5IVPA

Crystal structure of the peptidyl-trna hydrolase from vibrio cholerae in the c121 space group at ph 6.5
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
196
structure length
195
Chain Sequence
VSQPIKLLVGLANPGPEYAKTRHNAGAWVVEELARIHNVTLKNEPKFFGLTGRLLINSQELRVLIPTTFMNLSGKAIAALANFYQIKPEEIMVAHDELDLPPGVAKFKQGGGHGGHNGLKDTISKLGNNKEFYRLRLGIGHPGHKDKVAGYVLGKAPAKEQELDAAVDESVRCLEILMKDGLTKAQNRLHTFKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title Crystal structure of the Peptidyl-tRNA hydrolase from Vibrio cholerae in the C121 space group at pH 6.5
rcsb
source organism Vibrio cholerae o1 biovar el tor str. n16961
molecule tags Hydrolase
total genus 64
structure length 195
sequence length 196
chains with identical sequence B
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2016-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 5ivpA00
2MJLA 3TD2A 4OLJA 4JX9A 4ZXPA 3P2JA 3TCKA 1RYMA 1RYBA 2Z2KA 5EKTA 4P7BA 3OFVA 3TD6A 3V2IA 4YLYA 4JC4A 4ERXA 4FOPA 3TCNA 5IVPA 2PTHA 3KK0A 3NEAA 2Z2JA 4IKOA 4QT4A 2JRCA 1RYNA 4FOTA 4JWKA 4FNOA 2NAFA 5IKEA 4JY7A 2Z2IA 4QAJA 2LGJA 5IMBA 4QD3A 4Z86A 5B6JA 4DJJA 4HOYA 3VJRA 4LWQA 3KJZA 4QBKA 4FYJA 4DHWA
chains in the Genus database with same CATH superfamily
3MMSA 3I2KA 3FWPA 4GXNA 1KBQA 1QK4A 1TVKB 4PX3A 3DXZA 2HW8A 3RUIA 5EIBD 1NHGA 4DREA 5J3JA 4OHMA 1RWPA 4Y8VA 1D1QA 4YHBA 3A8TA 3QNUA 1FDIA 5E7IA 1DCMA 1Z7YA 2WE7A 2Y3IA 3RS0A 1Y0BA 1RYNA 1DIGA 1G60A 2JAPA 4DQ0A 2F9FA 2FZVA 4GUDA 1UT6A 5YASA 2ZIUB 4DWOA 4EPTA 1Z63A 4WXYB 3B9PA 3QK7A 3LQFA 1CRZA 4FONA 3D1LA 1OI4A 2Y9MB 5AJZA 4EY3A 2J5BA 4EJSB 2YOHA 4B76A 5C7OO 5D7NA 4TTIA 3HBFA 1RJGA 2Y66A 1DC6A 3GJTA 1VSBA 3QVLA 3TCKA 4BB6A 4DLRA 5JVDB 4EI7A 3VHLB 1FBNA 4DMFA 3DDNA 3TOSA 4QBGB 1ZG3A 3V1YA 4MCHA 1F9EA 2FYTA 4PTLA 3U49A 1Z37A 3H2ZA 2X2EA 2EQ5A 5J4LA 3QOWA 5I51A 3ORSA 1SKQA 2PR7A 3GLKA 4R54A 1XA4A 2JA2A 4HPWA 2RARA 3S68A 5M5BA 5IJ0B 1Z62A 4OQNA 3LC2O 4MUJA 3ZN2A 5K8VA 4CKZA 1KDVA 2GI4A 5E6SA 3WISA 1L5FA 4HUJA 2ZSKA 2CHUA 3HE3A 3IQWA 4KLCA 2QDKA 4CQJA 2ZAIA 2XYGA 3D2LA 1TEHA 5EEHA 3RBZA 3ZXIA 4F2GA 2BMDA 4IINA 1V8BA 1A8IA 2Q3LA 1S01A 2DKOA 3CKMA 3SQWA 2NU6B 3NIGB 5IN5A 4C0QC 3Q3VA 2OXFA 2I2WA 4ILKA 4CT0A 3QBDA 3AV3A 3ZWXA 4DR5B 1TC2A 4DV5B 4OKNA 1Z3CA 4IOKA 4TZKA 1OBFO 1FTYA 4E07A 3H04A 1ZZEA 2Q6VA 4RD3A 4H7FA 4YLGA 5A71A 4QBTA 2ZM5A 5H1YA 2XMRA 1PT8A 1VE7A 3NVDA 1ZNQO 1G2IA 1QGUA 3O1HB 1PR6A 1NM5C 5KKAA 4ZAYA 3ZWMA 5BN5A 3THYB 2WSBA 3ZU4A 3AESB 3OLZA 2RG1A 3VJKA 2HA5A 3CWCA 5GINE 2PFGA 4BFLA 3AOEC 2XKKA 4NOJA 5FWNA 1ZOOA 4NH4A 1VCOA 3HYCA 5BSVA 4YJFB 3EXFB 5F77A 1A9SA 1E0JA 4MUXA 4WESB 3O74A 4Y2JA 1ZEMA 2FUCA 1CERA 4MV8A 2HN9A 3L7KA 4WZAA 4WRRA 3RIYA 4D5GA 5DLYA 2E49A 3V32A 2QNRA 1CY4A 2ZVJA 3ILSA 2UKDA 1KI4A 2PRZA 2FF7A 3BILA 4N6GA 1QIGA 5FTNA 2OZLA 4OBXA 4ZPXA 1A9TA 4UREA 2X4GA 3E58A 3RIMA 5A62A 5HKBA 1HOTA 3W90A 1CUJA 1YGPA 4ZV7A 3CONA 2J9YB 4UATA 2I66A 2RGAA 2UVPA 3GGDA 2Y9PB 4OLHA 3EGWA 1V1MB 1BJKA 1DWOA 1XT6A 2F64A 2ZBUA 3AETA 3P0EA 2A0FA 1YBFA 4V0KA 4D96A 4AY6A 1ZHOA 3HZOA 1EJBA 3KLOA 2OPBA 1QHFA 1JHUA 1IYZA 3L41A 2F3TA 3U60B 4P54A 1ZCFA 1XIVA 2O06A 1AGPA 3NORA 1S0UA 2EEPA 3DLAA 4OHWA 1B0PA 2BHLA 3BCSA 3C3YA 1XTSA 3DT8A 3IPAA 3Q7TA 1KDOA 5TDHA 1KI6B 4KMOA 1I1OA 1P7ZA 3M1YA 1Y8QB 3HI4A 2FRXA 1AN9A 4GU5A 4BMVA 3GLGE 2QVLA 4TXMA 4BNXA 1YC5A 4FZVA 2Z56A 4NNOA 1CYEA 4Z51A 2MMCA 4YCCA 4ISBA 1DV2A 4ZOAA 3WTBA 2VPIA 3DVSX 1USVA 1XCLA 3N70A 4HX5A 1CR4A 1EXNA 1RT9A 4UBLA 4A7PA 5IH7A 1E2IA 5MFZA 2IHVA 1ZOIA 2Z2XA 5LQSA 3W8NA 2QAGB 2G40A 5AT1A 5BSEA 7GPBA 3T99A 5TNXA 2OHHA 4DJTA 1HDOA 2FOXA 4BNKA 4YRQA 1I9GA 3X3HA 4JXJA 1X2BA 3DZBA 1UKZA 3KL2A 5I8PA 1GDTA 3JWHA 4EJ2A 3GWZA 3H5AA 2M1ZA 2F9MA 4RXMA 4UUNA 4X85A 3QE3A 2X0DA 2AWNA 4BDTA 3KNZA 1ZITA 3WDSA 1GCUA 2FK7A 3WDMA 4TM7A 4TTVA 4FFPA 1O6BA 1NU6A 1ZIPA 2FSUA 4FM9A 2SKEA 4FDLA 4CLEA 1NMXA 1SXJE 1CJKC 3WQRA 1U4SA 3G13A 2P2GA 3UBMA 5KDLA 3WIBA 2D5CA 2BFCA 2JRLA 2YJ5A 5LA6B 3AQIA 3R20A 5I7VA 1V7CA 1A88A 1ELOA 4DDWA 5DM2A 4LOHA 2I3AA 4GE0A 1HL3A 1TA9A 1K7SN 1XGKA 1Z8HA 2GTIA 3FTCA 2W98A 4KIUA 1GU1A 2R7LA 4NE7A 3H65A 2B5OA 2H00A 2YZGA 1DAEA 1DRKA 3ECAA 1K7FB 4G1EB 1TQ4A 3E9QA 4JU9A 4KB5A 5TVKA 2V98A 2D1RA 4IW3B 4PFKA 3I28A 1GUDA 1NFFA 4QJ5A 1GPWB 4HKTA 4TX1A 2Q5LA 4MV3A 4UHKA 2PSEA 1BRTA 1P4AA 1HQCA 2QRUA 3L8ZA 3R9IA 5F2NA 1JE1A 4UM5A 2IDKA 2IY8A 2JGMA 2JNWA 4R8RA 3LZCA 4YJKA 3VKWA 3HYSA 1T3HA 2IP4A 3FDIA 4J3NA 3ZHUA 5BYAA 2QGNA 1YQDA 3E05A 1YAHA 5JRJA 5DIFA 2FSPA 1EM8A 1O08A 4G4IA 2L17A 4U5XA 1Q7RA 3MC1A 5HTKA 5BNFA 4EY8A 4LJSA 2CDNA 4WFKA 3BAZA 1U5AA 4GBMA 4B6PA 3QYPA 3WK7A 1K66A 2VRCD 2YYSA 3B8EA 4YRJA 2UYHA 1XVLA 4LZWA 5DCYA 4W4TA 3I42A 1OPRA 3CT4A 3DP7A 3AMVA 3OCZA 2IV7A 4EKIA 4P0PB 3ZVLA 1TZ2A 5BP7A 1Z0SA 4CGYA 3EW7A 4EW6A 3WAJA 1JHPA 2H7VA 4JQYA 1Z15A 3KSMA 4A0QA 3KQUA 4YDRA 3QFFA 1G5HA 1CULC 4RTPA 3VHXA 2BKUA 4LC1A 4X1YB 1WKCA 2CXNA 1UKAA 2HSDA 1F5NA 4RL6A 3NPMA 3RVSA 3I73A 4UM9D 1BWSA 4AS2A 1MH1A 2JANA 3PR2B 4JEUA 2JI8A 4FFOA 4DLLA 5BQXA 3PJEA 3PNQA 2M1XA 1JFTA 3DB2A 1OAOA 1YMQA 4YN3A 4L0CA 4R0MA 1ZD9A 1IB0A 2FPPB 2J7PD 3GJ3A 1I32A 3DXFA 3N53A 5EUQB 1JBQA 4DNFA 4Q24A 1G20A 2FE1A 5HKKD 2DXIA 4ABTA 4MS1B 1ANKA 3NO4A 4P36A 1J7KA 1MOZA 3W34A 1P2BA 2XCLA 4JUAA 3WRYC 1ADGA 5CW1A 1FNMA 2GBPA 1Z2EA 2GPWA 3C2QA 2FPGB 1SD1A 2HO5A 1JDVA 3OPXA 4MAAA 1BA2A 4BJ6A 4OMUA 1G5FA 3G5MA 4DG8A 2PUAA 1FU8A 4FFSA 5FA5A 1ZU5A 3H1PA 5C4GB 1VLMA 1F2UB 2GN0A 2QN6A 4DSAA 2C5EA 2ADMA 1HURA 1VL6A 1T25A 3L4BC 1ZH4A 4JT8A 4W8HA 5AUOB 2QI9F 2G1PA 4LZLA 3EUAA 5SZJA 1CD5A 1WA5A 1VYUA 2NV0A 3D3QA 4M99A 3C70A 2RBGA 4HWTA 1CNEA 4RGVA 2F8MA 4MUAA 1KY3A 3V6MA 2OB2A 2B4TO 3AM4A 4IR7A 4UTXA 4MPJA 4PLHA 2BGLA 1EIZA 2BSQA 4D25A 1ZONA 2QD2A 3N87A 3KS9A 4XJSA 3IE2A 2QUJA 1E64A 1C9MA 1FSGA 1SU8A 1W46A 3QSGA 4HN2A 1JXOA 3B5IA 3WLJA 2WNIA 3ZJ4A 3UAWA 2DQKA 3I5MA 1XFDA 1K4MA 3R4CA 1T2NA 5JAOA 3Q2IA 1TCUA 4R7TA 1BEEA 4TLAA 3W5CA 4GYKA 1ZW1A 3ED5A 4HYYA 3ZDFA 1VMIA 2CZCA 4D9CA 2QTTA 2A9FA 4DV3B 1XA0A 5E4YA 1IN1A 4Z7NB 4J0HA 4DXDA 3A6HA 1TLTA 2EKQA 1XZGA 3K8ZA 2IYOA 3EFOA 2IE8A 2XMDA 3HSYA 1C81A 2VJCA 1PKXA 5JS2A 1KJWA 2FZGA 4DC9A 5J5VA 5TF4A 3ELBA 5ENZA 3TECE 1KH3A 2CD7A 3F98A 1I6WA 5TMDA 5WRFA 2GEUA 4RA6B 2QOEA 2VAMA 4MIKA 1ZM4A 4XEUA 1YQWA 3HFRA 3OO0A 4G0ZA 3W2GA 4FW8A 1TM2A 1R5NA 1WV1A 4WVLA 2HUNA 4C3UA 1T2VA 5K4HA 4ND5A 1KC3A 1DXQA 5K0SA 4WH0A 3V9PA 1FL9A 2I4TA 2PJRA 1FMLA 4PC7A 1BX3A 4O1MA 3AEXA 4WVFA 2B5VA 5KYXA 1AQUA 2CYBA 1UBNA 3JQPA 4RVUA 5GIPE 1UBKS 1MQ8B 1LPPA 2QTZA 4Q1VA 2FLVA 1G3QA 2HTEA 1Z29A 2Z2YA 3L8HA 3O84A 1WDTA 5T5QA 3LYUA 1QRRA 3EIQA 3DBOB 4Y9UA 3E5MA 2OBNA 1GYRA 1P5HA 3I92A 1O89A 5K0LA 4DV7B 2I7DA 3T3EA 4EB0A 2YH2A 2E4ZA 4M86A 2JC3A 2PE5A 1KO7A 1PDVA 3CRZA 3F5MA 3WMFA 3LUDA 1JIKA 2AZ4A 4A9AA 4FOLA 2QTWB 4OFZA 2B30A 1WBDA 3U19A 4CN9A 1JHOA 2O5EA 1Z75A 1FP6A 4GLFA 1E6KA 4BS9A 1L5HA 1E1KA 1AGRA 1JKJA 4YFYA 4A0FA 4WY8A 4YXFA 4WMLA 1R6DA 3U48A 3RROA 4WZ6A 5EERA 1GNQA 2DKFA 4F6RB 1X80A 3P0IA 1TCAA 4QFDA 4NLLA 2R00C 4UXHA 3PHHA 2P6RA 4OAQA 2ADFA 2X14A 3M5DA 4JI1B 4Z4FA 4BGDA 3MS7A 1A2OA 2KWIA 4RGYA 4UHFA 3JQQA 1MKYA 2VAWA 4PZEA 1NVGA 3DYVA 2EG5A 4I1PA 4N7BA 4B73A 1Z5UA 5JXIA 1E9DA 5IHXA 3R8FA 4HQKA 1SELA 2I3GA 1T9HA 3Q7IA 2E18A 3M2TA 1QE5A 2V6FA 1H94A 3VSAA 1JSRA 1TK3A 3AP2A 5C32A 3FWZA 1VJ5A 3H9CA 1Z06A 2C4UA 1L6IA 2GCEA 3SXPA 1CDEA 3BCUA 4D43A 4G65A 4HAVA 3CZ5A 4M0UA 1DDOA 4O4HB 2OV2A 4N8EA 1L1RA 3S6JA 4WZAE 3UPTA 1Z5OA 2DBRA 3RO7A 3B78A 5MFPA 3D6JA 2H4XA 3QVGA 1ZCBA 1ABBA 1DG1G 3VKFA 1YR1A 4Q3AA 3UT5B 4D1YA 3GT0A 1HF3A 3C6QA 5BSMA 1MB2A 2EOAA 2WIJA 5D00A 3KZKA 5LP1A 4NCJA 1E2QA 4ZO6A 4K8RB 3ZZMA 1FYWA 3ZCVA 4PZ0A 1L1EA 1SVMA 2HFKA 4GP7A 3RS5A 2AZXA 3CO0S 1KEEB 2RH4A 2YXDA 1P4HA 3EGXA 4KDFA 4A8TA 2OQIA 1BN7A 2C4VA 2D7DA 1SUAA 4YDSA 3FG9A 3VRHA 1RE0A 5BVGA 4XIIA 1IVSA 1NWHA 2VK4A 3UW1A 1ZOPA 3W6ZA 2FQ1A 3SP1A 4KN6A 4WECA 4E32A 2XWJI 4MUHA 1K3TA 2A57A 4GM0A 3AGQA 3TW6A 2YC4C 4QPCA 1AKRA 3F5FA 2G4LA 1T8TA 3B1KA 1QIFA 1ORTA 2IK8A 1ZQ1A 2ZTVA 3L0DA 4RSGA 3UC9A 3D6TB 1ZM9A 3BICA 5CPBA 5HCNA 2R86A 3MMXA 4XUDA 5EWMA 4YUYA 1U11A 4I19A 1F6DA 2GVNA 4YC7A 1B1CA 1DAMA 2NV6A 4FPXA 4XA8A 1WVIA 3LCJA 1MGOA 3NBKA 4MUFA 3PS9A 1ADCA 1I9CA 4K03A 1OU0A 1O94A 5BQPA 4QUDA 1H4QA 3JAKB 4B45A 1L1FA 3R0ZA 1T1SA 4F4JA 1XD8A 4G9EA 1M1ZA 3A26A 2JFYA 2WD8A 1NUAA 4OXXA 1CLUA 2AHRA 5G3ZA 1P81A 4GT1A 5GONF 3TZKA 2REOA 3ZD9A 3PP8A 4E2ZA 1OB5A 1A7JA 1AUQA 3H5RA 4L50A 1RWXA 1ZN9A 2AQHA 4AURA 2A3NA 5HNKA 4LGVA 2Q6KA 1GZ4A 1IIBA 2C8KA 3AI1A 3C7TA 4HY3A 1PDWA 4KGVA 5DWVA 5IBQA 3T38A 1C41A 1QFSA 4CM7A 2A5YB 5DGCA 1QC5A 5DF1A 5IF9A 4OAOA 1PZEA 5DU2A 4F56A 4JUBA 4OG2A 1I7NA 2FMXA 5MF6A 1LJUA 1O97D 3DOUA 3ASYA 3GH1A 5L51A 1EWTA 1QK5A 4JI5B 2JKZA 2PPVA 4NKRA 3ZLJA 2XV1A 4QJIA 4TKMA 3F7NA 3CNBA 3TZCA 3JRNA 2YKGA 1OYOA 2V9PA 5CLQA 4F9FA 3OZEA 1XRNA 3DTVB 1C9JA 1YMUA 5GM2A 4Q34A 2MR6A 3G2OA 5JARA 4D81A 4P4NA 2EKLA 3Q8WA 3FPLA 1F0PA 2BEVB 1E0KA 1ETUA 4TVSA 4P4GA 1I4LD 3RHZA 4KXVA 4IUBS 4BPBA 3A9TA 2B0CA 2ZBDA 1BTOA 4ZCIA 3EIOA 1YZGA 3KQQA 4YWHA 421PA 3F67A 1O2DA 1Z17A 4LBVA 1MO4A 1FFHA 2FW7A 3AY3A 3G8AA 4J1SA 3TMKA 3NUZA 4BFZA 4BP1A 1HZZC 2QSYA 2XB9A 4K6HA 1NHWA 3E18A 3MTAA 4KR0A 2G5GX 1KHHA 4FYHA 2R47A 3WB1A 5HQTA 2ZXFA 2YJNA 2WSYB 3ZW7A 3AXTA 4YWJA 3FPKA 4KO8A 2FHPA 1KJJA 1J6UA 2GOYA 2YNMC 5CAEA 3NALA 3S2YA 1I6KA 4CM9D 2YZKA 2YXBA 4FEGA 5JUWA 2V1XA 3ZXSA 1ORRA 2X22A 5ARDA 4BOYA 3PNPA 1HQDA 2BW0A 3BD8A 4DWWA 5LQKA 4ER6A 2P4EA 1N5OX 3PYXA 1P0CA 1TQHA 3LH5A 1T15A 1EP3B 2LDXA 3IP8A 4KDEA 3SLGA 3GNLA 5HMMA 4CTNA 1PTJA 2Y67A 3AEKB 4JLJA 2GJKA 3B20A 4PRKA 5ADVA 1G6Q1 5AXDA 2C29D 1WUTA 5JNRA 1Z6PA 1O9BA 4ES6A 4GQAA 1QYVA 1PL0A 3ED1A 4QXQA 4X84A 2IDZA 4PRZA 5AI9A 5HE8A 3QOFA 1HZJA 1K5PA 1W9HA 1XZBA 3HZRA 1U7ZA 1RRPA 4IY1A 2BGNA 4WEOA 4M89A 5HBRA 1R12A 1FYXA 1V1RB 4TYMA 3ZIDA 1ESZA 2WMYA 4D8TA 5B1YA 1QOQB 3CH5A 3U3RA 5LB4A 4PCLA 4ED9A 3AUUA 4GSLA 3OCXA 4EHNA 2PNJA 1KMHB 1ZRSA 2D1SA 4EZIA 4IV8A 4E1AA 1AV7A 3C6YA 3NNSA 3HO1A 1EAMA 4CLXA 4RH3A 5DGHA 5EJGA 1JKIA 2HMWA 3AF0A 5FF9A 3PQDA 1VMDA 3LJKA 1MO3A 2GAAA 4RPJA 2GZAA 1KJ9A 3WGQA 1M0TA 2NVUB 1R5JA 3BC1A 1FDRA 3C3BA 3NHRA 1HEIA 1J0CA 3P52A 3ASVA 2EJUA 1PN3A 2BEUA 3PNKA 3T54A 4U2GA 2XF8A 3KUUA 4FR2A 4JL6A 1DL5A 1GN9A 1OBOA 4BVGA 3LDAA 1BAPA 1MR3F 4CQMA 2K4MA 2ODWA 3HDTA 4JXXA 2QN7A 5DW3A 1G291 3O8QB 1EI9A 1JZQA 3QEAZ 2GN2A 4ECAA 4ESHA 4IIJA 2FWNA 5CFQA 3ZI4A 5EIXA 3PUZA 5CEJA 1G66A 1VE6A 4JOCA 1AM4D 5EMJA 3DEJA 4OHZA 3ZV6A 1QZUA 2DFLA 4RC9A 5A0TA 1VI2A 2GBGA 3DZGA 4MK4A 2FFRA 5FOWA 2PS9A 1HA3A 2DWUA 5AHXA 5IZCC 3TBHA 2O14A 4NU6A 3NTRA 1XQ9A 4PZYA 4CIAA 4X6LA 1XZ8A 2ZT5A 4CLHA 3H2KA 4RPKA 3ANTA 4ZI2A 3MWFA 1E3WB 3RFFA 1MOSA 1BMTA 4Q3DA 2A6PA 1WTCA 3JARA 3N0TA 4MH0R 4R1TA 1O8CA 3E9MA 1C3EA 3PFGA 5ECGC 1KGDA 4RIGA 1ZN7A 5FNVA 1T5OA 3VYWA 3H16A 4QPZA 5LQRA 4ZGBA 4DR6B 4HDSA 2WB2A 5EGSA 1UM9A 1Y6ZA 2E5FA 4ON9A 4H7EA 3GI1A 1GKYA 3B5JA 4B3CA 3RB8A 2ZW9A 3RNLA 4BKMA 1VYHA 2C4WA 2O6LA 1NI5A 5ERXA 3JATB 3EGIA 1AV6A 3O91A 2YJTD 2C8LA 2WFLB 4EPVA 3KLNA 1EU1A 2PH5A 4G9BA 2FPRA 4I6EA 4MV0A 2IXEA 3BGWA 5JALA 5A3SA 3M4NA 1ZKMA 1VHJA 2RHHA 4G86A 4KBFA 4WV3A 4XX1A 2LKCA 2ZR0A 2QAJA 3YASA 1K88A 2B3DA 5TPZD 1MFPA 4JI0B 2VQDA 1GQFA 1ZMRA 2D2FA 2IODA 2XOXA 3C4JA 5DZSA 2X8JB 1KZ4A 4JLAA 2O0LA 1LKZA 2ORVA 4JP1A 3QFCA 4G0MA 5BURA 1LPSA 4GECA 3Q7SA 4GC9A 4N9QA 3GLFB 3A6FA 3ESAA 3GVIA 5EE0A 2WYWA 2LWIA 2IEDA 2OHIA 1D7AA 1KAOA 1UP4A 1NOJA 2VF8A 2XCUA 4B7XA 1QYDA 4PYNA 5CYOA 4OU5A 1T2DA 3N8HA 2X41A 1TNDA 1TAUA 2RH5A 2YIVX 4EYSA 3WTCA 2F7SA 2Q6LA 3ON5A 1JLKA 4UBNA 5B57C 2BV3A 4JGBA 4YMTA 1HLGA 4CG0A 1QONA 3LPAA 1PQYA 1RI5A 2WJZB 1OLUB 3HKEB 3P1JA 3W3AA 4DM3A 2EP5A 3OWOA 3GAFA 1WDLA 4XFKA 3W9BA 3HPRA 4UULA 4D9BA 2HA0A 2JZNA 1OXBB 4BLSA 5DHFA 3E1KA 1U8ZA 4WCFA 1M0WA 2GPSA 3CLTD 4IIDA 3AFOA 2FWPA 2VNSA 5D85A 1I0LA 5A2QA 4QYTA 1FCJA 1WEKA 4HWPA 3TR0A 3VR0A 2EBHX 2PSSA 3D64A 5I8ZA 1I30A 1H3FA 1YS6A 3F3SA 3G0CA 4J1NA 4QEZA 1KARA 4NV0A 2HF9A 2IZZA 2UVQA 2C9ZA 3AJ8A 4TL7A 3Q5EA 3GO4A 3HWRA 1E5QA 2BISA 1PJ8A 4W8OA 2ZS8A 1A76A 5BRNA 1I51A 1P60A 3MQFA 1E1CB 1O95C 4AAYA 1OYYA 3X1MA 4FFLA 4YK7A 2X13A 1BVYF 4TRMA 1M7GA 4YTEA 3QEBZ 3P9IA 3QQPA 1EJ0A 1O54A 2C5GA 3O82A 1FW6A 2D4HA 2OECA 5AWFC 4I9FA 4QXRA 4Y1RA 3FH0A 1P3Y1 2IA5A 2Z95A 1NVDA 3H3JA 3WKDA 4C4XA 3AHFA 1FQJA 1FY2A 1P3JA 1U0JA 1D3AA 1ENOA 2JIMA 2O23A 5IG2A 1KOFA 3VDXA 5HZGA 1V0JA 2G70A 2IH2A 3FMIA 4RF2A 2J0UA 1DQZA 4AQDA 2YZMA 3HKDA 3UT6A 2H0AA 4ARIA 1U3FA 4JLDA 3FPGA 3QMPA 4GXQA 2ILVA 4Y6GB 4V0OA 3LFHA 1V5WA 1M1NB 3SYLA 3BMXA 4L8FA 1FEZA 3JAWA 4MP3A 4DC0A 4DLXA 1A9XA 4NBLA 2KW5A 5J63A 4ERXA 1H5NA 2P6UA 2W6JA 3FCAA 4WJLA 1XNHA 4CR8A 4URVR 4KVGA 2K87A 4RPIA 1MNQA 4KFUA 3WKCA 3R6TA 4X1KA 3RF7A 1QG2A 2NAFA 2QZPA 1FDSA 4GMGA 2ZJ1A 4AJIA 2VH5R 1P9NA 1TIKA 2IY9A 3ICEA 3ZZUA 1E4OA 2XWSA 4M0KA 5CDYA 1QIEA 1WVGA 3D9QX 4JJKA 3OZAA 4XDZA 5CJPA 3B1XA 1W2WB 4GPD1 4S1NA 4BMOB 1G5RA 2GPJA 3WLRA 2IDJA 1HDIA 3ZG6A 3LE8A 1HRDA 3ZVKA 1QDUA 1ZGHA 2VXCA 1E59A 1JIQA 4KXFB 4TN5A 1AXRA 1FTSA 1FFGA 1ZM2A 2VJMA 4J90A 4R2XA 1IEXA 4NBRA 1RMTA 1VE3A 1XLVA 2YWRA 4MKIA 4TXJA 5LVAA 1K5HA 3EXEB 3ND6A 2ZT7A 4B4VA 3ICCA 2Z9BA 3HUDA 5KNLA 1NG9A 2ZBPA 2P9YA 1XZLA 3QXXA 1QP7A 4ZJYA 2ZWAA 4K0RA 3C3DA 4JQCA 4JI4B 2VF4X 3BTOA 3CWQA 5AIBA 3U4CA 1HLFA 4OFXA 3EEQA 3IEIA 3LGSA 1C9YA 2PWYA 4PN3A 1YB6A 3ESRA 2GEJA 4UNQA 1V4VA 5BY2A 4DV0B 1UKEA 3Q8MA 1OAAA 2A94A 1OZ0A 1R66A 3B5EA 4Q37A 1QCZA 2PKQP 1E94E 4XXHA 3PNVA 1GUYA 1N8SA 4L74A 4OXKA 2WPDD 1AKMA 2GM4A 2GHIA 3ADKA 3PGVA 2P4QA 1AKWA 1Q7TA 4MRMB 1BMFD 4RTMA 3N76A 5B1HA 4D42A 3NDRA 4C3VA 5ICEA 3CLUC 2AXPA 2WZBA 1P62B 1LC0A 2DLCX 5ALHA 4PSAA 3PFHA 2CFRA 1Y7LA 4ZO7A 2IUYA 1AURA 2BGTA 3O8NA 4JNKA 2FG7C 3NP9A 2WP8J 4L0DA 1CQPA 5JSQA 1UADA 2QZ4A 3GOQA 2HRDA 1WXEA 5AOCA 5B1SA 3MSCA 4DPKA 2DUMA 2I22A 4HTFA 3QRWA 1ONBA 4DILA 4UZEA 4XVHA 1GZHB 2BY4A 2W48A 2R5NA 4HX2A 2ZI6A 3GZNA 4MW1A 4KO1S 5CRIA 3KQLA 3GEDA 1PUXA 2GJAA 5B6IA 3IPXA 5LU9A 3AVTA 3QUTA 2DWQA 3HFSA 1RYHA 2G6TA 4MEJA 4BV3A 3ZDZB 3X1ZA 3L7JA 2O7RA 3URMA 5FADA 4LJ8A 2J30A 1V3UA 4K2AA 1NY5A 3KLPX 1XEFA 1P4GA 1VGRA 3WNZA 4ZZ2A 3CX7A 4ER7A 4P33A 1O4WA 3C5WP 1IBSA 5HOQA 4H60A 4OGWA 1DI0A 2JFBA 4R1PA 1LI7A 4JP2A 4Y2QA 1JMKC 1V96A 2IIPA 2QAIA 5KYVA 1SZDA 2I8AA 4R69A 4Q19A 5LZ5A 3A2LA 3TB6A 2WTBA 3ZE8A 5FWXA 3B3AA 4RMGA 2R0QC 4CBVA 2ZULA 3JW8A 3EDCA 4TMZA 3M6XA 4WXRA 1BQ4A 1X7YA 3VNSA 3UWDA 3ZD8A 1R6TA 5DTQA 1H42A 2LR0A 2IXGA 1CQJB 1OKKD 4G1FA 5IT0A 1EKXA 4WLNA 2I6FA 4GW3A 3TZQA 4WKBA 1DSSG 4CMJA 3O9VA 1MDBA 4H3SA 4U8HA 1M6EX 2I03A 2XD4A 5JJ5A 4WKCA 1A72A 4GICA 1MC8A 4LGYA 3HR7A 5C7LO 3UJ6A 5EZQA 2ZYSA 1UIMA 5ALMA 4R4JA 4OX9B 1DP4A 1NAHA 2AG1A 3MHPA 4HJXA 4UASA 2RJ3A 3V7WA 8GPBA 8ABPA 4JAVC 4GNKA 2O4UX 2C4TA 4G2TA 1E7WA 4LDQA 3JQEA 3KE8A 4QTYA 4LOKA 2CJYA 1ZBDA 2AB0A 3H9EO 6YASA 1QYXA 2ALJA 4OQYA 4P5PA 1AKTA 1Z5NA 1HFWA 2B20A 2QVBA 2PZGA 1LEHA 3F8SA 4MRSA 1D2MA 4EQ6B 1FFYA 1H8HD 2GAJA 1ZI6A 3IMFA 2OOKA 4XD7D 2H59A 2NU8A 2QD3A 3TYXA 4LJYA 1EUCB 3IRUA 3PL1A 4F96A 4YV7A 4NYMQ 2L82A 1KY2A 3FHJA 3CTMA 2Z2JA 4WZBB 3SY8A 1QFYA 4URYR 4CMHA 2IS1A 2XE4A 2Q9UA 3GRPA 4LHXA 2I6TA 4XAQA 5E9AA 5EHXA 3HCNA 1VP3A 3EGVA 1EX6A 4CV1A 3S1AA 1DC5A 4OHYA 3JPYA 3E7XA 5A4IS 4HDOB 1MN6A 4HDKA 2HUPA 2FP4B 3CR8A 4IZIA 2CBGA 3TM5A 4MARA 4C0AC 3A6PC 3FPAA 1E18A 2RIPA 3WP0A 1XQWA 1EK1A 2G1JA 4I1OA 1BA3A 1YBMA 2GDZA 3H5IA 2WU3A 1MP0A 4FU0A 4PLYA 5GZ6A 3UF0A 4A2CA 2W0SA 5EPOA 1Z4NA 2GHRA 2WMOB 5AI5A 3I04M 1DTWA 2B82A 1GTJ1 3RJ9A 1CT9A 4FYWA 5FHRA 1LZKA 1RC1A 3MMNA 2JGFA 2OA0A 4AN0A 1FNSA 4MYHA 4C6HA 3ENKA 2XOKA 4F7DA 3KKMA 4OMCA 4G63A 3G9XA 1YB7A 4YV1A 2TECE 1E6CA 4KQGA 5IC4A 4NH0A 1GTMA 2CHEA 3A4MA 4GPEA 3GMSA 4BGIA 3FYUB 1PJQA 3G2IA 4MUEA 1UZNA 4IS2A 4LTMA 1RHJA 2PQ6A 2CJXA 5GJVC 2A5LA 4ENPA 4FP9A 2DUNA 3PEVA 5FH9A 3CH7A 2P9FA 3A2MA 2HU7A 3CQ9A 1UPFA 3B53X 3AW8A 3GROA 2F43A 4ZI3A 1ZN8A 2OK8A 1RZ3A 2GN6A 2ZAYA 5FBHA 3B1YA 4YROA 3NXKA 3H83A 1AUPA 1TCCA 2ZPAA 4C89A 4CF4A 4PNHA 1JKMA 2G09A 2P9ZA 3IAHA 4HYEA 1GILA 1U2ZA 3Q87B 4LCBA 5A03A 1APBA 3N8GA 4FBLA 1J9EA 2LCQA 1XHLA 1NYQA 1Z0JA 2JI4A 1VLZA 2QM3A 4OH7A 1OFUX 4L9SA 2OD7A 3D0QA 5DI3A 3K70D 1E1QA 2WIKA 1CRLA 2ZB8A 5EXTA 1P31A 3HJNA 3M6UA 3L4KA 1E2LA 1UBJS 2Q27A 5P8WA 1C7EA 4GHWA 1NMEA 2BHTA 5F23A 2UZAA 3LPCA 3SK0A 1ZGBA 3EDOA 3PQ6A 1DIRA 1SD5A 2V3CC 4QPPA 2NX2A 3EX7C 5FPKA 3SBOA 1IXKA 3HEMA 4US2R 3JZAA 3L82B 4PR0A 2EAUA 4EVSA 3UGJA 1F48A 3SKYA 5KHAA 3D2CA 3IQGX 3ZY6A 3VNBA 1QPGA 3ZLVA 5HJ7A 3IP7A 4KVZA 5A7FA 3IDOA 5J1SB 2PKRA 3PQFA 1ZIYA 1JTVA 4URFA 4Z9BA 4QTUB 4DSTA 1NJ6A 4JZYA 1OWNA 2ARKA 4M9CA 3SPXA 1KMNA 2QRZA 1RAGA 4NC9A 1CFJA 3LCUA 5DLPA 5EY5B 3OT5A 1XU7A 2I1VB 3FTPA 1H2BA 4MI3A 2ZJ4A 4W9NC 1XMJA 1V2HE 4HOYA 4NBWA 1SKMA 2ZQ5A 1FNNA 1CZRA 3VC7A 2VP0A 3HNRA 3W4JA 2VYVD 4DT1B 5CXXA 2X7HA 2YVAA 3NCTA 4RBNA 2C3OA 1DBVO 4CT5A 3EQ7A 3CWZA 3MBKA 3NGMA 5HMLA 4YMUA 1QRDA 1I8TA 1WAMA 4RM3A 5B4VA 2QJOA 3PC6A 1JJFA 3UK1A 4BVJA 4ZOCA 1EFLA 4PM4A 1WOMA 3L07A 4LOIA 5E6UA 3K5WA 5F9MA 4N47A 3RW9A 3UA3A 1K4YA 3DHYA 4JR0A 4RVNA 3FSEA 4IQ4A 1N8KA 3OI7A 1U7TA 1ODLA 4B4DA 2FPOA 5KCZA 3NH6A 4YT4A 2EZ4A 3A6GA 1E7RA 3NX4A 4KI7A 4BQRA 1VG1A 3OOSA 4F45A 2ZYTX 4WOCA 3H2HA 1ML3A 3I9NA 4HNUA 3OOHA 2FPIB 2BMWA 4HH3C 2Z1NA 2HGZA 3MOIA 4G0YA 4MR9B 1J21A 4O08A 5AIAA 2ZZMA 1X7XB 3RKUA 1CU1A 5HUJA 8MHTA 1LPNA 3B6ZA 3SX4A 1EUZA 5LKRA 3KR0A 1Y48E 3A3OA 3HJFA 3V2HA 4HQFA 1SHZA 3FZEA 4C6SA 2NP7A 4TWBA 3RAPR 1YO6A 5AW5A 2FWRA 3I45A 3IR6A 3K6RA 1ZMXA 2UZ1A 3ZDQA 4EYQA 2WDPA 5IYZB 1GNLA 1KI9A 1XNGA 3FGOA 1UEIA 1FSPA 1GCAA 4ZVOA 4AKIA 3CX8A 3IODA 3LSTA 4MVJF 4O2BF 3EXG1 4R40A 4WBNB 2JRCA 3ORRA 3T3DA 4QSMA 2PZJA 3T1HB 1O77A 2GD0A 2JFOA 3PZBA 2FN8A 5F64A 2QMOA 4XOUA 5F1OA 5FB3A 3V8BA 9GPBA 1POXA 2PZLA 4MV6A 4DV6B 3BCHA 3V4LA 2CLLB 3M4YA 1BGWA 1M6VB 1OASA 2FX3A 4CZ2A 1P1RA 4FYPA 2A9OA 2INGX 2PXXA 4WX2B 5JBIA 4K9OA 1D2RA 4UU8A 3ENWA 2KYRA 4HJRA 5FP0A 1IAVA 4HHEA 4IDCA 3L43A 2Q7DA 1L5KA 3ZU6A 3VAZA 5CFZA 1ZD4A 4PRLA 3ESYA 1Z38A 3MT0A 1ZI9A 3RVMA 4UBOA 3T3IA 2VP4A 4N0PA 2O2DA 1JF8A 2P2DA 1H8ED 2PTHA 1SA0A 2Q5HA 3LUPA 4CQLB 2VDWB 2ZKIA 4NDAA 1YZYA 5JD5A 1XR3A 2YQ5A 3KJQA 4FCCA 3ZWQA 5CITA 1IHXA 3PQ3A 4EFKA 4R68A 3S2GA 1C1HA 1B73A 1V8DA 4R2WA 2X42A 1C1DB 3KFXA 4Z2AA 3OJOA 5EIBC 4CM8B 3MJDA 2DBVO 4M9UA 1W4BA 3MTIA 4ER3A 2C20A 2ZRNA 3HSSA 3AF3A 4FKMA 5EIHA 1P39A 3G9QA 4ND8A 1XNRB 3ZR4B 3K73O 4KXYA 2XDAA 1AT1A 2Q8QA 4KRFA 2BC9A 2XVYA 3GJ5A 3D2BA 4WZZA 3SEFA 1WRBA 1UC9A 5IUKC 3VR6A 5DYYA 4L8YA 1F60A 2HPAA 2IZOA 3JTMA 3WFIA 3CLHA 2YBEA 1LX7A 3PUYA 2AKYA 4TTJA 4XB1A 3OEHD 4UKDA 1G9SA 1DQYA 1Q0SA 3C3EA 4OHKA 4BLQA 1X1SA 3FLMA 4EUEA 5FLEX 4EW2A 3KLMX 1M2NA 1VL5A 4WW0A 1UMBA 5BWOA 2YWFA 3GJRA 3BD7A 3RSOA 1VKJA 4BO4A 2XNJA 3M4ZA 4C7VA 1OHHA 2BCEA 4R81A 5KJFA 4DSNA 2VOJA 2VWHA 4MAMA 3G2HA 2B1QA 3DC7A 2HDNB 4RAQA 5FOTA 2V03A 1AVTA 5ES4B 1DX4A 4ZAVA 4YMHA 2GZ2A 2J3DA 2FA9A 2X40A 3O4HA 2O7NA 1W96A 1BKSB 3PE4A 2WHPA 1MX5A 2WQZA 3HR8A 3M81A 5FOVA 3FYDA 3MN1A 2VYNA 1SJ9A 1SRRA 1YV9A 3I2JA 2JGAA 3KTAB 2JIZA 4UNNA 2QPTA 4AN1A 4CWAA 3UCFA 5IVDA 1QTIA 5CVCA 4PCAA 3WSVA 4PZCA 3FLAA 3NDIA 3K0BA 2QG4A 1BCSA 3QKTA 3EXIB 2YN2A 3FY4A 2WJHA 5B3AA 2SHKA 4FMCB 5IXYA 1GQSA 4PIPA 3L04A 5DWDA 4BYMA 4R84A 4Q1AA 3E3AA 3LRPA 5C37A 3I0ZA 4LRUA 2HF8A 2QRHA 5JE8A 1NI3A 1YCGA 1OC4A 4GWKA 4N6NA 3GDHA 5TXGA 3JR7A 1BO6A 3D8HA 4WI1A 2OO7A 5HS4A 1CFZA 4L4XA 3ZLUA 4Y2TA 2ZRPA 2J3JA 2FEAA 3BJMA 3UWMA 4LOLA 1AZTA 1MRNA 2HM7A 3DTTA 4UM7A 5F98A 1XDGA 1AO0A 2VRBA 3UHJA 3O8BA 2H9IA 5L7YA 2UUAB 1D2NA 1LH0A 1DNPA 3VPDA 1A2KC 3ZS8A 1P1FA 2O8CB 2BFPA 3ROMA 2KMLA 2PX2A 2SKCA 5IKPA 1E66A 2JI7A 3OWXA 4U00A 3T61A 3ZQKA 3SN6A 4PTZA 2W2KA 2C8VA 1Q3KA 1SC9A 3H0CA 3PXBA 4U2FA 4PG8A 2XVZA 4UEWA 1ACMA 2EJWA 5DGDA 1T1IA 3OHMA 1CETA 5C8YA 4D8XA 4UAGA 2OXEA 1P74A 4R9NA 1YB4A 3E27A 3PQ5A 4HH4A 1KSGA 2K7FA 3G6WA 3DLHA 1TFUA 1EDOA 1KIMA 3QLTA 1MRZA 4YP5A 3I58A 3I05A 4FEAA 3O0DA 1G1AA 4KZPA 3EC1A 3ADDA 4CMGA 3L7CA 2WJAA 3WR5A 3SKXA 3SYTA 2V97A 1T2UA 3O8RA 2BM9A 3ADOA 3DJYA 1UH5A 2XDQB 1J8DA 1JEQB 1OROA 3DQZA 3HXPA 4L95C 4LWQA 5DN9A 5AP9A 4IHJB 3DUWA 4QTZA 5ILGA 2W2QA 3IPCA 4WN9B 5BPHA 1FNDA 4ZAWA 4BLWA 1FUEA 4QUJA 4L5CA 3BL5A 2VJPA 4HGOA 3BQMB 2C92A 3HCOA 2CKDA 1X9GA 1I4TD 1T6ZA 3CLRD 1IU9A 1H69A 1YR3A 1AQLA 1WQ4A 3K1TA 4WKPA 1YONA 4YECA 1DOZA 3N07A 5ENVA 5KWEA 3E84A 4NZ9A 3VV3A 4Q3KA 4GL4A 2BEJA 3L8EA 2OHGA 1FP2A 1ZH8A 1SCUB 1I1NA 1WABA 1WO8A 2PFKA 3C97A 3K8OE 1KMMA 3VR5A 4PN7A 5B7QA 5ADHA 5BYKA 1U0RA 1KZYC 1UJBA 3IEXA 2WG0A 4DW8A 1H85A 3B36A 5JCJD 2NUTA 3HLTA 3I4FA 7AT1A 4CM1A 2VDPB 4I14A 4MKGA 4C29A 2UXCB 1SHKA 4Y2YA 1BG6A 4XCXA 1W2HA 4NSNA 3T12A 1L2TA 2IUSA 5G0TA 4ENRA 4OSOA 2QT9A 3SDBA 1JT2A 3IB6A 4EABA 2AXQA 1M73E 1MABA 4O1HA 4QHTA 1LD3A 4ETIA 3KUDA 4J0DA 1KYTA 1G64A 1IQUA 3MHTA 4C04A 2VK1A 4P4LA 1PGOA 4INZA 4RJJA 4ZO8A 3I5YA 1X1QA 1Y9JA 5KVCA 1F2TB 1YJBA 2FDRA 1P4RA 3PUXA 4JLSA 2GYUA 4JSYA 5CBPB 1KAEA 4S04A 4MRPA 1PE0A 2AOTA 2XA1A 2ZR7A 2WTNA 3P71T 2RBEA 4FNAA 4BNZA 3FPCA 4HB4A 3UYLA 3Q3EA 4KO4S 3NFYA 5CHEA 2RAVA 2IP2A 2YWXA 4LSGA 3LPNA 4EARA 1LNQA 1PZFA 3VBEA 3RYCA 1N2OA 3K4QA 1QGOA 3SZLA 4YMVA 3NHUA 1KYVA 1XTVA 3CPEA 1FTGA 1YT5A 3LLSA 2HHJA 2WV9A 4LYJA 3SEZA 4KUHA 4IEEA 1JYEA 3JQ9A 1NRXA 1WCIA 2VF7A 3DWGA 3FBTA 3TLGA 1NVKA 1PI3A 3KOYA 4LBYA 3LECA 4LE2A 2O50A 5DNEA 3HB5X 1ZX1A 1M9NA 2HU5A 3TJZA 3UWOA 1RPTA 1UZAA 1M5UA 1BH6A 3EASA 4GFDA 4A8JB 2POCA 4JITA 3QEJA 2SCUB 6PFKA 1LF5A 2IEAA 4ZRDA 1W6UA 1DKUA 5CTJA 4ZYLA 2WSSD 4O59O 1X1TA 3EMVA 5LP6C 3TQRA 5IKEA 3PPWA 1WNTA 5FFMA 4JYCA 2H7YA 2RHCA 4X1IA 2C03A 2NADA 1BX1A 3RABA 2C84A 3MVEA 3VKUA 3IBGA 4J29A 4JIMA 2DFVA 1GRVA 4PW0A 3L8FA 4AULA 3GJXC 1RTTA 4KBYA 4WE3A 3TPFA 4DLVA 1AA6A 1SEPA 3H0KA 4OTZA 3DBIA 1QYRA 4L7VA 4RV4A 1FU7A 1D6SA 4F2HA 2E9SA 2GZSA 2GEKA 2O1SA 2X2PA 4NZNA 3DZ8A 3RFXA 1G0NA 3TLEA 4BNHA 1SBQA 3FTQA 1GZSA 3WSWA 3G0GA 3GNQA 2FPUA 4HGRA 2GXSA 5A2GA 4CRWB 4TXHA 3EBLA 5AM3A 3R7FA 2JFNA 1NR7A 2WQ7A 4PZAA 1NJ2A 2XGGA 1HMPA 4RK7A 1W25A 4BVBA 2C4HA 2LGJA 4GGPA 4NCBA 3ET5A 2QL5A 5B1EA 4ZEVA 4I5GA 3E48A 2JFGA 1RVV1 1MRSA 3H0EA 3K0CC 5LCXA 5FUVA 1RACA 2R2AA 1H05A 3OP4A 3VZCA 3P27A 4YRRA 5JH7A 1Y5IA 2JLXA 1HGXA 1DV1A 2JDID 3EZNA 4JSRA 1EFCA 1UINA 4N7JA 5ECDA 4EPWA 2BMEA 1I4WA 3WBKA 5KZMB 2W2TA 3G82C 1Y1RA 1DIHA 1SBZA 1YRHA 1YC2A 1DJPA 2VP9A 2I1WA 4Q7JB 1MHTA 4CKCB 2NQ8A 4HXGA 4OL0A 4QECA 5K8UA 1J5EB 2Q3MA 3BCRA 1IQ0A 3DAHA 4IIGA 2RGEA 5ALTA 4RS4A 1XALA 1UKCA 4HWOA 3GUHA 4LF8B 1G55A 4OJQA 1A3CA 3B9RA 2FW8A 4Q82A 4H15A 3WB2A 4YAWA 4G5XA 4QYSA 1Y9EA 3L7YA 3IYLW 1R9NA 3U1BA 1Q0ZA 3NB0A 2Z5LA 4LZZA 1WX1A 4YQFA 2NP6A 1IK6A 5GOZA 2EYQA 4EUFA 3DL4A 2XXAB 2V7UA 4KQCA 1GGNA 2XVAA 3N1UA 1PJSA 3PSHA 4C7BA 1TA0A 3GQBA 3JU3A 4EO9A 1RQ2A 2GS9A 4HS9A 3HY6A 3PJGA 4AL4A 2C7VA 2HIHA 3Q8XB 4GP9A 1V9LA 1P3DA 3H1GA 1A98A 2PO5A 9LDBA 3K6JA 4YRFA 4R16A 3GN1A 3USZA 3OIUA 4BHTA 3AY7A 3A05A 1VCNA 2C5BA 6ABPA 1NVEA 4IO1A 3K0AA 1SXJD 2G9NA 1C9DB 4KXUA 1GTRA 2NYAA 2GEDA 3VC1A 1EK5A 3SVZA 4C06A 1YZLA 1Q0LA 2TMYA 2VPXA 3AI2A 3GRAA 1U8TA 3X1YA 1RLJA 4TV9A 2FDCA 1VCHA 1KVQA 2G9ZA 3CRQA 3UTCA 4DLWA 2Q7OE 2Q0HA 2WTMA 3GZJA 4CR7A 3QA3E 1TOAA 4L5IA 2H31A 3MRVA 4TRJA 5IM4A 4EY7A 1PV1A 2J07A 3INNA 3KZVA 3A9WA 4M1TA 3U1VA 5JRZA 4OX9Y 1ENPA 3ERCA 1DQPA 5AK4A 3EGDB 4ASUD 4R83A 4XPIA 2F1OA 1PKEA 1SBTA 1UZMA 4RZUA 1J1IA 5JD6A 3IDQA 3NIDB 3KUCA 4PC6A 2AYYA 5CVVA 4AO8A 2I55A 4OBBA 4S2UA 2BTQA 2P9JA 1Q1ZA 2RGWA 3BXGA 2WM2A 3KSRA 4HAUA 1SG9A 2Q3HA 3F7MA 1E4YA 2OZEA 3SQXA 1H9BA 3BXPA 3O1LA 3C1AA 4EUHA 4NAUA 2J4CA 4TS1A 4I55B 5K0CA 2FW6A 2EL9A 3P9YA 2O52A 1KY4A 3WA7A 2CUNA 4MS4B 1RJ9A 1GIAA 2W7TA 3EQ9A 4O02B 4Q16A 1L7EA 4R2IA 3DE2X 4AZVA 4ZQHA 1FC0A 1L4LA 4R0VA 1RYBA 4PU0A 2QX9A 2X1HA 1OBVA 1R5BA 1Z73A 3HXLA 1U8CB 3GGCA 2OSVA 4MTLA 2IE0A 1F4PA 1DWUA 3R5SA 5EINA 5JZSA 3L7IA 2J32A 2IUTA 4X44A 2FNAA 3V4OA 1HYEA 2YZNA 4N54A 3ELYA 4PVCA 1ISFA 1UOOA 2WUGA 4U7TB 4UU0A 3WQBA 5AVTA 2WF5A 1MEEA 2HHCA 3QNWA 1CVRA 2ID8A 2AJLI 5FL3A 1NW8A 3UENA 2QX8A 4O4IB 1EXVA 1KRWA 4CDRA 1N36B 5BV8A 1KHTA 1H0RA 2C3UA 2YMMA 3ENVA 3NU1A 1K5DA 3K96A 4OK6A 4QODA 4HNTA 3OQHA 4KZKA 5JWRA 2CDBA 2EDAA 4UMFA 1OIWA 1YDWA 1S4QA 2PT6A 4J6FA 3DFKA 3MGKA 4CM4B 2NXEA 1GUAA 2JKYA 4Q9LA 2WVGA 2AHOA 3R8CA 2JJ2D 5FLKA 1T5HX 3DHVA 1YXMA 1ZM7A 3LQ2A 4CT4B 1W88A 2SBTA 1R64A 2FZ4A 2HBYA 4TWJA 4UD6A 3H18A 2YN0A 3H5VA 4PNPA 4OGFA 2VSYA 3F90A 1EJ6A 2CUZA 2GSWA 3LUJA 4O0LA 4QICA 1AH2A 2A7QA 2ZYHA 1SIOA 3L5KA 3OD5A 3A1SA 1P61B 4QDKA 3ID6C 4ZVLA 1TYBE 1QU2A 13PKA 4GNRA 5AVOA 2IEGA 1WBJB 3WK8A 5B55A 3UANA 4L9RA 5F4ZA 1HK7A 4D79A 4KMRA 2WJVA 1T8PA 1DRVA 1UPAA 2PSHA 1TZBA 1WDKA 2R60A 2W2VA 3QUCA 4MQ6A 2OV1A 5I4IA 3HTXA 1QH8A 2AG6A 4PIVA 4C4TA 4RY0A 3AOGA 2IT1A 3R3JA 4PZLA 2FMFA 4MWCA 4DNXA 5AVQA 3RKRA 1IC6A 1E79D 5A4AA 5KYWB 3RLFA 3IAUA 2YN4A 3BH7A 3O7MA 3ONNA 4EVIA 5K05A 4BAZA 1JHYA 4XLLA 2AW5A 1HE3A 1OX5A 2Q3EA 3DVRX 3E35A 3JQAB 5AOVA 4DCPA 3UUWA 3KKNA 2PVSA 2X5NA 4FN5A 1P5ZB 3QOYA 1EUYA 2GRJA 2XX3A 3S2UA 1GM5A 5LOVF 5KX5A 4NOMA 1BFDA 3LWBA 1M34A 2UUCB 4CL8A 1M3SA 5FYQA 2V4MA 3PGLA 2R65A 1FYVA 1V1JA 3CXUA 4YAEA 4CLOB 3BXFA 5K8JB 1JIUA 5IJ9B 4A0HA 1DIBA 2A0YA 2H3HA 5ES3A 4K6OA 4P2GA 1CPYA 1CQIB 3KTOA 3PL5A 4OHCA 1ZVMA 2FR0A 2IBTA 2G67A 3EFEA 1E9AA 3ZY5A 4YR7A 2W58A 3NUQA 4DVGA 3PNYA 3THRA 1EFVB 1RPJA 1PZGA 2TS1A 2C4KA 2ZIAA 3CB4A 3FNRA 4EZEA 5C46F 2JLZA 3KOXA 5CB4A 1HNNA 2OGTA 1JI3A 3CEHA 1NBMA 4TTTS 4BKUA 4BNDB 2PLRA 3TUJC 4XTCS 4BFWA 1X1EA 3MK31 2RGYA 1JEYA 1H9CA 1U3CA 2DVMA 1NN5A 3U56A 2VXYA 1QVZA 3KC2A 4MPRA 1MCZA 2JD0A 3OM0A 3EVTA 3SZUA 4CI0B 1C3OA 2ONYA 1CUYA 2G8LA 2XNKA 3HA3A 1W94A 2XTNA 3TE6A 4JD5A 3WS7A 1C4KA 2O07A 3ZYZA 4DS3A 4OKIA 5I3ZA 4DANA 1DCTA 2GZHA 4NATA 1EHIA 1NI4B 1QQ7A 3RJ5A 4DAOA 3VPHA 4N0EA 3W7AA 1GPMA 1YWGO 2JIQA 2OVBA 4MYDA 3K9QO 2H1OA 3WK4A 3QLUC 3IIKA 3TUIC 4X8LA 1E2PA 1U7HA 1XZJA 2WMNB 1LTKA 1QG0A 2QRVA 2Z8XA 3BK7A 4XGIA 3K0FA 1N0VC 1P7PA 5BN3B 2O7VA 4QM6A 5LXTA 1JLLA 1K6EA 2V7WA 3MS2A 4NR0A 1S7CA 1U65A 3FUCA 3RYTC 1XZKA 1UBMS 3LGAA 1OA1A 3LSYA 3FMVA 3EFHA 1YS9A 1J23A 4OHPA 5L3SB 4GMHA 3RADC 2GAFA 4LNAA 2MSWA 5BMVB 1JAYA 1XWFA 2JA1A 1Q17A 2BGUA 2HI0A 4GIBA 4PWYA 4RL4A 3ZHVA 3ZQJA 5IU6A 4Z7OB 2JGIA 4AJ4A 1IRIA 1H2ZA 1LC3A 2ZRIA 3ZE1B 5JASA 4K9RA 4IVRA 4WKGA 1RW4A 1L4YA 1VJGA 2QNBA 3EDQA 2X4DA 1T34A 3H9JA 4O4LA 4RDIA 1U02A 3HVRA 4H7IA 1AKQA 1PK7A 4MO9A 3BFXA 4G26A 4YASA 5CYFA 3R3UA 3S8EA 4M9RA 3QHAA 4KR6A 1MW9X 5C3UA 5ITZB 3KHKA 3ZNPA 1MZVA 4E4TA 1UXGA 2HD4A 4EFDA 4M7WA 4MP6A 2F67A 3WGMA 2DBZA 1H5UA 4NENA 1PLKA 2MYUA 1GFSA 1Y7IA 1RM3A 4P83A 3F7TA 5E4JA 2XQJA 3OG9A 1RQRA 3QV2A 3MGBA 1NN0A 1P29A 3KT3A 1BWPA 4LY0A 4MLDA 2BKLA 1L7QA 3CF6R 4PBTA 1OOEA 1S3FA 4X0EA 4F1JA 4KITB 5K7SA 2A5GA 3G79A 1Y63A 1EXDA 3BWYA 1EWVA 5AHOA 5I9BA 1OX4A 2LV8A 3AFIA 3HS3A 5F2KA 5I7EA 5MN5A 1VDZA 2HRQA 5KYKA 4Q4AA 2O8FA 4UNSA 1TW2A 1F06A 2C07A 2NM0A 2NZVG 3B9QA 3OAAA 4GG1A 1UPUA 4RPHA 1XP8A 2OV6A 2D5LA 1P2UA 4DV4B 4QHYA 3CNHA 4CKEA 3D59A 4WT7A 4GZLA 3I0NA 4NTZA 4R1MA 3KOOA 4E2XA 1T5BA 1NLUA 3OKPA 4GC5A 4YALA 3GFSA 2OSBA 1DAGA 3BOSA 5G02A 5M34A 1XJWA 1NX6A 3TRJA 4DR3B 1GTVA 1U28A 3SSAA 3VZSA 2ATEA 3U0BA 2VNKA 1CDOA 3F0TA 1X1AA 3DMRA 1E2HA 3AERA 4RHTA 2IS2A 1SIBE 5DWQA 2HQSA 3KZMA 1BRMA 1LBEA 2V6MA 3IAXA 5M04A 3ZZNA 1EUDA 4HX9A 1F8GA 3T1VA 1US8B 1YOVB 2RB5A 4D7AA 4CFSA 2IYVA 1BHQ1 3PDCA 1W581 1XEXB 2QG6A 3MTEA 5IC5A 3E9ZA 2HJHA 3RUCA 3OQIA 1NNUA 4F0JA 3QUBA 4PSUA 3MMPA 3FFXA 1NVFA 4MI1A 4AWBA 4OHOA 4KR9A 1X7GA 1MB0A 4XPZA 4KNYA 2JGEA 4HC4A 2ZRFA 4Y9SA 3SVTA 1WULS 2JJYA 1ZDMA 1NATA 1ZUIA 1GWNA 1QK3A 3DJFA 1TZMA 1XEWX 1BCRA 1BHSA 2OK7A 1T0JB 1TJ4A 1R4MA 3A4LA 3KWMA 3QHQA 3AHHA 4NRDA 3VQTA 1V3QE 3DL2A 1J0DA 2H4WA 3ABSB 3PVZA 4JSTA 2ISCA 3RHTA 3ROFA 1XRLA 1W8IA 3F7OA 1OFGA 2JLCA 4HZGA 2F1HA 3EOBI 4LDAA 3CH4B 3M3HA 4ARZA 4CUJA 5I01A 3RWBA 2MIIA 2X2FA 3HYTA 3CUUA 3KOMA 1S8FA 3L49A 3M7IA 3HBLA 4TLEA 5ELMA 3GLFE 1M76A 4DLKA 2E82A 3KIPA 2AR7A 4AUNA 2C95A 4V38A 4G5OA 4YYEA 3CCFA 4DM7A 4UXIA 4FX2A 2XZLA 4I9UA 4B1FA 2BKEA 2FEKA 2ONKA 2X7XA 3KX2A 2SICE 3MUOA 2WG2A 1EEXB 5DX0A 1PD0A 2Q5CA 3QVWA 4MKHA 5HILA 3VSEA 4ND3A 3IIJA 4IDOA 1NKTA 1ZNWA 1QHHA 4CM3A 1WUYA 1JQEA 3TW4A 3FE2A 4NFYA 5CK5A 1TM7E 4YS6A 5JXHA 1U4OA 4PPYA 4Q21A 2WR8A 3REQA 4JU8A 5DCLA 1ST3A 3FWYA 3H1FA 2H2GA 2WJJA 1QR6A 3A1TA 5IJAA 3PC3A 4Z7JA 1TZKA 1AK2A 4UTRA 4JB8A 3BKWA 4UCQA 1M7BA 1IOLA 3BGIA 4KQWA 3NTOA 4MKFA 4UEKA 4KAXA 4KFTA 5J43A 1FRFS 3CLKA 3EMDA 3I52A 4UOQA 4KDCA 2N42A 1NBWB 4P38A 4C6TB 3LQQA 3D8BA 1KSJA 4KE9A 4QQ8A 4CIXA 4NY1A 4V3CA 4ZC8A 1V9SA 3OEYA 4RCVA 2LTAA 1U3UA 4WERA 1L7VC 3UG7A 3MYRA 5F78A 2FMHA 3EHEA 4AMVA 3GLUA 5ADUS 5H3LA 1Y5MA 3QU7A 3KKKA 1PCXA 1XPRA 2IBSA 3C43A 1JKXA 4MJXA 1KFCB 1E1RA 3TNDA 2YW2A 2Q7XA 4F8YA 2WAAA 1HOXA 3PQ7A 1PGQA 1M2VA 2GPTA 3FD8A 3HA2A 4D4GA 2PUBA 3F78A 5DE3A 3B51X 2XODA 1XWIA 1NXOA 1TU4A 1NV8A 4B0OA 3ZHSA 4I1VA 3HN2A 1JA0A 4XIYA 4BZPA 4E7PA 1RCUA 1K3UB 1UC4B 4YDQA 4Y2RA 3ZBUA 3D7RA 5DK6A 2GCNA 2VPQA 3CLTC 4PX2A 3ADBA 4FUQA 1JNXX 4B48A 3LBHA 4W9MC 1XPUA 1ZUNB 2QIPA 3FDZB 4K3VA 3W4KA 1SCBA 5FD8A 3CLSD 3EEFA 3QG1A 1CE8A 3R0JA 4RDCA 3O21A 1SG6A 1G7SA 2GD2A 1VRVA 3GMIA 1VCMA 3NVMB 3OEEA 2OY0A 3FR7A 2AE1A 3JVEA 3DXXA 4B3SB 4IKPA 3GA7A 1HT1E 1X7ZB 2ZYGA 3DE1X 5IJZA 4TMTA 2GRUA 2FMUA 1ULSA 2D5BA 4NIMA 3U37A 1UBEA 2Q0XA 3S2IA 2XQVA 3CFYA 2B37A 3U9LA 4BMCA 2GXAA 4ETWA 5FQOA 3ISJA 2ODTX 1CHNA 3ESZA 3ZQUA 3N2GA 4YEDA 3TSZA 3HGTA 3WLMA 4F1WA 2DU8A 1G3RA 1T5IA 4ZOLA 4KQHA 4YI5A 4BEBA 1CDZA 2QI9C 1O87A 1U5BA 5JXGA 2FAXA 3EK2A 4R7GA 4TV8F 2XWQA 3CN9A 2COUA 1L5WA 4MUMA 2IPAB 3AYXB 3RRZA 1R0BA 1Q22A 1R6VA 3SJAA 5TB5A 3CVYA 5DX8A 4BMYA 4D98A 2CK3A 2YWBA 5SICE 3BWDD 7ADHA 3G8CA 1VHWA 1U2PA 3E23A 1H0HA 1T2EA 4GEGA 4I5IA 3OPQA 3C45A 5DHRA 2AQKA 4HQ0A 1RLUA 3RWOA 2RHDA 3TKYA 1JLSA 1B3BA 1LSUA 1DO0A 1M34E 3DMYA 3MFQA 4PCVA 4KPFC 1VRWA 3RTAA 4B34A 1X14A 4BKRA 4BDSA 4BQSA 5FLYA 1WP4A 4F9TA 3TZ6A 5K8IA 4DWJA 2CL6X 5B37A 5AW8A 1V47A 1XLWA 2QTHA 3BMNA 3OPYI 5D3MB 1W2GA 4V3BA 1BX0A 2XI4A 2C7BA 4D9EA 1KQ3A 2W8BB 3MOSA 4GEKA 4RKYA 1YVPA 4JOBA 2PQ2A 5DSXA 3VR3A 4DR1B 3L0YA 4JLMA 1ND6A 4GZ5A 5I4KA 4IKOA 4A1FA 3GAMA 5KVAA 5JDIA 3QJYA 3GJYA 1L4UA 1T1RA 4KYIB 3RAFC 3DSRA 3NQ41 4B3JA 1MMFB 5KNBA 5KBYA 1JNYA 3C5CA 4Q7QA 3BB1A 1J8QA 3EBOA 1ABFA 1JWBB 4P3YA 3L6CA 1WHSB 3MBIA 3D7KA 4TSFA 1KDTA 1Z4PX 1WHTA 2P35A 5CK4A 3SC6A 5JVDF 3LUHA 5JPIA 1FRZA 3ISVA 3KALA 4E12A 3GRZA 1W0JA 1KXJA 3HJTA 3V2IA 3AI7A 4YUWA 3KOUA 4GKAA 2CLOB 4DC1A 1QWSA 4CI9A 2YQ4A 4NV3A 3E7DA 2RKBA 3ICOA 1RZUA 4MVJH 4RESA 2WI8A 3K0HA 2ZK7A 3F2IA 3K3PA 2QN3A 3MUNA 4XJTA 3EYAA 4IV0A 4D0GA 4L5AA 2RI0A 4REQA 1ADYA 1XJ0A 4WWHA 4Y2HA 3NWPA 4LOJA 2I34A 4PBRA 3AP1A 3OPYB 1L5GB 1PFYA 2VTBA 2XRYA 3RREA 3UFBA 4BNWA 3PDJA 2HAEA 3TQCA 5JLJA 3D4LA 1KFJB 1S2GA 1KMIY 3EF1A 1JUDA 2YMQA 5A6SB 2GZRA 4JQSA 1J70A 4LCJA 4ALLA 1B42A 1TYAE 2CVHA 4OQ4A 5EA2A 3WB0A 1D2GA 1NULA 2Z8YA 1GSHA 3ANLA 2VLBA 1F38A 3PHBE 4AJNA 2Q9CA 4C2AA 1RWMA 3ZBQA 1N0HA 3QKWA 4BQPA 4M2LA 3G5AA 5E95A 4RVDA 4BGVA 1OGYA 2R6CA 4E3WA 4B3TB 3ER6A 4HNAA 3UHFA 1K86A 4AG3A 3BSWA 4EHIA 1YD7A 2QUIA 2NACA 1MT3A 3HJBA 2BGJA 3VOTA 3JWGA 3STYA 2D2XA 3KQKA 1DIOB 1TM3E 4XRGA 1U0BB 1EDDA 3R5TA 2DHEA 1JFFB 1WIWA 1GVHA 2UYQA 3N2NA 4QUBA 4EO7A 1XDDA 1U2DC 1X39A 2WPNA 4E5KA 3I2YX 3URKA 2EGGA 3QM1A 2OFFA 1ZGGA 3EG5A 3RT7A 1XAHA 4YJ2B 4HAWA 5AUNB 2BGWA 4LZAA 2AXNA 1EE2A 4L8LA 2VDQB 2I33A 2J0EA 1NWCA 4KLZA 2ZRLA 3TLKA 3ZC3A 3IT1A 1U2EA 1SULA 5I7UA 4V03A 3WMEA 5BNWA 4HLUC 1UDBA 1V3VA 1N5IA 2A9QA 2O2CA 3TEJA 5FWDA 4U7HA 2AX3A 3SZRA 4F60A 1GAWA 4BCCA 4NV1A 5AW1A 2QORA 2CBXA 5F7XA 2W4MA 2H1FA 4ZDWA 1TD9A 3W1EA 2DCMA 1UBCA 1JDSA 1EWRA 3IUBA 4I7EA 5AVKA 5JXWA 5HF6A 5LYJB 3EZLA 3KR1A 4MR8B 4WZBE 3K70B 4DA8A 1Z7WA 4GOMD 1QQBA 2IHUA 3HLYA 1IXRC 5IAGA 3I4CA 1I14A 2B25A 2IUUA 4RTJA 1ZD1A 1EJ2A 3PFWO 1PJLA 4IDQA 2ERCA 4JBIA 1RC0A 5DVZA 4BNTA 2IU3A 1PJAA 4X54A 2JCGA 4G1BA 1X8KA 4G09A 3RV3A 1L7RA 2ONCA 4TXNA 4JI8B 1JA9A 4OK5A 3R7WB 1GAXA 1KYZA 3BBLA 4OHUA 2YX1A 2W6ID 5KC9A 1B93A 1LK7A 5KOYA 2OCKA 1Z4QA 3TOVA 4EA8A 2FCRA 3M6VA 3RUAA 4DDKA 2QNIA 3G0DA 3QYJA 1FMFA 4GOOD 3GFBA 1N9KA 2C42A 2PU7A 3MINA 4FS3A 4GI5A 4OQXA 3B8HA 3CH6A 3RT9A 5FKJA 2VYFA 2GPYA 1V11B 3EY4A 1P33A 1X1RA 2WF9A 2G17A 3NC0C 5C80A 2H2AA 5LDHA 3PDUA 4ACBA 5CLLA 5I6DA 4Z49A 5IHPA 5AK3A 3S2SA 1TKRA 3V55A 3R44A 3DLBA 2E87A 2QN1A 1RFLA 3DV0B 2XWPA 3P8ZA 3ZIAA 4AYTA 2I6QA 3KQVA 3UJNA 4G4JA 3ORHA 1S89A 3OCCA 3LL7A 2H51A 2FJPA 4ZCPA 4QAJA 2B2CA 3REFA 2BWJA 1UAGA 5KU1A 4MXDA 4N8SA 5LA6F 5C7IO 4RVSA 5JPDA 4Q3LA 3M89A 4W1SA 4F7WA 3TF5A 1H0SA 1NN3A 5G1PA 1Y34E 1EFHA 2J6IA 3K20A 3KB6A 1CRWG 1IB6A 4FCWA 4YP0A 5AW6A 2V5AA 2ZETA 1NNSA 1F9AA 4BQNA 3OZDA 2ZR8A 3CO5A 2ZSUA 4EA6A 4ZHQA 2B1RA 5E4FA 1N1MA 1NM5A 1T0IA 2ZGVA 3ST7A 1YS1X 1AZSC 5I45A 2ZUFA 2UZ3A 3N2LA 1IM8A 1WCYA 1ZINA 5B7PA 2XH8A 2PGJA 1NZFA 3AOEA 1YR6A 4L3VA 4PAMA 5CH3A 3RJZA 1N1GA 1LWNA 2I2AA 5BOVA 3LP5A 1P1BA 1LGYA 2AUNA 4MVWA 5BSFA 1ZISA 3C3MA 1NDQA 3I01A 2XUGA 1C8LA 3EDYA 2VHXA 4QG7A 3CPHA 1PBNA 2Z43A 3L7MA 4Z8YA 3V4ZA 4BY9E 3HDYA 4MVYA 4KTVE 5DXJA 1KTIA 4RHEA 2WIBA 4GVXA 3GD5A 2YFKA 1VHQA 2CXSA 5DBEX 1TU0A 1FMJA 3K70C 1M75A 3NWOA 4MJ3A 3Q7RA 1RM4A 3UKOA 4M38A 2A8YA 4QU8A 3PEEA 4J76A 1TM5E 5L7WA 5JRDS 3IBSA 1YBVA 1TW3A 1CS0B 1D4AA 3DVQX 4AZ0B 3AUKA 1M83A 1SCDA 1U2RA 3EUWA 3LX5A 4TWAA 5ALPA 2QRKA 3UOWA 3GLIB 2Z2IA 3AKZA 3KJGA 4AMUA 2ZDHA 4DBZA 1N6KA 1B2LA 4CMEC 3BZUA 3AUJB 3TUZC 2WY2D 2F3QA 4M54A 2YJGA 2FH5B 3R5HA 4RKFA 1GTSA 3KL4A 3IX7A 2Q5IA 2O8NA 2ZRMA 4J9UE 1WU7A 4KIWA 4ND4A 3RM3A 4ZODA 7REQA 3KWLA 4CKYA 4NXNB 4HK4A 4YMIA 3QFRA 2W4QA 3O3OB 5DLDA 2XCOA 1IPFA 5HKLA 4Q05A 3DKIA 4NOKA 1XCJA 5I5GA 4FW9A 1JR2A 1ZHFA 2QN9A 3N05A 3IT3A 3K8YA 3OJCA 2XLCA 3Q3GE 3FB4A 5JNWA 4HFJA 3SHQA 1M7HA 4EW1A 3K16A 2G25A 1T4CA 3B1ZA 3GJQA 3ZCRA 1VBNA 5GIOE 1VJ1A 3NFRA 4MSUA 2YHBA 4G67A 1TCVA 4PXYA 5BV2P 4HDRB 1N0IA 4J0JA 4MGKR 5L4SA 1KVSA 3EVAA 4JL8A 5DX1A 4YIKA 4DDHA 4AF8A 3WJ1A 2Q5FA 3OM1A 4CQMD 5E3IA 5F1PA 1GYQA 3A1DA 5F12A 3FFBA 5CX4A 3K94A 1D03A 1JHQA 2VDRB 3GGSA 1YRBA 1EUQA 2XMSA 2HV9A 5KTYA 3M6IA 2YY5A 3T6KA 4L07A 1T8RA 4B3GA 5DNUA 1ADBA 4OUDA 2NUAA 3AUAA 1AK1A 2XY4A 3AHJA 3KVYA 5A9SB 1J00A 3K6SA 3FGZA 3LBNA 3GEPA 4FB4A 2C7OA 2XA2A 3CF2A 4KRGA 5I7WA 2Q28A 3JSAA 3PKJA 4TQ9A 4UAJA 4Q4HB 4E21A 4KDRA 1AOXA 1FJHA 2R87A 1NW6A 2BJVA 2FXVA 2YMLA 3A1EA 4JJFA 1N5JA 5A4FS 4UPVA 3TQOA 2WWYA 1G3MA 2Y0BA 2XRMA 1L7BA 5IT5A 1H1TA 2HY7A 4QOEA 5FORA 2QXTA 3K72B 5IN4A 4C0SA 2H3EA 1DIAA 1WZEA 1Y1KE 2HREA 3EG9A 4RKQA 4QOSA 3ZLTA 5JFOA 5ALZA 1G17A 5IW8A 3A58B 2UXDB 2R6DA 3PKZA 3O8CA 4WADA 3EJWA 4C7XA 4E70A 4ZVRA 5EUBA 4RLHA 2VZ8A 3L06A 1R4AA 2VS1A 4HDAA 2WYHA 3NTUA 4ZYUA 5C7YA 5FO1A 4NBKA 4M1MA 2ZYAA 3FVWA 3S7ZA 4KLRA 3DQQA 1D4FA 2G77B 3L02A 4WFQA 3KTDA 3EB9A 1DXYA 4KUEA 4PS0A 1CS4C 1X15A 4QGAA 4EUNA 5EYPB 2ZIXA 3RE1A 4P4SA 4G1MB 1G5TA 5G0SA 1GXSB 2XSZA 4O2AA 3T5CA 1AXEA 1GTZA 1QKKA 2FEOA 3JX9A 2V9CA 4C07A 2I80A 4TQGA 4BZWA 3LT4A 3MW8A 1T8WA 4IO0A 4FJ1A 1WWKA 4NE2A 1QX3A 2IZ1A 2VPYA 4RAOA 5KHOC 3CX4A 3DPSA 3PGKA 5EZYA 3EZ6A 4ISCA 2JFUA 4LDRA 3SD7A 4GI1A 3DOFA 3WRYA 1E2KA 4AROA 5HTOA 3BX1A 3W3AD 2ANBA 2Q1YA 1CY8A 3H6GA 4PG6A 1IJKA 5CXSA 2SKDA 3TCNA 2B94A 3RFTA 3HRKA 1QBKC 4YJ3B 4B3IA 1Z6TA 3MQ4A 2G72A 4Z5XA 4Q12A 4WIAA 2C3MA 1I7QB 3E22B 4II2A 3E6AA 4J7CA 1E2GA 1T5TA 4ZVTA 2RCYA 3KYCB 3L4BA 3AEUA 4YJGA 3FUUA 5AH0A 1TEZA 1PT9A 3KSDO 1IOVA 4DJJA 3IR7A 2YIMA 4TVKA 4MJ7A 1LBSA 1UBLS 1UCFA 4QRDA 2AUMA 3QXJA 4O4HF 4HQRA 1DQSA 3ACBA 1QRUA 3W5JA 4QE3A 4KOEC 2O2JA 4XZ3A 5KQRA 3IRVA 2AG5A 3NAGA 4R3NA 4RVOA 1T1JA 2HK7A 3EVZA 5HQ3A 2L0XA 4L6IA 2CLIB 2PD6A 1PEKE 2MSEB 1HDYA 2ZVDA 3UK6A 2WKSA 3ETCA 2G5TA 2XCIA 3TZEA 4DJFC 2WM9B 1U0HC 2Z0MA 4HATA 1SUWA 1LLCA 1FS5A 3FW1A 3GUZA 1UWVA 1Y4ZA 2UVDA 3LD9A 8AT1A 2QZ9A 4RKWA 4WNAA 4G0VA 1U8XX 4YRDA 1MAUA 1TO2E 2PAFA 3QENA 3H5WA 1JECA 1FXWF 4NBUA 2JI6A 3JV7A 3T4XA 3VVBA 2P8JA 2R6ZA 3MJEA 3VYVA 3GVPA 2R7NA 4MW6A 1JR4A 2FSSA 4M7OA 1W9MA 1Z0IA 2AJ8A 3INYA 3QX8A 1OXKB 4MS3B 2Q5EA 2P1RA 1YRWA 3GJ0A 4INJA 5AKZA 4M6WA 2HYIC 4QDZA 3U44B 5E7JA 1OVGA 3WA6A 4F3YA 1NVMB 2ORIA 2OXCA 1O96A 3F71A 5HOEA 2VNHA 3IUEA 5AVRA 1SCAA 1HLPA 4W6ZA 4N39A 3NEYA 4ZEOA 1MF7A 1T36B 4Q1CA 3TOXA 4PGAA 5HR5A 1XVVA 1FXUA 1YVDA 4MWOA 4P3OA 4ZTUB 5JI2E 2ZPUA 4CIYA 1T9KA 1U3TA 3UAXA 2R62A 2YBDA 3H3XA 4WKNA 3DOCA 3HY3A 4TMVA 5EXEA 3O4GA 3W5IA 3ZHQA 4CG1A 2FEMA 3LA6A 4G6ZA 5CX1B 1MJNA 1DHRA 2PJZA 3CVJA 4ZD6A 4C4YA 1M5TA 1N6NA 4MQEB 1Q7GA 2I4RA 1BN6A 3DDZX 1PG0A 2ZFUA 3GNTA 2B9VA 1DJOA 4S05A 2C0PA 1M2FA 4LXHA 4HRVA 2D6FA 1GKUB 4PNZA 4UBKA 5DBIA 5ALKA 4FI3C 2X4IA 2ACVA 2BFOA 3Q0TA 1L4EA 3R9XA 1P77A 3JVDA 4QUAA 3ITEA 1E5TA 4QGFA 4XB6B 5DNWA 2EG9A 4RQBA 2OV8A 4DB2A 3HDVA 2V7XA 1I3MA 1EQAA 5F7ZA 3GXBA 1VJDA 4AUEA 2I1LA 3F9CA 1TTPB 4JCCA 1BXZA 3OF5A 2Z5FA 4KP7A 1TK9A 5DTEA 3CLRC 3A6DA 5LPNA 2CBZA 1H6AA 1SKAA 5JNLA 1VLJA 3TEMA 2FWIA 3VAAA 2ZDQA 3LHSA 2R00A 3GMTA 2NO5A 3GCDA 2W37A 3IV7A 4OVKA 3DZFA 2WTAA 1T6NA 3ZCQA 4HNRA 4TTAA 5UKDA 2R8BA 2XJ4A 1N0UA 3VZPA 5BSKA 3PA6A 4BO3A 1LDGA 4P08A 1U3WA 4R8VA 2LE0A 3QU5A 4KO3S 3IKMB 3R3ZA 3RSZA 3WOVA 2QU7A 5IBCA 2K2QB 5J2UB 1IWOA 1QOZA 4PPQA 1PYGA 3OZUA 4DCMA 1W5EA 4UDYX 5LUBA 3PUVA 5LZ8A 4P92A 3IUQA 3W3ZB 3GLRA 5TQ0A 3SC4A 4M98A 2ZUDA 2VP6A 1FFAA 5ALQA 3ZGYA 2XMGA 4B7ZA 4DDUA 5JJKA 4Q9AA 3GL9A 1V3TA 1ZGAA 3GZTB 1RAEA 3UK0A 4MKZA 3WB9A 2BI4A 4TZTA 2WSMA 3JQ6A 3U3KA 2JLSA 4IXMA 1BZYA 4OK3A 1NBIA 1U2GC 4XWOA 1XYVA 1Q91A 1ZCZA 2QR5A 3F4KA 1KE2A 3GLGB 1GAJA 1QF6A 2DHDA 3NWJA 4JLPA 4AXBA 1W6RA 3EQ6A 1U90A 3S29A 5AVYA 2FPXA 4LFAB 5KNDH 2LRHA 4YCMA 4WOKA 4AMBA 1QZTA 1H2FA 5AK0A 1DPGA 4HR7A 4UOEA 4G4SO 3NT5A 4RD0A 4EB6B 2Z09A 5K99A 3IAAA 2IU0A 2IIBA 3UJ7A 2WM3A 3AGPA 2P5YA 4E14A 4PSVA 4AFNA 4B6EA 1M5RA 3DCYA 2FLWA 1CY1A 4ME6A 3FZYA 1OIVA 2H1LA 3STTA 3X1XA 4YDHB 2B8EA 3FETA 4HEA1 4BX3A 1LSOA 4COOA 4C76A 4V39A 4TWZA 2IDMA 3FJ1A 2CVOA 2PN1A 1M2OA 2H1VA 3Q3HA 1WSAA 4MR7B 1VG9B 4N03A 4P8RA 4QU0A 4LJAA 1XC7A 3NH9A 3QKUA 3M5WA 2EX1A 3BHNA 3DBHB 4X9XA 1TYZA 4WOPA 4D9KA 1ACJA 3KJNA 2XKAA 3TJRA 1IZ0A 2AD5A 3HZZA 1DJLA 1E63A 3JYOA 4FEYA 2XQFA 2ZTLA 4DJEC 1PR0A 2PO7A 4JYBA 3VU0A 5JCOC 4A10A 5KAMA 3LLCA 4KQ2A 4V0SA 1JA1A 1MIOB 2K6GA 3IESA 3LDUA 4RCZA 4YT8A 4JS0A 2IYAA 3NAMA 5T3UA 3PXXA 3VTZA 2AH5A 3S2EA 1N1EA 4C2BA 1DWQA 3WQQA 5AW3A 4X64B 4WK6A 1NL3A 1RC8A 1G3UA 3P2KA 2JAHA 3D5QA 3LT5A 4EHJA 2A33A 3NOVA 4RK6A 5ELXA 4B8WA 2CLMB 4H4CA 16PKA 3BN3A 4I4TA 3VH1A 2MWMA 2I2BA 4D2IA 2JHCA 3HB0A 4H77A 1N2XA 1RRKA 3QF7A 4KGZA 3BB3A 1U0TA 1SWWA 1Z39A 1T9CA 2Q46A 2QR2A 3D0OA 1RXSA 3E53A 2B9EA 3E5RA 1FU4A 3LC7O 2JJ8A 4M1ZA 4OMDA 4TUYA 3VU9B 1JG2A 4NS4A 3VH3A 1YE3A 5DPMA 2YVLA 4IGIA 2EP7A 3MWDA 2W2LA 5BVHA 4PYLA 2HA4A 4MA0A 1RIIA 1OV4A 4UC0A 3U9TA 3ZY2A 2TRSB 3PUHA 4LRSB 2ECFA 1KDRA 4G0PA 4MQLA 4BE4A 3C8HA 4RTSA 2AQ8A 5JCZA 1A97A 4OJNA 4D92A 1HQKA 2ZTSA 1XMXA 2PWAA 3EXHC 4MDYA 4QJ4A 2X19A 4M0EA 2QQFA 2J9ZB 5JAZA 4Y6OA 1UBUS 3OD1A 8ATCA 4PG5A 4KG7A 4QFBA 1JAHA 1VJCA 5BUCA 1XMOB 5CBKA 2OG1A 1HZZA 3VNAA 2ZYVX 3ENQA 4Q1EA 2XOKD 2P78A 1HL7A 2VBCA 3F3KA 1IUNA 1PWEA 1RHUA 1U9JA 3Q8LA 3F6BX 4IFTA 1XK6A 1U1GA 1D6NA 3TQFA 2YNMA 4YO7A 3T1TA 4H08A 3IAS1 5EFOA 4UNPA 3S2FA 3ZV7A 3PQCA 4GSYA 4BVHA 5ITVA 3JYQA 2VBFA 4UUOA 3ZCTA 5ARBA 3HXMA 4YP7A 4FS8A 4O25A 1MD9A 3TD2A 1EP2B 4MVJM 4KQIA 3K53A 1II0A 3UC5A 4DRZA 1KS9A 1E5DA 2GCPA 1YA4A 2DERA 2GK6A 2OFPA 3S55A 5HZKA 5C4MA 1FUIA 1SXJC 2CVFA 2YYZA 3TLXA 1GHTA 3QTBA 1KZ1A 3KVNA 4PO9A 3ZZ0A 3GPDG 4OLBA 1E1QD 2EERA 1JDJA 3QELB 2PT5A 3OZ7A 2OWEA 2O3SA 5KUTA 3ENNA 5CGZA 1O6ZA 2R9VA 5EJ5A 3CJTA 3PF9A 5IABA 2OESA 1DAFA 2GEFA 5FNZA 1RKQA 3E9RA 2Q49A 4ZQCB 4LHVA 1CRQA 5E6RB 1DDIA 6GPBA 3ANMA 1A5SB 1P75A 4FYMA 3NBQA 3H4VA 4JN6B 1KRHA 4RD4A 4G8DA 4D3FA 4D02A 4HL6A 4L51A 4PZZA 5KTPA 3L93A 3QVSA 3ZX4A 3LF2A 3SEAA 3MELA 4EF4A 2DQSA 1Q20A 2P6NA 1U7UA 4QUGA 1WUKS 2EKDA 3G68A 3V3TA 1UM8A 5LBTA 1G2QA 1N7IA 2OAP1 3F5DA 1JIXA 2Z9CA 4GAEA 4HG2A 5CDGA 3INRA 2BJWA 3HM9A 2D06A 3THWA 3FR8A 3U16A 4F38A 5FI1B 3R5KA 5HBGA 2V45A 4N48A 3DV9A 3PT9A 1XPJA 3CPJB 4Y2UA 5KPJA 1IG3A 2QV0A 1UDXA 3TKLA 3PV0A 4Z9XA 1YZUA 3ZD7A 2XE8A 3GCWA 1EVEA 2NTEA 4ZN6A 1XWWA 5EIAA 2WU4A 3DFIA 3IH5A 5K3CA 1R0RE 2IEBA 1XQVA 2FP3A 1N5LA 3QBTA 2DQYA 3NKLA 2FFAA 2HCTA 2YZ7A 4I1SA 3UH1A 4H1VA 3ZY4A 1NVAA 3MNFA 3BE8A 1Q0HA 4DXHA 3L0SA 4IZ6A 3SQNA 2HX1A 4RK4A 5IZCA 3R0IA 1AHHA 2PSJA 2DY1A 3UY4A 2JGRA 4H6PA 4UVHA 1BGVA 4JUDX 3CGGA 4U2KA 1WXQA 1YNSA 4S1TA 3VPGA 2ZJ7A 4MQBA 3AM5A 4HDMA 1ZIDA 1XZPA 3H2YA 5BOSA 2C99A 2GD6A 4N76A 1WEHA 1V7PC 1ZZGA 4B6FA 3JYHA 4EPRA 4LHWA 1JYSA 3ABIA 1EINA 1VYTA 4I50A 2C96A 4KXXA 1FK8A 2WLSA 3V5NA 4JNCA 2CNWD 3C4VA 3MWEA 4GLBA 4EHDA 1ULHA 3HXTA 4LJ9A 5I48A 5E6SB 2ZRJA 1HSOA 3ZCSA 1SZCA 2DULA 4E08A 1TA4A 1EZ4A 4WJZA 4FK8A 2JBAA 2QENA 5JQGA 5K6AC 4A15A 5A4DA 2OBYA 2GTPA 2PHZA 5LD2B 1JU4A 4N12A 2P3LA 521PA 1D6JA 2XAAA 4MUGA 1LLQA 1FQWA 5JJBA 4U9UA 3RFUA 4Q1DA 3ZWCA 4R2HA 2YHAA 5E1OA 2OPHA 1E1NA 1O03A 1XD2A 3E2MA 2BFDA 1HKHA 3HRIA 1RLIA 3IILA 4Z2YA 3DH0A 3IAEA 3WGJA 5KYGA 2GCOA 2OCAA 4MLCA 1Z2CA 1ZH2A 1GKLA 4F4HA 4K0KB 5E3JA 2B4QA 3BS4A 3FTNA 3C3KA 5EKDA 1QGUB 2XKJE 2DSTA 2QTMA 1IAQA 3V1UA 1RS0A 1NBAA 4GZ3A 4ZI7A 4F6CA