5IVVA

Linked kdm5a jmj domain bound to the inhibitor n12 [3-((1-methyl-1h-pyrrolo[2,3-b]pyridin-3-yl)amino)isonicotinic acid]
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
317
structure length
300
Chain Sequence
EFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEVKSFRFTPRVQRLNELEAMAFGFEQAVREYTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGSGFPVKDGRRKILPEEEEYALSGWNLNNMPVLEQSVLKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIMNPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for KDM5A Histone Lysine Demethylase Inhibition by Diverse Compounds.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Lysine-specific demethylase 5A
total genus 88
structure length 300
sequence length 317
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5ivvA00
3PTRB 4D6RA 5A7WA 4EZHA 2YBKA 5IVFA 5A7PA 2GP5A 5FP4A 4E4HA 3K3NA 5FY5A 4DO0A 4BU2A 4D6QA 5FUPA 2P5BA 5A7NA 3LDBA 5FZFA 5KR7A 5IVBA 2XUEA 4QXCA 2W2IA 4IGQA 4GAZA 4QWNA 5FXZA 5FJHA 4GJZA 2XXZA 5FYUA 5FYYA 5IVYA 5FZIA 5FZHA 4CCLA 2YBSA 5LW9A 2OQ6A 5FY8A 4TN7A 4V2VA 5LY2A 5FY9A 4UF0A 2PXJA 5A7QA 5FUNA 5FZGA 4Y3OA 3PUQA 2WWJA 5FZKA 3KVBA 4IGOA 5FZMA 4CCOA 5ANQA 3N9MA 2YPDA 4URAA 3KV6A 4XDPA 5F2SA 5FZLA 4ASKA 3K3OA 5A7SA 2YU1A 5FP3A 5FZCA 5F5CA 4C8DA 5FWJA 4HOOA 5FPUA 2GP3A 5FYSA 5FXVA 3U4SA 3DXTA 2OS2A 4LITA 4LXLA 5FP8A 4QU1A 5FY7A 5IVVA 3KV5A 3KVAA 5FPAA 3KV4A 3UYJA 2YBPA 5FYBA 5FYVA 5FXWA 5F3GA 5F5AA 2Q8EA 4CUGA 2OX0A 3N9QA 4Y33A 4EYUA 4QXHA 4GD4A 1VRBA 5FPBA 5F37A 4BISA 4QX8A 3OPTA 5FY4A 4IGPA 5IVJA 4BXFA 5FXXA 5A7WB 5FBJA 5FZBA 3NJYA 5A3WA 5F39A 5FPVA 5FPLA 3U78A 3DXUA 4CCNA 3PUAA 5A80A 3PDQA 5F3CA 5IVCA 5FZ7A 5FP7A 5FZOA 2WWUA 5IW0A 3ZPOA 3OPWA 5F3IA 2Q8DA 5FYMA 5LY1A 5FZ1A 3RVHA 4AAPA 3PU8A 3ZLIA 5A3PA 5IVEA 5FZ6A 4EZ4A 4LIUA 5FJKA 3PURA 5FP9A 4QX7A 3AVRA 4AI9A 4UF0B 5A1FA 5CEHA 5FZOB 5FY0A 5E6HA 5F2WA 5FZAA 5LWBA 3N9OA 5FZ0A 5IWFA 3AVSA 5FZ9A 5FYHA 5F5IA 4LIVA 5FYIA 5ISLA 2OQ7A 5FWEA 5FZ8A 5FZDA 5FZEA 4CCJA 4QXBA 5A1LA 5F3EA 5FY1A 4HONA 3PUSA 3N9PA 3N9LA 2Q8CA 2XDVA 5FYCA 2YU2A 5A3TA 4CSWA 4XDOA 5FZ4A 3PU3A 2VD7A 5K4LA 2OT7A 5A3NA 3KV9A 4CCMA 3N9NA 5FZ3A 4GJYA 4DIQA 3K2OA 5FYTA 5F32A 5FV3A 4V2WA 3AL5A 3LD8A 4Y4RA 5FYZA 3AL6A 4D6SA 4NUBA 5A7OA 2XMLA 4CCKA
chains in the Genus database with same CATH superfamily
4U36A 1K45A 3VZLA 4IV1A 1OXCA 2WT0A 4YM0A 3WDYA 2W95A 4D6RA 1CONA 3ZFFA 3O1RA 2GDFA 5E88A 3D8CA 4XCBA 1PGSA 5I8SA 1HRI1 4Y1UA 3C2UA 4QU2A 4QB1A 3LPGA 4BU2A 1PNFA 1ZZ7A 3I54A 1O7FA 4OFGA 2VUJA 4B1LA 3ACFA 1W8NA 4FPLA 2VR4A 2WO3A 4AK3A 1ZYBA 2C4XA 1DQ6A 1Y4WA 4XEZA 4ZS3A 5D8AB 4HL0A 4BLIA 5FYUA 5J09A 3T2QA 1DU3D 3AMQA 1Q3EA 2RS13 2HWC2 3M2MA 2J1EA 5FZHA 4OI2A 1RHI3 3D0JA 1XPWA 2MHFA 4JAAA 4RGAA 1CESA 1LNSA 1Q8VA 4Q26A 3C8XA 3KGLA 4A3XA 1YQ8A 3O5SA 1YFWA 5D2AA 3LEKA 3SH5A 4YZ5A 5KWRA 1PO13 1QGLA 2R072 5FZMA 4QPWA 3ZPYA 2V4AA 1STMA 3ZYPA 4FPOB 3WUDA 1ODMA 3RDIA 1UZWA 4IQPA 5F1RA 5A7SA 2XVKA 4EWDA 3F95A 4HOOA 2VZ3A 3M3CA 3WNLA 4NE9A 4HPKA 2RS31 1Z7S3 3QH6A 4CU7A 1HRI2 4BOWA 5C4WC 3BOPA 2W52A 1BJQA 4E2GA 1H4GA 1JZ8A 4XURA 3BIWE 5FY4A 1AR91 1Z7S1 2VBDA 4FPJA 3ZYGA 4AI3A 4PIYA 1H30A 3VD5A 4BB3A 1LGCA 2O14A 2VNOA 5CA6A 4Q4Y1 1E5SA 4C1XA 2X5IA 3HEIA 2DCJA 2B7YA 1BBT3 2FMYA 3M3IA 4O61A 2YUEA 3HQXA 3UV9A 4RQPC 1UU5A 3PIJA 1VRH3 1QY4A 2OVUA 1GZWA 4K3UA 1VBE2 3CKHA 1AL23 1MACA 3PVNA 1G9AA 2JENA 4TZDA 5FP7A 5JI7A 5IW0A 4LQRA 5ABJC 3BI3A 2G9ZA 5CIRA 1LKNA 2EICA 1S0EA 3ITQA 1O8SA 3BOWA 5LBCA 4XCAA 1R092 1UYZA 2OA2A 3NJVA 2WAAA 1EAH2 1OSGA 4YGEA 2WZR3 5LWBA 2VQUA 1CGPA 1KJLA 4XFCA 2GAUA 5IWFA 5JOWA 3KLSA 1VBA1 2WFF2 5I93A 2LUWA 5CB7A 3T1MA 2WINB 2VQTA 2RJLA 1VBB1 4S2HA 4OUMA 3HOBA 5F3EA 2G9FA 4IE7A 3D82A 4X8PA 2OW4A 4BIFA 4LKDA 2Q8OA 4MGQA 3RWKX 2ZS6B 2PHUA 3NAPC 2Q4SA 4I3GA 1DG6A 1W6QB 4NHYA 5FTTC 4FPEA 3TAYA 4BK5A 2D5FA 1W9WA 1HIXA 4D8MA 2VD7A 4E4DX 1JZ6A 1LHWA 5LK5A 3R4SA 3MF6A 4Q0UA 1LHVA 4K20A 4PI2A 5JR7B 3E6BA 4YRDA 4CUCA 5FKCA 4JGYB 3H1WA 2HWE1 1QHDA 4KWUA 3WF1A 1X8EA 4XBNA 2PHTA 4AFBA 2R062 4AHZA 4M4RA 4BQYA 2W46A 4XZPA 3TYJA 3VBRB 3KT4A 4JDMA 5LCWL 2WN3A 2Q0AA 2JDKA 4F8AA 3IM0A 4HVOA 3RJ2X 3LPFA 4W6WA 1DYPA 1YFUA 1XB9A 1F9KA 1Y7BA 1DF0A 1OI6A 2JEMA 4YG3A 2YMZA 1KD7A 3LSEA 4ARXA 5CYYA 5CNAA 2Y38A 5EIYB 2WWSA 1N1YA 4ES8A 1C5IA 4QT6A 3V0BA 1ZA7A 3GXUA 3OOXA 3HR9A 4R9CA 5JI9A 5FK7A 1O91A 2EF6A 2JE9A 3VHPA 2DWRA 3NAPB 4CDQB 1BCXA 1DZTA 2PXJA 3HT2A 1OA4A 1FV2A 1DQ2A 1DP0A 2YB7A 3LWCA 5FZKA 2GNBA 4FPYA 3O0WA 1X9TA 2EIGA 3ZYIB 1IPKA 1AL22 3NW4A 5ANQA 2YPJA 2Z42A 4LHSA 2GC1A 4X6RB 4XXAA 1Q8SA 4Q8LA 1RITA 4FTSA 1CJPA 1YJLA 2DCZA 2A70A 2FDJA 3DUIA 3KQ4B 5LA0A 2JWPA 3LF7A 1QKQA 1M4WA 3K77A 1W05A 1C8M3 1CN1A 1W8FA 1XNDA 3DV8A 4TYSA 5FYBA 2XVLA 3PVBB 3THDA 5IUQA 3JD73 3SKJE 4BDVB 2Q8EA 2WNUC 2OX0A 3ATGA 3N9QA 4EYUA 4FP3A 4A7KA 2VW2A 4D7TA 3JBG1 5CFCA 1GZTA 1OPMA 5JSOA 5JR2A 4GB33 2SLIA 5E16A 5FZBA 2XQXA 3FWEA 3OEAA 2WO1A 1IS3A 1JBCA 1EUUA 1OUSA 1R64A 2ZGTA 3E6DA 2VCCA 2ZJCA 5EV7A 1LHUA 3PTYA 3P1IA 1SMVA 2Z4FA 3WP4A 5C9AA 2R32A 5DDJ2 3ENRA 1ZZBA 4XTMA 2JB8A 2C24A 3DF0A 3N7MA 2QQWA 5F3IA 3FX3A 5FYMA 4CEWB 5BNOB 1POQA 2B39A 4JGZC 3TB0A 3U37A 4OZOA 1MVEA 4BK4A 5F9TA 3ORJA 1JYIA 4NIAA 1RUI3 4ZZ5A 4YVWA 1OUXA 3A0KA 1X9PA 3SCGA 1N1VA 1DGRN 3J4UH 2VPVA 4B8EA 3SISA 2C9AA 2QVSB 1MQTB 4C91A 5KXDA 4Y4YA 3B7MA 3UJQA 4RL7A 2WS91 3OJBA 2FZ1A 3EHKA 3GBFA 3PUSA 4MGZE 1UOFA 4NROA 5A3OA 3SCFA 3UK9A 1PO21 3KS7A 4EN6B 1ODNA 5KHIA 5C6CA 5J37A 3NJZA 1AYN3 2BOJA 4FPFA 4OUEA 2W3JA 2GNMA 5DG1A 3N9NA 4QB6A 2EALA 5FZ3A 3UKNA 3ZMOA 1NLSA 1J3RA 5GKAC 3RSJA 1GNYA 3ABZA 4BQ3A 4YW6A 4EJRA 1KDKA 2ZMKA 3BTAA 1W6MB 1W3VA 1S0DA 2HKXA 3I2IA 3PMSA 2IWGB 1C5HA 3D3AA 3QLQA 4RA0A 4BQXA 2YFUA 3CJIB 2E7AA 2J42A 1JZ2A 3K75B 2WQ8A 5FP4A 1GV9A 2RR13 4XAAA 1UOJA 3GJBA 5FZFA 1ZRFA 3ELNA 4IE4A 3I4IA 3WDTA 4G4FA 5DZGA 1JS9A 1SPPA 3WNNA 3AKQA 1IG3A 2XQRA 4R4ZA 1GOHA 1JZ4A 1LRHA 1VP6A 1XC6A 4LO5B 4WM7C 3S7EA 1IKPA 4KBBA 3VD7A 5LW9A 4JV4A 2WJSA 4GB32 1GQGA 2A5ZA 4JRAA 1S55A 3RZKA 2CSGA 4M3CA 4FOWA 4R9BA 3QACA 1Q8PA 2VJXA 3PUQA 5GLWA 4ZONA 3WNMA 4IEOA 4PHZA 3ZFFC 3JCIA 1J84A 2VECA 3T2TA 4E8DA 3ZSEA 1EUTA 1X36A 3AMMA 1UMHA 4LBQA 3VN4A 1MS1A 3TBDA 1VIWB 2YPDA 3IB3A 4HXCA 4F3JA 4ISQA 4JZRA 1A78A 4S2DA 1GNHA 2X05A 4C8DA 4D94A 1QNYA 2GP3A 5GZGA 1APNA 1VBB3 4G9SB 1W2AX 4IESA 4RSUA 2BVBA 1FXZA 2NYYA 4A2UA 3D4KA 4Y26A 1PHMA 4P9GA 3AZZA 5JSPA 5CKNA 3KF3A 5GALA 2E9QA 2TNFA 3WD5A 5C3RA 3ZFEB 2NLRA 1XOYA 4JQTA 4M0NA 4PJYA 4QXHA 3VKOA 5CISA 4Q0PA 5DAXA 5EJ1B 4M0HA 2I2SA 4Q4W1 1NY71 4JGYA 4XE9A 4XUOA 3OPTA 2LS6A 4BMEA 1AR62 4K8FA 1MS8A 5LA1A 1CAXA 2XJVA 5IATA 5A7WB 4L8QA 5CFDB 5GLUA 4AHYA 4MYEA 4QGNA 4LT5A 4QKFA 1VMJA 4CDUB 5CKQA 2ZGRA 4R9DA 1AR71 2R1DA 1XNCA 5DUXA 1OC1A 3ACLA 3CZUA 4XHXA 3T0AA 1AYN2 1MPXA 2GH2A 4XUPA 4CUBA 5J48A 1RUH2 3J8F1 1XNTA 5CBLA 2KD7A 5BNPC 2A6YA 4H14A 2VVDA 1LEMA 1OLME 3ZN4A 1V00A 1H2MA 3URFA 2UWCA 3AP9A 4LE3A 5T5PA 2ZEWA 2WKKA 5CU1A 1JU3A 3JD72 3O0VA 1FMD1 4QKBA 2CU5A 3VDDB 4BQWA 2QCSB 3CJIC 3EJKA 4QX3A 3VBUB 4KU8A 3AZWA 4Y5TA 1KITA 5T52A 3VDDC 4MXWA 1ZZCA 4DS0A 3W9AA 1MVQA 2DFCA 3WUCA 1H2KA 2VW1A 4FQ4A 3H8UA 1TG7A 1ZVFA 2WN2A 4UFKA 2VMHA 2GSYA 3POFA 1AUYA 1J3QA 4P9WA 1K5JA 3ZFGB 4CEWA 1QXPA 4AQTA 4DPNA 1KRIA 1FAYA 4MGTA 3LDKA 1TNRA 5FOBB 2DYCA 1W03A 3HN3A 2XBO3 4QPIC 3VKNA 4ET7A 1WLTA 5I0RA 1FPN1 3ACGA 3KD4A 5HXMA 4R52A 3RNSA 5EP9A 3RWNA 2R6QA 2AENA 4W65A 3VDDA 4LULA 2FDGA 2O1QA 3AJYA 2A3XA 5AVPA 4CP9B 3CL1A 3IDEA 3VBOA 5I0UA 1L3JA 3CDZB 3IZOA 4MXWB 1R082 2RE9A 2QQLA 4WBBA 4HK9A 3H3UA 5AVAA 4Z2AA 1YRZA 3ZFGC 3CHXA 4CDWB 4YM3A 5AC93 3U10A 1WW7A 3VHNA 5FZIA 2B45X 3IMMA 4EWEA 1OA2A 2ZX3A 5BUVA 2RS52 3LA7A 3AP6A 4GMP1 1N3QA 4UF0A 1WD3A 5L9BA 5FUNA 4BE3A 1UU4A 2D6LX 2XL7A 3JUUA 4W4ZA 1A3KA 4P9JA 4MO3M 1Q8QA 5EHDA 2CV6A 2KA3A 4PCRA 5B4XA 3IIAA 3AYAA 2WNUA 4QPIB 3PUHA 4L97A 2D43A 1RUH3 1W9SA 2VZQA 1I9RA 1EP0A 3GALA 3SH4A 2YXSA 5H9QA 2YU1A 3TN92 2OUJA 2R7EB 2Y6JA 4YVSC 4FBFA 4OZXA 3TWIA 5FPUA 1U5ZA 5CKMA 1TEIA 3ILFA 3ME2A 2WS93 1VAVA 1RC6A 1SFPA 2VMCA 2Y34A 5FYVA 4HN1A 4Z8BA 3FZ3A 3IAQA 4CUGA 1CAUA 3MZHA 1UWWA 2VBPA 5H9RA 4QM9A 5FREA 4CYDA 3ZXKA 1RUD1 1GP4A 2W5FA 1OQ1A 3D6EA 2D93A 3M3OA 5FOJB 3NQHA 2BU9A 4NR1A 5C8CA 2CAVA 1PIV1 3CJIA 4CCNA 3PUAA 3AYDA 3ILNA 1WMEA 3PMEA 1PO12 2R073 2RVAA 1QQP2 2ETEA 4QAWA 1AXKA 4UWDA 3FUQA 1RUC3 2HWB2 2EXJA 2JG8C 1NLQA 2IZWA 3Q9OA 5IFPA 1RIRA 3C7GA 2VVFA 4LIUA 1VBA3 1EY2A 1LHNA 3CMGA 4C0BA 3I2DA 3NWKA 5A1FA 3BTZA 3MV01 2AGSA 3FBYA 1OMIA 1EV11 3KT7A 1PVC1 3I7DA 2JIJA 3J8F2 1H8TA 3ZR5A 1TZOA 4COVA 4AEDA 1O4YA 3VD9A 4HANA 3VDCA 2C5DA 2ZEZA 4E8CA 1ZRDA 1R091 4A41A 4JHZA 3POYA 1L7QA 1X82A 3Q8EA 3U75A 2PAMA 3DPRA 3HNMA 2QQJA 2ZGMA 3E5XA 1GWMA 3IBMA 2OKXA 1WBLA 2D3SA 2EAKA 4NJ4A 4HSLA 3NJXA 5FZ4A 3ZYBA 2TUNA 2ADEA 1W6MA 2DVFA 4CDWC 4LBQD 1KS5A 3KV9A 2A6WA 2BNMA 3BCWA 4JKMA 4UW4A 2A3WA 4YVWC 4Q1PA 1SZBA 3S57A 3AL6A 4YFWA 5GLVA 3DPRC 2RJKA 2ZGLA 1US2A 2X10A 2CTVA 4COZA 2WZR2 3WLUA 3FHIB 3CZJA 3K3NA 5FY5A 5A33B 3VBFC 5ACA2 3S0MA 1ND3C 4FQZA 1ZZ6A 3U07A 4PIZA 5C70A 4N90A 3EXUA 1BMV1 1H1IA 5D1IA 1HV1A 2WABA 3J7LA 1D4M1 1OLRA 3TEWA 3MFAA 5FAXA 5DXDA 2R30A 2CGOA 2IXCA 2NMOA 3H0OA 3NVCA 4OI4A 3MDPA 3ZX7A 5ABJB 2BJSA 2XPJA 4V2VA 4AGRA 4PDWA 5DAQA 1WW6A 4IEWA 1CAVB 2ET7A 1OQDA 3SXWA 4UW3A 3KCYA 3U4XA 1UIJA 1UKGA 2ET1A 1RVF3 3GNEA 1HQLA 4OMDA 3VBHA 2GU9A 3POIA 4NRQA 3RPQA 1MZFA 1OLQA 5C4WA 5LRSA 3DEMA 3LA3A 1WMXA 2DDUA 4XDPA 5F2SA 2ZX1A 4URAA 2LALA 2OUHA 1GICA 1V6LA 3WHUA 4EROA 1GBGA 3NKTA 3U4SA 1EYBA 4HVQA 2D97A 1HJGA 5FY7A 1W2UA 1G8WA 2ZTNA 3AXDA 1O5LA 4PT6A 5FXWA 3VBFB 4SLIA 3O12A 4Q4V2 5ACA1 3C7FA 3THTA 1V70A 1ULDA 2OIIA 2P3KA 1GQPA 2Z69A 3PNAA 1Q56A 4HLTA 1UF2C 3T0DA 1LOGA 4QX5A 3RQ0A 2XJUA 5JLVA 2ZGQA 2DBIA 1ASJ3 3ZFEA 4KI5M 4B4RA 3U78A 1AR93 1KXGA 1Y9QA 3W5NA 1C3HA 3I2OA 4Q27A 1O3SA 5JIAA 5L9VA 4Q4Y3 4TXWA 5F3CA 2VGDA 2BWCA 2AACA 3NSTA 5TSWA 5JSRA 1HB4A 2R1BA 4YW2A 1ZREA 1LHOA 1G86A 5BXXA 1RUI1 2HYKA 2ARBA 2HH9A 4CA9A 4CP0A 4AAPA 4CP2A 1NYWA 1FPN3 1OPOA 2X5IC 3ZLIA 3N7KA 5A3PA 3SEPA 2YV8A 2D40A 1NZCA 4EZ4A 4YZ4A 2VMFA 4U2AA 4CEYC 2B46X 3MYXA 4AEMA 1ZM1A 3QH7A 4ZU4A 1NKGA 4MOAA 4G3YC 3ZN6A 1O5UA 4NN0A 2RM23 3RI8A 3NKGA 4LUKA 4PQQA 5DZEA 3VZKA 2DFBA 2E31A 4XACA 3TNPB 1OBNA 2W91A 3MLKA 5FWEA 2UWAA 3B94A 1DQ4A 2IVJA 3H1YA 1MS9A 4YWAA 1WUVA 2ADDA 4QQ2A 1XSRA 2RS12 3POEA 3TEXA 1V6OA 5I0DA 4ZU5A 5JCTA 2VAUA 5FMOL 2B5HA 1UAIA 3ROUA 1RB8G 1CAVA 4URTA 1QOSA 1UY4A 1RUG1 4LBJA 1YYNA 1AL0G 4B3NA 1XNKA 5K7PA 4GWJA 5FV3A 2Y64A 4PQ9A 1ZA4A 2JE8A 2Z5WA 5F7UA 1YJKA 4KGGA 1Y43B 2A6XA 4XFGA 2QKDA 4AI2A 2IXHA 3OBRA 1YIPA 5LB6A 3ZXEA 3MW4A 2ILMA 3WW1A 2ORXA 4ASMB 4DRRA 4CTEA 2VZTA 1HN1A 1PMHX 5LBEA 4EV0A 4HMZA 1SG3A 2HLEA 1VLNA 1ULPA 1DQ5A 1TME3 4L99A 5FXZA 4GWMA 3AZXA 2R071 4YZ3A 4N9IA 3EQEA 1QJU2 2GC0A 2WNEA 4ES9A 1TVGA 5C7GA 1EV13 1GP5A 1T6GC 1X33A 4LR4A 4WVMA 5LRRA 2FDKA 2VUAA 4RR3A 2XJTA 5FLIA 2GC3A 5CFCB 1KS4A 1ND2C 1VBE1 2IXKA 3E5QA 2BQPA 1BBT1 4IV3C 1NX9A 1F15A 4K7JA 1LB2A 4H55A 1VRH1 5A32B 2A71A 4PIXA 5LEKA 4JTNA 5T54A 1W8TA 3SCHA 2FCTA 4A45A 1D4M2 2BGPA 2RS32 2VUDA 2WUHA 5JZGA 2VM9A 4GWIA 2W1WA 4JGYC 5FWJA 2ZXQA 2OZ6A 3KSCA 4GZ9A 4UFMA 1RUD2 2FCVA 1GQHA 2PYTA 4NMIA 4O9GA 3ES4A 2WAOA 3U0ZA 1DYKA 1HX6A 2DU1A 4COUA 1W2NA 1HB1A 1ULCA 5JUVA 3J26N 3B93A 4WM8C 2ZGOA 2EIBA 4HKLA 4XPVA 3I97A 1JOBA 1RHI2 2HWB1 1UZVA 2DTWA 5F39A 4YGDA 1DGWA 3ZFFB 3P6BA 3DXUA 3USUA 1WW4A 5DUVA 1HXS3 2BBAA 4AW7A 4XJ9A 2HEWF 1KFXL 4Q4V1 3NL1A 1Q43A 2B4KA 3KB5A 4I0BA 1R1A1 4MSVA 3ZYHA 1QOOA 4PLOA 2W1SA 4DOUA 2XBO2 1UXXX 5D8AA 3PU8A 3ZN6B 1S2KA 3GCWA 3O14A 4UXAA 5EFUA 5FZ6A 4CPBD 1R1A3 1JZ5A 2J1UA 2QFEA 5A70A 1W6NA 2XLFA 4RQPB 5FMBA 4AL9A 5F2WA 3AKTA 3N7LA 1PX4A 3VKFC 1LGNA 3OGSA 2E7QA 1VAMA 5T5LA 3B5LB 1S0CA 2Y26A 2Q5TA 2YGMA 4IV1C 2BZDA 5FYHA 5HXVA 1ZBE3 3PIGA 4KH9A 1AR63 2Y6GA 1VALA 1NXMA 2DURA 5FZEA 5A3MA 2WNUB 3BALA 3HBKA 4QPIA 4DXZA 1RVF1 4GKXA 3AX4A 4KL1A 1YNAA 1TNFA 1LODA 1UNBA 3OYWA 1W0OA 2YZ4A 1DDLA 2P6HA 2CY6A 4NVPA 1BK1A 5APAA 1RL3A 1IS6A 2WC2A 4XUTA 4MUVA 3VL8A 4Q4Y2 5HCHA 5T3NA 4D69A 4J6GA 4QGMA 2ZABA 4PBOA 3V0AA 1AX2A 4V2WA 3KCXA 2BYVE 5KHHA 4NUBA 4RS5C 4AVSA 1G9DA 2RS33 2PQQA 3FJSA 1IZ3A 2GMEA 4Z82A 1A8DA 3SC7X 3W5MA 1EAH3 3I59A 1NCRA 2YBKA 4JX0A 4L11A 5HCBA 2BBVA 1NAEA 4ONUA 1H6YA 4CDQC 1CR7A 1RUD3 3FMGA 3KHBA 4DO0A 5KR7A 4XF4A 4Q0QA 2WO2A 4ATFA 4P5YA 3WG1A 3KHCA 5LATA 4E27A 3NNGA 3JD71 4ARYA 3GJAA 4TLFA 1IPJA 3FFQA 1RUF1 5IVYA 4Y5Z0 4BZ4A 3BPZA 1H9WA 4NIIA 5FY8A 4CUAA 3S7IA 3IDBB 5GM0A 3IDCB 5DDJ1 2W68A 4RYDA 3EMRA 3LSDA 5A6QA 3T4VA 3H1MA 3JXSA 1QQP3 2ZPXA 5DDJ3 4H7MA 1QXJA 3ZFEC 1UPSA 1MZ5A 4FO9A 5I8YA 3Q8AA 5H9SA 4P00B 4CEYB 1FI2A 5KC6A 4YNIA 1NY72 3HD8B 4WVWA 1FT9A 4P14A 1XE8A 3DXTA 4MHRA 2DF7A 3WHTA 4CP9A 3RZLA 2A6ZA 1W0NA 3OB8A 2ORZA 2YBPA 3B00A 3C3VA 4NPRA 4B29A 1NOVA 4AI8A 1QIQA 2WZEA 1JYWA 1LOAA 4QHZA 5FPBA 4K40A 4XJUA 2WIIB 1MQTA 4QX8A 3HWJA 4CCEA 1W8HA 4L2NA 1XYOA 4YZ2A 4OI1A 4AHXA 5IVJA 2JE7A 1GWLA 5FXXA 2WQZC 1H8TC 4BHPA 4LO7A 4ZKTB 1PM4A 4XHBA 2ZA9A 2J1SA 3C7EA 1MS4A 1QU0A 4XZUG 4AF9A 2WT1A 5IVCA 1NA1C 1VB2A 3MW2A 1NT0A 2CWSA 3HNBM 3ST7A 1NCQC 1PK6A 1SCRA 1SLIA 2XJSA 2HEYF 4XW3A 3ZPOA 5BPXA 4AEDC 5C3QA 3VKLA 2H6BA 2WT2A 5FZ1A 5GLTA 3MIEA 5FK8A 3B9IA 3FLPA 2QZ3A 1AX0A 4RR3B 2GC2A 1GLHA 3AVRA 2WS92 2V72A 3WP5A 1YHFA 3QD6A 2DVAA 5JIUA 3K48A 1H2NA 1R1ZA 1K5MC 5DAVA 3ZYFA 4BJ0A 5F5IA 1UMZA 4I30A 3UETA 1N1TA 2EXIA 4AE2A 1MEC1 2PELA 4BYYA 1OURA 1K5MB 2C6SA 3ETPA 1V9U1 4QXBA 5BV6A 4XF3A 1OKQA 1C4RA 1V6KA 1MEC3 2ZAAA 5G04L 2DU0A 1CJDA 1G9BA 2MPFA 1PVC2 3USSA 3ZVXA 5BNOC 5C8WA 1XE0A 5L19A 1W0PA 2CNAA 3BU0A 2NN8A 1LESA 5HCFA 4CCMA 1DFQA 4MV2A 4XC9A 3K2OA 5FYTA 2HWB3 2ZHNA 1RVF2 1HDKA 1VBC2 3AL5A 4O9EA 4Y4RA 4Y5SA 1IQAA 4EN8B 4LOSA 4QM8A 3VBRC 5EYXA 4WZFA 4Y1VA 1QXRA 2P2KA 3VBSC 5JAXA 2XLGA 4JCKA 1W39A 5DAWA 3T4HB 2YGLA 2GP5A 3AK0A 2D7FA 1JHJA 3K4DA 4N7IA 1ZBA1 2RMU1 3AP5A 5DMYA 1JOPA 3WDXA 3FE5A 5HV4A 4YVSA 2JKBA 3DCQA 1A6CA 4RS5A 2G1MA 4NRPA 2XHKA 5GZDA 4B1MA 3AZYA 4A4AA 4DUXA 3UKVA 2AH2A 1M06G 3VZOA 4XQ4A 3S5QA 5IK8A 2HWD3 2CGPA 2Y33A 5JMCA 1UQXA 4ORFA 5FY9A 4K1YA 4Q0VA 3APBA 1R081 2XOMA 4UFLA 1XU1A 2C1FA 1JI6A 3WW2A 2FD8A 2PLV2 3KVBA 2JDAA 1N1SA 2QDNA 2VE1A 4JHTA 4LJHA 2VTFA 4WM8B 3D0SA 4CCOA 2GALA 2L9LA 4ZS2A 4XFHA 5FPZA 1QJY1 2AREA 2ZMNA 3GF6A 1CIYA 2BEOA 5JOZA 2WZPP 4BQ2A 2DVBA 2JKXA 3BODA 5GLZA 3WOGA 2Z79A 2VTXA 4BLJA 3UYJA 5IT6A 4WM7B 4GH4B 5E1RA 4LO4B 2LTNA 1DYOA 4C90A 1UY2A 4M00A 2JDZA 2JG9B 1ZBE1 4XDQA 3T2OA 2VNRA 2GN3A 2VNVA 2WYFA 1OVPA 3ASIA 3M4FA 5JPMB 3ZDSA 3I2KA 3MIHA 5A6YA 1WGPA 4UT5A 4IETA 2DV9A 5A1AA 1NE6A 2OXBA 2W1QA 2PQSA 3VZNA 3OGGA 3ZSJA 5DAPA 3KCCA 3ZXGA 2Y6LA 2BP6A 2Q8DA 1SPPB 4Z07A 2UYBA 2W92A 2VQAA 2XJQA 2CGNA 2XUMA 3DKQA 4OUSA 4E2QA 1ZX5A 1ND3B 5HCAA 3H9AA 1XJAA 2DVDA 4FAGA 3PUIA 2ARCA 1YQ2A 1QJY2 1E5IA 4CDUC 1RUJ2 1LENA 4KGQA 2ZKNA 4AVBA 2F6BA 2CWMA 5FZ0A 4FOVA 2ZGSA 5FZ9A 4K8RB 2Q30A 4N43C 1W2OA 4PBPA 4XMIA 5JXJA 2NP0A 1LOFA 1S0FA 5ISLA 5A33A 1WZXA 5C3PA 2JG9C 1W8OA 4OULA 5FZ8A 1OHFA 1TME2 4Y1YA 4YVWB 3VDAA 1SCSA 2V73A 4A6SA 5JZGB 3BUCA 4CDUA 2R16A 1BBT2 2BVVA 4Q4W2 5LA9A 2QTWB 1EV12 3SHRA 2PHLA 3I3BA 2RS53 4N43A 3GBGA 4PI0A 1SLBA 2XL9A 1RUE2 4CDQA 1NLRA 2PTMA 3A4UA 3DL3A 1JZ3A 1ACCA 4EWAA 4LA3A 4YLZA 5L73A 3R6SA 3SITA 3TN91 1BZWA 4LBMA 2KR2A 1QDOA 3U1XA 1LECA 4I09A 2ZGNA 3MIFA 2NQYA 3ZYRA 1RUH1 1WCUA 2G19A 1H4HA 1REDA 2P3IA 1W3XA 2VVEA 4MX3A 4AI1A 3UGGA 1H9PA 4O65A 2XONA 3AP7A 3LQCA 3H8RA 1QMJA 4D6QA 4E9KA 3ZSLA 4QXCA 5D21A 2BRTA 5BNOA 1ZRRA 1CAUB 2RDQA 4DINB 2WO7A 3UESA 3KWVA 1Q8OA 2RG4A 3AFGA 3OBTA 2VOXA 5JZGC 2E6VA 1PM7A 1W9TA 1BEV1 3IT8A 3NV2A 4QPYA 4DEQA 2PMWB 1CZTA 1PIV3 3LAGA 4LBLA 1JW6A 4FPGA 4K6BA 2P6CA 2DUQA 2HWD1 1S2EA 4JQRA 4L9BA 1F5JA 1WLCA 1W04A 1QJU1 3P5BA 3N4MA 3GDBA 5F6LB 4OQ8A 2R063 3KV6A 1COV2 3M1HA 3K3OA 5KHJA 4YG0A 5IK5A 4DQAA 5F5QA 5AFEA 3IIIA 4Y20B 1RUOA 3CJXA 3ZKUA 1MS5A 4AFDA 2PLV1 2Y6KA 1VBD1 5FPXA 1WCSA 1VBA2 2WFF1 2K9ZA 3AYCA 4MH0E 4OHWA 1IHMA 4XQWA 1CAXB 2A75A 3MV11 1MS3A 2VG9A 3O7OA 4DB5A 3FC0A 4AEDB 4CDXC 1ENQA 3CQOA 5C71A 1KDMA 3RS6A 1JYXA 1VRBA 1QEXA 4XF9A 1MZEA 1OFNA 3M3QA 2GNTA 3N3HA 4MGSA 3NV4A 4COWA 1RINA 4EN9B 4I2OA 3ZKYA 1AXZA 5FBJA 1UYXA 3GBWA 3LEIA 4NAOA 2P17A 3FFZA 3VDBA 2FMDA 3FHQA 5FPVA 1DIWA 3INAA 2J1AA 5AFBA 2LM3A 1FMD3 1QDCA 2Q1ZB 3LOIA 4NHMA 5M0TA 1AHSA 1W6QA 3AXEA 5IAVA 1BVP1 3A7QA 2ZACA 2BGOA 3POGA 4W6YA 4AAXA 2PHDA 4YSFA 5LY1A 2WL1A 1J58A 4QB2A 4QX2A 4QPGA 2R041 2E63A 2HWF2 5IVEA 1LAJA 5HV0A 3GZTB 5FP9A 3IKWA 3I3DA 3LFMA 5LASA 1KQRA 3UJOA 1SFNA 1QJX3 5E6HA 5K8SA 1C8M1 4BQ1A 4BXSV 1GANA 1SACA 1W90A 4OMCA 3W20A 3WF4A 1B35A 1D7PM 2BWAA 1JODA 2EXKA 2ZHKA 4I01A 3ZXFA 1IPSA 2JG8A 2QQKA 3LCPA 2W47A 1ULFA 1UYPA 1C8NA 2WNVA 4N43B 1GFF2 1T6BX 1ENXA 2XJPA 3I49A 4W8JA 4AXOA 5JWPA 3HBZA 3H8XA 4JDNA 2DVGA 1DLLA 3LEGA 3N9LA 2W87A 2XDVA 1QJEA 5FCCA 1F8VA 4XDOA 3AM2A 4QPGC 5KXEA 3A21A 4IEPA 2O8QA 4CCDA 2ZHLA 5A3NA 4B4PA 2YHJA 1PIV2 2KM2A 2VU9A 3OGJA 3QOPA 1A34A 4AGVA 4CCCA 1VB4A 1LR5A 2HJIA 5A7OA 4LK7A 2QBXA 3E97A 1POV3 1R1A2 1OLMA 3RYPA 3IDAA 1QJY3 4XIOA 1PNGA 2I07B 3K46A 2QQNA 3P3PA 5T5JA 3VBUC 2IFWA 2R042 2P3YA 2E26A 2XWJB 3AFKA 3HNYM 1Z78A 3ES1A 3I2HA 4S2GA 3NV3A 5A7NA 3SMHA 2JDPA 5JXHA 5IVBA 3KF5A 4ATEA 1IGOA 5FJHA 4A42A 3ZIWA 4NPMA 2IC1A 3J7HA 1LU1A 4ZZ8A 3MUZ1 2ZGUA 2AYHA 3OUHA 5FYYA 2EXHA 1NQDA 5A3LA 1KEXA 2YBSA 3WXPA 1D2QA 3ZO0B 1E57A 5KC5A 1H0BA 3POJA 4XJZA 1SLAA 1DCSA 3TNQA 1VMFA 4FT8A 5A7QA 3AJZA 2WWJA 2XHNA 4SBVA 4AVCA 3HIFA 1SLCA 1OD5A 1AVBA 4IGOA 5IK4A 2NPIA 2VCAA 5FUIA 3BPSA 1BKZA 3WG2A 4TWTA 4UFHA 1V6IA 1V6JA 1W2TA 2QZ2A 3SH3A 3WVJA 1ULEA 2XWBB 4R9AA 4FTBA 2F4PA 1FOD3 1UMIA 3OBZA 3OUJA 4RD7A 2X29A 1ONAA 4GMP3 5C8CC 4R4XA 4O7XA 1W9FA 3WNKA 2WZR1 4M01A 3I8TA 5D8AC 2W94A 2YYOA 4PLNA 1YIFA 5C3OA 2JDMA 5I91A 3LFIA 3LIGA 1CPNA 3GGLA 1S4CA 4WVMB 5EPAA 4BISA 1ALYA 2H0BA 3BN6A 4AYUA 5IK7A 1F4AA 1B35C 1UU6A 2TBVA 2QJVA 4CE8A 4LHLA 1DGWX 1J83A 3CEWA 4CXXA 2VZSA 4EQVA 4XVHA 3TEZA 1SDDB 5DZFA 4L0PA 2QDRA 4FPCA 2VW0A 4XILA 4AFAA 2VNGA 2RDRA 3V65A 1DLCA 3ILRA 1COV3 5C8CB 1WA4A 2QNKA 2V4VA 2HWE3 3CIHA 3SQOA 4CDXA 2JDHA 2G4IA 5FJKA 1G7YA 3PURA 4N53C 4AI9A 2Z2SB 4W50A 4LE4A 2FDHA 4HFSA 4XBQA 3FN9A 2BW8A 2UY8A 1W28A 5EYYA 1O3RA 3MO4A 3N9OA 3PJYA 3TRSB 3ZXLA 4ASLA 2Q1MA 3WV6A 5A3UA 5FKBA 1F2NA 1UY1A 2ZX4A 5FYIA 3H8OA 4QD2A 2HEVF 4IXLA 1F4HA 5I0SA 1GU3A 3WSOA 4GXLA 3WEZA 1DGLA 1REEA 5FFOC 4AFMA 4DRVA 4Y20A 2GN7A 4DFSA 4FPKA 2Q8CA 1QJU3 3ZR6A 1UY0A 4LNVA 1PMJX 2BDRA 3G6JB 4FP2A 4DMIA 3VKMA 1OA3A 1AR73 1VBE3 3OTFA 3VD4A 3JZVA 3VV1A 3ZDVA 1S0IA 4QDQA 4FTEA 2ZOEB 1JUIA 4XTPA 4FCAA 4XJWA 3BGAA 1HN0A 3V64A 2J1VA 4XXPA 3UGFA 3SNMA 2RJ2A 3LA2A 4MGIE 3ECQA 4PF5A 3BYWA 1W9YA 4RFT0 1SBEA 1OQEA 3Q8CA 3ZXDA 1R093 2A1XA 3HT1A 3R0RA 3AMPA 5CFDC 5DQ0A 3B69A 4MADA 1W8ZA 3H7YA 3RMYA 2QQOA 2WSVA 2WBKA 2JJ6A 4UBHA 2R49A 1RUJ1 1ST8A 1UD1A 2MEV1 2ZAHA 3LKJA 3N36A 3QBQA 2WA4A 1HRV1 4UW6A 1W6OA 4E2SA 5FDBA 4GIQA 2IUWA 1GWKA 2O8OA 1GP6A 3GM8A 3RZZA 5A32A 1NA1B 4YG6A 4J1XA 1UY3A 2F4LA 3WG4A 1X50A 2JB4A 1AYM3 2UWBA 1NE4A 2WR9A 4Q5OA 1VAKA 3NNLA 4HG6B 5BNNB 3NRUA 1O59A 1NZIA 3RZHA 4A7ZA 3BB6A 2ZCWA 3ALQA 4CVUA 1AYM1 4AQ2A 2XBO1 1B35B 4CU8A 5FO9B 4PLMA 3JBG3 3VBSB 4I0AA 5GZCA 1U5YA 1TMF2 4OVEA 1REFA 2G9GA 4GWNA 2PA7A 4OQ9A 2RM21 2A3YA 4KG0A 1F31A 5FYSA 2PFWA 5KBFA 4COYA 4LITA 5T5OA 1RHI1 1WKYA 2FQPA 1LOEA 1TQ5A 2B42B 2J1RA 4TSVA 3NMBA 2D3RA 5JPNB 5F5AA 3LIHA 1ND2A 1NA1A 1PO11 3I3EA 1H6XA 3IPVA 3B02A 4JVAA 5DPNA 1PX3A 2ZGPA 2P4EA 1C57A 2RS11 5AC91 4RHV3 4F83A 4FSJA 2W0XA 3WDWA 4IGPA 5BNQA 1DQ1A 4BXFA 5FMCA 1Y9GA 5A3WA 2TEPA 1BVVA 1OVSA 1PO23 1QH7A 3LGRA 4JRLA 5FPLA 3GYDA 4EE2A 1AX1A 4LOTA 3U14A 4IEVA 4UBGA 4LKSA 4OHZA 1CZSA 1L7RA 2X09A 2V09A 3OPWA 4QHBA 3WQBA 2XH6A 2Y8KA 1G9CA 1DGRA 2BV4A 1BYHA 1UZ0A 2F17A 4LUMA 1RXGA 2BTVC 3PL0A 2LRPA 4LKEA 3J7MA 3FBMA 5ERLA 4XABA 5FY0A 1RUG3 3S6PA 2P3JA 1XNBA 5C5UA 3MUY1 3AKSA 2RR12 2V5DA 2XB6C 5HI0A 5K0UA 1IQDC 1HQNA 5F6KA 4YW4A 4ZY9A 4JGZA 1IG0A 4MXVA 5I0TA 5KXBA 1AF9A 4CCJA 2CL2A 4FXGB 4A3ZA 2RS51 4RS5B 3GHNA 1VBC1 3WF0A 3Q8FA 2VL4A 3V0AB 4P08A 1PMIA 3OUIA 5A3TA 4HN0A 4CSWA 2R061 2WSUA 2B8MA 5EJ3A 4FFFA 1WCDJ 1UZYA 3M3EA 1W06A 5FMOS 3O1SA 2VTXJ 4D6SA 1CIWA 5FYZA 1N47A 2VOTA 3VUOA 2V5YA 3AB0A 1XE7A 4XJAA 1FATA 1YQ5A 4AVAA 1TMF3 5K0UC 2ATFA 5SV5A 3IWZA 4N8MA 3VL9A 1UX7A 4YGBA 2Y6FA 3HPNA 3PTRB 2E7TA 4L92A 4QDRA 4EZHA 5LEJA 5IVFA 3QCWA 2YC4A 1J59A 5K0UB 3RJRA 4BWOA 3LEMA 4XJ8A 2HBUA 2IVIB 2PHXA 3LDBA 3WQ0A 1C1LA 1LU2A 5IFTA 1G9FA 1W99A 2YY1A 4IGQA 1Z7S2 4JGZB 3GZEA 4YW3A 1YCIA 1YQCA 4Q4V3 5CG8A 1W8UA 1D4VB 2LROA 4Q4W3 2VULA 5CVRA 2UURA 1I5PA 4JKKA 5LY2A 3U11A 2WLPA 1MZ6A 2VZRA 4OHXA 3EO6A 5L7OB 4OYUA 1JHNA 1YWKA 1OT5A 1CAWB 3K4ZA 1X8MA 2D6OX 3DN7A 5T50A 1NQJA 2ZX2A 5CAZA 2YG0A 1U12A 1QJX1 1ULOA 1GNZA 1GZWB 3GZUC 1GOGA 3CF6E 1XU2A 4BIOA 2IXLA 5T55A 3KMHA 4AVVA 5DUWA 5KHGA 1BQPA 1LULA 2CDOA 1CX4A 2IXIA 4QMAA 3BTXA 4PDWC 1ND2B 1FPN2 4P9IA 3IPVB 3WW3A 2OS2A 3S30A 1WLWA 1RGSA 1FX5A 3KV4A 3POSA 3C7HA 1YFYA 2B9UA 4ZU7A 2X53S 5F3GA 4CPBA 1LOBA 3BVCA 5EWSA 4NIDA 1ZZ9A 5LZ6A 1SFYA 2RM22 2I74A 4ZXEA 2C9KA 2BOIA 2PHRA 3Q8BA 4P9YA 2BPA2 1O4ZA 4DXTA 4Q8KA 1AJKA 4IL7A 4K1ZA 1YXWA 1QOTA 1PGW1 1WMFA 2WNVB 1RUF2 3ACHA 2D6NA 3N35A 3H3LA 3AZVA 5L7OA 4MVTA 5HPOA 3BKZA 1XSQA 4QGLA 1GZ9A 5E8AA 4F7ZA 5JDBA 1VMHA 5FMDA 1S1AA 5CADA 3WY6A 2GH8A 2HYXA 2QQVA 3V56A 1JN2P 5CFCC 1JYCA 3UKTA 4YZ1A 1S0GA 2VMIA 2FHRA 4NPLA 2VZPA 2VC9A 1XQNA 2QUOA 3MI8A 1POV0 4BQ5A 4CEWC 4XF1A 1RJ7A 1PZ8A 2XKPA 1SHWB 3CBNA 3HMYA 3MW3A 3WCSA 3WF2A 3OEBA 2CAUA 2NM1A 1AYN1 1ASJ1 2YROA 3I3QA 4ITCA 5FZAA 4ZXKA 4GH4A 1QJZA 3I2GA 4HT1T 1HXS1 4D0QA 4DY3A 5J98B 1YFXA 4IEYA 1ZRIA 3PVEA 1OKOA 1XRUA 3H7JA 3MIDA 4MGYE 3WNXA 4BA6A 4IEZA 1SDWA 1J3PA 3OG2A 5CFDA 4IEUA 4HKOA 5FLJA 3M8LA 4NRMA 3N9PA 1O8PA 5EZWA 5JVVA 4CEYA 3L2HA 1YC61 2YDEA 2YU2A 3MGUA 4HVRA 1HJFA 1FMD2 2I45A 4A44A 4AQ6A 5C3SA 1JYTA 4KG8A 3HN1A 2VBBA 1LGBA 4W6XA 2J1TA 3MF9A 3MIGA 2OT7A 5K4LA 3OPZA 4RHV1 1D2SA 3PVOA 4Z92B 4FFIA 1GMMA 4KMQA 1YQ6A 4DIQA 4FOQA 1DHKB 3VHOA 2PHWA 2ZEYA 3CNAA 2H0VA 1UZZA 2WFPA 1WMDA 2UU8A 5FBZA 5BY5A 4XUQA 3B9CA 5A7WA 3POWA 4PF1A 1RUE1 2QQIA 4JTOA 4RN5A 3NV1A 2CHHA 1H1MA 5A7PA 1JOJA 1BEV2 3MICA 5F8PA 3ZM8A 4Y22A 4NIHA 1C8M2 1W6PA 4GAZA 4QWNA 1FV3A 3SEEA 1RMU2 1NCRB 4N7UA 4KNCA 5KHKA 2A7AA 1MEC2 3VB9A 3DYOA 4BPZA 1AJOA 1PZ9A 2LW8A 1OH4A 2WQ4A 1E5HA 4YPJA 2OQ6A 2VUCA 1COV1 3X29B 3ZYJB 3J7NA 2RHPA 3WG3A 2EIDA 5DUUA 3UGHA 2FDIA 4EN7B 3I3MA 4Y24A 5H9PA 4Q29A 3RRDA 3RZGA 1VBC3 2JD9A 4Y1ZA 3MFCA 2HWC1 3C7OA 3JB4C 1GR3A 1FOD1 2D98A 3WNPA 4ASKA 1UKRA 1U5IA 4RR3C 1KGYA 5FP3A 1UOGA 3E5UA 1O3TA 4MG2A 2D6KA 3MLJA 5C9AC 4LLOA 4CP1A 3JQWA 1O6UA 4ZPIA 3KV5A 4TTGA 1AZDA 5BNPB 3VLBB 4DUWA 1OOPB 1TME1 2BUKA 2WDBA 1ZBA2 1B09A 2RMU2 3HQRA 5ABJA 1V9U3 2W39A 3T3YA 3WT3A 4JKLA 3RFRA 1JXNA 1K12A 1FNYA 5B4NA 4N53A 4AEJA 5J36A 1JZ7A 5A6ZA 3PDQA 5FIXA 5J96B 3MLLA 4P02B 4BM8A 4MLOA 1AXYA 4HSJA 4GA9A 3G7DA 3TN93 4DZGA 4X8NA 2W1UA 4QQLA 2ZZJA 4CDWA 3P3NA 4META 4I0WB 1TMF1 2JD4A 1TE1B 2ZKLA 3RGBA 3WR0A 4P9LA 2VZOA 3L9JT 1KFUL 1RXFA 2VMEA 1URXA 3JU9A 5CEHA 5DG2A 1IS4A 2ZEXA 2OPKA 3E6CC 1BLZA 4QX1A 1BHGA 3FLRA 1CAWA 1NUKA 2P37A 3UT0A 4TLGA 4GMP0 5GZEA 1XXNA 2OQ7A 2VO5A 1LOCA 4NWVA 2WA3A 3VBSA 1WD4A 3FLTA 3JQXA 3KM5A 3IMNA 4GKYA 1RMU3 2O0OA 3HVDA 4GB31 2N7GA 3OGRA 4YW7A 4HONA 2D5HA 4LHKA 1KJRA 4OHVA 3RZMA 2X5IB 4BMBA 2XG3A 2VZVA 2UY9A 4WVZA 4LA2A 3V0BB 1FYUA 4Z2WA 1C1FA 4CXYA 1ENSA 3TOJA 5LK7B 1DZQA 1XBFA 1VE0A 4WM7A 1UO9A 1K42A 3EB7A 3MPBA 2JG9A 5F32A 1ND3A 3LD8A 3O1PA 1Q5OA 4CCKA 3ACIA 1VBD2 1W6PB 1F35A 1RUJ3 2QQUA 1UX6A 1YUDA 4IV3B 2WNVC 3ZIXA 4AHWA 5JOYA 3DYMA 4E4HA 1S0JA 3DECA 3J8F3 2EIEA 4E4SA 4NHKA 4XUNA 1ZBE2 5IJRA 5KXCA 1AR81 1OOPA 2W2IA 1RJ8A 2JG8B 2BGCA 2XLAA 1HRI3 3I59B 2XXZA 1RYYA 1WCKA 1YEWA 2WRAA 1NCQB 1WA6X 2VY0A 5FO8B 1RUNA 1IS5A 2IXJA 1NCRC 2PAEA 4CCLA 1YI9A 2XR4A 1W8WA 3OYWB 3I2JA 1YLLA 4LK6A 4Q2FA 2R0FA 4YGCA 1QH6A 1EPZA 4YVSB 4NO4A 4IE5A 1H8VA 4XFIA 4DNYA 4NAMA 4AWDA 2FZ2A 1H8TB 1BMV2 4UYBA 1DQ0A 4UFIA 4LORA 4I3PA 1SLTA 4KBZA 1HV0A 4KU7A 1LTEA 4IV1B 2JXAA 3RG0A 1ZRCA 4AR2A 5FZLA 3H50A 4LPLA 4YYOA 3WF3A 2VMDA 3RYRA 1EAH1 2P1BA 5F5CA 1Y3TA 4AOCA 4XQDA 1PVXA 4IV3A 3ZOIA 2RR11 1CD3G 2QQMA 3HQUA 4QU1A 3B3QE 5FP8A 5IVVA 5FPAA 4CU6A 3VZMA 1W6NB 4RQPA 1IKQA 3R05A 1QF3A 2AEZA 3ZXJA 4GD4A 4LBNA 2MEV2 2DCKA 5F37A 1NCQA 1PK6C 1HRV2 1QQP1 5HBAA 2ES3A 3AYEA 3A23A 1HB2A 4XIKA 4BH9A 4E4ZA 2AEYA 4MHUA 3WDUA 1K5MA 2D3PA 3GHMA 2EVXA 2ZZQA 4XF0A 3WX5A 1JUHA 1UXZA 2D6MA 1PVC3 2FCUA 4OLLA 1V6MA 3VBOB 2PN5A 4S2FA 2WWUA 2VXJA 1FNZA 1SLLA 4GULA 2GNDA 3RVHA 2HBTA 2EAAA 2RV9A 2VMGA 3ZSMA 5EXOA 2YFZA 1QJFA 2W08A 3FL7A 1U0AA 2ARAA 4FAHA 2X8KA 4Z1VA 2VCBA 1I5ZA 4LBKA 4QX7A 1UW8A 2DCTA 2XVGA 4UF0B 4WVVA 3W58A 3POBA 3OCPA 2NMNA 4RFRB 3OY8B 3ZN5A 1U5XA 1DBNA 2ZBJA 2ERFA 4XOGA 2OZJA 4UOJA 2R0HA 2W9XA 4BQ4A 4HKWA 4RHV2 1N3PA 1NXD1 4UW5A 5JXGA 5FZDA 1J1LA 1RUC1 4QXKA 1O4TA 3UNPA 1HW5A 2J22A 1PZ7A 1GSLA 1P8JA 1N3OA 1LCLA 1UIKA 1AR92 3WDVA 3AC0A 3OBAA 5B2GB 3S5AA 1D0HA 3K4AA 3VBUA 5FO7B 4D7SA 4QX0A 4B4QA 1PGW2 3NNJA 5C9AB 1V0AA 4A6OA 3MPPG 4HPKB 4FOYA 2GMMA 4MGKE 4AGGA 4I02A 2MNGA 5BNNA 3O1TA 2PLV3 4LLFA 5FQ0A 2HWF3 4CZSA 4CU9A 1JU4A 1D4M3 1WCQA 1HB3A 2D44A 4Q1RA 4XBLA 2DCYA 4QKNA 2A6VA 3ZFGA 3EYPA 3WCRA 1V6NA 3VBHC 1RUG2 2HWF1 4DXRA 2K2SA 4Q4X1 3OY8A 1SBFA 1C28A 4N53B 2DUPA 2WFF3 1RTVA 4MZUA 3BU7A 5LA2A 3VD3A 1HQWA 2OPWA 5I8TA 4GJZA 4IW3A 2WNOA 4KWJA 4QPGB 3T0BA 1CX1A 2JECA 1GOFA 1WW5A 3MEPA 4NIGA 4IEQA 3ZMNA 1IOAA 4D3WA 3BIEA 1HRV3 3AP4A 3VHRA 4HZFA 1OF3A 2QE3A 4TN7A 4WV8A 4DUVA 3WZ1A 2WYSA 1I1EA 1ZNPA 2JICA 5FZGA 4Y3OA 5IYYA 2CDPA 5FQ0B 3J9SA 4X6QB 3W21A 3VZJA 1MR5A 2Y0IA 1ULGA 4H7LA 1XYPA 4CRQA 5EQUA 5FLHA 1LJ7A 1JMUB 3KGZA 3THCA 4QKDA 3FHAA 2H6CA 4HBNA 1Z0HA 4YW1A 2VOWA 3DYPA 5FRAA 5G05L 3DPRB 3EBRA 2R043 4HK8A 1VR3A 4M3CF 1CVNA 2HWE2 5CZKA 3OF1A 5FXVA 4EN0A 2ENRA 1WWYA 4LXLA 5EJZB 2E51A 2J7MA 1CPMA 1BXHA 4LHNA 3R4UA 1R083 1SBDA 4NHLA 2Q1FA 5GJ6A 1D0GA 2Y60A 4Q4X2 1X7NA 2OYZA 1YI7A 3A0NA 1GKBA 1A8MA 4IDZA 4M3CE 4QHOA 4FI9A 1WLDA 4V1PA 5J7MA 1CWPA 1PGL1 1RMU1 4YFZA 1DZRA 2BNOA 5BNPA 2VZ1A 4UI9L 1H1AA 3AKPA 1MS0A 3PLQA 4WZCA 1LOFC 2DTYA 4N9HA 3HAGA 1POV1 1J1TA 2B9VA 4CDXB 4XETA 2PHFA 4LKFA 3T08A 1HLCA 4FXKB 3D5OA 2PAKA 3KQRA 4Y22B 1RUE3 3AMHA 1AR61 4WM8A 3DKWA 2C0ZA 3T2PA 4LBQB 3WNOA 1QNWA 3M70A 3RI9A 4UAPA 3CU7A 1UCXA 4XAEA 2FDFA 4H3WA 1JH5A 1SEFA 5LBBA 2JDUA 3R4DB 1GUIA 1S0BA 2UYAA 1FOD2 2ZMLA 3ZSKA 2ID4A 4DY5A 1OFSA 3NNFA 1MQTC 5FZOB 3CO2A 2K0GA 3ON7A 4QDSA 3WW4A 3LE0A 4FFGA 3IN9A 1UYYA 4P5HA 5GZFA 1ENRA 3GZAA 4LIVA 3O1UA 2MEV3 2ZX0A 5ACA3 1AR83 4K21A 5L9RA 3VBHB 1I6XA 1UN1A 2CYFA 5A1LA 5C4WB 4LTAA 4RGKA 5FY1A 1RUF3 4DEVA 5FR3A 5JXIA 3USUB 2AZ5A 3A22A 5FYCA 3BTYA 3WP6A 4B7EA 1PGL2 1HXS2 4YM1A 3TEYA 2RDSA 2ZGKA 2WLQA 3OSDA 1AYM2 4YM2A 2XJRA 1ZZ8A 1AL21 4PDWB 2E33A 4AZZA 1RUC2 2XKOA 3VBFA 4QQOA 1O3QA 3SLIA 4KQ7A 3ZXAC 2YC2A 4K9SA 5JMOA 2C26A 1UPIA 4LO8A 1QWRA 5J1XA 1RUI2 3W59A 1W6OB 2BFUS 3FUOA 3LB9A 1LEDA 3N7JA 2BNNA 4JDOA 1US3A 4OHYA 3O0XA 3THPA 1E5RA 5J3UA 1GYKA 3T09A 2JX9A 5FUPA 3O1OA 2P5BA 5BNNC 4FVVA 2JDNA 2Y6HA 2XUEA 2DUOA 2VCMA 1SQ4A 5A6XA 4Q4X3 3SKVA 3OGVA 1BK0A 3UL2A 1EPWA 4QQPA 4UFJA 4IE0A 4AG4A 3T1LA 4XFBA 4YARA 1V9U2 1AR72 2Y0OA 5CG9A 1OF4A 2D6PA 4RGGA 1JYVA 1CQ9A 3VBOC 1K3IA 5E89A 4KWKA 3KT1A 3JB8A 1PO22 4ISRA 4KWLA 3WQ1A 4AQSA 1JYNA 3B01A 3ETQA 4IUGA 3O1MA 1L7LA 4R8HA 3OD0A 4H2AA 3WQ7A 1PK6B 4XMAA 3N9MA 4GQ7A 4HETA 2JDYA 1WBFA 3L2YA 5DABA 1OOPC 1VPHA 5FZCA 1S2BA 1YO8A 1UL9A 1BEV3 2GZWA 3WINE 2VOVA 3E1F1 3OD4A 2VH9A 3KVAA 1H2LA 2SBAA 2VXRA 2BERA 2E53A 1QJX2 2EA7A 4J25A 5LBFA 4M4PA 4A7YA 2WZ8A 4AI0A 1F5FA 4Y33A 2XGXA 3T30A 2IFRA 3MHZA 3AKRA 1OH3A 2AR6A 2ARXA 1AR82 2HWC3 3DGTA 3H3ZA 1UOBA 3I2FA 3MIBA 5ANNA 3WP3A 2A73B 1NG0A 4B7KA 3NJYA 3O1VA 2DBNA 3IAPA 5JOXA 3CLPA 4GALA 1VJ2A 4FFHA 5A80A 2VQ0A 4P9XA 2GMPA 2BFUL 3JBG2 4GH4C 2FBEA 4YW5A 5FZ7A 3VGIA 1XNAA 4LMFA 5FZOA 2JIGA 3NNMA 2AUYA 2ZHMA 1G6NA 5BYNA 2AC1A 4BCUA 3LDRA 3RYKA 4CXWA 2E32A 4LBOA 4XYXA 3LOBA 4D7YA 4LO6B 1VBB2 3F2ZA 2P34A 4IERA 4Q0SA 4IEXA 4NHXA 1VBD3 4OCTA 5DN2A 3NAPA 4NOTA 4AEKA 4M3CB 3PHMA 5SV8A 4C0HA 3VBRA 3NO8A 3AVSA 4Y1XA 4INDA 1T2XA 2NZ9A 3H42B 3HJRA 1I3HA 3LZZA 1ZBA3 2RMU3 3M7AA 4JC1A 4LEJA 4C1WA 1OD3A 5L7OC 4J1WA 4XFAA 2VZUA 1HKDA 3AMNA 1CZVA 2KXLA 5L36A 1GZCA 2RDNA 3K51A 5C33A 5AC92 1ASJ2 5IHRA 1Y9MA 1VRH2 3PU3A 4QQHA 2HWD2 4OI0A 2YC0A 2QQPA 4IE6A 4DXSA 2VOKA 4AFCA 4GJYA 4AVTA 4ZHNA 3RZJA 5C5TA 4XFFA 5K9YA 3GCXA 3RMXA 3KZ4C 4FPHA 3PJQA 5IAXA 3MBWA 1JTZX 2XMLA 1XYNA 4NWWA 2K46A
chains in the Genus database with same CATH topology
3PTRB 4D6RA 5A7WA 4EZHA 2YBKA 5IVFA 5A7PA 2GP5A 5FP4A 4E4HA 3K3NA 5FY5A 4DO0A 4BU2A 4D6QA 5FUPA 2P5BA 5A7NA 3LDBA 5FZFA 5KR7A 5IVBA 2XUEA 4QXCA 2W2IA 4IGQA 4GAZA 4QWNA 5FXZA 5FJHA 4GJZA 2XXZA 5FYUA 5FYYA 5IVYA 5FZIA 5FZHA 4CCLA 2YBSA 5LW9A 2OQ6A 5FY8A 4TN7A 4V2VA 5LY2A 5FY9A 4UF0A 2PXJA 5A7QA 5FUNA 5FZGA 4Y3OA 3PUQA 2WWJA 5FZKA 3KVBA 4IGOA 5FZMA 4CCOA 5ANQA 3N9MA 2YPDA 4URAA 3KV6A 4XDPA 5F2SA 5FZLA 4ASKA 3K3OA 5A7SA 2YU1A 5FP3A 5FZCA 5F5CA 4C8DA 5FWJA 4HOOA 5FPUA 2GP3A 5FYSA 5FXVA 3U4SA 3DXTA 2OS2A 4LITA 4LXLA 5FP8A 4QU1A 5FY7A 5IVVA 3KV5A 3KVAA 5FPAA 3KV4A 3UYJA 2YBPA 5FYBA 5FYVA 5FXWA 5F3GA 5F5AA 2Q8EA 4CUGA 2OX0A 3N9QA 4Y33A 4EYUA 4QXHA 4GD4A 1VRBA 5FPBA 5F37A 4BISA 4QX8A 3OPTA 5FY4A 4IGPA 5IVJA 4BXFA 5FXXA 5A7WB 5FBJA 5FZBA 3NJYA 5A3WA 5F39A 5FPVA 5FPLA 3U78A 3DXUA 4CCNA 3PUAA 5A80A 3PDQA 5F3CA 5IVCA 5FZ7A 5FP7A 5FZOA 2WWUA 5IW0A 3ZPOA 3OPWA 5F3IA 2Q8DA 5FYMA 5LY1A 5FZ1A 3RVHA 4AAPA 3PU8A 3ZLIA 5A3PA 5IVEA 5FZ6A 4EZ4A 4LIUA 5FJKA 3PURA 5FP9A 4QX7A 3AVRA 4AI9A 4UF0B 5A1FA 5CEHA 5FZOB 5FY0A 5E6HA 5F2WA 5FZAA 5LWBA 3N9OA 5FZ0A 5IWFA 3AVSA 5FZ9A 5FYHA 5F5IA 4LIVA 5FYIA 5ISLA 2OQ7A 5FWEA 5FZ8A 5FZDA 5FZEA 4CCJA 4QXBA 5A1LA 5F3EA 5FY1A 4HONA 3PUSA 3N9PA 3N9LA 2Q8CA 2XDVA 5FYCA 2YU2A 5A3TA 4CSWA 4XDOA 5FZ4A 3PU3A 2VD7A 5K4LA 2OT7A 5A3NA 3KV9A 4CCMA 3N9NA 5FZ3A 4GJYA 4DIQA 3K2OA 5FYTA 5F32A 5FV3A 4V2WA 3AL5A 3LD8A 4Y4RA 5FYZA 3AL6A 4D6SA 4NUBA 5A7OA 2XMLA 4CCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PTR B;  4D6R A;  5A7W A;  4EZH A;  2YBK A;  5IVF A;  5A7P A;  2GP5 A;  5FP4 A;  4E4H A;  3K3N A;  5FY5 A;  4DO0 A;  4BU2 A;  4D6Q A;  5FUP A;  2P5B A;  5A7N A;  3LDB A;  5FZF A;  5KR7 A;  5IVB A;  2XUE A;  4QXC A;  2W2I A;  4IGQ A;  4GAZ A;  4QWN A;  5FXZ A;  5FJH A;  4GJZ A;  2XXZ A;  5FYU A;  5FYY A;  5IVY A;  5FZI A;  5FZH A;  4CCL A;  2YBS A;  5LW9 A;  2OQ6 A;  5FY8 A;  4TN7 A;  4V2V A;  5LY2 A;  5FY9 A;  4UF0 A;  2PXJ A;  5A7Q A;  5FUN A;  5FZG A;  4Y3O A;  3PUQ A;  2WWJ A;  5FZK A;  3KVB A;  4IGO A;  5FZM A;  4CCO A;  5ANQ A;  3N9M A;  2YPD A;  4URA A;  3KV6 A;  4XDP A;  5F2S A;  5FZL A;  4ASK A;  3K3O A;  5A7S A;  2YU1 A;  5FP3 A;  5FZC A;  5F5C A;  4C8D A;  5FWJ A;  4HOO A;  5FPU A;  2GP3 A;  5FYS A;  5FXV A;  3U4S A;  3DXT A;  2OS2 A;  4LIT A;  4LXL A;  5FP8 A;  4QU1 A;  5FY7 A;  5IVV A;  3KV5 A;  3KVA A;  5FPA A;  3KV4 A;  3UYJ A;  2YBP A;  5FYB A;  5FYV A;  5FXW A;  5F3G A;  5F5A A;  2Q8E A;  4CUG A;  2OX0 A;  3N9Q A;  4Y33 A;  4EYU A;  4QXH A;  4GD4 A;  1VRB A;  5FPB A;  5F37 A;  4BIS A;  4QX8 A;  3OPT A;  5FY4 A;  4IGP A;  5IVJ A;  4BXF A;  5FXX A;  5A7W B;  5FBJ A;  5FZB A;  3NJY A;  5A3W A;  5F39 A;  5FPV A;  5FPL A;  3U78 A;  3DXU A;  4CCN A;  3PUA A;  5A80 A;  3PDQ A;  5F3C A;  5IVC A;  5FZ7 A;  5FP7 A;  5FZO A;  2WWU A;  5IW0 A;  3ZPO A;  3OPW A;  5F3I A;  2Q8D A;  5FYM A;  5LY1 A;  5FZ1 A;  3RVH A;  4AAP A;  3PU8 A;  3ZLI A;  5A3P A;  5IVE A;  5FZ6 A;  4EZ4 A;  4LIU A;  5FJK A;  3PUR A;  5FP9 A;  4QX7 A;  3AVR A;  4AI9 A;  4UF0 B;  5A1F A;  5CEH A;  5FZO B;  5FY0 A;  5E6H A;  5F2W A;  5FZA A;  5LWB A;  3N9O A;  5FZ0 A;  5IWF A;  3AVS A;  5FZ9 A;  5FYH A;  5F5I A;  4LIV A;  5FYI A;  5ISL A;  2OQ7 A;  5FWE A;  5FZ8 A;  5FZD A;  5FZE A;  4CCJ A;  4QXB A;  5A1L A;  5F3E A;  5FY1 A;  4HON A;  3PUS A;  3N9P A;  3N9L A;  2Q8C A;  2XDV A;  5FYC A;  2YU2 A;  5A3T A;  4CSW A;  4XDO A;  5FZ4 A;  3PU3 A;  2VD7 A;  5K4L A;  2OT7 A;  5A3N A;  3KV9 A;  4CCM A;  3N9N A;  5FZ3 A;  4GJY A;  4DIQ A;  3K2O A;  5FYT A;  5F32 A;  5FV3 A;  4V2W A;  3AL5 A;  3LD8 A;  4Y4R A;  5FYZ A;  3AL6 A;  4D6S A;  4NUB A;  5A7O A;  2XML A;  4CCK A; 
#chains in the Genus database with same CATH topology
 4U36 A;  1K45 A;  3VZL A;  4IV1 A;  1OXC A;  2WT0 A;  4YM0 A;  3WDY A;  2W95 A;  4D6R A;  1CON A;  3ZFF A;  3O1R A;  2GDF A;  5E88 A;  3D8C A;  4XCB A;  1PGS A;  5I8S A;  1HRI 1;  4Y1U A;  3C2U A;  4QU2 A;  4QB1 A;  3LPG A;  4BU2 A;  1PNF A;  1ZZ7 A;  3I54 A;  1O7F A;  4OFG A;  2VUJ A;  4B1L A;  3ACF A;  1W8N A;  4FPL A;  2VR4 A;  2WO3 A;  4AK3 A;  1ZYB A;  2C4X A;  1DQ6 A;  1Y4W A;  4XEZ A;  4ZS3 A;  5D8A B;  4HL0 A;  4BLI A;  5FYU A;  5J09 A;  3T2Q A;  1DU3 D;  3AMQ A;  1Q3E A;  2RS1 3;  2HWC 2;  3M2M A;  2J1E A;  5FZH A;  4OI2 A;  1RHI 3;  3D0J A;  1XPW A;  2MHF A;  4JAA A;  4RGA A;  1CES A;  1LNS A;  1Q8V A;  4Q26 A;  3C8X A;  3KGL A;  4A3X A;  1YQ8 A;  3O5S A;  1YFW A;  5D2A A;  3LEK A;  3SH5 A;  4YZ5 A;  5KWR A;  1PO1 3;  1QGL A;  2R07 2;  5FZM A;  4QPW A;  3ZPY A;  2V4A A;  1STM A;  3ZYP A;  4FPO B;  3WUD A;  1ODM A;  3RDI A;  1UZW A;  4IQP A;  5F1R A;  5A7S A;  2XVK A;  4EWD A;  3F95 A;  4HOO A;  2VZ3 A;  3M3C A;  3WNL A;  4NE9 A;  4HPK A;  2RS3 1;  1Z7S 3;  3QH6 A;  4CU7 A;  1HRI 2;  4BOW A;  5C4W C;  3BOP A;  2W52 A;  1BJQ A;  4E2G A;  1H4G A;  1JZ8 A;  4XUR A;  3BIW E;  5FY4 A;  1AR9 1;  1Z7S 1;  2VBD A;  4FPJ A;  3ZYG A;  4AI3 A;  4PIY A;  1H30 A;  3VD5 A;  4BB3 A;  1LGC A;  2O14 A;  2VNO A;  5CA6 A;  4Q4Y 1;  1E5S A;  4C1X A;  2X5I A;  3HEI A;  2DCJ A;  2B7Y A;  1BBT 3;  2FMY A;  3M3I A;  4O61 A;  2YUE A;  3HQX A;  3UV9 A;  4RQP C;  1UU5 A;  3PIJ A;  1VRH 3;  1QY4 A;  2OVU A;  1GZW A;  4K3U A;  1VBE 2;  3CKH A;  1AL2 3;  1MAC A;  3PVN A;  1G9A A;  2JEN A;  4TZD A;  5FP7 A;  5JI7 A;  5IW0 A;  4LQR A;  5ABJ C;  3BI3 A;  2G9Z A;  5CIR A;  1LKN A;  2EIC A;  1S0E A;  3ITQ A;  1O8S A;  3BOW A;  5LBC A;  4XCA A;  1R09 2;  1UYZ A;  2OA2 A;  3NJV A;  2WAA A;  1EAH 2;  1OSG A;  4YGE A;  2WZR 3;  5LWB A;  2VQU A;  1CGP A;  1KJL A;  4XFC A;  2GAU A;  5IWF A;  5JOW A;  3KLS A;  1VBA 1;  2WFF 2;  5I93 A;  2LUW A;  5CB7 A;  3T1M A;  2WIN B;  2VQT A;  2RJL A;  1VBB 1;  4S2H A;  4OUM A;  3HOB A;  5F3E A;  2G9F A;  4IE7 A;  3D82 A;  4X8P A;  2OW4 A;  4BIF A;  4LKD A;  2Q8O A;  4MGQ A;  3RWK X;  2ZS6 B;  2PHU A;  3NAP C;  2Q4S A;  4I3G A;  1DG6 A;  1W6Q B;  4NHY A;  5FTT C;  4FPE A;  3TAY A;  4BK5 A;  2D5F A;  1W9W A;  1HIX A;  4D8M A;  2VD7 A;  4E4D X;  1JZ6 A;  1LHW A;  5LK5 A;  3R4S A;  3MF6 A;  4Q0U A;  1LHV A;  4K20 A;  4PI2 A;  5JR7 B;  3E6B A;  4YRD A;  4CUC A;  5FKC A;  4JGY B;  3H1W A;  2HWE 1;  1QHD A;  4KWU A;  3WF1 A;  1X8E A;  4XBN A;  2PHT A;  4AFB A;  2R06 2;  4AHZ A;  4M4R A;  4BQY A;  2W46 A;  4XZP A;  3TYJ A;  3VBR B;  3KT4 A;  4JDM A;  5LCW L;  2WN3 A;  2Q0A A;  2JDK A;  4F8A A;  3IM0 A;  4HVO A;  3RJ2 X;  3LPF A;  4W6W A;  1DYP A;  1YFU A;  1XB9 A;  1F9K A;  1Y7B A;  1DF0 A;  1OI6 A;  2JEM A;  4YG3 A;  2YMZ A;  1KD7 A;  3LSE A;  4ARX A;  5CYY A;  5CNA A;  2Y38 A;  5EIY B;  2WWS A;  1N1Y A;  4ES8 A;  1C5I A;  4QT6 A;  3V0B A;  1ZA7 A;  3GXU A;  3OOX A;  3HR9 A;  4R9C A;  5JI9 A;  5FK7 A;  1O91 A;  2EF6 A;  2JE9 A;  3VHP A;  2DWR A;  3NAP B;  4CDQ B;  1BCX A;  1DZT A;  2PXJ A;  3HT2 A;  1OA4 A;  1FV2 A;  1DQ2 A;  1DP0 A;  2YB7 A;  3LWC A;  5FZK A;  2GNB A;  4FPY A;  3O0W A;  1X9T A;  2EIG A;  3ZYI B;  1IPK A;  1AL2 2;  3NW4 A;  5ANQ A;  2YPJ A;  2Z42 A;  4LHS A;  2GC1 A;  4X6R B;  4XXA A;  1Q8S A;  4Q8L A;  1RIT A;  4FTS A;  1CJP A;  1YJL A;  2DCZ A;  2A70 A;  2FDJ A;  3DUI A;  3KQ4 B;  5LA0 A;  2JWP A;  3LF7 A;  1QKQ A;  1M4W A;  3K77 A;  1W05 A;  1C8M 3;  1CN1 A;  1W8F A;  1XND A;  3DV8 A;  4TYS A;  5FYB A;  2XVL A;  3PVB B;  3THD A;  5IUQ A;  3JD7 3;  3SKJ E;  4BDV B;  2Q8E A;  2WNU C;  2OX0 A;  3ATG A;  3N9Q A;  4EYU A;  4FP3 A;  4A7K A;  2VW2 A;  4D7T A;  3JBG 1;  5CFC A;  1GZT A;  1OPM A;  5JSO A;  5JR2 A;  4GB3 3;  2SLI A;  5E16 A;  5FZB A;  2XQX A;  3FWE A;  3OEA A;  2WO1 A;  1IS3 A;  1JBC A;  1EUU A;  1OUS A;  1R64 A;  2ZGT A;  3E6D A;  2VCC A;  2ZJC A;  5EV7 A;  1LHU A;  3PTY A;  3P1I A;  1SMV A;  2Z4F A;  3WP4 A;  5C9A A;  2R32 A;  5DDJ 2;  3ENR A;  1ZZB A;  4XTM A;  2JB8 A;  2C24 A;  3DF0 A;  3N7M A;  2QQW A;  5F3I A;  3FX3 A;  5FYM A;  4CEW B;  5BNO B;  1POQ A;  2B39 A;  4JGZ C;  3TB0 A;  3U37 A;  4OZO A;  1MVE A;  4BK4 A;  5F9T A;  3ORJ A;  1JYI A;  4NIA A;  1RUI 3;  4ZZ5 A;  4YVW A;  1OUX A;  3A0K A;  1X9P A;  3SCG A;  1N1V A;  1DGR N;  3J4U H;  2VPV A;  4B8E A;  3SIS A;  2C9A A;  2QVS B;  1MQT B;  4C91 A;  5KXD A;  4Y4Y A;  3B7M A;  3UJQ A;  4RL7 A;  2WS9 1;  3OJB A;  2FZ1 A;  3EHK A;  3GBF A;  3PUS A;  4MGZ E;  1UOF A;  4NRO A;  5A3O A;  3SCF A;  3UK9 A;  1PO2 1;  3KS7 A;  4EN6 B;  1ODN A;  5KHI A;  5C6C A;  5J37 A;  3NJZ A;  1AYN 3;  2BOJ A;  4FPF A;  4OUE A;  2W3J A;  2GNM A;  5DG1 A;  3N9N A;  4QB6 A;  2EAL A;  5FZ3 A;  3UKN A;  3ZMO A;  1NLS A;  1J3R A;  5GKA C;  3RSJ A;  1GNY A;  3ABZ A;  4BQ3 A;  4YW6 A;  4EJR A;  1KDK A;  2ZMK A;  3BTA A;  1W6M B;  1W3V A;  1S0D A;  2HKX A;  3I2I A;  3PMS A;  2IWG B;  1C5H A;  3D3A A;  3QLQ A;  4RA0 A;  4BQX A;  2YFU A;  3CJI B;  2E7A A;  2J42 A;  1JZ2 A;  3K75 B;  2WQ8 A;  5FP4 A;  1GV9 A;  2RR1 3;  4XAA A;  1UOJ A;  3GJB A;  5FZF A;  1ZRF A;  3ELN A;  4IE4 A;  3I4I A;  3WDT A;  4G4F A;  5DZG A;  1JS9 A;  1SPP A;  3WNN A;  3AKQ A;  1IG3 A;  2XQR A;  4R4Z A;  1GOH A;  1JZ4 A;  1LRH A;  1VP6 A;  1XC6 A;  4LO5 B;  4WM7 C;  3S7E A;  1IKP A;  4KBB A;  3VD7 A;  5LW9 A;  4JV4 A;  2WJS A;  4GB3 2;  1GQG A;  2A5Z A;  4JRA A;  1S55 A;  3RZK A;  2CSG A;  4M3C A;  4FOW A;  4R9B A;  3QAC A;  1Q8P A;  2VJX A;  3PUQ A;  5GLW A;  4ZON A;  3WNM A;  4IEO A;  4PHZ A;  3ZFF C;  3JCI A;  1J84 A;  2VEC A;  3T2T A;  4E8D A;  3ZSE A;  1EUT A;  1X36 A;  3AMM A;  1UMH A;  4LBQ A;  3VN4 A;  1MS1 A;  3TBD A;  1VIW B;  2YPD A;  3IB3 A;  4HXC A;  4F3J A;  4ISQ A;  4JZR A;  1A78 A;  4S2D A;  1GNH A;  2X05 A;  4C8D A;  4D94 A;  1QNY A;  2GP3 A;  5GZG A;  1APN A;  1VBB 3;  4G9S B;  1W2A X;  4IES A;  4RSU A;  2BVB A;  1FXZ A;  2NYY A;  4A2U A;  3D4K A;  4Y26 A;  1PHM A;  4P9G A;  3AZZ A;  5JSP A;  5CKN A;  3KF3 A;  5GAL A;  2E9Q A;  2TNF A;  3WD5 A;  5C3R A;  3ZFE B;  2NLR A;  1XOY A;  4JQT A;  4M0N A;  4PJY A;  4QXH A;  3VKO A;  5CIS A;  4Q0P A;  5DAX A;  5EJ1 B;  4M0H A;  2I2S A;  4Q4W 1;  1NY7 1;  4JGY A;  4XE9 A;  4XUO A;  3OPT A;  2LS6 A;  4BME A;  1AR6 2;  4K8F A;  1MS8 A;  5LA1 A;  1CAX A;  2XJV A;  5IAT A;  5A7W B;  4L8Q A;  5CFD B;  5GLU A;  4AHY A;  4MYE A;  4QGN A;  4LT5 A;  4QKF A;  1VMJ A;  4CDU B;  5CKQ A;  2ZGR A;  4R9D A;  1AR7 1;  2R1D A;  1XNC A;  5DUX A;  1OC1 A;  3ACL A;  3CZU A;  4XHX A;  3T0A A;  1AYN 2;  1MPX A;  2GH2 A;  4XUP A;  4CUB A;  5J48 A;  1RUH 2;  3J8F 1;  1XNT A;  5CBL A;  2KD7 A;  5BNP C;  2A6Y A;  4H14 A;  2VVD A;  1LEM A;  1OLM E;  3ZN4 A;  1V00 A;  1H2M A;  3URF A;  2UWC A;  3AP9 A;  4LE3 A;  5T5P A;  2ZEW A;  2WKK A;  5CU1 A;  1JU3 A;  3JD7 2;  3O0V A;  1FMD 1;  4QKB A;  2CU5 A;  3VDD B;  4BQW A;  2QCS B;  3CJI C;  3EJK A;  4QX3 A;  3VBU B;  4KU8 A;  3AZW A;  4Y5T A;  1KIT A;  5T52 A;  3VDD C;  4MXW A;  1ZZC A;  4DS0 A;  3W9A A;  1MVQ A;  2DFC A;  3WUC A;  1H2K A;  2VW1 A;  4FQ4 A;  3H8U A;  1TG7 A;  1ZVF A;  2WN2 A;  4UFK A;  2VMH A;  2GSY A;  3POF A;  1AUY A;  1J3Q A;  4P9W A;  1K5J A;  3ZFG B;  4CEW A;  1QXP A;  4AQT A;  4DPN A;  1KRI A;  1FAY A;  4MGT A;  3LDK A;  1TNR A;  5FOB B;  2DYC A;  1W03 A;  3HN3 A;  2XBO 3;  4QPI C;  3VKN A;  4ET7 A;  1WLT A;  5I0R A;  1FPN 1;  3ACG A;  3KD4 A;  5HXM A;  4R52 A;  3RNS A;  5EP9 A;  3RWN A;  2R6Q A;  2AEN A;  4W65 A;  3VDD A;  4LUL A;  2FDG A;  2O1Q A;  3AJY A;  2A3X A;  5AVP A;  4CP9 B;  3CL1 A;  3IDE A;  3VBO A;  5I0U A;  1L3J A;  3CDZ B;  3IZO A;  4MXW B;  1R08 2;  2RE9 A;  2QQL A;  4WBB A;  4HK9 A;  3H3U A;  5AVA A;  4Z2A A;  1YRZ A;  3ZFG C;  3CHX A;  4CDW B;  4YM3 A;  5AC9 3;  3U10 A;  1WW7 A;  3VHN A;  5FZI A;  2B45 X;  3IMM A;  4EWE A;  1OA2 A;  2ZX3 A;  5BUV A;  2RS5 2;  3LA7 A;  3AP6 A;  4GMP 1;  1N3Q A;  4UF0 A;  1WD3 A;  5L9B A;  5FUN A;  4BE3 A;  1UU4 A;  2D6L X;  2XL7 A;  3JUU A;  4W4Z A;  1A3K A;  4P9J A;  4MO3 M;  1Q8Q A;  5EHD A;  2CV6 A;  2KA3 A;  4PCR A;  5B4X A;  3IIA A;  3AYA A;  2WNU A;  4QPI B;  3PUH A;  4L97 A;  2D43 A;  1RUH 3;  1W9S A;  2VZQ A;  1I9R A;  1EP0 A;  3GAL A;  3SH4 A;  2YXS A;  5H9Q A;  2YU1 A;  3TN9 2;  2OUJ A;  2R7E B;  2Y6J A;  4YVS C;  4FBF A;  4OZX A;  3TWI A;  5FPU A;  1U5Z A;  5CKM A;  1TEI A;  3ILF A;  3ME2 A;  2WS9 3;  1VAV A;  1RC6 A;  1SFP A;  2VMC A;  2Y34 A;  5FYV A;  4HN1 A;  4Z8B A;  3FZ3 A;  3IAQ A;  4CUG A;  1CAU A;  3MZH A;  1UWW A;  2VBP A;  5H9R A;  4QM9 A;  5FRE A;  4CYD A;  3ZXK A;  1RUD 1;  1GP4 A;  2W5F A;  1OQ1 A;  3D6E A;  2D93 A;  3M3O A;  5FOJ B;  3NQH A;  2BU9 A;  4NR1 A;  5C8C A;  2CAV A;  1PIV 1;  3CJI A;  4CCN A;  3PUA A;  3AYD A;  3ILN A;  1WME A;  3PME A;  1PO1 2;  2R07 3;  2RVA A;  1QQP 2;  2ETE A;  4QAW A;  1AXK A;  4UWD A;  3FUQ A;  1RUC 3;  2HWB 2;  2EXJ A;  2JG8 C;  1NLQ A;  2IZW A;  3Q9O A;  5IFP A;  1RIR A;  3C7G A;  2VVF A;  4LIU A;  1VBA 3;  1EY2 A;  1LHN A;  3CMG A;  4C0B A;  3I2D A;  3NWK A;  5A1F A;  3BTZ A;  3MV0 1;  2AGS A;  3FBY A;  1OMI A;  1EV1 1;  3KT7 A;  1PVC 1;  3I7D A;  2JIJ A;  3J8F 2;  1H8T A;  3ZR5 A;  1TZO A;  4COV A;  4AED A;  1O4Y A;  3VD9 A;  4HAN A;  3VDC A;  2C5D A;  2ZEZ A;  4E8C A;  1ZRD A;  1R09 1;  4A41 A;  4JHZ A;  3POY A;  1L7Q A;  1X82 A;  3Q8E A;  3U75 A;  2PAM A;  3DPR A;  3HNM A;  2QQJ A;  2ZGM A;  3E5X A;  1GWM A;  3IBM A;  2OKX A;  1WBL A;  2D3S A;  2EAK A;  4NJ4 A;  4HSL A;  3NJX A;  5FZ4 A;  3ZYB A;  2TUN A;  2ADE A;  1W6M A;  2DVF A;  4CDW C;  4LBQ D;  1KS5 A;  3KV9 A;  2A6W A;  2BNM A;  3BCW A;  4JKM A;  4UW4 A;  2A3W A;  4YVW C;  4Q1P A;  1SZB A;  3S57 A;  3AL6 A;  4YFW A;  5GLV A;  3DPR C;  2RJK A;  2ZGL A;  1US2 A;  2X10 A;  2CTV A;  4COZ A;  2WZR 2;  3WLU A;  3FHI B;  3CZJ A;  3K3N A;  5FY5 A;  5A33 B;  3VBF C;  5ACA 2;  3S0M A;  1ND3 C;  4FQZ A;  1ZZ6 A;  3U07 A;  4PIZ A;  5C70 A;  4N90 A;  3EXU A;  1BMV 1;  1H1I A;  5D1I A;  1HV1 A;  2WAB A;  3J7L A;  1D4M 1;  1OLR A;  3TEW A;  3MFA A;  5FAX A;  5DXD A;  2R30 A;  2CGO A;  2IXC A;  2NMO A;  3H0O A;  3NVC A;  4OI4 A;  3MDP A;  3ZX7 A;  5ABJ B;  2BJS A;  2XPJ A;  4V2V A;  4AGR A;  4PDW A;  5DAQ A;  1WW6 A;  4IEW A;  1CAV B;  2ET7 A;  1OQD A;  3SXW A;  4UW3 A;  3KCY A;  3U4X A;  1UIJ A;  1UKG A;  2ET1 A;  1RVF 3;  3GNE A;  1HQL A;  4OMD A;  3VBH A;  2GU9 A;  3POI A;  4NRQ A;  3RPQ A;  1MZF A;  1OLQ A;  5C4W A;  5LRS A;  3DEM A;  3LA3 A;  1WMX A;  2DDU A;  4XDP A;  5F2S A;  2ZX1 A;  4URA A;  2LAL A;  2OUH A;  1GIC A;  1V6L A;  3WHU A;  4ERO A;  1GBG A;  3NKT A;  3U4S A;  1EYB A;  4HVQ A;  2D97 A;  1HJG A;  5FY7 A;  1W2U A;  1G8W A;  2ZTN A;  3AXD A;  1O5L A;  4PT6 A;  5FXW A;  3VBF B;  4SLI A;  3O12 A;  4Q4V 2;  5ACA 1;  3C7F A;  3THT A;  1V70 A;  1ULD A;  2OII A;  2P3K A;  1GQP A;  2Z69 A;  3PNA A;  1Q56 A;  4HLT A;  1UF2 C;  3T0D A;  1LOG A;  4QX5 A;  3RQ0 A;  2XJU A;  5JLV A;  2ZGQ A;  2DBI A;  1ASJ 3;  3ZFE A;  4KI5 M;  4B4R A;  3U78 A;  1AR9 3;  1KXG A;  1Y9Q A;  3W5N A;  1C3H A;  3I2O A;  4Q27 A;  1O3S A;  5JIA A;  5L9V A;  4Q4Y 3;  4TXW A;  5F3C A;  2VGD A;  2BWC A;  2AAC A;  3NST A;  5TSW A;  5JSR A;  1HB4 A;  2R1B A;  4YW2 A;  1ZRE A;  1LHO A;  1G86 A;  5BXX A;  1RUI 1;  2HYK A;  2ARB A;  2HH9 A;  4CA9 A;  4CP0 A;  4AAP A;  4CP2 A;  1NYW A;  1FPN 3;  1OPO A;  2X5I C;  3ZLI A;  3N7K A;  5A3P A;  3SEP A;  2YV8 A;  2D40 A;  1NZC A;  4EZ4 A;  4YZ4 A;  2VMF A;  4U2A A;  4CEY C;  2B46 X;  3MYX A;  4AEM A;  1ZM1 A;  3QH7 A;  4ZU4 A;  1NKG A;  4MOA A;  4G3Y C;  3ZN6 A;  1O5U A;  4NN0 A;  2RM2 3;  3RI8 A;  3NKG A;  4LUK A;  4PQQ A;  5DZE A;  3VZK A;  2DFB A;  2E31 A;  4XAC A;  3TNP B;  1OBN A;  2W91 A;  3MLK A;  5FWE A;  2UWA A;  3B94 A;  1DQ4 A;  2IVJ A;  3H1Y A;  1MS9 A;  4YWA A;  1WUV A;  2ADD A;  4QQ2 A;  1XSR A;  2RS1 2;  3POE A;  3TEX A;  1V6O A;  5I0D A;  4ZU5 A;  5JCT A;  2VAU A;  5FMO L;  2B5H A;  1UAI A;  3ROU A;  1RB8 G;  1CAV A;  4URT A;  1QOS A;  1UY4 A;  1RUG 1;  4LBJ A;  1YYN A;  1AL0 G;  4B3N A;  1XNK A;  5K7P A;  4GWJ A;  5FV3 A;  2Y64 A;  4PQ9 A;  1ZA4 A;  2JE8 A;  2Z5W A;  5F7U A;  1YJK A;  4KGG A;  1Y43 B;  2A6X A;  4XFG A;  2QKD A;  4AI2 A;  2IXH A;  3OBR A;  1YIP A;  5LB6 A;  3ZXE A;  3MW4 A;  2ILM A;  3WW1 A;  2ORX A;  4ASM B;  4DRR A;  4CTE A;  2VZT A;  1HN1 A;  1PMH X;  5LBE A;  4EV0 A;  4HMZ A;  1SG3 A;  2HLE A;  1VLN A;  1ULP A;  1DQ5 A;  1TME 3;  4L99 A;  5FXZ A;  4GWM A;  3AZX A;  2R07 1;  4YZ3 A;  4N9I A;  3EQE A;  1QJU 2;  2GC0 A;  2WNE A;  4ES9 A;  1TVG A;  5C7G A;  1EV1 3;  1GP5 A;  1T6G C;  1X33 A;  4LR4 A;  4WVM A;  5LRR A;  2FDK A;  2VUA A;  4RR3 A;  2XJT A;  5FLI A;  2GC3 A;  5CFC B;  1KS4 A;  1ND2 C;  1VBE 1;  2IXK A;  3E5Q A;  2BQP A;  1BBT 1;  4IV3 C;  1NX9 A;  1F15 A;  4K7J A;  1LB2 A;  4H55 A;  1VRH 1;  5A32 B;  2A71 A;  4PIX A;  5LEK A;  4JTN A;  5T54 A;  1W8T A;  3SCH A;  2FCT A;  4A45 A;  1D4M 2;  2BGP A;  2RS3 2;  2VUD A;  2WUH A;  5JZG A;  2VM9 A;  4GWI A;  2W1W A;  4JGY C;  5FWJ A;  2ZXQ A;  2OZ6 A;  3KSC A;  4GZ9 A;  4UFM A;  1RUD 2;  2FCV A;  1GQH A;  2PYT A;  4NMI A;  4O9G A;  3ES4 A;  2WAO A;  3U0Z A;  1DYK A;  1HX6 A;  2DU1 A;  4COU A;  1W2N A;  1HB1 A;  1ULC A;  5JUV A;  3J26 N;  3B93 A;  4WM8 C;  2ZGO A;  2EIB A;  4HKL A;  4XPV A;  3I97 A;  1JOB A;  1RHI 2;  2HWB 1;  1UZV A;  2DTW A;  5F39 A;  4YGD A;  1DGW A;  3ZFF B;  3P6B A;  3DXU A;  3USU A;  1WW4 A;  5DUV A;  1HXS 3;  2BBA A;  4AW7 A;  4XJ9 A;  2HEW F;  1KFX L;  4Q4V 1;  3NL1 A;  1Q43 A;  2B4K A;  3KB5 A;  4I0B A;  1R1A 1;  4MSV A;  3ZYH A;  1QOO A;  4PLO A;  2W1S A;  4DOU A;  2XBO 2;  1UXX X;  5D8A A;  3PU8 A;  3ZN6 B;  1S2K A;  3GCW A;  3O14 A;  4UXA A;  5EFU A;  5FZ6 A;  4CPB D;  1R1A 3;  1JZ5 A;  2J1U A;  2QFE A;  5A70 A;  1W6N A;  2XLF A;  4RQP B;  5FMB A;  4AL9 A;  5F2W A;  3AKT A;  3N7L A;  1PX4 A;  3VKF C;  1LGN A;  3OGS A;  2E7Q A;  1VAM A;  5T5L A;  3B5L B;  1S0C A;  2Y26 A;  2Q5T A;  2YGM A;  4IV1 C;  2BZD A;  5FYH A;  5HXV A;  1ZBE 3;  3PIG A;  4KH9 A;  1AR6 3;  2Y6G A;  1VAL A;  1NXM A;  2DUR A;  5FZE A;  5A3M A;  2WNU B;  3BAL A;  3HBK A;  4QPI A;  4DXZ A;  1RVF 1;  4GKX A;  3AX4 A;  4KL1 A;  1YNA A;  1TNF A;  1LOD A;  1UNB A;  3OYW A;  1W0O A;  2YZ4 A;  1DDL A;  2P6H A;  2CY6 A;  4NVP A;  1BK1 A;  5APA A;  1RL3 A;  1IS6 A;  2WC2 A;  4XUT A;  4MUV A;  3VL8 A;  4Q4Y 2;  5HCH A;  5T3N A;  4D69 A;  4J6G A;  4QGM A;  2ZAB A;  4PBO A;  3V0A A;  1AX2 A;  4V2W A;  3KCX A;  2BYV E;  5KHH A;  4NUB A;  4RS5 C;  4AVS A;  1G9D A;  2RS3 3;  2PQQ A;  3FJS A;  1IZ3 A;  2GME A;  4Z82 A;  1A8D A;  3SC7 X;  3W5M A;  1EAH 3;  3I59 A;  1NCR A;  2YBK A;  4JX0 A;  4L11 A;  5HCB A;  2BBV A;  1NAE A;  4ONU A;  1H6Y A;  4CDQ C;  1CR7 A;  1RUD 3;  3FMG A;  3KHB A;  4DO0 A;  5KR7 A;  4XF4 A;  4Q0Q A;  2WO2 A;  4ATF A;  4P5Y A;  3WG1 A;  3KHC A;  5LAT A;  4E27 A;  3NNG A;  3JD7 1;  4ARY A;  3GJA A;  4TLF A;  1IPJ A;  3FFQ A;  1RUF 1;  5IVY A;  4Y5Z 0;  4BZ4 A;  3BPZ A;  1H9W A;  4NII A;  5FY8 A;  4CUA A;  3S7I A;  3IDB B;  5GM0 A;  3IDC B;  5DDJ 1;  2W68 A;  4RYD A;  3EMR A;  3LSD A;  5A6Q A;  3T4V A;  3H1M A;  3JXS A;  1QQP 3;  2ZPX A;  5DDJ 3;  4H7M A;  1QXJ A;  3ZFE C;  1UPS A;  1MZ5 A;  4FO9 A;  5I8Y A;  3Q8A A;  5H9S A;  4P00 B;  4CEY B;  1FI2 A;  5KC6 A;  4YNI A;  1NY7 2;  3HD8 B;  4WVW A;  1FT9 A;  4P14 A;  1XE8 A;  3DXT A;  4MHR A;  2DF7 A;  3WHT A;  4CP9 A;  3RZL A;  2A6Z A;  1W0N A;  3OB8 A;  2ORZ A;  2YBP A;  3B00 A;  3C3V A;  4NPR A;  4B29 A;  1NOV A;  4AI8 A;  1QIQ A;  2WZE A;  1JYW A;  1LOA A;  4QHZ A;  5FPB A;  4K40 A;  4XJU A;  2WII B;  1MQT A;  4QX8 A;  3HWJ A;  4CCE A;  1W8H A;  4L2N A;  1XYO A;  4YZ2 A;  4OI1 A;  4AHX A;  5IVJ A;  2JE7 A;  1GWL A;  5FXX A;  2WQZ C;  1H8T C;  4BHP A;  4LO7 A;  4ZKT B;  1PM4 A;  4XHB A;  2ZA9 A;  2J1S A;  3C7E A;  1MS4 A;  1QU0 A;  4XZU G;  4AF9 A;  2WT1 A;  5IVC A;  1NA1 C;  1VB2 A;  3MW2 A;  1NT0 A;  2CWS A;  3HNB M;  3ST7 A;  1NCQ C;  1PK6 A;  1SCR A;  1SLI A;  2XJS A;  2HEY F;  4XW3 A;  3ZPO A;  5BPX A;  4AED C;  5C3Q A;  3VKL A;  2H6B A;  2WT2 A;  5FZ1 A;  5GLT A;  3MIE A;  5FK8 A;  3B9I A;  3FLP A;  2QZ3 A;  1AX0 A;  4RR3 B;  2GC2 A;  1GLH A;  3AVR A;  2WS9 2;  2V72 A;  3WP5 A;  1YHF A;  3QD6 A;  2DVA A;  5JIU A;  3K48 A;  1H2N A;  1R1Z A;  1K5M C;  5DAV A;  3ZYF A;  4BJ0 A;  5F5I A;  1UMZ A;  4I30 A;  3UET A;  1N1T A;  2EXI A;  4AE2 A;  1MEC 1;  2PEL A;  4BYY A;  1OUR A;  1K5M B;  2C6S A;  3ETP A;  1V9U 1;  4QXB A;  5BV6 A;  4XF3 A;  1OKQ A;  1C4R A;  1V6K A;  1MEC 3;  2ZAA A;  5G04 L;  2DU0 A;  1CJD A;  1G9B A;  2MPF A;  1PVC 2;  3USS A;  3ZVX A;  5BNO C;  5C8W A;  1XE0 A;  5L19 A;  1W0P A;  2CNA A;  3BU0 A;  2NN8 A;  1LES A;  5HCF A;  4CCM A;  1DFQ A;  4MV2 A;  4XC9 A;  3K2O A;  5FYT A;  2HWB 3;  2ZHN A;  1RVF 2;  1HDK A;  1VBC 2;  3AL5 A;  4O9E A;  4Y4R A;  4Y5S A;  1IQA A;  4EN8 B;  4LOS A;  4QM8 A;  3VBR C;  5EYX A;  4WZF A;  4Y1V A;  1QXR A;  2P2K A;  3VBS C;  5JAX A;  2XLG A;  4JCK A;  1W39 A;  5DAW A;  3T4H B;  2YGL A;  2GP5 A;  3AK0 A;  2D7F A;  1JHJ A;  3K4D A;  4N7I A;  1ZBA 1;  2RMU 1;  3AP5 A;  5DMY A;  1JOP A;  3WDX A;  3FE5 A;  5HV4 A;  4YVS A;  2JKB A;  3DCQ A;  1A6C A;  4RS5 A;  2G1M A;  4NRP A;  2XHK A;  5GZD A;  4B1M A;  3AZY A;  4A4A A;  4DUX A;  3UKV A;  2AH2 A;  1M06 G;  3VZO A;  4XQ4 A;  3S5Q A;  5IK8 A;  2HWD 3;  2CGP A;  2Y33 A;  5JMC A;  1UQX A;  4ORF A;  5FY9 A;  4K1Y A;  4Q0V A;  3APB A;  1R08 1;  2XOM A;  4UFL A;  1XU1 A;  2C1F A;  1JI6 A;  3WW2 A;  2FD8 A;  2PLV 2;  3KVB A;  2JDA A;  1N1S A;  2QDN A;  2VE1 A;  4JHT A;  4LJH A;  2VTF A;  4WM8 B;  3D0S A;  4CCO A;  2GAL A;  2L9L A;  4ZS2 A;  4XFH A;  5FPZ A;  1QJY 1;  2ARE A;  2ZMN A;  3GF6 A;  1CIY A;  2BEO A;  5JOZ A;  2WZP P;  4BQ2 A;  2DVB A;  2JKX A;  3BOD A;  5GLZ A;  3WOG A;  2Z79 A;  2VTX A;  4BLJ A;  3UYJ A;  5IT6 A;  4WM7 B;  4GH4 B;  5E1R A;  4LO4 B;  2LTN A;  1DYO A;  4C90 A;  1UY2 A;  4M00 A;  2JDZ A;  2JG9 B;  1ZBE 1;  4XDQ A;  3T2O A;  2VNR A;  2GN3 A;  2VNV A;  2WYF A;  1OVP A;  3ASI A;  3M4F A;  5JPM B;  3ZDS A;  3I2K A;  3MIH A;  5A6Y A;  1WGP A;  4UT5 A;  4IET A;  2DV9 A;  5A1A A;  1NE6 A;  2OXB A;  2W1Q A;  2PQS A;  3VZN A;  3OGG A;  3ZSJ A;  5DAP A;  3KCC A;  3ZXG A;  2Y6L A;  2BP6 A;  2Q8D A;  1SPP B;  4Z07 A;  2UYB A;  2W92 A;  2VQA A;  2XJQ A;  2CGN A;  2XUM A;  3DKQ A;  4OUS A;  4E2Q A;  1ZX5 A;  1ND3 B;  5HCA A;  3H9A A;  1XJA A;  2DVD A;  4FAG A;  3PUI A;  2ARC A;  1YQ2 A;  1QJY 2;  1E5I A;  4CDU C;  1RUJ 2;  1LEN A;  4KGQ A;  2ZKN A;  4AVB A;  2F6B A;  2CWM A;  5FZ0 A;  4FOV A;  2ZGS A;  5FZ9 A;  4K8R B;  2Q30 A;  4N43 C;  1W2O A;  4PBP A;  4XMI A;  5JXJ A;  2NP0 A;  1LOF A;  1S0F A;  5ISL A;  5A33 A;  1WZX A;  5C3P A;  2JG9 C;  1W8O A;  4OUL A;  5FZ8 A;  1OHF A;  1TME 2;  4Y1Y A;  4YVW B;  3VDA A;  1SCS A;  2V73 A;  4A6S A;  5JZG B;  3BUC A;  4CDU A;  2R16 A;  1BBT 2;  2BVV A;  4Q4W 2;  5LA9 A;  2QTW B;  1EV1 2;  3SHR A;  2PHL A;  3I3B A;  2RS5 3;  4N43 A;  3GBG A;  4PI0 A;  1SLB A;  2XL9 A;  1RUE 2;  4CDQ A;  1NLR A;  2PTM A;  3A4U A;  3DL3 A;  1JZ3 A;  1ACC A;  4EWA A;  4LA3 A;  4YLZ A;  5L73 A;  3R6S A;  3SIT A;  3TN9 1;  1BZW A;  4LBM A;  2KR2 A;  1QDO A;  3U1X A;  1LEC A;  4I09 A;  2ZGN A;  3MIF A;  2NQY A;  3ZYR A;  1RUH 1;  1WCU A;  2G19 A;  1H4H A;  1RED A;  2P3I A;  1W3X A;  2VVE A;  4MX3 A;  4AI1 A;  3UGG A;  1H9P A;  4O65 A;  2XON A;  3AP7 A;  3LQC A;  3H8R A;  1QMJ A;  4D6Q A;  4E9K A;  3ZSL A;  4QXC A;  5D21 A;  2BRT A;  5BNO A;  1ZRR A;  1CAU B;  2RDQ A;  4DIN B;  2WO7 A;  3UES A;  3KWV A;  1Q8O A;  2RG4 A;  3AFG A;  3OBT A;  2VOX A;  5JZG C;  2E6V A;  1PM7 A;  1W9T A;  1BEV 1;  3IT8 A;  3NV2 A;  4QPY A;  4DEQ A;  2PMW B;  1CZT A;  1PIV 3;  3LAG A;  4LBL A;  1JW6 A;  4FPG A;  4K6B A;  2P6C A;  2DUQ A;  2HWD 1;  1S2E A;  4JQR A;  4L9B A;  1F5J A;  1WLC A;  1W04 A;  1QJU 1;  3P5B A;  3N4M A;  3GDB A;  5F6L B;  4OQ8 A;  2R06 3;  3KV6 A;  1COV 2;  3M1H A;  3K3O A;  5KHJ A;  4YG0 A;  5IK5 A;  4DQA A;  5F5Q A;  5AFE A;  3III A;  4Y20 B;  1RUO A;  3CJX A;  3ZKU A;  1MS5 A;  4AFD A;  2PLV 1;  2Y6K A;  1VBD 1;  5FPX A;  1WCS A;  1VBA 2;  2WFF 1;  2K9Z A;  3AYC A;  4MH0 E;  4OHW A;  1IHM A;  4XQW A;  1CAX B;  2A75 A;  3MV1 1;  1MS3 A;  2VG9 A;  3O7O A;  4DB5 A;  3FC0 A;  4AED B;  4CDX C;  1ENQ A;  3CQO A;  5C71 A;  1KDM A;  3RS6 A;  1JYX A;  1VRB A;  1QEX A;  4XF9 A;  1MZE A;  1OFN A;  3M3Q A;  2GNT A;  3N3H A;  4MGS A;  3NV4 A;  4COW A;  1RIN A;  4EN9 B;  4I2O A;  3ZKY A;  1AXZ A;  5FBJ A;  1UYX A;  3GBW A;  3LEI A;  4NAO A;  2P17 A;  3FFZ A;  3VDB A;  2FMD A;  3FHQ A;  5FPV A;  1DIW A;  3INA A;  2J1A A;  5AFB A;  2LM3 A;  1FMD 3;  1QDC A;  2Q1Z B;  3LOI A;  4NHM A;  5M0T A;  1AHS A;  1W6Q A;  3AXE A;  5IAV A;  1BVP 1;  3A7Q A;  2ZAC A;  2BGO A;  3POG A;  4W6Y A;  4AAX A;  2PHD A;  4YSF A;  5LY1 A;  2WL1 A;  1J58 A;  4QB2 A;  4QX2 A;  4QPG A;  2R04 1;  2E63 A;  2HWF 2;  5IVE A;  1LAJ A;  5HV0 A;  3GZT B;  5FP9 A;  3IKW A;  3I3D A;  3LFM A;  5LAS A;  1KQR A;  3UJO A;  1SFN A;  1QJX 3;  5E6H A;  5K8S A;  1C8M 1;  4BQ1 A;  4BXS V;  1GAN A;  1SAC A;  1W90 A;  4OMC A;  3W20 A;  3WF4 A;  1B35 A;  1D7P M;  2BWA A;  1JOD A;  2EXK A;  2ZHK A;  4I01 A;  3ZXF A;  1IPS A;  2JG8 A;  2QQK A;  3LCP A;  2W47 A;  1ULF A;  1UYP A;  1C8N A;  2WNV A;  4N43 B;  1GFF 2;  1T6B X;  1ENX A;  2XJP A;  3I49 A;  4W8J A;  4AXO A;  5JWP A;  3HBZ A;  3H8X A;  4JDN A;  2DVG A;  1DLL A;  3LEG A;  3N9L A;  2W87 A;  2XDV A;  1QJE A;  5FCC A;  1F8V A;  4XDO A;  3AM2 A;  4QPG C;  5KXE A;  3A21 A;  4IEP A;  2O8Q A;  4CCD A;  2ZHL A;  5A3N A;  4B4P A;  2YHJ A;  1PIV 2;  2KM2 A;  2VU9 A;  3OGJ A;  3QOP A;  1A34 A;  4AGV A;  4CCC A;  1VB4 A;  1LR5 A;  2HJI A;  5A7O A;  4LK7 A;  2QBX A;  3E97 A;  1POV 3;  1R1A 2;  1OLM A;  3RYP A;  3IDA A;  1QJY 3;  4XIO A;  1PNG A;  2I07 B;  3K46 A;  2QQN A;  3P3P A;  5T5J A;  3VBU C;  2IFW A;  2R04 2;  2P3Y A;  2E26 A;  2XWJ B;  3AFK A;  3HNY M;  1Z78 A;  3ES1 A;  3I2H A;  4S2G A;  3NV3 A;  5A7N A;  3SMH A;  2JDP A;  5JXH A;  5IVB A;  3KF5 A;  4ATE A;  1IGO A;  5FJH A;  4A42 A;  3ZIW A;  4NPM A;  2IC1 A;  3J7H A;  1LU1 A;  4ZZ8 A;  3MUZ 1;  2ZGU A;  2AYH A;  3OUH A;  5FYY A;  2EXH A;  1NQD A;  5A3L A;  1KEX A;  2YBS A;  3WXP A;  1D2Q A;  3ZO0 B;  1E57 A;  5KC5 A;  1H0B A;  3POJ A;  4XJZ A;  1SLA A;  1DCS A;  3TNQ A;  1VMF A;  4FT8 A;  5A7Q A;  3AJZ A;  2WWJ A;  2XHN A;  4SBV A;  4AVC A;  3HIF A;  1SLC A;  1OD5 A;  1AVB A;  4IGO A;  5IK4 A;  2NPI A;  2VCA A;  5FUI A;  3BPS A;  1BKZ A;  3WG2 A;  4TWT A;  4UFH A;  1V6I A;  1V6J A;  1W2T A;  2QZ2 A;  3SH3 A;  3WVJ A;  1ULE A;  2XWB B;  4R9A A;  4FTB A;  2F4P A;  1FOD 3;  1UMI A;  3OBZ A;  3OUJ A;  4RD7 A;  2X29 A;  1ONA A;  4GMP 3;  5C8C C;  4R4X A;  4O7X A;  1W9F A;  3WNK A;  2WZR 1;  4M01 A;  3I8T A;  5D8A C;  2W94 A;  2YYO A;  4PLN A;  1YIF A;  5C3O A;  2JDM A;  5I91 A;  3LFI A;  3LIG A;  1CPN A;  3GGL A;  1S4C A;  4WVM B;  5EPA A;  4BIS A;  1ALY A;  2H0B A;  3BN6 A;  4AYU A;  5IK7 A;  1F4A A;  1B35 C;  1UU6 A;  2TBV A;  2QJV A;  4CE8 A;  4LHL A;  1DGW X;  1J83 A;  3CEW A;  4CXX A;  2VZS A;  4EQV A;  4XVH A;  3TEZ A;  1SDD B;  5DZF A;  4L0P A;  2QDR A;  4FPC A;  2VW0 A;  4XIL A;  4AFA A;  2VNG A;  2RDR A;  3V65 A;  1DLC A;  3ILR A;  1COV 3;  5C8C B;  1WA4 A;  2QNK A;  2V4V A;  2HWE 3;  3CIH A;  3SQO A;  4CDX A;  2JDH A;  2G4I A;  5FJK A;  1G7Y A;  3PUR A;  4N53 C;  4AI9 A;  2Z2S B;  4W50 A;  4LE4 A;  2FDH A;  4HFS A;  4XBQ A;  3FN9 A;  2BW8 A;  2UY8 A;  1W28 A;  5EYY A;  1O3R A;  3MO4 A;  3N9O A;  3PJY A;  3TRS B;  3ZXL A;  4ASL A;  2Q1M A;  3WV6 A;  5A3U A;  5FKB A;  1F2N A;  1UY1 A;  2ZX4 A;  5FYI A;  3H8O A;  4QD2 A;  2HEV F;  4IXL A;  1F4H A;  5I0S A;  1GU3 A;  3WSO A;  4GXL A;  3WEZ A;  1DGL A;  1REE A;  5FFO C;  4AFM A;  4DRV A;  4Y20 A;  2GN7 A;  4DFS A;  4FPK A;  2Q8C A;  1QJU 3;  3ZR6 A;  1UY0 A;  4LNV A;  1PMJ X;  2BDR A;  3G6J B;  4FP2 A;  4DMI A;  3VKM A;  1OA3 A;  1AR7 3;  1VBE 3;  3OTF A;  3VD4 A;  3JZV A;  3VV1 A;  3ZDV A;  1S0I A;  4QDQ A;  4FTE A;  2ZOE B;  1JUI A;  4XTP A;  4FCA A;  4XJW A;  3BGA A;  1HN0 A;  3V64 A;  2J1V A;  4XXP A;  3UGF A;  3SNM A;  2RJ2 A;  3LA2 A;  4MGI E;  3ECQ A;  4PF5 A;  3BYW A;  1W9Y A;  4RFT 0;  1SBE A;  1OQE A;  3Q8C A;  3ZXD A;  1R09 3;  2A1X A;  3HT1 A;  3R0R A;  3AMP A;  5CFD C;  5DQ0 A;  3B69 A;  4MAD A;  1W8Z A;  3H7Y A;  3RMY A;  2QQO A;  2WSV A;  2WBK A;  2JJ6 A;  4UBH A;  2R49 A;  1RUJ 1;  1ST8 A;  1UD1 A;  2MEV 1;  2ZAH A;  3LKJ A;  3N36 A;  3QBQ A;  2WA4 A;  1HRV 1;  4UW6 A;  1W6O A;  4E2S A;  5FDB A;  4GIQ A;  2IUW A;  1GWK A;  2O8O A;  1GP6 A;  3GM8 A;  3RZZ A;  5A32 A;  1NA1 B;  4YG6 A;  4J1X A;  1UY3 A;  2F4L A;  3WG4 A;  1X50 A;  2JB4 A;  1AYM 3;  2UWB A;  1NE4 A;  2WR9 A;  4Q5O A;  1VAK A;  3NNL A;  4HG6 B;  5BNN B;  3NRU A;  1O59 A;  1NZI A;  3RZH A;  4A7Z A;  3BB6 A;  2ZCW A;  3ALQ A;  4CVU A;  1AYM 1;  4AQ2 A;  2XBO 1;  1B35 B;  4CU8 A;  5FO9 B;  4PLM A;  3JBG 3;  3VBS B;  4I0A A;  5GZC A;  1U5Y A;  1TMF 2;  4OVE A;  1REF A;  2G9G A;  4GWN A;  2PA7 A;  4OQ9 A;  2RM2 1;  2A3Y A;  4KG0 A;  1F31 A;  5FYS A;  2PFW A;  5KBF A;  4COY A;  4LIT A;  5T5O A;  1RHI 1;  1WKY A;  2FQP A;  1LOE A;  1TQ5 A;  2B42 B;  2J1R A;  4TSV A;  3NMB A;  2D3R A;  5JPN B;  5F5A A;  3LIH A;  1ND2 A;  1NA1 A;  1PO1 1;  3I3E A;  1H6X A;  3IPV A;  3B02 A;  4JVA A;  5DPN A;  1PX3 A;  2ZGP A;  2P4E A;  1C57 A;  2RS1 1;  5AC9 1;  4RHV 3;  4F83 A;  4FSJ A;  2W0X A;  3WDW A;  4IGP A;  5BNQ A;  1DQ1 A;  4BXF A;  5FMC A;  1Y9G A;  5A3W A;  2TEP A;  1BVV A;  1OVS A;  1PO2 3;  1QH7 A;  3LGR A;  4JRL A;  5FPL A;  3GYD A;  4EE2 A;  1AX1 A;  4LOT A;  3U14 A;  4IEV A;  4UBG A;  4LKS A;  4OHZ A;  1CZS A;  1L7R A;  2X09 A;  2V09 A;  3OPW A;  4QHB A;  3WQB A;  2XH6 A;  2Y8K A;  1G9C A;  1DGR A;  2BV4 A;  1BYH A;  1UZ0 A;  2F17 A;  4LUM A;  1RXG A;  2BTV C;  3PL0 A;  2LRP A;  4LKE A;  3J7M A;  3FBM A;  5ERL A;  4XAB A;  5FY0 A;  1RUG 3;  3S6P A;  2P3J A;  1XNB A;  5C5U A;  3MUY 1;  3AKS A;  2RR1 2;  2V5D A;  2XB6 C;  5HI0 A;  5K0U A;  1IQD C;  1HQN A;  5F6K A;  4YW4 A;  4ZY9 A;  4JGZ A;  1IG0 A;  4MXV A;  5I0T A;  5KXB A;  1AF9 A;  4CCJ A;  2CL2 A;  4FXG B;  4A3Z A;  2RS5 1;  4RS5 B;  3GHN A;  1VBC 1;  3WF0 A;  3Q8F A;  2VL4 A;  3V0A B;  4P08 A;  1PMI A;  3OUI A;  5A3T A;  4HN0 A;  4CSW A;  2R06 1;  2WSU A;  2B8M A;  5EJ3 A;  4FFF A;  1WCD J;  1UZY A;  3M3E A;  1W06 A;  5FMO S;  3O1S A;  2VTX J;  4D6S A;  1CIW A;  5FYZ A;  1N47 A;  2VOT A;  3VUO A;  2V5Y A;  3AB0 A;  1XE7 A;  4XJA A;  1FAT A;  1YQ5 A;  4AVA A;  1TMF 3;  5K0U C;  2ATF A;  5SV5 A;  3IWZ A;  4N8M A;  3VL9 A;  1UX7 A;  4YGB A;  2Y6F A;  3HPN A;  3PTR B;  2E7T A;  4L92 A;  4QDR A;  4EZH A;  5LEJ A;  5IVF A;  3QCW A;  2YC4 A;  1J59 A;  5K0U B;  3RJR A;  4BWO A;  3LEM A;  4XJ8 A;  2HBU A;  2IVI B;  2PHX A;  3LDB A;  3WQ0 A;  1C1L A;  1LU2 A;  5IFT A;  1G9F A;  1W99 A;  2YY1 A;  4IGQ A;  1Z7S 2;  4JGZ B;  3GZE A;  4YW3 A;  1YCI A;  1YQC A;  4Q4V 3;  5CG8 A;  1W8U A;  1D4V B;  2LRO A;  4Q4W 3;  2VUL A;  5CVR A;  2UUR A;  1I5P A;  4JKK A;  5LY2 A;  3U11 A;  2WLP A;  1MZ6 A;  2VZR A;  4OHX A;  3EO6 A;  5L7O B;  4OYU A;  1JHN A;  1YWK A;  1OT5 A;  1CAW B;  3K4Z A;  1X8M A;  2D6O X;  3DN7 A;  5T50 A;  1NQJ A;  2ZX2 A;  5CAZ A;  2YG0 A;  1U12 A;  1QJX 1;  1ULO A;  1GNZ A;  1GZW B;  3GZU C;  1GOG A;  3CF6 E;  1XU2 A;  4BIO A;  2IXL A;  5T55 A;  3KMH A;  4AVV A;  5DUW A;  5KHG A;  1BQP A;  1LUL A;  2CDO A;  1CX4 A;  2IXI A;  4QMA A;  3BTX A;  4PDW C;  1ND2 B;  1FPN 2;  4P9I A;  3IPV B;  3WW3 A;  2OS2 A;  3S30 A;  1WLW A;  1RGS A;  1FX5 A;  3KV4 A;  3POS A;  3C7H A;  1YFY A;  2B9U A;  4ZU7 A;  2X53 S;  5F3G A;  4CPB A;  1LOB A;  3BVC A;  5EWS A;  4NID A;  1ZZ9 A;  5LZ6 A;  1SFY A;  2RM2 2;  2I74 A;  4ZXE A;  2C9K A;  2BOI A;  2PHR A;  3Q8B A;  4P9Y A;  2BPA 2;  1O4Z A;  4DXT A;  4Q8K A;  1AJK A;  4IL7 A;  4K1Z A;  1YXW A;  1QOT A;  1PGW 1;  1WMF A;  2WNV B;  1RUF 2;  3ACH A;  2D6N A;  3N35 A;  3H3L A;  3AZV A;  5L7O A;  4MVT A;  5HPO A;  3BKZ A;  1XSQ A;  4QGL A;  1GZ9 A;  5E8A A;  4F7Z A;  5JDB A;  1VMH A;  5FMD A;  1S1A A;  5CAD A;  3WY6 A;  2GH8 A;  2HYX A;  2QQV A;  3V56 A;  1JN2 P;  5CFC C;  1JYC A;  3UKT A;  4YZ1 A;  1S0G A;  2VMI A;  2FHR A;  4NPL A;  2VZP A;  2VC9 A;  1XQN A;  2QUO A;  3MI8 A;  1POV 0;  4BQ5 A;  4CEW C;  4XF1 A;  1RJ7 A;  1PZ8 A;  2XKP A;  1SHW B;  3CBN A;  3HMY A;  3MW3 A;  3WCS A;  3WF2 A;  3OEB A;  2CAU A;  2NM1 A;  1AYN 1;  1ASJ 1;  2YRO A;  3I3Q A;  4ITC A;  5FZA A;  4ZXK A;  4GH4 A;  1QJZ A;  3I2G A;  4HT1 T;  1HXS 1;  4D0Q A;  4DY3 A;  5J98 B;  1YFX A;  4IEY A;  1ZRI A;  3PVE A;  1OKO A;  1XRU A;  3H7J A;  3MID A;  4MGY E;  3WNX A;  4BA6 A;  4IEZ A;  1SDW A;  1J3P A;  3OG2 A;  5CFD A;  4IEU A;  4HKO A;  5FLJ A;  3M8L A;  4NRM A;  3N9P A;  1O8P A;  5EZW A;  5JVV A;  4CEY A;  3L2H A;  1YC6 1;  2YDE A;  2YU2 A;  3MGU A;  4HVR A;  1HJF A;  1FMD 2;  2I45 A;  4A44 A;  4AQ6 A;  5C3S A;  1JYT A;  4KG8 A;  3HN1 A;  2VBB A;  1LGB A;  4W6X A;  2J1T A;  3MF9 A;  3MIG A;  2OT7 A;  5K4L A;  3OPZ A;  4RHV 1;  1D2S A;  3PVO A;  4Z92 B;  4FFI A;  1GMM A;  4KMQ A;  1YQ6 A;  4DIQ A;  4FOQ A;  1DHK B;  3VHO A;  2PHW A;  2ZEY A;  3CNA A;  2H0V A;  1UZZ A;  2WFP A;  1WMD A;  2UU8 A;  5FBZ A;  5BY5 A;  4XUQ A;  3B9C A;  5A7W A;  3POW A;  4PF1 A;  1RUE 1;  2QQI A;  4JTO A;  4RN5 A;  3NV1 A;  2CHH A;  1H1M A;  5A7P A;  1JOJ A;  1BEV 2;  3MIC A;  5F8P A;  3ZM8 A;  4Y22 A;  4NIH A;  1C8M 2;  1W6P A;  4GAZ A;  4QWN A;  1FV3 A;  3SEE A;  1RMU 2;  1NCR B;  4N7U A;  4KNC A;  5KHK A;  2A7A A;  1MEC 2;  3VB9 A;  3DYO A;  4BPZ A;  1AJO A;  1PZ9 A;  2LW8 A;  1OH4 A;  2WQ4 A;  1E5H A;  4YPJ A;  2OQ6 A;  2VUC A;  1COV 1;  3X29 B;  3ZYJ B;  3J7N A;  2RHP A;  3WG3 A;  2EID A;  5DUU A;  3UGH A;  2FDI A;  4EN7 B;  3I3M A;  4Y24 A;  5H9P A;  4Q29 A;  3RRD A;  3RZG A;  1VBC 3;  2JD9 A;  4Y1Z A;  3MFC A;  2HWC 1;  3C7O A;  3JB4 C;  1GR3 A;  1FOD 1;  2D98 A;  3WNP A;  4ASK A;  1UKR A;  1U5I A;  4RR3 C;  1KGY A;  5FP3 A;  1UOG A;  3E5U A;  1O3T A;  4MG2 A;  2D6K A;  3MLJ A;  5C9A C;  4LLO A;  4CP1 A;  3JQW A;  1O6U A;  4ZPI A;  3KV5 A;  4TTG A;  1AZD A;  5BNP B;  3VLB B;  4DUW A;  1OOP B;  1TME 1;  2BUK A;  2WDB A;  1ZBA 2;  1B09 A;  2RMU 2;  3HQR A;  5ABJ A;  1V9U 3;  2W39 A;  3T3Y A;  3WT3 A;  4JKL A;  3RFR A;  1JXN A;  1K12 A;  1FNY A;  5B4N A;  4N53 A;  4AEJ A;  5J36 A;  1JZ7 A;  5A6Z A;  3PDQ A;  5FIX A;  5J96 B;  3MLL A;  4P02 B;  4BM8 A;  4MLO A;  1AXY A;  4HSJ A;  4GA9 A;  3G7D A;  3TN9 3;  4DZG A;  4X8N A;  2W1U A;  4QQL A;  2ZZJ A;  4CDW A;  3P3N A;  4MET A;  4I0W B;  1TMF 1;  2JD4 A;  1TE1 B;  2ZKL A;  3RGB A;  3WR0 A;  4P9L A;  2VZO A;  3L9J T;  1KFU L;  1RXF A;  2VME A;  1URX A;  3JU9 A;  5CEH A;  5DG2 A;  1IS4 A;  2ZEX A;  2OPK A;  3E6C C;  1BLZ A;  4QX1 A;  1BHG A;  3FLR A;  1CAW A;  1NUK A;  2P37 A;  3UT0 A;  4TLG A;  4GMP 0;  5GZE A;  1XXN A;  2OQ7 A;  2VO5 A;  1LOC A;  4NWV A;  2WA3 A;  3VBS A;  1WD4 A;  3FLT A;  3JQX A;  3KM5 A;  3IMN A;  4GKY A;  1RMU 3;  2O0O A;  3HVD A;  4GB3 1;  2N7G A;  3OGR A;  4YW7 A;  4HON A;  2D5H A;  4LHK A;  1KJR A;  4OHV A;  3RZM A;  2X5I B;  4BMB A;  2XG3 A;  2VZV A;  2UY9 A;  4WVZ A;  4LA2 A;  3V0B B;  1FYU A;  4Z2W A;  1C1F A;  4CXY A;  1ENS A;  3TOJ A;  5LK7 B;  1DZQ A;  1XBF A;  1VE0 A;  4WM7 A;  1UO9 A;  1K42 A;  3EB7 A;  3MPB A;  2JG9 A;  5F32 A;  1ND3 A;  3LD8 A;  3O1P A;  1Q5O A;  4CCK A;  3ACI A;  1VBD 2;  1W6P B;  1F35 A;  1RUJ 3;  2QQU A;  1UX6 A;  1YUD A;  4IV3 B;  2WNV C;  3ZIX A;  4AHW A;  5JOY A;  3DYM A;  4E4H A;  1S0J A;  3DEC A;  3J8F 3;  2EIE A;  4E4S A;  4NHK A;  4XUN A;  1ZBE 2;  5IJR A;  5KXC A;  1AR8 1;  1OOP A;  2W2I A;  1RJ8 A;  2JG8 B;  2BGC A;  2XLA A;  1HRI 3;  3I59 B;  2XXZ A;  1RYY A;  1WCK A;  1YEW A;  2WRA A;  1NCQ B;  1WA6 X;  2VY0 A;  5FO8 B;  1RUN A;  1IS5 A;  2IXJ A;  1NCR C;  2PAE A;  4CCL A;  1YI9 A;  2XR4 A;  1W8W A;  3OYW B;  3I2J A;  1YLL A;  4LK6 A;  4Q2F A;  2R0F A;  4YGC A;  1QH6 A;  1EPZ A;  4YVS B;  4NO4 A;  4IE5 A;  1H8V A;  4XFI A;  4DNY A;  4NAM A;  4AWD A;  2FZ2 A;  1H8T B;  1BMV 2;  4UYB A;  1DQ0 A;  4UFI A;  4LOR A;  4I3P A;  1SLT A;  4KBZ A;  1HV0 A;  4KU7 A;  1LTE A;  4IV1 B;  2JXA A;  3RG0 A;  1ZRC A;  4AR2 A;  5FZL A;  3H50 A;  4LPL A;  4YYO A;  3WF3 A;  2VMD A;  3RYR A;  1EAH 1;  2P1B A;  5F5C A;  1Y3T A;  4AOC A;  4XQD A;  1PVX A;  4IV3 A;  3ZOI A;  2RR1 1;  1CD3 G;  2QQM A;  3HQU A;  4QU1 A;  3B3Q E;  5FP8 A;  5IVV A;  5FPA A;  4CU6 A;  3VZM A;  1W6N B;  4RQP A;  1IKQ A;  3R05 A;  1QF3 A;  2AEZ A;  3ZXJ A;  4GD4 A;  4LBN A;  2MEV 2;  2DCK A;  5F37 A;  1NCQ A;  1PK6 C;  1HRV 2;  1QQP 1;  5HBA A;  2ES3 A;  3AYE A;  3A23 A;  1HB2 A;  4XIK A;  4BH9 A;  4E4Z A;  2AEY A;  4MHU A;  3WDU A;  1K5M A;  2D3P A;  3GHM A;  2EVX A;  2ZZQ A;  4XF0 A;  3WX5 A;  1JUH A;  1UXZ A;  2D6M A;  1PVC 3;  2FCU A;  4OLL A;  1V6M A;  3VBO B;  2PN5 A;  4S2F A;  2WWU A;  2VXJ A;  1FNZ A;  1SLL A;  4GUL A;  2GND A;  3RVH A;  2HBT A;  2EAA A;  2RV9 A;  2VMG A;  3ZSM A;  5EXO A;  2YFZ A;  1QJF A;  2W08 A;  3FL7 A;  1U0A A;  2ARA A;  4FAH A;  2X8K A;  4Z1V A;  2VCB A;  1I5Z A;  4LBK A;  4QX7 A;  1UW8 A;  2DCT A;  2XVG A;  4UF0 B;  4WVV A;  3W58 A;  3POB A;  3OCP A;  2NMN A;  4RFR B;  3OY8 B;  3ZN5 A;  1U5X A;  1DBN A;  2ZBJ A;  2ERF A;  4XOG A;  2OZJ A;  4UOJ A;  2R0H A;  2W9X A;  4BQ4 A;  4HKW A;  4RHV 2;  1N3P A;  1NXD 1;  4UW5 A;  5JXG A;  5FZD A;  1J1L A;  1RUC 1;  4QXK A;  1O4T A;  3UNP A;  1HW5 A;  2J22 A;  1PZ7 A;  1GSL A;  1P8J A;  1N3O A;  1LCL A;  1UIK A;  1AR9 2;  3WDV A;  3AC0 A;  3OBA A;  5B2G B;  3S5A A;  1D0H A;  3K4A A;  3VBU A;  5FO7 B;  4D7S A;  4QX0 A;  4B4Q A;  1PGW 2;  3NNJ A;  5C9A B;  1V0A A;  4A6O A;  3MPP G;  4HPK B;  4FOY A;  2GMM A;  4MGK E;  4AGG A;  4I02 A;  2MNG A;  5BNN A;  3O1T A;  2PLV 3;  4LLF A;  5FQ0 A;  2HWF 3;  4CZS A;  4CU9 A;  1JU4 A;  1D4M 3;  1WCQ A;  1HB3 A;  2D44 A;  4Q1R A;  4XBL A;  2DCY A;  4QKN A;  2A6V A;  3ZFG A;  3EYP A;  3WCR A;  1V6N A;  3VBH C;  1RUG 2;  2HWF 1;  4DXR A;  2K2S A;  4Q4X 1;  3OY8 A;  1SBF A;  1C28 A;  4N53 B;  2DUP A;  2WFF 3;  1RTV A;  4MZU A;  3BU7 A;  5LA2 A;  3VD3 A;  1HQW A;  2OPW A;  5I8T A;  4GJZ A;  4IW3 A;  2WNO A;  4KWJ A;  4QPG B;  3T0B A;  1CX1 A;  2JEC A;  1GOF A;  1WW5 A;  3MEP A;  4NIG A;  4IEQ A;  3ZMN A;  1IOA A;  4D3W A;  3BIE A;  1HRV 3;  3AP4 A;  3VHR A;  4HZF A;  1OF3 A;  2QE3 A;  4TN7 A;  4WV8 A;  4DUV A;  3WZ1 A;  2WYS A;  1I1E A;  1ZNP A;  2JIC A;  5FZG A;  4Y3O A;  5IYY A;  2CDP A;  5FQ0 B;  3J9S A;  4X6Q B;  3W21 A;  3VZJ A;  1MR5 A;  2Y0I A;  1ULG A;  4H7L A;  1XYP A;  4CRQ A;  5EQU A;  5FLH A;  1LJ7 A;  1JMU B;  3KGZ A;  3THC A;  4QKD A;  3FHA A;  2H6C A;  4HBN A;  1Z0H A;  4YW1 A;  2VOW A;  3DYP A;  5FRA A;  5G05 L;  3DPR B;  3EBR A;  2R04 3;  4HK8 A;  1VR3 A;  4M3C F;  1CVN A;  2HWE 2;  5CZK A;  3OF1 A;  5FXV A;  4EN0 A;  2ENR A;  1WWY A;  4LXL A;  5EJZ B;  2E51 A;  2J7M A;  1CPM A;  1BXH A;  4LHN A;  3R4U A;  1R08 3;  1SBD A;  4NHL A;  2Q1F A;  5GJ6 A;  1D0G A;  2Y60 A;  4Q4X 2;  1X7N A;  2OYZ A;  1YI7 A;  3A0N A;  1GKB A;  1A8M A;  4IDZ A;  4M3C E;  4QHO A;  4FI9 A;  1WLD A;  4V1P A;  5J7M A;  1CWP A;  1PGL 1;  1RMU 1;  4YFZ A;  1DZR A;  2BNO A;  5BNP A;  2VZ1 A;  4UI9 L;  1H1A A;  3AKP A;  1MS0 A;  3PLQ A;  4WZC A;  1LOF C;  2DTY A;  4N9H A;  3HAG A;  1POV 1;  1J1T A;  2B9V A;  4CDX B;  4XET A;  2PHF A;  4LKF A;  3T08 A;  1HLC A;  4FXK B;  3D5O A;  2PAK A;  3KQR A;  4Y22 B;  1RUE 3;  3AMH A;  1AR6 1;  4WM8 A;  3DKW A;  2C0Z A;  3T2P A;  4LBQ B;  3WNO A;  1QNW A;  3M70 A;  3RI9 A;  4UAP A;  3CU7 A;  1UCX A;  4XAE A;  2FDF A;  4H3W A;  1JH5 A;  1SEF A;  5LBB A;  2JDU A;  3R4D B;  1GUI A;  1S0B A;  2UYA A;  1FOD 2;  2ZML A;  3ZSK A;  2ID4 A;  4DY5 A;  1OFS A;  3NNF A;  1MQT C;  5FZO B;  3CO2 A;  2K0G A;  3ON7 A;  4QDS A;  3WW4 A;  3LE0 A;  4FFG A;  3IN9 A;  1UYY A;  4P5H A;  5GZF A;  1ENR A;  3GZA A;  4LIV A;  3O1U A;  2MEV 3;  2ZX0 A;  5ACA 3;  1AR8 3;  4K21 A;  5L9R A;  3VBH B;  1I6X A;  1UN1 A;  2CYF A;  5A1L A;  5C4W B;  4LTA A;  4RGK A;  5FY1 A;  1RUF 3;  4DEV A;  5FR3 A;  5JXI A;  3USU B;  2AZ5 A;  3A22 A;  5FYC A;  3BTY A;  3WP6 A;  4B7E A;  1PGL 2;  1HXS 2;  4YM1 A;  3TEY A;  2RDS A;  2ZGK A;  2WLQ A;  3OSD A;  1AYM 2;  4YM2 A;  2XJR A;  1ZZ8 A;  1AL2 1;  4PDW B;  2E33 A;  4AZZ A;  1RUC 2;  2XKO A;  3VBF A;  4QQO A;  1O3Q A;  3SLI A;  4KQ7 A;  3ZXA C;  2YC2 A;  4K9S A;  5JMO A;  2C26 A;  1UPI A;  4LO8 A;  1QWR A;  5J1X A;  1RUI 2;  3W59 A;  1W6O B;  2BFU S;  3FUO A;  3LB9 A;  1LED A;  3N7J A;  2BNN A;  4JDO A;  1US3 A;  4OHY A;  3O0X A;  3THP A;  1E5R A;  5J3U A;  1GYK A;  3T09 A;  2JX9 A;  5FUP A;  3O1O A;  2P5B A;  5BNN C;  4FVV A;  2JDN A;  2Y6H A;  2XUE A;  2DUO A;  2VCM A;  1SQ4 A;  5A6X A;  4Q4X 3;  3SKV A;  3OGV A;  1BK0 A;  3UL2 A;  1EPW A;  4QQP A;  4UFJ A;  4IE0 A;  4AG4 A;  3T1L A;  4XFB A;  4YAR A;  1V9U 2;  1AR7 2;  2Y0O A;  5CG9 A;  1OF4 A;  2D6P A;  4RGG A;  1JYV A;  1CQ9 A;  3VBO C;  1K3I A;  5E89 A;  4KWK A;  3KT1 A;  3JB8 A;  1PO2 2;  4ISR A;  4KWL A;  3WQ1 A;  4AQS A;  1JYN A;  3B01 A;  3ETQ A;  4IUG A;  3O1M A;  1L7L A;  4R8H A;  3OD0 A;  4H2A A;  3WQ7 A;  1PK6 B;  4XMA A;  3N9M A;  4GQ7 A;  4HET A;  2JDY A;  1WBF A;  3L2Y A;  5DAB A;  1OOP C;  1VPH A;  5FZC A;  1S2B A;  1YO8 A;  1UL9 A;  1BEV 3;  2GZW A;  3WIN E;  2VOV A;  3E1F 1;  3OD4 A;  2VH9 A;  3KVA A;  1H2L A;  2SBA A;  2VXR A;  2BER A;  2E53 A;  1QJX 2;  2EA7 A;  4J25 A;  5LBF A;  4M4P A;  4A7Y A;  2WZ8 A;  4AI0 A;  1F5F A;  4Y33 A;  2XGX A;  3T30 A;  2IFR A;  3MHZ A;  3AKR A;  1OH3 A;  2AR6 A;  2ARX A;  1AR8 2;  2HWC 3;  3DGT A;  3H3Z A;  1UOB A;  3I2F A;  3MIB A;  5ANN A;  3WP3 A;  2A73 B;  1NG0 A;  4B7K A;  3NJY A;  3O1V A;  2DBN A;  3IAP A;  5JOX A;  3CLP A;  4GAL A;  1VJ2 A;  4FFH A;  5A80 A;  2VQ0 A;  4P9X A;  2GMP A;  2BFU L;  3JBG 2;  4GH4 C;  2FBE A;  4YW5 A;  5FZ7 A;  3VGI A;  1XNA A;  4LMF A;  5FZO A;  2JIG A;  3NNM A;  2AUY A;  2ZHM A;  1G6N A;  5BYN A;  2AC1 A;  4BCU A;  3LDR A;  3RYK A;  4CXW A;  2E32 A;  4LBO A;  4XYX A;  3LOB A;  4D7Y A;  4LO6 B;  1VBB 2;  3F2Z A;  2P34 A;  4IER A;  4Q0S A;  4IEX A;  4NHX A;  1VBD 3;  4OCT A;  5DN2 A;  3NAP A;  4NOT A;  4AEK A;  4M3C B;  3PHM A;  5SV8 A;  4C0H A;  3VBR A;  3NO8 A;  3AVS A;  4Y1X A;  4IND A;  1T2X A;  2NZ9 A;  3H42 B;  3HJR A;  1I3H A;  3LZZ A;  1ZBA 3;  2RMU 3;  3M7A A;  4JC1 A;  4LEJ A;  4C1W A;  1OD3 A;  5L7O C;  4J1W A;  4XFA A;  2VZU A;  1HKD A;  3AMN A;  1CZV A;  2KXL A;  5L36 A;  1GZC A;  2RDN A;  3K51 A;  5C33 A;  5AC9 2;  1ASJ 2;  5IHR A;  1Y9M A;  1VRH 2;  3PU3 A;  4QQH A;  2HWD 2;  4OI0 A;  2YC0 A;  2QQP A;  4IE6 A;  4DXS A;  2VOK A;  4AFC A;  4GJY A;  4AVT A;  4ZHN A;  3RZJ A;  5C5T A;  4XFF A;  5K9Y A;  3GCX A;  3RMX A;  3KZ4 C;  4FPH A;  3PJQ A;  5IAX A;  3MBW A;  1JTZ X;  2XML A;  1XYN A;  4NWW A;  2K46 A; 
#chains in the Genus database with same CATH homology
 3PTR B;  4D6R A;  5A7W A;  4EZH A;  2YBK A;  5IVF A;  5A7P A;  2GP5 A;  5FP4 A;  4E4H A;  3K3N A;  5FY5 A;  4DO0 A;  4BU2 A;  4D6Q A;  5FUP A;  2P5B A;  5A7N A;  3LDB A;  5FZF A;  5KR7 A;  5IVB A;  2XUE A;  4QXC A;  2W2I A;  4IGQ A;  4GAZ A;  4QWN A;  5FXZ A;  5FJH A;  4GJZ A;  2XXZ A;  5FYU A;  5FYY A;  5IVY A;  5FZI A;  5FZH A;  4CCL A;  2YBS A;  5LW9 A;  2OQ6 A;  5FY8 A;  4TN7 A;  4V2V A;  5LY2 A;  5FY9 A;  4UF0 A;  2PXJ A;  5A7Q A;  5FUN A;  5FZG A;  4Y3O A;  3PUQ A;  2WWJ A;  5FZK A;  3KVB A;  4IGO A;  5FZM A;  4CCO A;  5ANQ A;  3N9M A;  2YPD A;  4URA A;  3KV6 A;  4XDP A;  5F2S A;  5FZL A;  4ASK A;  3K3O A;  5A7S A;  2YU1 A;  5FP3 A;  5FZC A;  5F5C A;  4C8D A;  5FWJ A;  4HOO A;  5FPU A;  2GP3 A;  5FYS A;  5FXV A;  3U4S A;  3DXT A;  2OS2 A;  4LIT A;  4LXL A;  5FP8 A;  4QU1 A;  5FY7 A;  5IVV A;  3KV5 A;  3KVA A;  5FPA A;  3KV4 A;  3UYJ A;  2YBP A;  5FYB A;  5FYV A;  5FXW A;  5F3G A;  5F5A A;  2Q8E A;  4CUG A;  2OX0 A;  3N9Q A;  4Y33 A;  4EYU A;  4QXH A;  4GD4 A;  1VRB A;  5FPB A;  5F37 A;  4BIS A;  4QX8 A;  3OPT A;  5FY4 A;  4IGP A;  5IVJ A;  4BXF A;  5FXX A;  5A7W B;  5FBJ A;  5FZB A;  3NJY A;  5A3W A;  5F39 A;  5FPV A;  5FPL A;  3U78 A;  3DXU A;  4CCN A;  3PUA A;  5A80 A;  3PDQ A;  5F3C A;  5IVC A;  5FZ7 A;  5FP7 A;  5FZO A;  2WWU A;  5IW0 A;  3ZPO A;  3OPW A;  5F3I A;  2Q8D A;  5FYM A;  5LY1 A;  5FZ1 A;  3RVH A;  4AAP A;  3PU8 A;  3ZLI A;  5A3P A;  5IVE A;  5FZ6 A;  4EZ4 A;  4LIU A;  5FJK A;  3PUR A;  5FP9 A;  4QX7 A;  3AVR A;  4AI9 A;  4UF0 B;  5A1F A;  5CEH A;  5FZO B;  5FY0 A;  5E6H A;  5F2W A;  5FZA A;  5LWB A;  3N9O A;  5FZ0 A;  5IWF A;  3AVS A;  5FZ9 A;  5FYH A;  5F5I A;  4LIV A;  5FYI A;  5ISL A;  2OQ7 A;  5FWE A;  5FZ8 A;  5FZD A;  5FZE A;  4CCJ A;  4QXB A;  5A1L A;  5F3E A;  5FY1 A;  4HON A;  3PUS A;  3N9P A;  3N9L A;  2Q8C A;  2XDV A;  5FYC A;  2YU2 A;  5A3T A;  4CSW A;  4XDO A;  5FZ4 A;  3PU3 A;  2VD7 A;  5K4L A;  2OT7 A;  5A3N A;  3KV9 A;  4CCM A;  3N9N A;  5FZ3 A;  4GJY A;  4DIQ A;  3K2O A;  5FYT A;  5F32 A;  5FV3 A;  4V2W A;  3AL5 A;  3LD8 A;  4Y4R A;  5FYZ A;  3AL6 A;  4D6S A;  4NUB A;  5A7O A;  2XML A;  4CCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...