWZA 1LGYA 2IKSA 4W5RA 3WKCA 1D2HA 5HM6A 1N3LA 1Q16A 4FQ8A 2HYDA 3GWGA 2DJ5A 4I8XA 3A1CA 5AKIA 4GC9A 1KFBB 1XDDA 5EUCA 3SSNA 3FTEA 4RDXA 2PG3A 1O9GA 2IEGA 1OJLA 2FRXA 1JU3A 3ZE7A 4RZXA 4V0NA 3UOAB 3JVIA 4D82A 4MW2A 4GRAA 4CEHB 4MKXA 2PXCA 2XVZA 4GP9A 3ROMA 4OLAA 1N5OX 1DB3A 3D5TA 2DFKB 1W96A 5F78A 2Z3WA 4IMRA 1OH6A 2HLPA 2Z2XA 3TZBA 5DHUA 3F2VA 1T25A 3ZG6A 2IX9A 1Y8ZA 4Z3KA 4KN6A 1SB9A 3FCCA 3Q7SA 4KQIA 4JCCA 3HXQA 4D3YA 2I66A 3BIXA 3GD5A 3RS7A 4GOXA 3RFVA 2BM9A 2N42A 1H2BA 4HNTA 1O54A 3PEYA 2QN3A 3FZNA 3NXKA 3HQ4O 3VU9A 2EJTA 4MQ5A 1N6RA 7MHTA 2QORA 1OAOC 2X8JA 3CG0A 1RRMA 4V39A 5C3MA 1UKBA 1O6ZA 1PRYA 2FW1A 3AF0A 1MAWA 1L5OA 3OWXA