5IVXF

Crystal structure of b4.2.3 t-cell receptor and h2-dd p18-i10 complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
234
structure length
234
Chain Sequence
MKVTQMPRYLIKRMGENVLLECGQDMSHETMYWYRQDPGLGLQLIYISYDVDSNSEGDIPKGYRVSRKKREHFSLILDSAKTNQTSVYFCASSLGHTEVFFGKGTRLTVVEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVCTDPQAYKESNYSYALSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-D alpha chain
publication title An allosteric site in the T-cell receptor C beta domain plays a critical signalling role.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 61
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2016-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ivxF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ivxF02
3BPOB 3EZJB 3CK0L 1K3ZA 2DICA 3FRPG 3VWKB 4S0TD 4DZBA 1H5BC 2ITCB 3S36L 4PRPA 2P8PB 1QZ1A 3QEUA 1WIUA 4XXDA 3KJ4C 4F7MA 3M8OH 5B39G 1I4FA 3KAAA 3ECBB 4QRUA 5MHSE 1MCFA 2ZZUT 2B1HH 4ZOCA 3U9PH 1TNMA 2VQUA 1OAXH 2W0PA 4ZUUA 2J2ZA 4OZFA 2XICA 1KFAL 3ARDD 2ADJA 4WEMB 4NP4L 5I1IL 2XQYK 1JK8B 1T03L 5D7SL 5FO7A 2FGWH 3CSYA 1BVKA 5JDSB 2EECA 1ZSDB 1RK0A 3DPBA 4OZGF 4KRPB 2YRZA 4F7EB 2XN9B 5KTEH 2FH8A 2F54A 1TETL 5GSVB 2HJLA 2RQ8A 3MV8E 4HFWA 1FBIH 1FCCA 3UO1H 1X5GA 5GGTH 3B43A 4DAGH 1J1XL 3FRPA 3TLRA 2KUTA 5ISZE 3QQ9D 4TVPH 4XCEA 3U4AA 3NN8A 4B5EA 2N4IA 3IVKA 4X8JA 5B39A 1YEEH 2W9EL 1JPTL 3F6LA 4BZ2L 3BZEA 3ARQA 4LRIA 4PS4H 1UZ8A 4HH8A 3TA3D 1D9KB 4YHIB 2FLRT 3VFGL 3CDGA 1HSAB 4L8BA 4M61B 4NQVB 1C5DB 3SE4C 4CN1A 4JJHA 4JPVH 2EDXA 5HBBA 3CD4A 2VISA 4ODUB 4HWBH 2LVEA 1YQVL 1LD9A 1YMMB 5E99H 4M7KL 5DD3L 2VDLH 3IDGA 4B53A 5E95B 2PCPA 2CJUH 4AH2B 1RZKH 4L8DB 1HKLL 1AD9B 3JV5A 4FTVA 4EXKA 1FNGA 4UQ2B 2NX5A 4NNPL 4R26H 5HHPA 1V3MA 4NRZA 3OXRB 5JW5B 3EBAA 3RKDC 4ISVA 1ZS8A 4D9QE 2JKXA 1XGPA 1TENA 5BJTA 3C2AL 4TN9A 1SEQL 2VXUL 2X2YA 1Y18A 4MD5A 5DZNA 5C0RH 1KJMA 1JHTB 3ZO0A 3SGDH 4JO1L 1WQVT 4BSVA 4CU7A 4ELKB 5LG1A 4AENA 4LRNH 1JE6A 1I1CA 5DUML 4XP9L 3MR9A 1Z5LB 5KAQF 3CVHA 3LZFL 1QR1A 5DRZA 3KPRD 4M9PA 5DT1L 5FXCH 3WEXA 1SJHA 1YYLL 5DMYA 3NA4A 3BKML 2LE9A 3MLZH 1FZJA 5L8LB 1KIQB 2FEEL 3AS3A 3BN3B 1CR9H 4XNXH 5BOPA 3H9HA 5HY9B 3RJQB 1RUPL 2Z93A 3IFNL 3SDXF 1VEOA 4Y4HB 5I18L 2BNRD 3H9YA 5MENA 4WNQA 3MV9E 3IKCB 2X4OA 1QRNE 3ARXA 4LLDA 1FVDB 1QSFE 3V4PH 3BMWA 5DS8B 2F53A 5L9DL 4CVZA 3C9NB 1FH5H 4OBRA 4I18B 4JJ5B 3R0NA 4NCDA 4I0PC 3WMSA 5JLZA 2V2WB 1BX2B 5EBGA 1MHHA 2CIKA 4XZUB 4AEIL 2YD2A 1T0MA 5DRWB 4IRSC 1QSEA 4HS3A 3LY6A 2Y6SC 5IG7B 1WZ1H 4HZLB 3P3YA 2QTEA 4X9IA 4N90E 2GSIA 4JM2C 1OL0A 1NFDB 1T3FA 3EKCA 4N0FB 5ESQA 2A73A 5D1XA 1WT5A 3T0VA 4TVSa 3BRGC 1K8DA 4Z8FH 4X6BB 5ENWA 3W0WE 1IAMA 1JPGB 4U1SB 1YEIL 2ARJB 2HVKB 4H1LG 1OTSC 1K6QH 3TN0A 2C3WA 2RAMA 1VADB 3MUGB 3HMWH 5IVZA 1JHKH 1FNLA 3L6FA 4Z7QF 3GBML 1ZTXL 1BQSA 1O7VA 2IADB 2R69H 5HYIA 2I9LA 3K3QA 2GAZA 5DJDA 1RVFH 3N9GH 2G2RB 3FRUB 3VD3A 2EIZB 3BT2H 2Q6WB 4NQEE 4PJBF 4U33A 3MV8D 4P3DA 4PRDA 5SV4A 1KCUL 4J3VA 5E5RB 4E0RA 5SWZA 3MX0A 1MCQA 3ARGC 4JO3L 3ABZA 4OT1L 1KGCE 4N0UA 4ODBD 1D7FA 4XWGH 1NCUA 4KY1H 5ISZD 2ESVB 3VFPA 2R4SL 4YWGH 4NZTL 5IK3B 1FIGL 4MJID 4K55A 3I02B 1MJUH 4HJJL 4XH2B 4EI5C 3WNNA 1HKFA 3BVNA 1GXEA 1BQLH 2XOTA 3T1WA 2K3TA 2Z31D 1EGJH 3HZMB 3DHJA 4IIQB 5MEQA 4XNMB 1EDQA 5D1ZD 3HPLA 3PGDA 3LKPB 4WJ5A 1F6AA 1EA9C 3PHSA 5ALCH 5IESH 4TTDD 1FGNH 2FSEB 5EDXA 3JV6B 2ZUYA 4KRNA 4HWZA 4YXLH 1SBSL 3QXDA 5I16A 3EDKA 3ULSA 4ORGB 1YMHB 4KKCC 2X10A 3RNKB 1IAIM 3HAEB 3U7WL 5FKAA 5K9QG 2BFVH 2XWBA 4FFWC 3EOBA 2IFFL 4P4RB 2AEWA 3C6LD 4OF8A 3MOBL 1IGJA 4PLJD 1E4WL 5JW4M 3RGVA 1CL7I 4ERSL 1KJ2H 2VE6B 1MPAH 4GXUN 3ARTA 3HE7C 3TPUB 3L7FA 1CDGA 4IDLA 5ACZB 3BKYH 2I25N 3P40A 1GGCH 2CGRH 2R39A 1IC1A 5DMJB 5JZ7D 1NBVL 2HFGL 3GNMH 3MLWL 5D2LF 1T1XA 3LKSB 4UNVA 3B8SA 4NN7C 2B1AL 4UILH 1DUYB 2PN5A 1MHPH 3ALXA 3LSOA 5KZCD 1JFQL 4FNLL 1ZANL 1KF9B 3FZUD 5C0ND 3NTCL 1ZLSH 1AXTH 1NFKA 3FQRA 1XZ0A 3CSGA 3RQ3A 3L3JA 1RZ7H 2D7MA 4LCCA 3O8XD 3V52H 4BUGA 3FT4A 3HA0A 3MV9D 2APVA 3EJJX 3U1SH 1QRKA 2HKFH 4PJ5E 1GCFA 4OFKA 4F7TB 3V5DB 4L1HA 2NYYC 1TVHB 1OSZA 4X4YA 4XC1L 3VFOA 4C55A 5T3XD 1FN4A 4PPTA 4QRSA 1XF5A 1F42A 3I3BA 3N1MC 5T1MA 1I1AB 1UM4H 4R90H 3F65A 1IGIH 3TO2A 1HI6A 2GJ6E 5ID0A 1E27B 2BVUA 1B0GB 3CPLA 2NY0C 3VGBA 2JCCE 5IMMA 3M8OL 3MGOA 5I1JH 1KYOJ 5EU6A 1CXLA 1N5AA 2OS7A 4N90D 3PDGA 2B1HL 3U9PL 4P2QE 1OAXL 5CJBA 1NSNH 3FQTA 3SGKA 3VH8A 4OZIE 5ESVA 1FG2A 4AZ8A 3HG1E 2WIIB 3ARBC 4XMKH 2ZOKB 4YDLB 3P73B 3OKEB 4LDEB 2YD6A 3FHQA 1JGVH 3DUUA 2FGWL 2PO6D 1SVZA 3PL6B 2FHBA 4L5FL 4UU9B 5D4QA 4NC1C 1F4AA 1W72A 5KTEL 3ULVD 3O4OB 1NEZA 4JO2H 1UG9A 4LF3A 4QT5A 2IEPA 4LCWE 3RUGB 1FBIL 3BUYA 3IJYA 3UO1L 1EFXB 3DO7A 5GGTL 1G7IA 4DAGL 1RV6X 4HFUH 2OI9C 3UJTH 4U7KA 2PNDA 1ZA3B 3FO0H 2CUMA 4TVPL 1P4BH 2NZ9C 4HUXA 3IFLH 1KOAA 2GK2A 4R8WH 3ZYOA 3MYZA 5EC2B 5GXBB 1YEEL 2VR4A 1KGCD 2ED9A 4S1QH 3BGAA 2V17H 4ZOEA 4ZSOB 2CKNA 3TT1H 5L8JB 4PS4L 1H9VA 1FFOA 4HX1A 4Q6IC 4RGNC 2AEPH 3M17B 4L3EE 3MUZ1 4JPVL 3I85A 5ITFB 4HWBL 3ZSTA 5D8JH 1QFPA 4I4WB 5E99L 4G43A 1RULH 1XF4B 2VDLL 1NUGA 2CJUL 1DQDH 1RZKL 3MA9H 4NT6A 3U6RB 1DSFH 2R9HD 3ZYZA 1IJ9A 1OY3B 1ZLVH 4UIKH 5IT2H 5IVXB 2VLJB 3D9AH 2GTZB 1JHLH 1TTGA 3MA7B 1Y6MR 3WN5B 5DRXB 3SKNB 1GGYA 2R1WB 2ZNXA 5EUOA 5C0RL 3D85B 4ZYKB 2RIKA 3FJTA 5ELIA 1A22B 3QA3A 3D39E 5KVFH 4LRNL 4BFBD 5F97E 3PIQA 3W39A 4Z5RB 5JORA 5FOBB 4MNGA 1BFOB 2NTSP 5AUMB 3BW9B 1QR4A 5D6DA 5C0GA 4N5EC 2GITB 4AYFA 3O4LE 3MLZL 1CD0A 3V6FB 1EV2E 1SMAA 3RPKA 4PRBB 4XNXL 3VXQB 3FQNB 4PJEF 4GLRI 2QHRH 1JI2A 1QTYT 5FA3B 1P69B 2VDKH 3EOTH 4OZHA 3AU1B 1G84A 4NO0D 4WW2F 3KXFD 3V4PL 3TA3A 3RZCD 4KROD 3G6JE 4JN1H 1FH5L 4OAWB 2EXYC 4L4TE 3KYKH 1DQTA 1BZ9A 5DSCA 3SGJC 3WDIA 4PJ5D 1WAAA 2PW2B 1WZ1L 5DFVD 1QNZH 2XY1A 5F93C 2LV4A 1S9XA 2ZWLT 3LN5B 1RZ8A 4W4OA 5DD1L 1N59A 3QG6B 1XAUA 5J6HB 5BW7C 2AXFB 3HMXA 5INCB 2DDQH 2A2QT 4PJ9B 3PUCA 4PJCE 4X9HA 4P2QD 3P9LB 5FK9B 4JREB 3T65B 1K6QL 1RZKC 2RFXB 3HG1D 1S7RB 4EN3C 1CFTB 4PGDA 3HMWL 5F9WC 1JHKL 3KPRA 2ZKHH 5I19H 5EU5A 2H1PH 3P77B 4M3KB 2DM3A 3BPNC 4HT1H 1U8OA 4BH8A 2R69L 2FEEI 5CEZH 1RVFL 3N9GL 2UUDH 3DTXA 1OVZA 2HFFA 4U7MA 3MRHB 3OJMB 3DNKA 4WFGE 5IF0B 3BT2L 3QIBC 5INDA 1RZGB 1N3NA 1UKSA 3EGSA 1X4YA 4LCWD 5DJYA 2XWJA 4J23A 2BNRA 3O6MH 4XNQA 5IB4A 1I7RB 5LWYH 1TZHA 2PR4H 5C92A 3PABA 2Y25A 4PJDA 2NY2C 3TBSA 3PHOA 1A4JA 4XWGL 3GJFK 2DJ4A 4FN0A 5F3HB 1F4HA 4KY1L 3LCYA 3ARFC 4GKOA 2RR3A 4YWGL 1KXTB 2C7UB 5C08B 1YNTB 1FV1A 1WBXA 1MJUL 2WK2A 3W82A 3BH9A 3RIAK 4FRWA 1KPUA 2ICWI 1BQLL 3MYJA 3WFHA 1GL4B 3OGCA 5IFAH 3SKMB 4L3ED 4HWUA 2JE8A 4QTIH 5GGSY 4JDVA 3KLDA 4FQPA 5KSVA 3HE6D 5GRYA 1YYMH 2NXYC 4GRLC 1B90A 5TDPB 1HCVA 5ALCL 5IESL 1FGNL 3STLA 1PJ9A 4LLWB 3UBXG 3AGVA 4YXLL 2NW3A 3GMLA 2DD8H 5EO9B 2GUOA 1T7WA 1CD9B 2XIDA 2V5TA 1RY7B 3HFMH 3QUMH 2BFVL 4G8GB 3FB7B 5CZXC 1U42A 2Y5EA 4NKOB 1KT2A 4PJFE 2CLZA 3TCLB 5IVOA 3D6GA 4J1UA 1G0YR 1KJ2L 3FFCB 4WRLA 1MPAL 1T2XA 3WHXA 4XVSH 1YEJH 3K74B 1V8HA 4DQOH 3BKYL 1HYRC 4Y2DB 1CDYA 5GS2H 1GGCL 2CGRL 4PYGA 4G5ZL 4MCZA 3WV0A 5HHVH 3GNML 1E6OH 4UOW1 4PRNB 4KKLD 4PJ7F 4JM4H 4M93C 3DX9B 1UQSA 4UILL 3O4LD 1S7TA 4Y4KB 1MHPL 4HZAA 2ZUWA 1J12A 3PGCA 5F7DA 5IMOA 1R24A 3BZ4A 5FUCC 4X4XA 1ZLSL 1UVQB 2GHWB 2F5AL 4MJIA 2DAVA 3UBXA 1KLGA 1Q9WA 1RZ7L 1AQKH 2WUBH 1QFOA 4QWWD 3V52L 3EYQD 3RIFK 4GBXD 3LV3A 3HZVB 5FYJH 3U1SL 4Z78B 1HHKB 2HKFL 3VXUB 3HI5H 4L8SB 1G7MB 2Z31A 4Z7WF 4U49A 1PY9A 3GMMA 2VXQH 3D69A 5D1ZA 1CDCA 3EZ8A 5F89A 5JXEC 5C9JB 2R2HA 1NANI 1UM4L 4HKBB 2IANB 4GRWE 2P5WE 4FZ8H 4HJGA 1IGIL 5CSBA 1MFDH 2A6IA 2GJZA 5EOTB 1NUDA 4WV1B 3I6KA 5IFJB 3O6FA 5LAXA 1MVFA 5GISH 3LKOB 5I1JL 4XCNB 2NXZC 3V6OC 2CRIA 4ZPTB 5E6IB 1ACZA 3C6LA 4PJEB 4NJ9H 1NC2D 1NSNL 5LGHH 3SQBA 1MH5B 2J8OA 5B3JF 1P7KB 4HK0B 4M7JH 3REWA 2A6DB 4XMKL 1WFUA 5JO5B 3U36B 4NCC2 3M1BA 4A6YH 4HG4K 4GG6F 4W6YB 3F12B 1JGVL 1EZVY 5IB5B 4AIOA 1J8HB 2EYTA 5GRXG 2J8UB 1MVUA 4HIJB 5DJ8A 1NPUA 4PG9B 4Y5XB 4D0BB 4FFYH 1INDH 4GW1B 5B8CC 4JO2L 3RKPA 3KPMB 3QYCA 5JOEA 3RRQA 2VAAA 1A6WH 4MJ5A 1CIUA 3CX5J 4LPVA 1NMAH 2EDOA 4J6RH 1IEAA 2FBJH 5DWUH 2QR0B 2WBJA 4DEPB 2LU3A 4HFUL 4DUXA 1X7QA 4JFDE 3UJTL 3VRLE 2OTWA 5DQ9B 4FHBD 3SY0B 4X0KB 2H8PA 1P4BL 6FABH 1R5WB 3IFLL 4R8WL 1AHWA 5I2IA 3MREB 4RFOH 1EMTH 2QJDA 3BKJH 3P9MB 4JRXB 4S1QL 4F80A 5GS0D 2V17L 3IF1B 1J8KA 3OL2A 2D7NA 4KRPD 3TT1L 5CD3B 2Z8WC 4P23D 3S35L 4M7ZB 4TUOB 3KYNA 1NGXA 35C8L 2BSSA 4QRRA 4Q9BA 4Z95H 5D8JL 3RWCA 2YKLH 1RULL 3VA2C 4KDWA 4PY8J 3QO1A 1DQDL 4LPTA 3MA9L 4X99B 1TZIA 3AXLB 4WW1A 1DSFL 5DVOA 4LNRB 1KTLA 1WLHA 4NRXA 5CJOH 5HI5C 5ADPL 5D5MB 1U95B 4CDHA 1S7XB 1N8ZB 5KS9A 1A1OB 3CJJA 3KPLB 3SE3C 4LBEA 4UIKL 5IT2L 3MLXH 1L4IA 5TE4H 1LK2B 3D9AL 1JHLL 3VXPB 3KPQB 3KWWA 2PO6A 3MXVH 4P2RA 4ZO6A 4I2XA 4WFEE 1D9KD 1AIFB 5DURB 4HGKC 5KVFL 4JAMB 5HHQA 2YS4A 1MCLA 5ICYB 5J12B 4GW4B 1FO0A 5CJ5A 5LGJA 4IJ3B 4NO5A 2WINB 5IQ7H 2DJUA 1VESA 2AK4E 3ZT6A 4WGVB 2GFBA 3CLEH 3QDJB 5FOJA 1S7QB 3QUYC 4I5BA 4LVOC 4JEGB 1CICB 3C60A 5DO2C 3VCLA 3BJLA 2H32A 1R3LB 4M1GH 3IDMA 3HC4H 1H5BB 3RIAF 2QHRL 4XVUD 3MACH 3WHE0 5C0JB 2EYRB 2AABH 2JIXD 1WBZB 2VDKL 3EOTL 3WL9B 5E8NA 1EHXA 1ZXQA 3KJ4B 1XR8A 2NY1C 1L9NA 2XPGA 4QHMB 4C83A 1CD1A 4P5MA 4JN1L 3GIVB 3KYKL 2DIBA 2ATKB 4ZTOH 3NACH 4YK4C 1T6VN 4KJQC 5I1LB 3TFKD 4JDZA 5BRZA 5T1LD 1XT5A 1QNZL 4LLUA 5KSBE 2MFNA 4JFEE 1A6AA 5EFIA 1WICA 5IBUB 1G7LB 3P0YH 2P5WD 2YEZA 2JF1A 4LPXA 1XGUA 5KVGH 2IBBA 4BFEA 4X98A 5E2WH 1OGAB 2AEQH 3SGDI 1UB5A 2X4UA 1KN4H 2DDQL 3B9DA 3SJVB 3IJSA 3BEWB 4ZUSB 1AGCA 1UZ6F 4OLXH 1VFBB 4H5SA 4N9GA 3U0TB 1H3UA 1FL5B 2VIRA 5I19L 4R0LC 2H1PL 4HJ0C 4HT1L 1CLCA 4AT6B 5ESAB 2R2BA 4MJ6B 5CEZL 2XWTA 4C58B 3K80A 4KK5C 3ZTJH 5J9PA 3TBWA 8CGTA 2DQJH 3RIFF 4Y5VC 3IFPA 4ZODA 1ZA6B 1CE1H 3GM8A 3SDXE 3O6ML 3TV3L 2PR4L 4NO0A 3KXFA 4NRYA 3MNWB 4JFDD 3WUWG 3RZCA 1J0ZA 1G6RA 3C5SB 4P2OC 3LHPH 4NNYB 4I9WD 2HMID 2R1YA 2GI7A 3GM0A 3LB6D 4M1CC 4MMXC 3UAJC 3D18B 1CLYL 2P5EE 4LVNC 3HS0A 4PGEA 1PX4A 2WBWB 4XHQA 4ZO8A 4OLUL 5IFAL 2NZIA 4QTIL 2VN4A 4U1GC 1YYML 5CAYB 4GKZA 2DL9A 3O41B 4XBGA 3EO1A 3H9ZA 3F8UB 2Z92A 4F9LA 1F2XK 2DD8L 4JN2B 4QGTA 4DGIH 5DMKA 4PRIB 1OAUH 2ESVD 2AXJA 5ANMB 1CK0H 3HFML 3QUML 4J7RA 5DHVB 4YPGA 4XNZC 4MWFA 5IJKA 2EDKA 4JZJA 3KVQA 2GY5A 1MWAA 3WUWA 4Z7QE 2PTUA 4P4KB 4HUVA 4M6OH 2R8SH 5HHMB 2AXGA 5IB3B 1BJ1J 4NKQB 4XVSL 1YEJL 4NNXA 3LEXA 1T22A 2ICEB 2WW8A 3OAYH 2LU4A 3QXAB 1MLCA 3HUJA 2AV7A 1ACYH 4PJBE 5HHVL 1QVOB 3HZYA 3R06A 1E6OL 1S8DB 3P4NA 4I0PB 4JM4L 5DHYB 3MRRB 4JY5H 4IRSB 5GGRY 3UTZB 2VN7A 8FABB 1I1YB 4PTUB 1RIHH 4HIIA 1TCRA 1WZLA 5BS0E 3GKZA 5D70L 7CGTA 3VFSB 1LWRA 1OF2A 3CH1B 4HKJB 3SPVB 1H0DB 1A7RH 4JM2B 1A1NA 1AQKL 1F45A 1ZVHA 2WUBL 3S37H 2EDRA 2JK5A 3OB0H 1VEMA 5FYJL 5C7XL 4JCLA 3HI5L 4V2CB 3O3BA 4W81A 4DKEH 1S9YA 4NQDE 4L9DA 4L3EA 4LOUD 2LQRA 4P5TA 5D96C 5EUKB 2VXQL 4EDXB 1AKJB 5ID1A 5I6XB 1NFIA 2F8VA 5F7HA 3T0EE 4TUJB 3S8WA 1T7YA 2CDGB 3VE0B 5L88H 2BJML 2DQDH 4FZ8L 3GJFB 1A6ZB 3IJHA 1MFDL 5DDHB 1JNLH 3KHQA 3DRQA 1R3KA 1ZT7B 1PG7W 2VZOA 1GZQB 1H15A 5GISL 1T1ZA 3WFEH 4JVUA 3SDAC 4CADB 2XY2A 5EN2A 3ZHDA 1FG9C 5LGHL 4HAGA 1G9MH 4LHUB 4OCNC 4HUWA 4XCYB 5CLWA 1U8HB 4M7JL 4LCYA 5EIVA 4A6YL 5IROA 1NAKH 3ARGB 3DUHA 4KKBC 2WNGA 3IXAA 3DX8A 1B6UA 3KLHD 3F62A 1KLUA 3HC0B 32C2B 3QCVL 3VU2A 3DMMC 4FFYL 1KIUA 5SX4H 2ZCLH 1KB5A 1INDL 1IGFH 3VD4A 5D2LE 4OIAA 4KJYA 5ERWA 3LIZH 3B5GA 4EI5B 3VI4F 1A6WL 1AGFA 1NMAL 4OKVB 4J8RB 4MXWH 2FBJL 3WFCH 5DWUL 4YXHH 2YPLA 2HAZA 4DCQA 5IW1A 4CDGC 4PP1C 5D93C 1ADQH 3G5ZB 6FABL 1ZHKB 4GBXA 1ZLWH 4G8FB 1JGDB 1MCIA 1ZT4A 3GSNH 1OAKH 1LHZA 3NOIA 1EMTL 3BKJL 4J2XA 2PYEB 4N1CA 3BXNB 2ZP0T 3PL6D 2H2PC 4XP5H 1MJJA 5EU7E 4UUJB 2P5ED 2ICWB 3AVEA 2VXVH 1YPZA 4Z95L 2Y7QA 4Y4FC 3HPJA 2YKLL 4MXVF 1X44A 1AGDB 3NCJH 2MKWA 1DFBH 4WY7H 3HE7B 1GH7A 3Q1SH 3E6FB 3CSPA 3OTTA 3QNYA 5CJOL 4DTGH 5DD6B 3LQMA 1MCWW 3JUZA 3L5WA 3B9KD 4ZDHB 4OCMC 1K8IB 2OJEB 3VXME 3MLXL 4NN7B 5T5FH 1H3TA 3ZT5A 1ORSB 4Z7VA 5HD8C 2YA2A 2P47B 3MXVL 4QRPE 4ODXA 1I8KA 3CFDA 4M8QB 5F88B 4XT1C 2ITCA 1B6DA 4ZNEE 4TTGA 2P8PA 5IP4A 3WXVH 5IQ7L 5IJVB 4MVBD 1KIPB 2WBKA 4PJGA 3EDJA 1X4ZA 1IAKA 1LVEA 2MQ3A 3CLEL 3UTOA 5FAAA 3ECBA 1HE7A 1A47A 1NBQA 4RZCB 4Z77A 5HYJD 1KENH 4M1GL 3ARDC 2AJSH 3HC4L 3IETB 4YHLH 3MACL 1MQKH 4YEEA 1JK8A 2BX5A 2AABL 5DLMH 5JDSA 2NY0B 1PSKH 1ZSDA 2YUVA 3D85D 1UWXK 3UP1A 2YD1A 2UVEA 4F7EA 5GRWA 1DVFD 1OP5H 1NMCC 1S5IH 2BOBB 3CFCH 4NUJB 5GSVA 4P99A 1T20B 5IWLC 1BLNB 5DJXB 4ZTOL 3NACL 1BP3B 3U2SB 4GAFB 1MREH 4JDTH 3RVWD 4NQDD 3X12B 2OL3H 1I3RB 3S3PA 5FHBH 3QQ9C 1DBJH 4UBDD 5C0DB 1SVCP 3T0ED 5GGUB 4K3EH 3P0YL 4KKAC 5DUPH 1F58H 3NCYS 5KVGL 1MJ8H 4KPHH 2CPCA 5E2WL 2AEQL 1EFQA 1J0HA 3K2MC 3CIQA 4OLWH 3QFDB 1KN4L 4G9DB 1D9KA 2B7DT 4YHIA 4FQHB 1U36A 2OI9B 1HSAA 2Y4SA 4M61A 4NQVA 1C5DA 4J3SA 3ISWA 4ODUA 5I66B 1GAFH 3SEPA 1YMMA 2DB8A 5GZNC 3VMPA 4Y16D 1WTGT 2P46B 2VB5A 4L8DA 4Z0BH 4PD4J 2E9JA 1JPFB 2E7HA 5CLTA 4WI9A 4UQ2A 4AQOA 1IAII 5C0BB 3OXRA 5JW5A 2DQJL 4RGNB 1NBZB 1E28B 1E4KC 1CE1L 3UROR 3VFTB 2XA8H 4AG4H 1RIUH 2EYSB 4RAHA 2V2XB 1JHTA 4NQUA 2VLKE 1GOFA 5DA0B 5FYJU 3LHPL 1ZLVK 4LLYB 1Z5LA 3RL1B 5F21B 5HI3D 1NGWB 1ZAGA 3W9EB 2X4SB 2ZUVA 1KIQA 2BVQA 3NBNA 2VC2H 2NR6C 5HY9A 2PW1B 1IAOB 2Z0BA 1QBMH 3QNXB 3HNTL 5CJXA 2X9WA 3PWPB 4Y4HA 2AJUL 4Q58C 2DI7A 1A5FH 4JFXA 3IKCA 4Z7UB 3ZKMC 1FVDA 4DGIL 5DS8A 4KK9C 3TJHD 1OAUL 2FRGP 1CK0L 2GKIA 3H9SB 2XG5A 4JJ5A 2Y1VA 4YDJA 1IKFH 3VXMD 2PTTB 5C08D 2FO1A 1BX2A 1D6EB 2HTLD 4HPYH 3QUKB 3P2TA 4XZUA 3VG0H 4MD0B 4M7LH 4ZFGH 5IG7A 4M6OL 4HZLA 5CKAA 3FMGH 2R8SL 5C09B 3WKMH 2A77H 3BI9X 5D1QD 2DS4A 3TVMD 3WFBH 3HKFA 3K1KC 2LTQC 3MJGX 3M07A 1ACYL 1XGTB 1NFDA 5HYSB 4Q0XH 4N0FA 5F9JA 4JY5L 4PGZA 2EDYA 4X6BA 4EJ1C 3RTQC 4QNPF 1JPGA 4U1SA 1RIHL 2ARJA 3QCTH 2HVKA 2HWZH 4S11A 2EDNA 3BDBA 1YN6B 4GUPB 5F7KC 4G8GD 1HYSD 3MUGA 2EEDA 2H9GA 4FQQB 4NN5C 1PKQE 3ZSSA 3S37L 4HLZG 1U3YA 1CN4A 3FFCD 2K1MA 2APTA 2G2RA 3FRUA 43CAA 3RDTC 4Y2DD 4DKEL 4W68A 3CXHJ 2EIZA 3OKKB 2Q6WA 3MRFB 3HAEG 4EN3B 1YEHH 4F8QA 4BQ6A 5F9WB 5L88L 3B6SB 2DQDL 4JRYE 3RJDA 3WJJC 4X5WB 2COQA 3BPNB 3DBXB 3VW3H 2UUDK 1JNLL 5C0AE 5ICZB 2ESVA 4Q74A 3WFEL 5IK3A 3S3JA 1FFPB 3QIBB 2NLJB 1YN7A 1PEWA 5BVPH 1G9ML 3I02A 1RU9H 4XH2A 5EZIH 3FQXB 1ZWIB 2BY0A 1OAZH 3MLTB 1NAKL 4QY8B 3VXUD 4XWOD 4LSRH 4MNQB 2YUXA 4IIQA 4OZGA 3T2NH 4XNMA 1GZPB 3S9DB 3R8QA 1AR2A 3ARFB 1BOYA 2B39A 1X5ZA 1P4LB 2ZCLL 4OLZH 4TTDC 1IGFL 2FSEA 3JV6A 4PJ7E 4OFYD 3LIZL 4B50A 4CL7A 2C3VB 4HC1A 4BJLA 4ORGA 5FGBC 2IC2A 2XACC 5LJYH 3HAEA 3WFCL 4YXHL 4WWKC 3W11C 4P4RA 5E6ID 4GAYB 5JIKA 2G5BB 4HS6B 1OM3H 5ETUB 1ADQL 4LSDA 4NJAH 5DC9B 2NXYB 4GRLB 4MYWB 4S1SH 2VE6A 5L8KB 3MBEC 4TNVK 1FNSH 3TPUA 2VLKD 1OAKL 3GSNL 3OG6B 5ACZA 3K4AA 4NO2B 1J8HD 1AJ7L 1FVEB 1MRDH 4Q2ZB 4Z7WE 3GB7B 1BQHB 3HNVH 5JZ7C 4IMLA 4FXLA 1H3PL 1Z9LA 4NQCE 3LKSA 2YWZA 2VXVL 4X6CB 4X6DF 4YBHA 2J88H 1DUYA 3NCJL 1DFBL 4WY7L 1OOAA 5F7FA 3C8KB 3RI5K 3WLBB 5ALBH 3Q1SL 1PGRB 1BVLB 3ULUF 5EPMB 4U6TA 3WLWD 3QPXH 4DTGL 5JA8B 1FDLH 1A7OH 3MSPA 1BECA 4OI9A 3O8XC 3EYOB 5B3JE 1UXWB 1XIWB 3IB4A 4M93B 1C12B 5T5FL 4GG6E 4OD2B 3EJZD 4F7TA 1TVHA 4R4ND 2A9NH 2MMXA 3GBNH 4G3YH 3HCVB 1FAKT 3MUJA 1KN2H 1IL1B 3STBA 3H7BB 4MAYD 2FB4L 1I1AA 1TQBC 4TULL 1KCSH 1V3KA 3WXVL 5I1GH 1E27A 5AYUH 1B0GA 3QDGB 1G9MC 5CP3H 1R3JB 3TPKA 4GAGH 1QO3B 3NA9L 4ETQB 3BKCH 3HB3C 2DIAA 1HWGB 3C2SA 4MQ7B 1PYWB 2AJSL 5HGHB 2WIIA 4YHLL 1G1CA 5FYKU 2ZOKA 3G5VB 2DLFH 1MQKL 3P73A 3OKEA 4PJAB 4IMKC 3NZ8B 5DLML 3S98A 5DEFB 2VLRB 2ICWJ 1PSKL 4NM8L 1VFAB 2IPKB 1LO0H 2J5LB 2XTJB 3PL6A 4OGAD 2OZ4H 5DURD 3B2UC 4UU9A 2NXZB 2Y5TB 1A4KB 3QULB 1S5IL 3CFCL 5GPRA 1X5AA 3SBWA 5I0ZA 5BZDB 3RUGA 3T8XB 3T04D 5DK3A 1EFXA 2EKSB 1QBBA 2FIKB 5JW4R 1N64H 5LQBH 1FL6A 1MREL 4U31A 4U1JB 2OL3L 1ZA3A 5FHBL 3ZE1F 4JLRB 3GZKA 1DBJL 4XXCC 2G5RA 3NPZB 4PRAB 5B8CB 4K3EL 5EC2A 3UTTE 4JRYD 5F1IB 1F58L 1NKRA 3QIUD 1MJ8L 2ZUQC 4KPHL 3OHXB 1GGIH 1A7QH 4ZSOA 1LEGB 4GRWH 2A6JB 4OLWL 1BFVL 1NDGB 4QRUB 1KJ2B 3GJEB 4BELD 3M17A 4OF7A 1VFOA 5J1AB 1Y6KR 5ITFA 2G9HB 1GAFL 4I4WA 5CINH 4K8RH 3NZHH 1XF4A 4HKXB 4WHCA 4Z0BL 1JF1B 4OV5B 3GK8H 3B5HA 5J13C 4LVEA 3U6RA 1KC5H 4H1LH 5HYJA 5DK2B 2VSCA 4U7SA 5IVXA 1T7ZA 2GTZA 1HZHH 4GQ9H 1KCRH 3JWDH 3MA7A 2DWDB 4OLYH 3WN5A 3TH2T 1OGAD 5DRXA 3SKNA 4AG4L 4ODHH 9CGTA 1KELH 1U0QA 3AROA 5FUOH 2ENYA 3D85A 4ZYKA 3BEVB 3UMTA 4JGMA 4Z5RA 5I9QC 5GS3A 2PKDA 5FOBA 4JFHD 1BFOA 2E7MA 5AUMA 3BW9A 2YBRB 1DEEB 5A16B 5AAMA 3VG9C 2GITA 3VWJC 3ZKSD 3L95B 1V5JA 4PRBA 2VC2L 5JHDB 2XXMB 2QSCH 5JOPD 3FQNA 1QBML 2RJMA 5FA3A 3IDUA 2VXSH 1JWSB 2WQRA 3RVTD 3AU1A 1A5FL 2PCPB 2I24N 4QF1B 1KCLA 3O81A 3QUYB 4LVOB 4U6YA 3MNZB 4JPKH 5KBNC 5GJTH 4OAWA 4P2YA 1UZ6E 4H88H 3BQUC 3DV6B 3RKDD 1IKFL 2HH0H 4WO4D 2KBGA 4IOIB 3VG0L 4M7LL 2PW2A 4ZFGL 3FMGL 4E41B 2NY1B 3OKLB 3AAZB 2UY7A 2QADC 1A6VH 3LN5A 2A77L 1AXSB 3WFBL 1BEYL 3QG6A 4XPBH 1ZGLB 4Q0XL 5J6HA 1SJHB 4YK4B 5F71A 2AXFA 5INCA 4PJ9A 1X6LA 4E42B 4YDKH 1MCJA 1J05B 1OGTB 4XX1G 3QCTL 3P9LA 2HWZL 5EOQH 5FK9A 3QQNA 3T65A 2JB5H 2RFXA 1S7RA 1CFTA 5I8CB 4P46D 1AXIB 1LO5B 3MRNB 3P77A 4YFLF 1E6JH 2AQ1A 3KYMB 5HHMD 3EFDH 1IC4H 4LLDB 2FHCA 4PJIF 2DMBA 4YZFE 1DUZB 3T77B 3MRHA 5HVWA 5IF0A 1CQKA 2C4XA 4PREB 2EZ0C 1RZGA 4I0PD 4QOKB 2DMKA 1LEIB 5KANG 25C8H 1T0MB 4IRSD 4R0LB 1F5WA 3VW3L 2Y6SD 2DOCA 3T3MF 2IFGA 1EAJA 2C7UA 3MXWH 4Y5VB 5C08A 1YNTA 4JM2D 2CK0H 4L4VB 5BVPL 2RHEA 1RU9L 2A73B 5EZIL 1OAZL 2XZQH 2OMBA 4LSRL 43C9B 3QO0B 2WSKA 3T2NL 3SKMA 5EOCJ 1OTSD 4P2OB 2VRAA 1C8PA 4ZOAA 3HE6C 5FDYA 3CUPB 5J3HC 4OLZL 3DLQR 5TDPA 1V3LA 1U8QB 2KL6A 1WEJH 1W0VA 1TJHL 4LLWA 4LVNB 3WUZA 5EO9A 2BCKB 3VGAC 3VJ6B 5E6ZA 4JQIH 5CP7B 5DJZB 1M7IA 4G8GA 5F7NC 3FB7A 5E6YA 1UC6A 5A2FA 1I8MB 4NKOA 4U1GB 3LMJL 4LHUD 4NJAL 3TCLA 4S1SL 5TE6H 3SDYH 5EIQA 1Z9SA 3FFCA 1TCMA 1ZHNB 3ARGD 4EIZC 1FNSL 2WV3A 3CDCA 3DVGB 4NSKB 4Y2DA 1MRDL 5F9AC 2R29H 3HNVL 5DFTA 5HPMA 5JW3H 2BXYA 3ZLQC 4KAQH 1CTOA 4KKLC 4JG0L 4XVJH 4OQTH 4XNZB 4Q9QH 3DX9A 4KQ4H 2J88L 4U1NB 3BVNB 2UWEF 4Y4KA 3O3UN 4I0CC 1UH4A 1Z0MA 3GMPB 4PV9B 5ALBL 5FO9B 1AE6H 4U1IB 1UVQA 2BK8A 3QPXL 4CW1B 3S88H 4H0GA 1BVZA 1FDLL 1A7OL 1J88A 3B3IA 3EYQC 3DRTB 3TYFB 4AM0B 3HZVA 4Z78A 1HHKA 4V1DB 3VXUA 4KH2A 5L2KB 4L8SA 3ULSB 3MMEB 1G7MA 2VQ1B 4KKCD 2PYED 3KLAB 2Z8VC 5FGCE 5JIIA 2A9NL 1CLOH 3GBNL 3QFJB 5SX4I 2WM0A 2D03L 4FFWD 4G3YL 1UJ3C 4ORZC 1KN2L 5C9JA 1IGJB 3OB0K 4HKBA 2IANA 1CGTA 1KCSL 5SWQB 1N0LA 1Q9KB 4YPJA 3VI4E 4WV1A 5AYUL 3GSWB 1I85A 3HE7D 4U1HB 5TH2B 5IFJA 3VI3F 4GAGL 5IQ9B 1PFCA 3LKOA 4XCNA 1CDJA 3LQAH 4ZPTA 5E6IA 2WZPD 4PJEA 3BKCL 4N8PA 1MH5A 2C5DC 1P7KA 1EEQA 2NY7H 4HK0A 2A6DA 3U36A 4RFNC 2DLFL 5F1KC 3F12A 1IVLA 4WW2A 1MFBH 5IB5A 4H25B 2O5XH 5DJ0B 4ZUTB 1J8HA 2BNQB 2J8UA 4O2CA 1U6AH 4HIJA 1LO0L 1NCTA 1J5OH 2OZ4L 4D0BA 5HHOE 2E7BA 1XZ0B 4TNWK 4GW1A 4PG2C 3V4VH 3KPMA 3BD3A 4PJXF 5H8DA 4U0QB 5CMAB 4MXVE 3VFMA 3V6ZB 4POZC 4DGVH 1N64L 5LQBL 1NGYB 3T2OA 4M7LT 2NYYD 2QR0A 4ZOBA 1YDPB 3VXSE 2VLME 5DQ9A 3SY0A 4X0KA 3DMMB 1R5WA 1ZKAA 1IMHC 2YMXH 1KIRB 2W92A 3QUMB 4MNHB 1NDMB 5I30H 1HI6B 3MREA 3PQYE 3VDCA 4F37K 3P9MA 4JRXA 1GGIL 1Z2KA 2NY0D 1A7QL 5FECB 3IF1A 5CD3A 4P23C 4WWID 5EU6B 2B5IC 1VEPA 3T0AA 4TUOA 2L7UA 1ZLWK 4QCIB 5D93B 2MTPA 5T5NF 3ARBD 4HHAB 2D0FA 5CINL 4K8RL 2HN7B 3DSFH 3NZHL 5CIPH 3GSRA 4QLRA 3E0GA 3S36X 1DLFH 3GK8L 2RGSA 1O7SA 3ARUA 3AXLA 4OD3H 4FQ1H 1ZHLB 4LNRA 1KC5L 1CE6B 4WIQA 5D5MA 1U95A 1W72B 4W70A 1S7XA 1N8ZA 4XPGH 1NEZB 1A1OA 2A83A 3KPLA 1PLGH 3QZWB 1LK2A 3T2QA 3VXPA 4XC3L 4GQ9L 1KCRL 4Y4FB 3KPQA 3JWDL 4OLYL 1LEKB 1LP9B 4ODHL 1KELL 5FUOL 2R0LH 1AIFA 4GOSA 3L7EB 4RNRB 2AP2A 5EIIB 4TUKL 5ICYA 1Q8MA 4GW4A 1RPQA 4WDIB 1BBDH 2WINA 4K94H 5CILH 5IBUG 4DWHA 2FX9H 3QDJA 4ZO9A 1S7QA 3PV7A 1U8PA 4D9RE 5JNYB 1CICA 2DTMH 1ZEAH 1KJ3H 2P1YA 1R3LA 4HH9B 4HX1B 5C0BD 5TDOB 2QSCL 1H5BA 4XVUC 5C0JA 2EYRA 2VXSL 1WBZA 5J1TC 3RVUC 5FKPB 3WL9A 5H94B 4N1EA 4MDIB 1FVCB 4NT6B 4LAJH 4QHMA 3MLRH 4A6YB 1P6FA 4JPKL 5IMLA 3MO1B 4RWYH 5F1SA 4YGAB 5GJTL 3ARDB 3L3IA 3GIVA 4H88L 1J10A 5KVEH 2Y9RT 3H3BC 2ATKA 2HH0L 3REVB 3V0WH 3QQ3B 4F3FB 1FNEB 3F58H 5IW3A 2QHLA 1CD8A 5I1LA 3FAWA 3GRWH 1OP5K 5CJQH 5CSGA 1A6VL 4XI5C 4KRLB 4DOHE 1NMCB 4PR5B 1G7LA 3V5HB 3PWPD 4HK3N 4XPBL 2BVEA 2AS5M 2E9BA 2C3GA 1K4DB 1OGAA 2GCYB 2UWEB 1JYWA 5K33A 3SJVA 4YDKL 4HAFA 4N5ED 4K9EH 4K8RC 3BEWA 4QO1A 4ZUSA 1MJ7H 3NFPB 5EOQL 2JB5L 2DQIH 1VFBA 3UTSB 1K9TA 5CGYD 3ROOB 2NY3C 3U0TA 1FL5A 5EULV 2EIEA 4OZHB 4UV7L 1AY1H 3MODH 3MRQB 1VKXB 4ZTPH 1E6JL 3QISA 1WWWX 2D9CA 5ESAA 4AT6A 4MJ6A 3B83A 3EFDL 1IC4L 3KS0J 3X13B 2APFA 4UB0H 1T4KB 1CVRA 3MLYH 3JWDC 4LDOB 1JZ7A 4TSBL 3SE4A 1ZA6A 2EXYD 3MLVH 2VLJE 3K0WA 25C8L 3QAZC 4IS6B 1QA9B 1YY8B 1K5NB 2M1KA 2VLMD 4L3CB 1Q94B 5A43C 2AJZB 3C5SA 2MQ0A 2HMIC 1S9XB 4NNYA 4JPWH 3N1FC 4KI5F 3LB6C 1EO7A 3MXWL 5E9DE 4Q9CA 2CK0L 3D18A 3PQYD 2WWMC 4R9HA 4RMWA 2XZQL 3VRIA 3QDME 3P11H 4YAQA 4HMDA 1R5VB 2P49B 5CBAB 1UT9A 1WITA 2R23B 1FZKB 4X9GA 3OX8B 3QIWD 4PJXB 1GOHA 3KPRB 3O41A 4R4FH 1WEJL 2VDNH 3GMOB 5IW6B 4JN2A 3DTXB 4PRIA 4JQIL 4JY6B 3MFGB 2IG2H 5DHVA 2XKNB 1UWGH 1HHGB 4JKLA 4ESKA 2CMRH 3IDJB 2BNRB 1TTFA 4XNQB 1JTPA 1RUKH 4ELMB 5TE6L 1ETZA 1KPVB 3SDYL 2YA1A 3PABB 4MNQD 5IB3A 1F11B 2C1PB 2NY2D 3RZWA 5DZLA 2ICEA 3G6AB 2O61B 3QXAA 5C0IB 5JW3L 4KAQL 1QVOA 1S8DA 4I0PA 4XVJL 4OQTL 5DHYA 3MRRA 4Q9QL 3NMEA 4KQ4L 4IRSA 4QRQB 4D9RD 1I1YA 1TQCC 1XMWA 3R8BB 1NGZB 3CH1A 3VFSA 4HKJA 3SPVA 1AE6L 1H0DA 1MIEL 3S88L 2LTQB 4JM2A 2F58H 2ICES 2NXYD 1JZ2A 4TOYH 3GMLB 2CSPA 3RTQB 1MF2H 4DN4H 3QWRD 4RMQA 5EUKA 1OPGH 4PTTB 5T1DH 4EDXA 1CLOL 1AKJA 1AO7E 4GH7B 4P5KB 3FQUB 3G5YB 4NN5B 4TUJA 2CLZB 1V7NH 2CDGA 3VE0A 4N5UA 3GJFA 1A6ZA 5KSUB 5LXGH 4J1UB 2M26A 3BAEH 3C08H 3PWJB 1BBJB 3D3VE 1ZT7A 3SO5A 4XAKD 1H8OA 1GZQA 4D94A 4CADA 2DF3A 4JFQA 3MV8B 5KJRL 4TRPH 4B41A 1I75A 1KNOA 4LHUA 4XCYA 2NY7L 3LPWA 1U8HA 3P4OA 1IC7H 2HRLA 3MV11 4KHXH 4XX1E 1CGSH 3ARGA 1TNNA 1MFBL 3HNSH 1EHLH 4WHYG 2O5XL 2ZPKL 1T21B 5H37G 3KLHC 5ISZB 3HC0A 1U6AL 32C2A 1J5OL 5IEHB 1Y0LA 1QBLL 4OUUB 3V4VL 2QQKH 4EI5A 2XG4A 4N0YH 4X6DE 4LSPL 3QDGD 4OKVA 2HP4A 3LH2H 5DJ6B 3C87A 4J8RA 3AMLA 2Z31B 1AH1A 3CC5B 4DGVL 5D7IF 1INQB 3MFFB 3FO1B 3ULUE 3G5ZA 2C3HA 1ZHKA 2YMXL 2YZ8A 2FR4B 1SHMA 1JGDA 5I30L 1X5HA 2A6IB 4N8CH 1H3GA 1U3HC 2PYEA 5LAXB 3BXNA 1II4E 5CEXB 1J0IA 5GJSH 4WWKB 4NC2B 2NXZD 5E9DD 3V4UH 4CU8A 5GZOD 1ZV5A 4UUJA 5IOPB 2ICWA 1JYVA 3S4SB 1JGUH 5ABDE 3M1BB 3PWVB 4OBSA 4HEME 1AGDA 3MBEB 3QDMD 4JQXC 2QEJA 1UKTA 5AG9A 3HE7A 3W5MA 1DLFL 2IBZY 1IM3B 3V0AC 3E6FA 4FQ1L 4U05A 1RFDH 5DD6A 4Z7NE 5E2JA 3UZEA 4OD1H 3B9KC 4ZDHA 2LU7A 1U8LB 2ZUXA 4LLVB 4XPGL 1CS6A 1K8IA 1PLGL 2OJEA 1WIOA 1EHAA 2UY6A 1ORSA 5KZCB 4GS7C 3OSKA 4Y19E 4C54A 4LPCA 2R0LL 1PW3A 5TE7H 5FF6B 4M03A 2L0DA 3UTQB 4X6FB 4M8QA 5F88A 2W0LA 2FJFB 3D87B 2GQHA 3O8XB 1BBDL 3MV9B 3WD5H 4K94L 5CILL 1KIPA 5IGXH 2FX9L 2X44D 1QSFB 5DGRA 2HT3D 3BIAX 1CXIA 2IQ9H 4N9OB 4RZCA 2DTML 2DYPD 1ZEAL 4HDIB 4C4KT 1KJ3L 3ZE1E 4RDQF 3IETA 2LABA 1FZOB 1TQBB 4GAJH 2P48B 2FEDD 4GKSA 3MCKB 4LU5H 5AD0B 1B9ZA 1C1EH 2DLTA 3TNMB 4DFHA 3MLRL 1KTLB 1DVFC 1D6VH 4PGBB 5EORH 1OP9A 4H0HB 2BOBA 4K7PH 4NUJA 4RWYL 3NGBC 1T20A 4FQXD 5KVEL 3ARBA 1BLNA 2VLLB 4LBEB 3F7YB 5DJXA 1RZIB 1N5YH 3V0WL 4HUNB 4CGTA 3F58L 3W0WB 3IS1X 3FN9A 3X12A 4I1NB 1I3RA 3GRWL 1AO7D 1RJCA 5CJQL 3FOLB 4G7YH 1S7WA 5HYFA 4UBDC 1U93B 5C0DA 3T0EC 3D0LB 5GGUA 2VZSA 3U30C 1NAML 4W4NA 1CG9B 3T0DA 4LSVH 3VXRE 3D3VD 2GFBB 3QFDA 3QUYD 2CRZA 1MFEH 4G9DA 1YC7A 4K9EL 4FQHA 4NQEB 1MJ7L 3Q48A 5ACLA 3GSNB 5I66A 2DQIL 1IFHH 4NO3B 3E3QE 4JVWA 5CEZE 1IBGH 2VDRH 5IR1B 3T0BA 3OXSB 1KXQE 3DO3A 3FTGB 3T4AB 1AY1L 3MODL 4PV8B 3NPSC 4ZTPL 2ZUQB 1B2WH 1K4CB 1JPFA 2NCMA 4E41D 5CKGA 4UB0L 2NY1D 2XPGB 2XI9A 3MLYL 4C83B 5C0BA 4EEEA 4P5MB 4Q6IA 5JQ6H 4X80H 1NBZA 1E28A 4ONFH 3MLVL 4ZFOL 3VFTA 5JUEH 2V5RA 2NNAB 4YIQB 4U6VH 4KJQD 2EYSA 2V2XA 1VSCA 5J13B 4K94C 3ULUD 4MQSB 4LLYA 2K9UA 5JMRA 5BXFB 1A6AB 4JPWL 3RL1A 4NOBA 1BIIB 5HI3C 2YEZB 1NGWA 5F7MC 1Z3GH 1XF3B 3W9EA 5HYSG 2XFXB 5AZ2H 2X4SA 3I6LD 2X4UB 3BP7A 3DX7A 4JG1H 2R4RH 3D5OF 3P11L 5DR5H 5EU7C 1JWMB 4H0IA 2WUCH 2PW1A 1IAOA 3OQ3B 4JQVC 3OKOB 3QNXA 2ZUSA 4R7NB 3ETBF 5K9JH 4H5SB 4QOKD 3PWPA 5CWSB 3WNKA 1HNGA 1FE8H 1BZQK 4R4FL 2VDNL 1O5DT 4HJ0D 4PRHE 5IBLD 3VG9B 1IRAY 1KEMH 2UYLB 4PJHF 3RWJB 5C70A 1KTDB 1JI1A 2V9TA 3TNNB 1NC4D 1X5IA 3H9SA 3O2WH 3WJLC 1F4WH 2WMPA 2IG2L 2PTTA 3GMRB 1UWGL 1D6EA 1U8KB 3QUKA 2EDHA 4UDUB 2P45B 4ZUWB 1RI8A 2CMRL 2OSLB 4M6MH 4MD0A 2R2EB 1RUKL 4X7TB 5MEOB 4Y19D 4NRYB 1G9NH 5C09A 2FECI 4TSAH 4PJIE 2BVPB 3QEQE 5DQJB 5D1QC 4EI6B 3TVMC 5GGTA 2ICCA 2R1YB 1XGTA 3FB8B 3BQUB 4HW6A 4K9EC 2OL3B 2V7NB 2YD8A 5HYSA 4Z76B 3UAJD 3TIDB 5A3ID 4PJ5B 2AQ3A 1URLA 3QQ4A 3BOVA 5BVJB 2YN5A 4LKCB 2B2XH 3T3ME 1YN6A 4GUPA 5KVDH 4OGYH 1HYSC 4FQQA 4MZ2A 2ENSA 1BMGA 2DBLH 2Q3AA 2GJ6B 4GKZB 5JW4Q 2JCCB 5DXWA 5BW7A 4TOYL 2SEBB 4HWBA 4UV4H 1MF2L 4DN4L 3VMOA 4HUMB 4P2QB 3OKKA 1MCPH 3QUXD 1OPGL 4OZIB 1CFSB 3HRZB 1UCBH 3HG1B 3MCLH 3QR2A 1MOEA 4EN3A 3MLPA 4JZJB 5MP6H 1V7NL 1I8LC 1D5MB 3B6SA 3AB0B 4HD9A 1MWAB 1QG3A 3DBXA 5LXGL 3RAJH 3BAEL 3C08L 2AXGB 5ICZA 5HVGB 3ZT7A 1FNHA 3LEXB 5DVKA 1R5IB 5D2NC 2KKQA 2DQGH 3G9AB 3WIHH 1FFPA 3QIBA 3DVIA 2AV7B 2NLJA 1CGWA 5CD5C 1BQHG 4LCWB 1CF8H 2DQTH 1F02I 3VXRD 3FQXA 1ZWIA 5B38B 5SX5H 3MLTA 4KHXL 4QY8A 1CGSL 4V1DD 4XWOC 5L2KD 4MNQA 3HNSL 1EHLL 1QACA 2EDLA 1CXEA 2HT2D 2VXTH 5T3ZE 1GZPA 3OKYA 4L8CB 3QFJD 3ARFA 3B9VA 5CEZD 1P4LA 1WCBB 3NCBB 3BD5A 4HUKB 3GFUA 5TPWH 5SWSE 2QQKL 1ORQB 2C3VA 2VDPH 4N0YL 1AD0B 3K46A 3LH2L 5ANME 4L3EB 3QJHB 3IFOB 4GAYA 2G5BA 4HS6A 1I3GH 5ILTH 3HE6B 4PBWD 5ETUA 4GRLA 2FZ3A 3KPPA 2D9QB 5F9OH 3OF6D 4NO2A 3IYLW 1FVEA 2X4TB 3DRQB 1QQDB 3QWRA 4PGCB 4Q2ZA 3VGAB 1HH6B 5AYQA 1UEYA 3GB7A 3QUZC 1FORH 1WC7B 3SDAD 3V4UL 5EBMA 4JHAH 3CAFA 5D7KD 1VCAA 4X6CA 5F1OB 1JGUL 3GHBH 4X7CC 1KTKE 4NKMB 1OLLA 4KKBD 4Y1AE 3WLBA 3C8KA 3D39B 3OJVC 3CFJB 4HKZB 4JHWH 1X5JA 3VI3E 1BVLA 5EPMA 1RFDL 3DMMD 5EU4A 4OD1L 3KPSE 3EYOA 2EDEA 4FXKB 3VXTB 1UXWA 1XIWA 3AREC 5FM4A 4PRHD 1F2QA 1C12A 2HVJB 4OD2A 3O4LB 4AY0A 5BV7H 4R4NC 5TE7L 4MB4A 1HHJB 3HCVA 5IW1B 1Z6JT 4PP1D 1IL1A 4MAYC 3H7BA 4RX4D 4C4KO 1HQ4B 3LVEA 2H6PB 1FC2D 5BOZG 5F72S 3H2WA 3MOAH 4JPIB 1IQWL 5GS2D 4QHLB 1MRCL 2BOCB 4MCYB 4LK4A 3QDGA 5IGXL 4JY4B 5J06A 4J4PD 1R3JA 1RUQH 1CDHA 3NABH 3MRDA 3G6JB 3F7PC 1A6TB 3MCG1 3QEQD 5IBTH 1QO3A 2IQ9L 3IAPA 1VGEH 3U7YH 2H2PD 4L4TB 2C26A 4ETQA 4AEFA 1MJJB 3E1F1 1UJ3B 4MQ7A 5JXEA 1PYWA 4UIMB 1PQZB 5HGHA 3SE9H 3G5VA 1QFUH 2EH8H 4GAJL 4BZYA 1G7JB 4KVCH 4PJAA 3NZ8A 4NFCA 5DEFA 4FFZH 1U41A 5KN5A 2VLRA 2XNAB 4BKLB 1SEBB 2IPKA 4I3GA 3DYMA 4OGAC 4WI3A 1C1EL 5FYJD 3V6OA 2Y5TA 1D6VL 5EORL 1A4KA 3QULA 3CX2A 1NC2B 4K7PL 4O2EA 1H3WM 2QL1A 2I9TB 1OTTC 1W8NA 3T8XA 1GJIA 1YJDH 4RFNB 3GUTB 1N5YL 5E4IA 4Y8DC 2Z8SA 2EKSA 3QDMA 2FIKA 3DUSB 5DEGB 5HD8D 4PJCB 1MCEA 5AG8A 4U1JA 4APQD 3RWDB 1J0YA 1U91B 3CZFB 4JLRA 1X5XA 2VOTA 1PZ5B 4G7YL 3O3AB 1ERNA 1P4IH 2ED7A 3UPCA 3X17A 3VDBA 4PRAA 5B8CA 3SKJH 3VMNA 4PBVC 1X5KA 2X70B 5F1IA 5EA0H 1FYTE 3QIUC 4AEHH 4MX7B 3OHXA 4PJGB 4LSVL 1IAKB 1LEGA 2A6JA 2YA0A 1OTUC 1MFEL 1MUJB 1NDGA 1KULA 3W9DB 1VDGA 3R0MA 4Z77B 1MI5E 1KJ2A 3GJEA 3ESUF 2ZOLA 3D25B 1BGXH 1TVBB 5J1AA 1IFHL 2G9HA 1MCSA 4NC0B 5E7FA 1IBGL 2VDRL 1A1MB 4OZ4B 4HKXA 1XGRB 1MEXL 4KMQA 1JF1A 3KGRA 5T3ZD 4OV5A 2GSGB 1GSMA 1B2WL 3Q6FB 3ZL4H 1JZ3A 1DBBH 2IPTH 4P23B 2B5IB 3OWEA 2EO9A 5DK2A 5JQ6L 3MJ6A 1JPSH 2X9YA 4X80L 4ONFL 5F44A 5SWSD 1G0XA 5FYKE 4JZNB 3O6KH 4HLZH 2DWDA 5JUEL 3OG4B 4U6VL 1I7ZB 5BMFH 3BEVA 4U3HA 2YD5A 2XA3A 4CUCA 5EOCH 4A2MA 1VGKB 4ZQKB 2ERJC 3UTSD 4GRMB 1YECH 4KK6C 3SE3A 1BFTA 4KKAD 2YBRA 1Z3GL 2X9XA 1DEEA 5A16A 2JJUA 5AZ2L 4EQ2A 3L95A 3G08B 2E6PA 4JG1L 3DXAE 2R4RL 2UZXB 3GHEH 5DC0A 5DR5L 4DUWA 5JHDA 1ZMYA 4PJFB 3RY6C 5K93A 1A3QA 3MLSL 1T66D 5FV1L 5K9JL 1OCWH 3RVTC 1JWSA 1FE8L 2X7LB 5GZND 5E08L 3KNBB 4QF1A 4HIEB 1MAJA 3QUYA 1DN2A 3WSQH 3GIZH 5KSBF 3MNZA 4WUUE 5D7LE 3EO0B 3O2WL 3DV6A 5GS1C 1F4WL 4NQSB 2V5YA 2ATPB 4WO4C 4HF5H 3GGWB 3U4EA 2JIXB 4IOIA 3ROLA 4NWUH 4X9BA 4M6ML 4LSTH 4TPRH 4POYA 4UT9H 1G9NL 3L3HB 4E41A 4WI2A 3NCCB 3OKLA 3AAZA 3BISA 4XP4H 3QCUH 1AXSA 5D9SB 1X4XA 1ZGLA 1SJXA 2B8OT 5MI0C 1VHPA 5J4MA 3Q2CA 3RPIA 5C07E 4E42A 3BP5B 3ZYIA 1A7BA 1J05A 5T1LB 1OGTA 1E4JA 1LMKA 2B2XL 2BVQB 2GJJA 5KVDL 2IJ0C 1NGPH 2NR6D 3FO2A 4KI5E 5D7JC 4GRWB 2P5WB 4O9HH 4P46C 4YGVB 5I8CA 2DBLL 3LDBC 3CFBB 1LO5A 5C2BH 4YXKH 3MRNA 4JFXB 4OGZA 5EUOF 3KYMA 2VL4A 3ZKMD 1JGLH 4R3SB 4UV4L 3T77A 1DUZA 4KJPD 4FA8A 4KK9D 1EEUA 1MCPL 4PREA 5JXAH 3MCLL 1UCBL 4YDJB 4QOKA 4N0CC 4U4BA 1LEIA 2NY3B 3U9UB 5MP6L 3P9WB 4R0LA 3C5ZC 2G75B 1KTRL 1JUFB 2NMSA 3RAJL 4I48B 4B7IA 5EU3B 4NZUH 4JFZH 3JSSA 2DQGL 4Y5VA 3WIHL 4N68A 1BJMA 4IRJD 4L4VA 2YD4A 4ONGL 1CF8L 1JNJA 5C3TA 2DQTL 3V8CA 5FYLE 5F9JB 1QFWM 3QAZB 2IAMC 4XMLL 43C9A 3NH7H 3RTQD 5MHSD 3QO0A 4JFDB 1MI5D 3BGMB 4CKVX 2VXTL 3BESR 5MERB 4M1DH 1P9MC 4P2OA 1IKNC 4ONHB 2EICA 2H9GB 3CUPA 1U8QA 1WAAF 3PP3H 5TPWL 1QSZA 1L6XA 1MFAH 1IC5H 2VDPL 4AEEA 4AIXA 1UJTA 2BCKA 2F8XC 1J0KA 3VJ6A 43CAB 4LGPB 3RDTD 5CP7A 5DJZA 1A2YB 4FP8H 3QJFB 2DRUA 1MCBA 5ITBH 1G9NC 1I8MA 3RX7A 1I3GL 5ILTL 5FYKD 2EEAA 3OV6A 3MV7E 5CSZB 1WCQA 5FDWA 2R2CA 2NY4C 1MNUH 5F9OL 1ZHNA 1HIMH 2BRQA 5HJ3B 3ESVF 2FJHB 3DVGA 4NSKA 2D3VA 3VWKC 2IF7A 3IDIB 2V6HA 3EAKA 3OAUH 5FCUH 3N50A 1FORL 4CN4A 1TDQA 1YN7B 4JHAL 4FMKA 2X4NB 4U1NA 1UM5H 3GHBL 1KV3A 3TO4D 1J18A 4LARL 4PV9A 3GMPA 4OZGB 1BPVA 3CGTA 3H3PH 4JHWL 4UNTA 5FO9A 4U1IA 2IGFH 3QWQB 4CW1A 3RWGB 5B4MD 1SJEA 4X7EC 1CZ8H 3BWAB 3DRTA 2AK4B 3MRCB 3TYFA 4AM0A 4WI4A 1BD2E 1S7UA 5BZWB 4PJDF 4V1DA 1SJVA 5L2KA 3MMEA 4WUUD 1MCOH 4OLEA 2VQ1A 3KLAA 5BV7L 4XP1H 1TQCB 3QFJA 4RIRB 4WWKD 4D9QD 3W11D 2XRAH 5SWQA 3MOAL 5I1EH 1Q9KA 1XEDA 1EVTC 3MBED 3GSWA 4U1HA 5TH2A 3NABL 5IQ9A 3AY4C 1HILB 5D7IE 2O26U 1VGEL 5E5UB 3U7YL 4IMLB 1GYAA 4HCRH 1YY9D 3SE9L 1OT2A 4ACPA 1QFUL 3VH8G 2EH8L 5C07D 3OF6A 4KVCL 3TT3H 4H25A 1MHCB 5DJ0A 4ZUTA 4I13B 5I76B 2BNQA 4FFZL 1CI5A 5B21A 4JFEB 1RJYA 2F74B 4KI5D 3SDAA 3KDMB 2NW2B 1QRND 3PF2A 1P7QB 1YJDL 1NEZG 3QZWG 5CMAA 1QSFD 2RBLA 3V6ZA 2JB6B 4RBPH 1NGYA 1PKOA 4MA7H 1YDPA 3UX9B 2HG5B 5JOFA 3DMMA 1HNFA 2FO4B 2BMKB 1P4IL 4LKXB 3I9GH 1KIRA 3G04B 3SKJL 3QUMA 4MNHA 3RY5A 3TIEB 3WFDH 5EA0L 3BSZH 3ZZ1A 1NDMA 3F7RA 4S2SB 4WFHE 4URTB 3EYVB 5F6HI 5J0BA 5FECA 3ZKQD 3MTRA 1I1FB 3KS0H 4RRPG 2VZVA 3A67H 2NTFB 1UWXH 3V7AG 3HB3D 4RX4A 2FCBA 1BGXL 4QCIA 3QB7C 3SDXB 4HHAA 5J1SC 2HN7A 2J6EH 3DJ9A 4G9FE 1OP3H 3W0WD 4PD4K 1U3HB 3ZL4L 1FPTH 2H3NA 3G6DH 4C56E 1DBBL 1F4XH 1ZHLA 2NQCA 1CE6A 2IPTL 3B2UD 3BPCA 4YO0B 3OGOE 2VJXA 5BV7C 1JPSL 4HLJA 3QZWA 1WWCA 2P5EB 4LSSH 4UDTB 4Y4FA 3O6KL 3RFZC 1LEKA 1LP9A 4JFOB 4NKIH 1FL6B 1J1OH 4I18C 1A6PA 5BMFL 2OXHA 1QFWH 4NQED 3L7EA 4JFFE 4RNRA 2QKIB 2X5PA 5EOCL 5EIIA 3F6IA 4P2CG 4XTRC 3MGAA 1DJSA 3B9KB 4WDIA 3MV7D 5EO0B 1I7TB 1XGYH 1DBMH 3H0TA 1YECL 3ULUH 1HINH 1S7VB 2DWEB 4RRPA 5C0CE 4BSJA 5C3LD 4GS7B 5J56B 5JNYA 3MRBB 4NZJA 3S6CA 5L0QC 3GHEL 3PWNA 4HH9A 1G7HB 1CBVH 5TDOA 2OMNA 2YUZA 3BH8B 2W59A 1OCWL 4MS8C 2D4FA 1TJGH 4LAQH 4UZGA 2A9MH 5DD5H 5FKPA 3WO4C 5H94A 4LVHC 2BSRB 4M3JA 4MDIA 1FVCA 2XTJE 3WSQL 4F7PB 3GIZL 1FP5A 1YJDC 4M02A 5IIEB 4N1HB 4A6YA 5E94A 4PJBB 5HYJB 1JNHB 3MO1A 4R26L 1MHEB 3ARDA 3I3EA 1BD2D 3LD8C 4ODWB 3REVA 4HF5L 3H8NA 3QQ3A 1RJLB 4F3FA 1FNEA 3IRPX 3L5HA 3CFIC 4NWUL 1A7NH 4LSTL 3O3EB 4TPRL 1P53A 4UT9L 5BS0B 1C5CH 4FXGB 2N1KA 3CFKB 1DVFB 2IBZX 3IU4H 3GDBA 4XP4L 3Q0HA 4PR5A 3V5HA 1UACH 4PRPE 3O0RH 2E27H 5IWLA 1HDMB 4WU5B 4ZAKC 2UWEA 1K4DA 2GCYA 1LK3H 1JCKA 1KBGH 1N26A 4NQDB 3RP1A 3VWJD 5F6IC 3MRMB 3E2HC 3HZKB 4KVNH 3NFPA 4JR9H 2H41A 1CR9L 5KS9F 1NGPL 3NCFB 3T0EB 4G6AD 3UTSA 1IAIH 5FB8B 5IVNA 5CGYC 3ROOA 4O9HL 3U30B 5C2BL 3MRQA 4YXKL 1VKXA 2EDBA 1A7PH 2YD3A 3X13A 1T4KA 1JGLL 3MPCA 3CXHK 4U6YB 4KV5F 3ULVF 5CIPB 2F54E 1HXMB 5JXAL 3BQUD 4X4ZA 5GGSB 3TBTB 1A64A 4Y16B 4IS6A 1QA9A 3FCTA 1YEDA 1IE5A 1YY8A 2P24B 1K5NA 5I74C 4L3CA 1Q94A 4JO4H 2AJZA 4PJHE 1S78D 3DV4B 5DGQA 4NZUL 5LKNA 1LGVA 2QADD 5EBLB 4JFZL 3S97C 5FM5M 5LBSH 1PVHA 5D2LB 4QXTB 1E4KA 2GJ6D 4WFHD 1BZ7B 1T1YB 1C7SA 4FABH 1RK1B 2P42B 5FHAH 4Z8FL 3UDWC 4CBPA 5HVHC 4OFDA 3NH7L 1QOKA 5JPNB 1FFNB 1R5VA 2AJ3B 3VFWB 5CBAA 4M1DL 4XMPH 2R23A 1DE4B 5HXMA 2KDGA 1R3HB 1FZKA 3QIWC 3OX8A 1TMCB 3G5XB 4NBYB 5K9OB 1RZJH 4PJXA 2C4FT 3GSOB 1OQXA 3GMOA 1MFAL 5IW6A 1IC5L 2CLRA 4FTVE 1PDKA 2NX5E 4JY6A 4FP8L 3N06B 4KTEH 2XKNA 2EZ0D 2R0ZH 3O2DH 5ITBL 4YHPB 5FM5O 1HHGA 2LAGB 4R96B 3IDJA 4ELMA 3F5WB 4LHJB 1KPVA 1MNUL 4GKNB 2C4FU 4Y88A 3MLUH 1F11A 1HIML 2C1PA 3P4LA 4JKMA 4JFFD 3S37X 3G6AA 2O61A 3OAUL 5FCUL 5C0IA 3STZB 1DR9A 2AXHA 3VXMB 5KOVC 4XBPB 4DN3H 3CCHB 5IB1B 3MJ7A 1UM5L 4QRPB 4QRQA 4R4BA 1NAMB 2DKUA 1EGJL 3H3PL 1NGZA 2X1PA 3CNKA 5D1QB 2IGFL 3TVMB 1OWRM 4MZ3A 3S34H 1RUMH 1G7PB 5J3HD 1M4KA 5JPMB 5J7CC 1CZ8L 5MENE 1W0VB 1JPST 4OF0A 4KJWC 4N0RA 4PY7B 3L3KB 4NN6C 3ARVA 3RTQA 1MCOL 2F53E 4XP1L 1DANU 4PTTA 1M7IB 2F5BH 4P5KA 5IV2B 3FQUA 3CU1A 4LFHD 3EJYC 3G5YA 3PWLB 3MRJA 1EBAA 1QSEE 5KSUA 3MRKB 1TXKA 3PWJA 1BBJA 1ONQB 3D39D 4ZFOB 3RDTA 2CKBH 3RBSA 5HPMB 2BZDA 3MV8A 1D5IH 4KK8C 1QLFB 4HCRL 3BWUC 3TEUA 5TGBB 2AJYH 5DC4B 3JTTB 1DN0B 3WJJA 1JJUA 3TT3L 4NFDA 4UMGA 1U3ZA 1T21A 1VENA 2H26B 5ISZA 3X3GH 2QSVA 3PP4H 1Q9LB 4KDTC 5IEHA 2NY6D 3FOMB 1AXTL 1BFSA 2QLVB 3OJDB 4YQXH 2DTSA 4AIZB 1CYGA 1NCAH 4OUUA 3B3IB 3FONB 3B9EA 4MB3A 5SX5K 3FN3A 5T1KD 1QUNA 4J3UA 3FB6A 5CGMA 1E4XH 3BD4A 3WIFB 5DJ6A 2FDBP 2D0HA 3CC5A 3B4NA 3RWIB 1INQA 4YHOH 4MA7L 3MFFA 2F54D 3FO1A 3HUJF 4L4TD 4Y5YC 2YWYA 2X4QA 3RHWK 3I9GL 2FR4A 5SWZE 1EX0A 2CUHA 4R90L 3LS4H 1WV7T 2GTWB 3WFDL 1XCTB 1EH9A 1FRGH 2VAJA 4D8PB 3EDDA 4N0UE 5FGBA 4ZFFB 4X9FA 5CEXA 1LO4H 2R56H 3A67L 3RA7H 3NIGF 4WWKA 5GZOC 5E8PB 4B0MM 4PUBH 5IOPA 2E6JA 3TBVB 2BP3A 3V95A 3J8F7 3S4SA 2CQVA 2EEBA 3PWVA 3UTPE 2J6EL 3MBEA 2ARWA 2HJFB 4WW2B 2VLKB 2FX8H 3MZGB 2HRPH 2FIRT 1I9EA 3Q3GA 1IM3A 4O2CB 4G6JH 1FPTL 4Y0GA 3G6DL 3TWCH 1F4XL 3QUZB 1CDUA 4XNYH 5T3ZH 4LLVA 1U8LA 1C16A 1KPRB 3CDFA 4LSSL 2W0FB 3UPRB 2JELH 4FTVD 4KTDH 4OFVA 3VFMB 4PLNC 3RWHB 4POZD 3AFLA 4NKIL 1J1OL 4WFGD 4X7FC 5FF6A 3EYSH 3UTQA 4X6FA 2IALB 2FJFA 5FA4B 3FO0L 3RX5A 2MKLC 1HHHB 5KVMC 5EBWB 3O8XA 1XGYL 1DBML 3MV9A 5I0DA 4HS8H 1QRNA 3WS3B 4X6EB 3ULUL 1HINL 1QSFA 1AGBB 3QXWA 4V2BA 2HT3C 1F6FB 3C6SB 3WCYA 3ZKND 3AM8C 2AV1B 1TETH 3G9VA 4HGMA 4CJ0A 4HDIA 4RAUB 3GKWH 2YXMA 2Q8AH 2AEPL 4MAYB 2DM4A 1XCQA 1FZOA 4F58H 4RGOH 1TJGL 2FEDC 4LAQL 5F7YC 2A9ML 5DD5L 1OW0C 3GSRB 1EIBA 2V9RA 3MCKA 2FNBA 4JANB 5AD0A 5DUBB 2IBGA 3THMH 2Z91B 5IKCB 3TNMA 3UYPA 4BQ9A 4OB5H 4PGBA 2EDWA 1G9EA 5JA9A 4FQXC 2A83B 2W9EH 2VLLA 3BN9C 3F7YA 3BO8B 1RZIA 3GI8H 4U6XB 1U8NB 3W0WA 4IMKA 1A7NL 3BRFA 2F53D 4EUPB 1C5CL 1KSRA 3FOLA 1U93A 1PKQB 2BSTA 2V9QA 3IU4L 3JV0A 1HN1A 3D0LA 1YPZF 1UACL 3U46B 1QSED 3O0RL 2O5ZH 2VR5A 2E27L 3HI1B 1CG9A 4KZEH 3A6CH 3TH3T 1LK3L 1ADQA 4S1DD 5LCVH 1QD0A 4YHKH 4FFVC 4NNPH 1U8PB 4Q97A 1T5WA 5EU6E 4NQEA 4KVNL 1FLTX 1ZLUH 2BVOB 1OT1A 3IT8D 3VGEA 3GSNA 5CUSH 4XXCA 1U8IB 4NO3A 1CFVH 2DMCA 1IAIL 1X5LA 4JRYB 5IR1A 4YBQD 3OXSA 4Z7VF 3OKNB 3FTGA 3T4AA 3QIUB 4PV8A 3RVUD 1A7PL 4LLMB 1K4CA 5GSRB 4P9MH 4WVRA 3UEZA 1NLDH 3K4DA 4GSDH 3TN0D 3L9RB 3IU3B 3LEVH 6CGTA 5IMLB 1LNUB 2MCG1 2DLEA 2Y36H 2AW2A 4JZOA 3L3IB 1I9RH 2JJTC 3ILPB 1VACB 4QYOB 2NNAA 2B4CH 4YIQA 1KACB 4OCWH 3QG7H 3OR7A 4OTXH 1RUPH 3ULUC 2Z35B 2X4PB 2VMFA 4JO4L 3L3OA 3SGEH 1A9BA 5BXFA 2C1OB 1BIIA 4XI5D 5LBSL 5SWZD 4PJ7B 3BJ91 3RWEB 2FHFA 2PUQT 1MFNA 4GMTH 1XF3A 2J4WH 2ZSVB 4R97C 4FABL 2XFXA 4G42A 5FHAL 1F97A 3ES6B 4WU7A 4F9PC 4BFIB 1A3RH 4GXVH 4K8RD 1AI1H 4DW2H 4K3JH 1JWMA 3K4ZA 4Z18A 4MD4B 1JZ8A 4LLQB 3WKNA 4XMPL 3OKOA 4R7NA 4UT6H 2JTDA 2ERJB 4YE4H 5CWSA 5F7WC 5A2KH 3UTPD 1RZJL 1C7TA 2NY3D 4M48H 3V6BR 2ZKHL 4HQQH 5IBLC 2P7TB 5IHBA 3VWJA 4Z7WB 2UYLA 3RWJA 1SY6H 5H37H 5GGRB 1KTDA 4HV8B 4KUCF 3K1DA 4KQ3H 3SN6N 3TNNA 4NQCB 4KTEL 3GMRA 3O2DL 4O58H 5I8OH 1U8KA 4UDUA 1Z9OA 4ZUWA 2OSLA 4X7TA 2R2EA 1IGMH 5MEOA 4U1MB 1ZE3C 1ITBB 5LWYL 3NAAH 5EUOE 5L7XH 2ZG3A 3MJ8B 3MLUL 1FIEA 3C8HA 4LP4A 5FYKH 2QBWA 1RUAH 3OAZK 4OFPA 2BVPA 5DQJA 3RHWF 3MGTB 4EI6A 1WJ3A 4WHTB 3FB8A 4NQXB 3Q5TA 3BQUA 5GS1B 2OL3A 2V7NA 3LRGA 3RGVD 4Z76A 3DI3B 4WV1C 4WO4B 5H35B 3TIDA 5A3IC 5C6WH 4PJ5A 4MNGE 4GG6B 4DN3L 1FJ1B 2A0LC 2WWMD 5JHLH 5BVJA 3VRIB 4I8DA 4YZFF 5AZEH 5B38G 4LKCA 1F00I 4YAQB 2W07A 2W60B 4JHZA 3S34L 4JFPB 1RUML 2GJ6A 4OZHE 4R2GC 2JCCA 5MI0B 4EQ3A 2SEBA 4YH6A 3QPQC 4Y5XC 12E8H 3ZE0E 2EO1A 4P2QA 3QUXC 4BUHA 4OZIA 1CFSA 3HRZA 3HG1A 2F5BL 5D7JB 5CEYA 4P46B 3LDBB 1J9CT 1D5MA 1WAAE 1R6VA 3MJ9H 4ZUVB 1ETZB 4WFED 3O11B 4DQOL 2IPUG 3TZVC 2CKBL 3SO3C 1ODAA 1R5IA 4MHHI 5ADOH 5E8EB 2QV2A 1QPPA 5DTFB 1T89C 1D5IL 2VNCA 1GPOH 4LCWA 1X5YA 2AK4D 2AJYL 1FAIH 5B38A 1NLBH 4OUOA 1HXYB 3C5ZB 5FFLA 4HSQA 2IFFH 1RZJC 1Y6NR 2HT2C 4MSWB 1YUHB 3X3GL 4L8CA 1RAMA 2EC9U 3PP4L 1XF2A 3E3QC 1E4WH 1AR1D 5C2UB 1WCBA 4YQXL 2OM5A 3SDCC 1CFNA 5KSAC 1NCAL 4K7PY 5IM7B 3BRDA 4HXAH 1ORQA 4R7DB 4MA8H 1E4XL 1AD0A 2HFTA 2IAMB 4YHOL 3QJHA 3PG2A 3IFOA 1NFDF 5HDBF 5GGQH 3HE6A 3IXTB 4ONOA 3PP3K 3LRHA 3LS4L 1N7MH 4O51B 4PJDE 1FRGL 2X4TA 1TPXC 2HLFC 4JFED 1QQDA 4PGCA 1L0QA 1HH6A 4AL8H 1LO4L 1WC7A 2R56L 1J7VR 3RA7L 1MIMH 2ZUTA 5HTSA 4XAWH 4JFQB 1GIGH 4WTZA 2E3VA 4NJ9L 3RVVC 1KNOB 1EJOH 4PUBL 2M2DA 3UZVB 3P4OB 1JV5B 1P7QD 5I1AB 2NY4B 4YLQT 3RBGA 1FGVH 4NKMA 1XR9B 5GIRA 2FX8L 3D39A 2HRPL 3CFJA 4HKZA 1CXFA 4G6JL 5FYLH 3TWCL 1CGXA 3JTSB 4XNYL 2VUYA 2EE9A 1AFVH 4L4JA 1Y0LB 4FXKA 3P0VH 5T3ZL 2ILLA 3VXTA 1FL3B 3ARWA 5CFHA 2HVJA 3O4LA 3P4MB 2JELL 4J6RL 4KTDL 4QHNB 4ZFZA 1AP2B 2CXGA 3R1GH 3EYSL 1HHJA 4RAVB 4IHOA 3QBTB 5E8DH 3CMOH 1HQ4A 2H6PA 1OB1B 5IHZA 4JPIA 4MB5A 5T1KA 4QHLA 4HS8L 2BOCA 1MCKA 4MCYA 1X5FA 1U9KA 4JY4A 4J4PC 4RFOL 4RSVA 4Y2OA 4L5FH 4L9LC 1U3HD 2FX7H 3G6JA 4LPUA 1A6TA 4LSUH 4GG8B 4L29B 4L4TA 3GKWL 1UJ3A 1NKOA 4UIMA 1PQZA 4NIKB 2Q8AL 1FC1A 2X1OA 4F58L 5L6YH 4RGOL 1G7JA 3QNZB 1VA9A 1F13A 2P8MB 1JZ4A 5E5MB 2XNAA 4PJHA 4BKLA 1SEBA 3THML 5HPOA 4MJIE 4OB5L 5TFSH 2P8LB 1NC2A 1MY5A 5K9KB 2I9TA 5TE4L 3GUTA 4ODTH 3GI8L 1T1WB 3DUSA 5DEGA 4PJCA 3VGFA 4APQC 3RWDA 1ES0B 1MCDA 1Q9OB 1U91A 3CZFA 1PZ5A 4O02H 3O3AA 4NUGH 5C8JB 3RL2B 1U2CA 4PIRF 1CGYA 4PG2A 2X70A 2O5ZL 4MX7A 4KZEL 4RBPK 3A6CL 3IAGC 4YC2C 1QFWI 5LCVL 4EXPX 4YHKL 1MUJA 4Y7MA 3W9DA 2RB8A 3D25A 4HBQA 5CUSL 1TVBA 1OHQA 4FQ2H 3SKUD 5KANI 1CFVL 5JIHA 1BWWA 3GMNB 2VABB 4OF3A 1A1MA 4OZ4A 4PLKC 2WLYA 1XGRA 1LO3H 4CMHC 4GKSB 3GSUB 4HIHB 4QXGH 2I27N 2GSGA 3Q6FA 3RNQB 5BS0D 4P9ML 1JGEB 5H2BB 1NLDL 4DK3A 4GSDL 1U58B 4P23A 5K59F 3LEVL 5DI8A 3NIDE 1BM3H 4WFFE 5HHXH 2Y36L 3OZ9H 2JJSC 4RMUA 1I9RL 3ARBB 2NY5H 1OP3K 4JZNA 1KEGH 2B4CL 4LDLB 4XB8A 4XPFH 4OCWL 4OKDA 1I7ZA 3QG7L 4XNUH 4OTXL 1DL7H 2BVYA 3GEWB 3NCYP 1S7WB 3GI9H 1VGKA 4ZQKA 5HSFA 4POUB 5D2NE 5BV7B 3X11B 4GRMA 2NPLX 4P4KC 4IRZH 5IB2B 1EVUA 1ZK9A 4GMTL 4ZO7A 1EAPB 2J4WL 5DRNA 1LDSA 2HA1A 2EDJA 5J11C 5DK0B 3G08A 5HDLA 1IQDB 1A3RL 4GXVL 2V7HB 1AI1L 4DW2L 4K3JL 5A40E 5T3XE 5EZLB 1A14H 4PJFA 1QBAA 5CP3A 1NBYA 1XFPA 4UT6L 1T66C 1UWEH 4OLXL 4QRRE 3RUGF 4YE4L 4M48L 2X7LA 3QI9C 3KNBA 4HQQL 4HIEA 4XPHH 1ZT1B 1WTLA 1SY6L 5DD1H 5L0QB 4YR6B 4NZRH 1VFMA 3EO0A 4KQ3L 4Q6IB 3L3GB 5KS9E 4NQSA 3VFRB 2ATPA 3A6OA 4O58L 5I8OL 1ZGLM 3GGWA 3GSXB 2JIXA 2QQLH 4ODSH 2OZ4A 5DJ2B 2GK0B 1IGML 3WO4B 5T33H 1NCNA 4LVHB 3NAAL 4P2RE 3JWOH 1EK3A 4I2XE 5L7XL 3L3HA 5FYKL 5I6XC 1A21A 4ZD3H 1RUAL 4KV5E 4Z6AT 3ULVE 4UAOC 5D9SA 3WS6C 5TQ2H 3LD8B 1T6WA 2G60H 4QTHB 5J89A 5JHLL 5D6CB 5FGCB 1A0QH 3BP7B 3DX7B 3BP5A 5F6HJ 3N1GC 5AZEL 5T1LA 1PZUB 3QWOB 3LKRB 4H26B 5IVXF 3ZMRA 2P5WA 4YGVA 3CFBA 4ZAKB 2ZSWB 4BK4A 3QSKB 1S7SB 1S9VB 4R3SA 3LN4A 12E8L 4KJPC 5F6IB 3E2HB 2B4CC 1S9KC 5IMKB 1DQJB 1NMBH 3ET9F 4K7FA 4RFEB 4H1LA 3U9UA 4M8VA 4J3XA 2G75A 3MJ9L 1JUFA 4QRPD 4XPTH 4I48A 5BRZE 5EU3A 5HHOB 5LVEA 3WXWH 5I71C 5ADOL 4IRJC 4N8VB 1DCLA 1GPOL 2XT1B 4F2MB 3D2UD 1FAIL 3QQ4B 3O6FD 1NLBL 4ODVH 1XGQB 2OTUB 4JFDA 3BGMA 2CO7B 5I74B 3VXSB 2E7LC 1CLZH 5MERA 1T0PB 2D7QA 5KG9B 3FT3B 2ADGB 4ONHA 1JNNH 3TESA 1A7RL 3N85H 3TCXA 3PQYB 4OZFH 4HXAL 4YNYB 1T0NB 2XV6B 2LAAA 4G5ZH 4MA8L 3VRJB 5HVHB 1A2YA 3RVXC 3QJFA 4PJ8C 4WFFD 4YUEH 3WDHA 2VWEE 3OR6B 5GGQL 5JMOC 3QIWB 1OAQH 3CFEB 2Z8RA 5CSZA 1EBPA 3PXHA 2X09A 3KXFE 2WBJD 1N7ML 4XGZB 3TH4T 5HJ3A 2FJHA 2F5AH 1DZBA 4LEXH 3IDIA 4AL8L 1KB9K 2I5YH 2HYMA 4K23H 1MIML 4OCLC 5DJCA 1T80A 4XAWL 1P2CB 1GIGL 4IOSD 4F33B 3DURB 5CD5D 1M71A 1EJOL 2DM2A 4RMSA 2X4NA 1U2HA 1U3JA 3O9WC 4I3SH 3TO4C 1FGVL 2W0KA 1EUTA 4YFLI 2FJGB 2NY2B 1PAMA 2VH5H 3HHRB 5FYLL 4RCAA 1GRWA 1G0DA 3RWGA 4QRRD 5B4MC 3C09C 3NVQA 4FQCH 1AFVL 3IS0X 3I2CH 1YC8A 3P0VL 4OGXH 4IOFC 3BWAA 3MRCA 2AK4A 2FWOB 5BZWA 3RGHA 2A74B 4D2NA 4KDVA 3FHAA 1S3KH 4MXWL 1RZFH 3BZFB 1QYGH 4RIRA 3R1GL 1UXSB 5E8DL 5DMGD 3CMOL 4WGWB 1WWAX 3A0OA 5I1CH 2FZ3B 3K2UH 5KAQG 1L0XA 1E4XI 1RMFH 3KPPB 1QHPA 4P2RD 2CDFB 4P59H 3EYUH 4NN6B 4LSQH 2WQ8A 2FX7L 1KJVB 4LSUL 1HILA 3QUZD 4XP5L 1FHGA 4MA3B 3HUJE 2V2TB 3H42H 1YY9C 5EBMB 4W6XB 1L6ZA 5CZVH 5L6YL 3CVHH 1GGUA 2FD6H 1MHCA 2ED8A 4G6KH 5I76A 1N2RB 3C60D 5KSBA 4JFEA 3DYPA 4XBEH 3FFDB 3U82B 5E00B 4KI5C 4XCCH 4DOHB 2F74A 3NIGE 3I3DA 5EU4B 5TFSL 2AQ2A 4CVXB 3KDMA