5IVXF

Crystal structure of b4.2.3 t-cell receptor and h2-dd p18-i10 complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
234
structure length
234
Chain Sequence
b'MKVTQMPRYLIKRMGENVLLECGQDMSHETMYWYRQDPGLGLQLIYISYDVDSNSEGDIPKGYRVSRKKREHFSLILDSAKTNQTSVYFCASSLGHTEVFFGKGTRLTVVEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVCTDPQAYKESNYSYALSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-D alpha chain
publication title An allosteric site in the T-cell receptor C beta domain plays a critical signalling role.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 61
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2016-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ivxF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ivxF02
1UWGL 5C8JB 3T4AA 4N5UA 3MYJA 3CFCH 4O02H 2WINA 1UM6L 1XIWA 4OCYL 4I3GA 2WBJC 3LSOB 3FQUB 1X5XA 5E9DB 5CEZD 4K2UH 1VPOL 3HLAB 1J87A 2EKJA 1MAML 3QO0B 4LLQB 4U6XA 3DGGA 3ZE0F 5D93C 3UBXA 3TBSB 4PJGF 2R2BB 3MJ7A 3IAGC 1P7HL 1HHHA 2CXGA 2MWCA 4X9FA 5ALBH 2AXGB 4JZNB 1F90H 4F57H 3TESA 1RJYB 3OKEB 2DLIA 2Q7NA 4OBSA 2XV6B 3WCYA 3CCHB 1I1YB 2XA3A 1BOYA 3VXNB 1ERNA 4PJ9D 4HIXH 1VGKA 3QQ9D 1FZMB 4DW2H 4QWWD 3PABB 2D4DA 1NCNA 4JM2A 3VWKD 1YNKH 4LF3A 3EZ8A 1Q9LB 2Q20A 4M43H 1F58L 5KZCD 3MR9B 4G6FB 2H2PD 4A6YB 3DWTA 4I3SH 5C0BE 1QRKA 4FFZH 3AS2A 4UQ3A 2HA1A 1IGFL 2MFNA 3O3UN 4YDJA 1MCQA 2VH5H 4LEXL 3B2VH 1OP3K 1RUKL 4EN3A 2WIIA 4FABL 3VDBA 1NC4A 1MJJB 2QQLL 4V1DA 3VXOA 1P2CA 3LB6D 3O9WD 1S8DA 2G5RA 5GIRB 5FA3B 3H6JA 3RL2B 5H2BA 3TPUB 4XNXL 2PXYD 4KVNL 3BH9B 3JV4A 1PSKH 3LS4L 4QLRA 1DQLH 2R1XA 4PGEB 3QDHA 2ZCHL 2ZNWA 2F8OA 1FO0H 5I0ZA 4NN5B 3SDAA 5CLWA 4PR5B 1JN6B 2QQNL 4PRBB 4OCSH 3UDWA 3ZE1F 3JV6A 2ITDA 2J6EH 1EA9C 2AJZA 5FGSA 3STLB 3O8XB 1HHGB 3LHPH 4QOKB 3O41A 3FB8B 3NIGE 4R4FH 1FE8L 3TEUA 5CJQL 5SX4H 5EU5B 3RA7H 2H6PB 2VDOH 4J3SA 3TLRA 3O4LD 3HNTL 4YBQC 4N9GB 5FO9A 4OCMC 1KBGL 3FO2A 1FVDB 5C07D 3AXLB 3MO1A 4F9LA 4L1DA 1F4AA 3MRNB 4LIQL 3KLAA 3MFFB 3GK8H 4DN4L 3C6LC 3GJFK 4Y5VC 1N6QL 4RMUA 1P5UA 2PF6A 5C0AD 4BQ6A 1IM9B 3G08B 4I4WA 4DOHB 5EBMA 3GMLB 5H8DA 3PGFL 1A2YA 3BIKB 1IAII 1ZOXA 5HHOE 5BRZB 4HKZA 1U3ZA 5IB3B 5EPMB 3O6LH 3UPRA 1YNLL 1JHLH 2X09A 5GSRB 1J86A 3CFJA 1TJHH 1A6VL 1JGVH 4K3JH 2VDKL 1UH4A 1XGTB 1HH6A 5ID1B 2D2OA 3OXRB 4P3CL 5DYOB 3U30C 5D71L 3D1MC 5K9KB 3WNLA 1KGCD 4JPIA 1SJEB 4HKBB 2XXCB 4HBCH 1QTYT 2J8UE 5DUMH 1NCWL 4OKVA 4PV8A 3P4OA 2M26A 5DMJB 3T8XA 2NY6C 4AIXA 2ED8A 4ZUVB 2ZCKH 3I9GH 3QPQC 3TA3B 4D8PB 1U8HA 5E2JA 1MLBB 4F3FA 3O45B 5T5NF 4RQQA 4NQEA 1OAXL 3I6KB 2GITB 5C1MB 3O6ML 3EZJB 4A2MA 2LFGA 4H8WH 4MA7H 5ESVA 2X4RB 1S7UB 2EDFA 5T5FH 5F44A 3QRGH 3OBAA 1JI2A 1RZJL 4X99B 1HSBA 3VRJB 4XHQA 1GIGH 2A6JA 3MRQB 1RUPH 2OR9L 2EEDA 1F13A 3VWKA 5C0CA 1ZHBB 1JCKA 3GKZA 5TPWL 4QHLB 4G8FB 2JTDA 2R9HC 3AS1A 4JZOA 3HN3A 3OX8B 5EUOE 1I8IB 5I15L 1WFTA 3QIBC 4G6JL 3B5HA 1VFUA 3BD3A 3WJJC 2NY1B 3AS0A 5D9SA 1BJ8A 3NABL 4QO1A 4NNXB 3QHTC 4HGWB 4HKJA 1P84K 4K07A 5KVFH 3G04A 3QUYB 2XWTB 4U7SA 5HYSB 5EN2A 3TBYB 3BPOC 2F19L 3VGAC 4G43A 3VRIB 3T2NL 1J1XH 4ZOBA 3VFUB 1MFAH 1U8QA 3AAZB 4LVNB 4DTGH 4IMLB 4HIEB 1KOAA 5HVHB 1UH2A 3RVVC 5DRZB 1K4DB 2UWEB 3IFLL 2ITCA 2D7NA 2OTWB 3DMMC 3SE4A 5EZJB 3PWVB 2QSCH 3ULUD 4OCXL 2HJKA 4FQ1L 1UB6A 3I6GA 1JWSB 4IJ3B 4EOWL 1BFOA 4QNPE 4WHYG 1CFQA 4U7MA 4HWNA 2Z93A 5K9JH 2UYLB 1C7TA 2CO7B 5IT2H 2XZQL 5D2LB 3CK0L 5E1AA 2ICCA 2VLJB 3T77A 4LNRB 3VJ6A 1Z0MA 2X70B 1RVFH 4Y89A 4MD5A 2LABA 1ZT7B 4UV4H 1N5AB 4GS7B 3G6DL 3NCBB 1MH5B 3GSUA 2HJLA 1NFIA 3QHFL 1UXSA 3W82A 1CFNB 4PJCA 4APQD 4U6YA 5GS2H 3QIWA 3SO5A 2BFVH 3PL6B 1AD0B 4CJ0A 4NQTA 3CFCL 1J18A 5BW7A 2BY2A 5DGQA 3HMWH 2FLBT 3K2UL 1D9KD 4IHOA 3FQWA 4K2UL 4C56A 3Q2CA 4I2XB 2P4AB 3ZE2F 4E41E 5I1LA 1F4HA 2R2CA 4OLYH 1OARH 2DAVA 1NDGB 2IALB 4Q6YA 3N50A 5IHZA 3GMNB 3BHBA 1EAPB 3DROA 5JNYA 2E9WA 5E4EB 4F57L 1T2XA 4PIRF 1CXEA 3QBTB 1EUTA 3PWPD 5HPMB 4U2ZA 5FCUL 3CUPA 3BH8B 4XHJD 2IGFL 2WANA 4NKMA 4HIXL 3VXTA 2YR3A 3PUCA 4DW2L 4KDTC 4X4YB 5CD3B 2WZPD 1YNKL 4HUNB 1BFSA 4M43L 1X4XA 1B0GB 1KJVA 1ROWA 1EVUA 5MI0B 1WAAF 4I3SL 4FFZL 1Y18B 2W9EH 4OGAD 1BF8A 4JY5H 1JF6A 1QO3A 2MJWA 2VISA 4RA3A 5F3BA 3QUXA 2ATPB 3KPOA 3FONA 5D6DA 4P99A 4L3EB 2EDTA 1U8LA 7CGTA 2DQUH 3KAAA 3RUGA 2UUDK 1MI5D 3B9KA 1R5WA 1NDMB 3LVEA 1TETH 7FABL 5E0QA 3E2HC 3BQUC 4ZQKB 4K23H 4Q74A 4D3CL 1ZK9A 5JA8B 4BFEA 4NFBA 5EC2B 3QUKB 1PSKL 4QRPE 5FYKD 5B38A 5B21A 4PJEB 1LNUB 3JTSA 4U6VH 3S37H 4X8XA 4CVZA 3OWEA 4OCSL 3LD8C 5CIPA 3AB0B 3L3OB 1KEMH 1KTDB 2B1AL 1UXWA 1ZWIB 1J12A 4IM8A 4QRSB 3SJVB 4MJIE 4Z95H 4BA8A 1GOFA 2JJWA 5A40E 4OKDA 4H1LB 3BEVA 4R4FL 3OL2A 4X7SL 1H8NA 4QHKI 4UQ2A 3RA7L 3LQZA 1QYGH 1HCVA 5MEQB 1T0NA 5CJ5A 2VDOL 4GG8A 1XZ0A 3QG6A 3LKRA 4FXGB 2ZOLB 1VKXA 4HHAA 3V4UH 4WEBL 1S7QA 5SX4I 4X6DB 2ARJA 5KVDH 1P4LA 5ISZB 2GHWB 1FFPB 4LLMA 2BOCB 3LQAC 1FFRA 3BGFC 4NO0B 4X7EC 5F6IB 3RI5F 3HUJF 4TVPH 4XCFH 4F15B 5HHXH 1E27B 3I6LD 4R8WH 4WHDA 3GK8L 2FCBA 1FFNB 4F37K 3VXUE 4YBHA 1KIPB 5TDOA 1UCBH 3EOAA 1JYXA 2R4SL 4CAGA 3T1FA 1UVQA 3ETBF 5DHYB 2A9NH 1B0RB 1D5XB 4M4RA 4WV1C 3BVNA 5DURD 2WUBH 4Y19D 1I7TA 5DRNB 2E8ZA 1WQVT 1A5FL 3A6OA 1RK0B 5DK2B 1CFBA 2VZTA 1C7SA 3O6LL 3VW3H 1JHLL 3KXFD 3HZKB 3IGAB 2GCYA 4LGPB 2D7PA 4UDUB 2NLJA 1OPGH 1TJHL 5IUSA 2GTWB 3VI4E 1NGQH 2L4OA 4PBWD 2H9GB 2XPGA 1RUAL 3GSNH 1GGTA 4DVRH 2FR4B 1V3LA 1DDHB 4MA3A 4LCCA 5DUML 2C3WA 3GM8A 4DGIH 5J3HD 1FL6A 1H3XA 3O6FC 4HUWB 5KSAD 1IM3A 2IADA 2ZCKL 3I9GL 4HJGB 1LK2B 5E8EA 2F53A 1SY6H 1R6VA 3NPZB 1HXMB 2ADIB 4MXQD 4JQIH 2BNRB 3KPLB 2JCCF 1UQSA 2HFGH 5D6CA 4MA7L 2AK4B 3B5TA 5J13B 4LLDB 5T5FL 1NBVH 1G6RA 4M7ZC 1DQDH 4QYOB 1F3JB 3LKOA 4G8GA 1GIGL 1FPTH 3WMSA 3REWA 1RUPL 3MV9D 3SY0B 4IDJH 4F33A 4FMKA 5CJOL 5AD0B 1FHGA 5AAWA 1QVOB 3ZHLA 1JPSH 4KHXL 4K94H 1WT5A 1U91B 2OSLB 2X1PA 3RPIA 2NXYB 1ZMYA 2Q86B 5GRUH 1Q94B 4OZIE 3ARBA 4LDOB 3QIUD 4PJXB 2PR4H 1QOKA 5KVFL 3QUMB 2ENYA 3H2WA 4XCNA 3T3PE 1K8DB 1B6DA 3VFWA 1GHFH 1E4XH 1ZEAH 3FOMA 3T1WA 2Z9TA 5KG9A 5HI4D 4YJZL 2CDFB 3PP4H 4OM1H 4ODTH 3X14B 3T04D 5JQHC 3VFOA 4DTGL 3GHBH 3NCJL 1DQJB 5KANG 5DI8A 5GGTH 1TVHA 2PO6A 3UEZA 4YDIH 1YYLH 2YPLB 3KPPA 4B50A 5I1IL 3RWGA 3WL9B 5FYLD 1OM3H 2RHEA 1AO7E 2QSCL 1WZLA 1WZMA 4F9PA 4LLWB 4D94A 1JWMB 2XFXA 3FO0H 4BK4A 3TN0B 1SHMA 4O51B 3G5YA 5IT2L 2OXGA 5JPNA 1ZGLA 2WBJD 4YBLB 1BP3B 4PJBE 3SDDC 1AXSA 4PP2B 3WIFA 4M6OL 2GYSA 4KH2A 1I85C 2P8PB 2QHLA 5DJ6B 1S7WB 3B9DA 4Y16C 4TUJB 5ANMB 5TGBA 2EYRB 1SJHB 1TVBB 4BYHA 2FIKB 2BCKB 3QDGD 3B9AA 5HDQL 5FAAA 3QULA 3L3IB 1KIUA 4DFIA 5LGHH 4CVXA 5INDB 5A16B 3DV4B 5HGHA 1XGYL 3HMWL 2MSPA 4LPTA 3VFPB 1T1WA 2VXUH 4L8SA 3T4YA 4LHJB 4QTHA 3QDAA 1MELA 2H41A 4I5BB 1YJDH 2DMCA 2AXHA 5C0EA 3IRZA 1G7JB 2Z92A 4OLYL 1OARL 3DRQA 3Q6GH 3HZYA 5LVEA 2I9TB 4LASH 4LHUD 2XICA 1L0YA 2VUYA 1KACB 3FKUS 2YD7A 5T3ZH 2Y07H 3D3VD 4N1HB 3ULSA 5BJTA 1N7ML 2FRGP 4JLRB 1A3RH 1I9RH 4P2OC 5F7YC 2LTQC 5GRZA 5I19H 3VE0B 1HEZB 3MZGB 5D7IE 3RUGF 3N1PC 4URTB 4GUPA 4U1IB 2Y6SD 3DBXB 3RY6C 4JY5L 4JEGB 4Z6AT 4K71C 3G6JF 3MV8A 1RZJC 1FVEA 1RJCA 4TOYH 3OKDA 3Q5TA 2DQUL 1DUZB 2VR4A 1QLFA 4PJHE 4D0DA 5BV7B 4NQDA 2NY3D 1BEYH 1H15B 1TETL 3ESVF 4KMTH 4F7PA 4BFBD 5IP4A 5HHME 1LEKA 5C08E 5C9KA 2Y36L 1A1MA 5J6GA 4NZDA 4WU7B 1QEWA 3FT4A 2OI9B 4MHHG 3BP6A 3ET9F 3EOBA 4U6VL 5D7LE 5DJYB 3S37L 5E8DH 1G7PB 1ORQB 3ULVD 3INUH 3QFJA 2CIKB 2AS5M 3C9NB 1PDKA 2EE2A 3C6LD 3WS6C 5DJCB 5JHLH 1OAUH 2CKBA 4HJ0D 3K8LA 5I1HH 4JRXB 3KJ6H 4YGVB 4R9HA 4P5KB 4AIZB 4LHQB 1HNGA 1QYGL 2VR5A 3MLXH 4JR9H 4U1LB 4JFXA 1FP5A 2R2EA 1P7KA 4NUGL 4Y4FA 1CR9H 2EDXA 1U3HC 3L3GA 4M62H 3V4UL 5ADPL 4G80A 4YPJA 1CVRA 5MEPA 3AC0A 5CSZA 1AP2B 3RP1A 1JNLL 5KS9A 3LCYA 1BREA 5JO5A 4RRPG 1J05B 1T5XA 2IQ9H 1RQ5A 4L4TA 4TVPL 5HHXL 4HLZH 3K1KC 4KY1L 4R8WL 4RFNB 3I75B 2VLKB 2AAVA 4GQ9L 1UCBL 4CMHC 1HCFX 1JUFA 1CICD 2HN7B 2F58H 3F6LA 4X6CB 2ZOKB 4WY7H 3D18B 5FA4B 2NY6D 2BMKA 1XGRB 5DUPH 3QPQD 4JFPA 5D1QB 4TSCH 4R7DA 4PRID 3PJSA 5JHDB 1Z5LB 2EDWA 1A9EA 5IVXE 1CLYH 4IRJB 4P2RD 4HW6A 3VWJC 4GOSA 1OSPH 5IVZA 3MV7D 2VL5A 5J7CC 1MCJA 5DQ9A 3MNWA 4L8CA 1YUHB 4S11A 4JRYB 3NCEB 2CIIA 2B0SH 2AJYH 4M61A 3GSNL 5D7JB 4ELMB 4DVRL 1DN2A 4YIQA 3IFPB 1PY9A 4JKPH 2R9HD 1P5VA 4WFFD 4BUHA 5D1XB 1NL0H 1L4IA 4U1NB 1QZ1A 5IMLA 1TZHA 2UZYB 4PLKD 1FVCA 4R7NA 1YEKH 3QZWA 4RZCB 4JQIL 3ULUE 2HFGL 4MX7B 3RGVA 4YQXH 5TDNA 5BZDB 2X4QA 3KVQA 3WNNA 3U83A 4C59B 3DXAE 1NBVL 1DQDL 1HDMA 4LEOA 3D2UD 3MRKB 4OUOA 4LRNL 1FPTL 4Q6IC 1ULVA 1WBXB 2G9HB 5HYQA 1KB5A 1TTGA 2FNBA 4X7TB 3BDBA 3HC3H 1ACYH 2B5IC 1R0AH 2PYED 4XPHH 1JPSL 4YNYA 3GGWA 1CK0L 4K94L 3MPCA 5JR1H 4OZ4B 1MFNA 4MS8C 1AY1H 3RVVD 4P9MH 2JJTA 2AW2A 4JCMA 5D96B 3KYNA 1VEMA 3FN3A 3SGJC 4PRNB 2PR4L 3DMMD 1U9KA 4YFDB 4NRYB 3ARFC 4MSWB 1H5BC 2VZOA 1T89A 1S78C 1A21A 5IFAH 1E4XL 3S8WA 4MQ7A 5E2WH 3NCYS 4JKMA 4FFYH 5HYFA 3MACH 3OR6B 1FYTA 4FN0A 1MHEA 3PP4L 3QA3B 2AJVL 3FRPG 1CYGA 3D0LB 1E4XI 4WFHE 1NFDF 4AENA 2O5ZH 3GHBL 3JZ7A 5E6IC 1XAUA 1J9CT 5GGTL 1E6OL 5GGRY 5DJ0B 2B39A 1R3KB 2BOBA 3B2UD 4RSVA 4WTWA 4E42B 1PKQE 4PUBH 4GJTB 2VLLB 3V8CA 4GG6E 1DVFC 1ZLWH 2VZUA 4LKXB 4Y5VA 1A9BA 1HWGB 5CUSH 2C4FU 5KOVC 3LKNA 4Z7WF 2PTTB 2ZUSA 1FFOA 2EC8A 4HX1A 4N8VG 4R0LC 1NEZB 5B39G 3S5LB 5MP6H 3FO0L 3RZCC 4GAYA 4KK6D 3I50H 4GXUN 2FH6A 3HG1E 4YFLF 1FC2D 3KPSB 3RBSA 5HJ3B 3TVMA 4YC2C 4U1MA 1QSFA 1OGAA 5I73B 2G2RA 4OI9A 5GRXG 4P5MA 4F2MA 1TZGL 3CX5J 2HLAA 1K5NA 1S9XB 1HE7A 1U8MA 3P9MB 3HAEA 2I5YH 4JFOB 3ZT5A 1F8TH 3IDMA 1V05A 1J1OH 4XCYA 1REIA 1U8IA 1G7IA 3D85B 5F89A 3L3KB 4HZAA 4X6BB 5DD0H 2G75B 2A6IB 1A1NA 2R1YB 1QRNB 5CBEA 5LGHL 4M3JA 3DVGA 3V6OE 4N0CC 4GAGH 5C0FA 2AKRA 4CGTA 2VXUL 1YJDL 5BS0D 3MUGA 4RCAA 2C3VB 2OQJB 3U4BH 2AEWA 2I25N 4JQVA 2KH2B 2VZVA 5EBLA 5F93C 1JMXA 5AAMA 4WI9A 4U1SB 4UTAH 5CZKA 4UT9H 4ONFH 3WE6B 5T3ZL 5T5NG 5IW6A 5EUKB 4J6RH 4DEPC 2A73A 1R3JB 4YHNB 3AREB 2GK0B 3R06A 1A3RL 3FRUA 2OZ4A 5KANI 3BQUD 3UTOA 4NRXB 3LRSB 2IFGA 2ZG3A 5C3TA 5I19L 1IGMH 3QIBA 4YPGB 5FXCH 3H8NA 3ZYIA 2N56A 2ADJA 3U1SL 5L2KB 3ZDXF 3QFDB 4IDLA 3VMNA 2DWDB 2HH0H 4M6ML 4XZUB 1WFNA 1TDQA 3T2OA 4H1LH 1J88A 1C5CH 2OTPA 3QEQA 1J0JA 5DC9B 5CSBA 3EYFA 1X44A 4TOYL 4D2NA 4ZXBB 1B3JA 5EORH 5L2JB 2D9QB 5EU6A 2A6DA 4OZGB 1WWWX 4KXZH 3KHQA 2VITB 1BD2A 3PNWA 5DJDA 3P4MA 5LJYH 1QSED 4TUOB 3TWCL 4J23A 5E8NA 3UTPD 5JOEA 3S9DB 3KXFE 2GT9B 3H9ZA 3NIFF 1T1YB 2GW5A 5E8DL 4K7PX 3IDJB 3INUL 1I8MB 5K9OB 4HK0B 3UTTA 1G7HA 3STZA 3ZTNH 5JHLL 1F11A 1OAUL 1A3QA 4NGHH 4RA0C 5I1HL 1SMAA 3KJ6L 1R3IL 2F54D 4FFWC 1CXIA 4NPYA 5BQ7A 1E4KA 5KS9F 3SKOB 5DVLA 3SBWC 4JR9L 3MLXL 2X7LB 4I3RH 3UTSD 5AWNL 3KPNB 3BESR 4M62L 3TIDA 4ODVH 5FK9A 3VXSB 1D5BA 4IMKC 4QRTB 3RPKA 2ZUTA 3EO1A 5FOJA 1AQKH 3ROOB 3NMEA 4O58H 4FG6C 5C0GB 3LZFH 2IQ9L 3LSOA 1DCLA 3FQUA 4MB5A 5E9DA 3VRLE 1M6OB 1MWAL 5JXED 3HLAA 3MV9E 3QO0A 3S36H 3QDJB 2ZUQC 3MUY1 2MQ0A 2R2BA 1QA9B 2W65B 2F58L 5HYJD 4LK4A 5F1NB 4WY7L 2WW8A 1RHHB 2AXGA 2J5LB 4B7IA 3ALXA 4JZNA 3ZKQD 1RJYA 3OKEA 3FFCE 3H7LA 3O6FD 4I0CC 2CDEB 3V6BR 4BSWB 1HH9A 4GXUM 1YZZA 5DUPL 5KAQG 3D39E 4W6YB 3CCHA 4TSCL 1I1YA 4P23B 2OP4H 1P4IH 3ZDYF 4NKIH 2PYFB 1CLYL 4GW1B 1FZMA 3RWFB 1B4JL 3BZEB 5IROA 1KB9J 2O26U 5CEXB 2OK0H 2M1KA 1U2CA 2B0SL 2AJYL 4ZS6D 2YA2A 1TTUA 1DQMH 4A6YA 1I3GH 5IB4B 2FJGA 1EEQA 4JKPL 3PQYB 4X6FB 2GIYA 4JFEA 1NL0L 4M6NL 1LEIB 1MJJA 3N06B 4Q9QL 5I66B 3O3AA 5ICZB 2DYPA 1FC1A 2VZ3A 5GIRA 3RL2A 4Z0BH 4UIKH 5EZLA 3TPUA 3G5ZB 4YQXL 3BH9A 4DKDC 3M1BB 3VG0L 1YQVL 5BVJB 2VDNH 4PJFB 4J2XA 4PGEA 2E5EA 5I8EB 5D2NE 2YXMA 3LN5B 3PDGA 3S34H 1LEGB 3BDYH 4PR5A 3HR6A 4PRBA 5DFVC 3HC3L 1ACYL 1R0AL 1JGLH 3MXWH 4XPHL 4ETQB 3V5KB 3STLA 1HHGA 5JR1L 1WIPA 4N8PA 4PGCA 3FB8A 3U48A 1KJ3H 4P4RB 4P9ML 4Z7VB 1FN4A 5EU5A 1U8JA 4CMMB 4S10A 3RNKB 2H6PA 4PJGE 1F4YH 1K4CB 3K0WA 4F8TA 4J4PC 5I8CA 3MRJB 4R90H 1J0IA 3SDCD 4OCWH 1BPVA 1CG9B 5CGMA 4P46B 1FVDA 5E2WL 3AXLA 3NCYP 4FFYL 3MACL 4FP8L 5FGRA 4NP4H 1WLHA 3MRNA 4ZO9A 3VXMD 3WKMH 3MFFA 3K74B 2PNDA 5EU3B 2I26N 3T0EB 4FQCH 2XZCH 3SDDD 5ICYB 4BH8B 5CGYC 1IGJB 3HPLB 3WN5C 5D7SH 1IM9A 1WBZB 2X4PB 2CJUH 4Y16D 1NC2B 1YMMD 1QLRB 4NRZB 5B22A 3ESUF 5CUSL 1IKNA 3BIKA 3OTTA 3EYOB 4EI5B 5T1LB 5BRZA 4IS6B 2AJ3B 4PJ5E 3EO0B 4L8DB 5EPMA 1OD9A 3I50L 5GSRA 3MRPA 2GEEA 5SWSE 3W0WE 1SYSB 3SGKA 5IBLC 4R26L 3RGHA 5DYOA 1K3ZA 1AGBA 2DD8H 3MUJA 5CJXC 5K9KA 3J7HA 1ZAGA 4TQEL 1SJEA 4HKBA 1IL1B 4PJ8C 2I5YL 3IXTB 5F1IB 2J8OA 1QD0A 1F8TL 1J1OL 1JGDB 1RJZA 4L9LC 4ZTOH 5DJXB 4ZUVA 5E70A 3SE3C 4I0PD 1SEBA 4D8PA 2GJ6E 3ZE1E 1MLBA 4LCWE 3O45A 1FSKB 2A38A 4N8CL 1LE5B 4NIKB 2P5EE 3CIQA 3DETC 4P2OD 3QAZC 4LPCA 2VDRH 1JJUA 4GAGL 4U2YA 2X4RA 1S7UA 1RULH 3MBEC 4TNVK 3ARGD 3U4BL 3ULVE 5BV7H 1C1EH 2P7TB 1ZHBA 3WYRA 1F00I 4QHLA 3HR5A 3MV01 2VLRD 4G8FA 5TDPB 3DURB 4UTAL 4HMEA 3V7AG 2HFFB 3OX8A 3LRGA 1I8IA 4R96B 5F9WC 2VABA 2AV7B 4J6RL 4XC1L 1WEJH 4OQTH 1D7FA 5D1ZC 4AG4H 2ARWA 4LSSH 4NNXA 1YECH 5D5MB 4HGWA 4ELKB 3ES6B 1RHFA 1TCMA 1IGML 3QUYA 2CR3A 2XWTA 3JSSA 1XH3B 3D39B 3GMPB 2PTVA 4XPFH 3TBYA 2XACC 2HKHH 5MHSD 1JWUB 2C26A 1H8OA 3VRIA 2YWZA 2HH0L 2XQYG 3Q0HA 5DEFB 1MHHA 4KAQH 3LEYH 3S35H 1CFSB 4P59H 4BFIA 1C5CL 3EOYG 5MENB 3HZMB 4WUUE 3MGOB 1BIIA 3AAZA 4HDIB 4S0TD 2W07A 3FFDB 4RFOH 4UNUA 3N1FC 3Q5YA 4IMLA 3EO9H 2EXWD 4HIEA 5BCAA 2AERT 2DICA 2R1WA 1L9MA 2CLZA 5DRZA 1K4DA 2CLVB 3FB6B 4K94C 1OGTB 2OTWA 4XTRC 5HDOA 1X5LA 3SDXF 5EZJA 3PWVA 3O3EB 3L7FB 4KXZI 1U3HD 4JVPA 3C60B 1JYNA 4JM4H 4KJPC 1MCOL 4L4VE 4U1JB 1FNSH 2VZSA 4WWKD 3V0VB 3ISWA 2GTZB 2IF7A 1KIQB 5D7KE 4G7VL 4UT6H 2JLLA 5D2LA 3MTRA 2QV2A 5B3JF 1HZHH 4LNRA 4ODSL 1ZT7A 4NGHL 4WFFE 1AIFB 3OKMB 3QCUH 3SOBH 3MLYH 4ZPTB 1MH5A 4NNYB 4G5ZL 1M71B 3SDDA 4WO4D 4XPAL 4HS3A 3H7BB 2BSRB 1CFNA 4E0RB 4GBXC 1INEL 4E5XB 2R0WH 4ODVL 5JW4Q 3DGCR 3PL6A 1AD0A 3N85H 5GPRA 1PKOA 1KCVH 2RFXB 5JUEL 3SDYH 3LPGA 5GGSY 3VWJD 5FDYA 4O58L 3LZFL 2IANA 5I30H 1AHWC 5DC0A 4I2XA 1FNEB 2JIXB 1JPFB 4HUMB 5H35B 5C70A 3OJMB 3OKLB 3WV0A 2DQGH 2IALA 1T83C 1ZS8B 3EAKA 4TTDC 4NCDA 1KYOJ 3GMNA 3ZZ1A 1EAPA 2DKMA 4PG2C 1UYWH 4OZFG 4HZLB 5GJTH 1EEZB 4UAOC 5HPMA 5TE6H 3V5DB 4F58H 2VWEE 2OP4L 2BHUA 1P4IL 5TQ0L 3MMEB 1YNTB 1U95A 5ITFB 4X4YA 1QUNA 5CD3A 3LDBB 4N0FB 1B0GA 3EYSH 3BO8A 2OK0L 3ZMRA 4EDXB 4MCZA 1DQML 5EOCL 5F8QC 1I3GL 1UACH 2EH8H 1I1FA 1X9QA 4CW1B 1YJDC 1A02N 4XC3H 2ATPA 2XN9E 4L3EA 4TULL 1EJOL 5FKPB 4C55A 1W72H 1WTGT 3VXQB 2LU3A 3GJEA 5E24E 1BX2B 4ZQKA 1NCAH 2BNQD 4Z0BL 3EYQC 5IEHB 1JNNL 2NX5B 3QUKA 1O7SA 2VDNL 3ARFD 3CZJA 1UEMA 1QNZH 4HWUA 4PJEA 1LNUA 2JJSA 4BZ1H 3IU4L 1S78D 1NJ9A 2AGJH 2P5EB 4NWTL 1LO2H 3RDTB 3S34L 3BDYL 3L3OA 1KTDA 1RK1B 1YY9D 5SWZD 1JGLL 3MXWL 2AJUL 4QRSA 4HIHB 3GFUA 1QFHA 3VXRD 1HHJB 3OF6A 1MRFL 1RZFL 5E6ID 1U58B 4P4KB 1KJ3L 1PX4A 5IB2B 5EU4A 3ZE2E 2VN4A 4KQ3H 1DVFD 4FXGA 1F4YL 1MCLA 2X4UA 2ZOLA 4OZFH 4K7FB 1NCUA 3VFNB 4X6DA 5CJBA 1FFQA 5ISZA 4OCWL 4XAWH 3T0EC 2P5WB 1HILB 3RWJB 4Q9BA 3W9EA 2BOCA 4ZFOL 3GIZH 3GMQB 4NO0A 2B8OT 4FQXC 4NP4L 3SO3C 5BS0E 4JJ5B 1U3HA 2EEAA 2APTA 1I7ZB 1E27A 4PG9A 3WKML 4Y5XC 4HLJA 1FFNA 1EEYB 2Q3ZA 5C71A 1KIPA 2XZCL 3GMRB 2NXZC 3IXAB 5D7SL 2D3VA 4XT1C 5DHYA 3V95A 1B0RA 1D5XA 1EFQA 4V1DE 5GRJH 5JZ7C 2CJUL 5DC4B 5KOMC 2OL3H 4HT1H 3C5ZB 3J8F7 2ESVB 4HUUB 4PRPA 5DRNA 1S9VB 1MEXH 4PS4H 5JIKA 5DK2A 1J8HD 1JRHH 1ZA3B 3HZKA 2XTJE 3IGAA 1KJ2B 5BO1H 4UDUA 1T03H 5F9DC 4KKAC 1MCCA 2GTWA 4WIQA 4UBDD 2H9GA 4UINL 2DD8L 2EC9T 4HFWB 2W60A 5BOPA 1QR1B 2YS4A 1NGXB 3DX6A 4NQVB 5DEZA 3ZYJA 1DDHA 3WJLA 5JW4M 5HHPB 5L8LB 4NHUB 1RZIB 3BW9B 1KN2H 4ZTOL 3UYOD 4HUWA 4TNWF 4HJGA 2BVOB 2IBZY 1LK2A 2DBJA 3CPLB 2B1HH 3D0VB 4L1HA 2FLRT 1HXMA 4CU8A 2ADIA 5CHNB 2BNRA 4XCEB 1OTTC 2XKUA 2VDRL 2AK4A 3HI1A 4GKZA 3WBDA 4QXTB 4AEIH 4KTDH 4LLDA 4OIBA 5ETUB 1RULL 5DVKA 4X5XB 4QYOA 1F3JA 4HMCA 1N59A 4MNQA 3X12B 2P24B 1CDYA 3MA9H 1YEDB 4JFDB 3TJHD 1C1EL 3S36X 3D25B 3SY0A 3NCMA 4U0RB 1BVKB 3ZHKA 1TXKA 1X5IA 4NN7B 5AD0A 1M7DB 2K3TA 2Z8RA 3WSQH 1OB1B 1U91A 2OSLA 4Q6IA 3TO2B 4X7DC 5CP7B 1NSNH 4HWBH 2Q86A 4Z7QF 1WEJL 3KPRD 2PN5A 4OQTL 4AG4L 3ULUH 2MNUA 4LSSL 3VFGH 3F7PC 5J11C 4POUB 4PJXA 3WFHB 4ZOCA 2GAZB 1KC5H 3I2CL 3QUMA 2GJJA 1DANU 4C83B 1K8DA 4Y2DB 1NMAL 2HKHL 4KAQL 3LEYL 3S35L 2CDFA 4H26B 1ZV5A 4PRHA 4NKOB 3HCVB 1FL5B 2VL4A 3X14A 5I75C 2DBLH 5EWIH 3TZVC 4RFOL 1LO4H 3EO9L 5A2IH 1P1ZB 4ZAKB 4J12A 4FFWD 3FMGH 4FOMA 2YPLA 3SCMC 5I1AB 5E8PB 2VAJA 3WL9A 4RX4D 1IFHH 4OIAA 4YEEA 4JM4L 1DBKH 1JWMA 3QT2A 1FNSL 4S1RH 5DMIH 5F9JB 4O51A 4P2QD 5JTWA 3VG9B 5J9PB 5C09D 1HINH 3ARYA 4FG6D 1MIMH 1LD9A 4UT6L 5C0CE 2WINB 2V5TA 1HZHL 4KC3B 1XIWB 2YK1H 3RZCA 4PP2A 2X9XA 1CE6A 2BVEA 3QCUL 2P8PA 3MLYL 5DJ6A 3R4DA 1S7WA 2HVKB 5GHWL 4KRPD 4TUJA 5ANMA 5DMKA 3ZKSD 3MLRH 1TVBA 4NT6B 4H0IA 2FHBA 2X42A 2FIKA 4F7MA 3UJIH 1RUQH 1XCTB 2DQHH 4WU5B 2R0WL 5DZOA 4HH9A 5FYJE 1J0KA 2VTFA 3N85L 4QHNB 3N1GC 1P7QD 5INDA 2CR6A 1KCVL 1L0XA 3LY6A 3T0AA 5A16A 3SDYL 4OF3A 3VFPA 2Z31D 1JYVA 5I30L 4I5BA 4ZSOE 5GS2D 1YEHH 2DDQH 1G7JA 2I9TA 2DQGL 3D69B 3FAXA 1GGUA 3WIHL 5C86A 2HMIC 4KJYB 3F58H 1UYWL 2KZWA 3DJ9A 4UQ3B 4YDJB 5GJTL 3V4PH 4LL9A 4EN3B 4F58L 1R3LB 4FQLL 4OLVH 4XNZB 2HRLA 2ZCLL 3QB7C 3N1QC 1OAZL 2HWZL 3VE0A 1HEZA 3KG5A 3NGBC 1NLDH 5GJSH 4YHYC 1UWXK 3EYSL 3B6SB 1QKZH 1EIBA 3VXME 4U1IA 1UACL 1FYHB 2EH8L 4G9FD 4XI5C 5HI3C 3DBXA 4PTUB 5DFVD 4XC3L 2YRLA 3O3BB 3QUZC 1W72L 5H37H 1A6AB 1H15A 1YMME 4X9IA 4PJCE 1DBBH 4H25B 3T3MF 1NCAL 4NZTL 5HHNA 3HE7C 3Q5OA 5SX5H 3U46B 3EFFA 3FO1B 4BZ1L 1NAMB 2AGJL 4KHTL 1Z9OA 4RGNE 4C56E 1LO2L 2CH8A 1G7PA 5C0RH 4HF5H 1O7VA 4TTGA 1KLUB 3MO1B 2CIKA 2EC9U 2B7DT 3C9NA 5LGKA 5L7XH 3KLAB 3KLDA 5DJCA 2NY0C 3K46A 5CGYD 4JRXA 5FUOH 4YGVA 3OJVC 5DA4A 4P5KA 1MCDA 3VA2C 4GXVL 2P1YA 1K6QH 3PWLA 5JIPA 4U1LA 1OCWL 5F7DA 4IRSC 4EXKA 5A43C 4G3YL 5EBMB 3HUJB 5D70H 4XAWL 1A2YB 1HK6A 4LLYB 1GYAA 3WHE1 3U0WH 1V8HA 3GIZL 4NQCB 4HCRA 1J05A 3TBWB 2XTLA 3BN9C 1YMHA 5J06A 4Y4KB 4AH2A 5DWUL 4WFED 1IAKB 1W8NA 1MJUH 2VLKA 5DA0B 3V9FA 3MRFB 3MRCA 4LFHD 3GBNH 4FQHB 4TVPD 4X6CA 4EUPG 2ZOKA 4PJ8D 1BBJB 1TJGL 5GRJL 1SJVA 3D18A 3NOIA 3BIAX 5FA4A 2IH1A 2OL3L 2BVYA 4HT1L 4KKLC 4H0GA 1YEFH 1XGRA 1Z9SA 4NQUA 3P4OB 5D1QA 4I18C 1MEXL 5JHDA 1WIOA 1Z5LA 4PS4L 3IYLW 4ZUWB 3D87B 3DETD 4IRJA 3ZL4L 4NQEB 4LVHC 5BO1L 4HS8H 1T03L 1T21A 5E95B 3SN6N 1JRHI 5AUMB 2X1WL 4JRYA 5F7HA 3MNVB 2JJUA 4HUVB 3MBED 1JHTB 5D7JA 1LDPH 4PJ9B 1HSBB 4M1CC 4AEHH 2A6JB 3IFPA 2W0PA 5L8JB 5JA9A 5F3HB 3VWKB 1HYSC 4U1GC 4Z7NF 4ZNCD 5D1XA 1KN2L 2JCCB 4JZOB 5KZCB 1ZLWK 3BKCH 1CQKA 2B1HL 2QQQA 2AJSL 2XY1A 4RZCA 4L3AA 3LIZL 3REVA 3MBXL 3GM0A 3ZT7A 5BZDA 4HWEH 2YA1A 2BNUB 4KTDL 4FTVD 4LHUG 5LBSH 2C4XA 4UILL 3MRKA 1A22B 4RMTA 4V2CB 5EN2B 1NGPH 4D9RD 2G9HA 2VRAA 4X7TA 3RVTD 4PJXF 2XA8L 1BGXH 3WSQL 3QWRD 4UU9A 3SPVA 4OFDA 4OZ4A 1U8QB 1ZKAA 1SQ2N 1NSNL 3LRHA 4HWBL 4KJQD 3TO4C 3MREB 5KVEL 3ULUL 3VFGL 3LKPB 5I16B 4PRNA 4XTRD 2FSEB 35C8H 1KC5L 4NRYA 2E6QA 4MSWA 4Y1AD 4AQOA 1T6VN 1PVHA 2EE9A 2EIDA 1NLBL 5F9AC 1MCKA 2HJKB 3I6GB 4K3GA 4WNQB 2GQHA 2V9RA 4YDLC 3OR6A 3ECBA 4JDVA 3QA3A 3D0LA 4J4PA 2BDNH 3WDIA 2DBLL 5DVMA 5L9DH 2EYTB 4K9EH 3O4LB 5EWIL 3H9SD 4R2GD 5DTFB 3T77B 5DJ0A 1R3KA 2FO4A 2X44D 5C07B 2JJVA 5JDJA 2F53E 3FMGL 2DM7A 4HC1H 2VLLA 4PJ7F 1X7QB 1IFHL 1CD8A 3GSUB 2HJLB 2W1NA 2ED7A 2IWGA 4GBXD 2PTTA 4YXLH 1XF2B 4AIOA 3QCVH 1DBKL 2NW3B 3S5LA 5C0AB 4UNTA 4U6YB 4DKEH 5DMIL 2DJUA 4PV9B 5MERA 2LE9A 4G8GE 3L3HB 3WHXA 3GNMH 1HINL 1AJ7L 2ZPKH 4M7LT 1IGIH 4W4OC 2YK1L 3BKJH 4D9QD 3FQWB 4C56B 3P9MA 3NZ8B 3V6ZB 1NCCL 4JFOA 2H8PB 4TTDD 3S97C 4ZFFB 4QRRA 3L3KA 4JFHD 3BHBB 2G60L 3F7YB 4UDTB 2A6IA 2R1YA 1KV3A 1RUQL 1MVUA 2DQHL 2H3NA 1QRNA 1E6JL 5I1CH 3PXHA 4NBXB 3OAZH 3LKSA 4XP9H 2J7LA 1KXTB 3S96B 4G6FD 1YEHL 2DDQL 4JFFD 3DOSA 5CKGA 4P2CG 1KJVB 2FD6L 5SWZE 5B8CB 3S88H 4U1SA 1NCBH 1RPQA 2VISB 3HMXL 5F3BB 4G8EB 2EYSB 2XNAA 5IFHH 2OM5A 5EUKA 4ISVB 4LCYA 2J4WL 2HFEA 3V4PL 1R3JA 3QDMD 3RUGB 3AREA 4TYUA 2Q8BH 2W92A 3C5JB 3LH2H 3IKKA 3LRSA 4OM0H 2CGRH 5T3ZD 3EYQD 3C08L 5IHUH 1KLFA 3G6JB 3V5HB 1NLDL 4TRPH 4JHWH 5D1ZA 3ULVH 2DWDA 1QKZL 4XZUA 5IW1B 1VERA 4M48H 2H32H 3ZSTA 3O8XD 4ZXBA 1IAOA 4QOKD 2A1WL 5L2JA 3GO1H 3FCTA 1U3JA 4OZGA 4Z9KB 3MCLH 2GY5A 3C09B 1YN7B 2VITA 1DBBL 3VI3E 3BEVB 1CD1B 4NN6C 4TUOA 2DOCA 3RX5A 1HSAB 1XZ0B 3QG6B 2C1PB 2GT9A 3MLTB 3MRIB 1T1YA 4YHKH 5FCSH 1CGVA 5EC1B 4FQXD 4EJ1C 4JPVH 2KL6A 4PFEA 3S6CA 5IJKA 3VFTA 1G7MB 5T3XH 5K9OA 4HK0A 4K55A 3P0VH 3R0MA 5L7XL 2NXZD 5I6XB 3BPNC 2YUXA 3UZVB 3SKOA 3THMH 1K6QL 5TF0A 2HYMA 3WFDH 3KPNA 4QY8B 1CDJA 1LDSA 3HZVA 3C2AH 1DLHB 1PG7H 5D70L 1MHCB 1ZLVH 4QRTA 3VXSA 1I7TB 3U7YH 3VFMB 1JF1B 1PBYA 3U0WL 3ROOA 1AR2A 5C0GA 3FT2A 2A6KB 1XMWA 1EGJH 4KKAD 4XAKE 2AXFB 3MV8E 2NLJB 3MRDB 3QDJA 4YGAB 1UJTA 2BXYA 4TNVF 2P42B 1EPFA 1QA9A 1WWCA 5HPOA 2W65A 1MQKH 2CRZA 3ZDXE 5F1NA 4OT1H 1RHHA 4NJ9H 1GOGA 1D9KB 4MA3B 3VGFA 3TA3D 4LCCB 4BSWA 1PX3A 5KSBF 2CDEA 1KUMA 1GJIA 4YO0B 1G9MH 2WV3A 3AMKA 5F1SA 2QADC 1T83A 4P23A 2IADB 3QI9C 4ONGH 1BJ1H 2PYFA 4GW1A 3BZEA 1A7RH 1PG7W 4JO4H 3MSPA 1OTTD 5JOPE 1I9EA 1XF1A 1CU4H 1H0DB 4HS8L 4D0CB 1A0QH 5D6CB 1GC1H 3EDDA 3MZTA 5CEXA 3PWPB 4BJLA 4EEEA 2QLVB 1OTUD 3QFJE 1WITA 1G6RB 1D6VH 2IFFL 3K4ZA 4DGYH 5LXGH 4G8GB 3OSKA 4RWYH 3QWOB 4WFGD 4KKBD 4AEHL 3PQYA 4X6FA 4F33B 2QSQA 5E7BA 1WFOA 3BKCL 5M94B 1LEIA 4KK9C 4RGMB 3R0NA 1TQCB 2BRQA 5I66A 4DN3L 5ICZA 3STBA 3O9WC 1OOAA 2O5YL 3DTXB 2FL5B 3CJJA 3G5ZA 1C5DB 3M1BA 5BVJA 4PJFA 2PXYC 1H3PL 3EDKA 5I8EA 3EJYC 1MI5B 1HI6B 1UADC 3IFNL 1WTLA 4L4TE 4XCNB 3LN5A 1LEGA 3VFWB 1FLTX 2IPKB 2YPKB 3U36A 2DJ4A 1M4KA 1A1OB 1D5MB 5AYQA 4PP1C 4QGYA 4ETQA 1BGXL 3TBVB 2WWMC 3TZVD 5C0BD 4OF7A 1L0QA 5DI8B 4WI7A 4CMMA 5LAXB 2UVEA 4ZD3H 4MAYC 4ZG1A 1TVHB 3H3BC 3SCMD 4PJAF 35C8L 1X5GA 2XOTA 4XX1E 3WFZA 4JO3L 3T0BA 1P9MC 3KPPB 5DD3L 1MRDL 3BJ91 3MRJA 4J3TA 1NFDB 2EEBA 5E08L 4P46A 3FT3B 1J7VR 1OT2A 1SVZA 1YEGL 2MHAB 4G7YH 1D5ZA 2ERJB 4X9GA 5EBGA 2VLJD 3CX2A 2BDNL 5ACZB 5EU3A 1E4WH 5L9DL 3T0EA 4K9EL 3U2SB 5ICYA 4OFVA 4BH8A 5E5RB 3HI5H 3CXDH 3HPLA 4MDIA 2X1QA 5AEAA 4Z7WB 2HT2C 4DK3A 1Z9LA 3WIFB 3P0GB 1ZVHA 1CCZA 2X4PA 3ARUA 5ALCH 1I75A 1NC2A 3RJQB 3IJHA 4NRZA 3WUWG 4Q9RH 4M5YH 3EYOA 1XCQB 5T1LA 4O2FB 4IS6A 3EO0A 4L8DA 4M03A 4PREB 1EHLH 4XBPB 4DKEL 3KJ4C 1MIEL 1BQLL 2ZPKL 3ARDC 5DURB 1SYSA 1IGIL 5HGHB 2DQJH 3B3IB 2A74B 4Y19B 4F7TB 4OCRH 1T1WB 3VDCA 3BKJL 4EDWH 1U0QA 4JQXC 4Z7UF 4MMZC 2VDPL 4F8QA 2IAMC 4KGJA 1IL1A 5F1IA 4EKXA 4GKSB 2HMID 2VUOA 1JVKA 1JGDA 1U3YA 43CAA 2IQAB 1IEBB 3OGCA 1W2KT 4LP4A 3HRZA 5I1CL 1LE5A 1MWAA 3FAWA 4HULB 4FFVC 2ZG2A 3ULSB 4XP9L 3DRTA 2VXSH 4NQSB 2DQCH 1FYTE 2FZ3B 4P57B 5KSAB 1RAMA 2BK8A 5CBAB 3K8MA 2LVEA 1OAQH 3PGDB 2P7TA 1I1AC 3QSKB 5HI3D 4XI5D 1X5HA 2QL1A 2D0FA 3DURA 5TDPA 5IWLA 1FBIH 1NCBL 1WCBB 3P73B 2HFFA 3RTQC 1FVEB 5IFHL 1FGVH 3QUZD 2AV7A 1RJLB 5F71A 1AKJA 4OLZH 5E2UH 3HE6C 5I74C 2Q8BL 1K3IA 2C1OA 4NQDB 2XI9A 1GGCL 1KENH 3LH2L 3HE7D 1PEWA 2CGRL 3ES6A 5AZ2H 4Z78B 4JGJA 1IGYB 2IBGA 3GRWA 2AVGA 3TYGH 4YDVA 4M9OA 1T66D 1U93B 4PLJC 1QSFE 1JWUA 2RR3A 4JHWL 1OGAE 3ULVL 3UCRA 1Q9OA 1CFSA 3BP6B 3B83A 3OHXA 1FZJB 2EH7H 3EOBB 3U4EB 5MENA 1ZVSB 2OTUB 1I8LA 3HZMA 3SJVD 4M48L 3ZKXB 1QFOA 4HDIA 4UV7H 2IH3B 3O81A 4GRLC 1CGTA 3GO1L 2NY0D 3MCLL 3C6SB 3L5HA 2CLVA 4DUXA 3FB6A 1OGTA 2E27H 1DFBH 2FHCA 3HPJA 1U36A 1FJ1B 3L7FA 4IRSD 3IT8D 4RRPA 3ULUC 5ILTH 2PTUA 3V0VA 2GTZA 1JV5B 1H3VA 1KIQA 2B2XL 4NZUL 3W39A 1NGYB 4JPVL 4JO2L 2VQTA 5KS9B 4EUPB 5FOBB 3CDCA 5JO5B 4AZ8A 1RD6A 2Y5EA 3QNYB 3OKYA 3U4AA 3OKKB 1GCFA 2FEEL 3BP4B 1AIFA 3OKMA 4JG1H 4B53A 2WLYA 4ZPTA 5GISH 3THML 4NNYA 1M71A 5CJ8A 2FEEI 4XPBL 3H7BA 2WBJB 4XMLH 2BSRA 4S2SB 3WFDL 2DM3A 3MYZA 3CU7A 3I3EA 4E5XA 2C7UB 4OZHF 4FS0A 5D93B 3C2AL 2BMKB 4APQC 4MVBD 2RFXA 1F5WA 4S1DC 1AXTH 5CWSA 2QR0B 3R8QA 2VXTL 4X4ZA 5FFLA 5DSCB 4MCYB 2JIXA 3OZ9H 1JPFA 3QEQE 4D9RE 5H35A 1JL8A 3QDGB 2EDEA 3GSOB 2YC1B 2NY7L 5E99H 4JKKA 3OKLA 1T6WA 1MQKL 1ZS8A 4M1CD 4M61B 2P48B 2XQBH 5EU6E 4OT1L 8FABB 1HYSD 4NJ9L 4YIQB 3DYMA 1T80A 1BD2E 4HZLA 3ZTJG 1EEZA 2AEQL 3O0RH 1IGTB 3CDFA 5KSVB 4L5FH 5FYJH 1N0LA 5IMLB 1CBVH 4FXLA 4XHJC 1YNTA 1A7RL 4JO4L 3ZKMD 1EJ6A 4TUKL 3QZWB 4N0FA 2EIZA 2NY4C 3UJJH 2EZ0C 3FQNA 1A0QL 1GC1L 5TDNB 3D3VB 2X4QB 3D5OF 3QXVA 3CFBA 3QHZH 1VEOA 2YWYA 1G1CA 4X7FC 4EDXA 2ATKB 3UTTE 5LXGL 1DE4A 2YEZB 1QFWH 5HHOA 2XXMB 2K9UA 2YZ1A 1VGEH 3TV3H 3RJDA 4IOSD 1EFXD 4Y0GA 1EO5A 3VXQA 2HT4D 2VSCA 3GGWB 5B3JE 3TO4D 3HHRB 5HTSA 1UJ3C 4YX2H 5IEHA 2NX5A 4NC2B 4X80L 2BVUA 5IVOA 4HV8B 3FRPA 2A77H 2BSSA 3MLUH 3V6OC 3MRGA 5E9DE 3KYKH 3RDTA 3W5NA 4U7KA 1L6XA 1V7ML 5FO7A 5BMFH 5F7NC 4D9QE 1RK1A 3IF1A 5IMMA 1MHEB 4QT5B 2D9CA 2X9YA 3UROR 4Q0XH 1HHJA 3EDFA 1F3DH 1U58A 4P4KA 5IB2A 1TPXC 4N8VA 1OD7A 1UA6L 4ZD3L 4U6TA 2BOBB 2A0LC 5B39A 5IF0A 4BZYA 3RIAK 4OTXH 3GSVA 1B6UA 5JDSB 4XP1H 1IAIH 4K7FA 3TH4T 4LCUA 2OMNA 1QSZA 1AE6H 3C6LB 4Y5VB 1U42A 5JQ6H 2P5WA 5IKCA 5JXAH 1GAFH 1HILA 1UKTA 3TN0D 1QFPA 3E3QE 2DLHA 3GMQA 4G7YL 4JJ5A 4QRPD 4YH6A 4DAGH 4PLNC 3W9DB 3MRRB 1AGDB 1E4WL 3GMRA 2O5XH 3UBXI 2GI7A 3IXAA 3HI5L 2G2RB 3RHWK 5F1KC 5HHQB 3NPSC 5J56B 3ZKNC 4QXUH 5ALCL 4MJID 5F70A 3UC0H 1U8MB 2E7LC 2GFBB 2COQA 1CD0A 3TJEL 4EQ3A 3C5ZA 2ESVA 4HUUA 1VA9A 4Q9RL 4DKAA 5E4IA 1S9VA 3O2DL 2OR8A 4KV5F 1EK3A 4QF1B 5F89B 3U30B 4XP4L 4P9HH 3EJZD 1GH7A 2Y72A 5CZVH 1KJ2A 4GSDH 3B9EA 5CBEB 3DVGB 5DT1H 2NY6B 5C0FB 3C2SA 4OCRL 5CAYB 1Q9KB 4LSUH 4EDWL 1EERB 4PRIB 1QR1A 4HFWA 1VEPA 1I4FB 1NGXA 4NQVA 2R2HA 4P2RB 4QOKE 1DBAH 3VXUD 3MV7B 5TE4H 1RZIA 2LQRA 3BW9A 5E8OA 5EBLB 3ABZA 1UM4H 3CD4A 5J3HC 3JWOH 3CPLA 5KSAC 2LAGB 1KN4H 5CHNA 5CSGA 4XCEA 1PG7X 5GGQH 2P49B 4MXQC 3I85A 4B41A 4QXTA 2VXSL 3NFPB 4IRZH 1OY3B 2DQCL 4JREC 4X5XA 4RISH 2UVFA 1WFUA 5CIPH 3QIBB 1MFBL 2FGZA 3X12A 2P24A 1OAQL 4AM0B 5DGRA 5GS1C 1RURH 32C2B 1IVLA 1BVKA 4WI3A 4YK4C 2WIMA 1K2DA 1M7DA 2APBA 1FBIL 4XNUH 3JVGA 1T20B 4P5TC 1F4XL 5CP7A 3D2UB 3BPOB 4OLZL 4NJAL 5E2UL 3VGAB 4C4KT 4E41A 2ICWJ 2RBLA 1KENL 4J3XA 4JPWH 1A4KB 5BRZE 3WFHA 1JPTH 2GAZA 5AZ2L 2PYEB 3PNWB 3QIUC 4HK3J 4I9WE 3QNXB 4C83A 3NIDF 3QQ4A 3PWUB 4H26A 2R0KH 5ADOL 5HI4C 2XG4A 3MUHL 1T1ZA 1FL5A 3HCVA 4NKOA 3DMMB 3TBTB 5T1KD 4UV7L 2QQKH 2DQEH 3SDXB 5H94B 4IIQC 3UTTB 1P1ZA 4ZAKA 3DPBA 3T0DA 4HPOH 1FIEA 5A2FA 5T33H 2E27L 1DFBL 2YD4A 5I1AA 5E8PA 2LU7A 5IK3B 4PTTB 5JLZB 4KJWC 5ILTL 1BM3H 3GHEH 5F9JA 5FK9B 1D5BB 4XH2A 5J9PA 3EO1B 5FV2A 4PPTA 4FQIL 2K7PA 4H88H 5I8OL 5D2NC 4WCYH 2DWEB 2FBJH 4WW1A 3GKWH 4OJFH 4K8RH 4WFGE 3D9AH 3H0TB 2NZ9C 4JG1L 4ALAH 4GKNB 3SKJH 2Z8SA 4K9EC 5GISL 2HVKA 2YXFA 3NIGF 5CKAA 3QYCA 4NT6A 1TNNA 1LE9B 2VC2H 4I77H 4XMLL 2PCPB 1K9TA 1XCTA 1TCRA 4WU5A 2FBOJ 1EHAA 2QADD 5F72S 2Q8AH 1HH9B 2YUVA 4QHNA 3QI9D 3L3JA 1G6RH 4LSDA 1G9NH 4O9HH 1AO7D 1AQDA 2NCMA 2QSTA 4Z7QE 3U0TB 5F7LB 5GS3A 2VSDA 4X5WB 5DF0A 5E99L 1XGPB 4DJMA 4NC1E 2C5DC 3D69A 1NUNB 4UT7H 4U31A 2XQBL 3HC0B 4KJYA 3OJDB 2CSPA 2FJGB 3UAJC 2UWEE 4JFEB 3W81A 4KK9D 3O0RL 1R3LA 1AGCB 4L5FL 5FYJL 1CBVL 1DL7H 3BP7B 3X3FL 1WAAA 3O3AB 2DYPB 2VDLL 1FNHA 3ARZA 4LSRL 4XBGA 5EZLB 3IETA 1EAJA 3EJYD 3QHZL 1PAMA 3B6SA 5D2LE 2VLJE 5KBNC 2PW2B 4CKVX 5GSVB 3E2HB 2BY3A 3BQUB 4NCC1 4PTUA 3SE9H 3VD4A 3KS0J 1IILE 2Y6SC 1VGEL 4PP1D 2DJSA 2J8UF 3TV3L 3LKQB 1L9NA 3O3BA 3QP3A 2WWMD 5K59E 1A6AA 1QFWI 1WIUA 5HD8C 2J1KA 5F21B 2AV1B 2NY3C 4PGCB 1GVIA 4H25A 1ED3A 2ICWB 1ZXQA 2VERN 2GK2A 3LD8B 3U46A 4MAYD 3FO1A 3GIVB 4XXDA 1FN4B 4YX2L 2D0HA 4IOFC 1U8JB 1EMTL 4YHZH 2A77L 3QQ3B 4Y4HC 1NAMA 3MLUL 5I8CB 4QRQA 4I2XE 3QRFM 4RDQG 1KLUA 3PHOB 4CU6A 1QSEB 1J10A 1I9IL 2N4IA 5BMFL 2HKFL 4RAVA 3ULVC 4WW2C 5FHBL 4Q0XL 1WV7T 1LILA 3R1GH 2X10A 5C2BH 5SWQB 5EUOF 5GGUB 3WUWB 2HT2D 4WENB 4HJ0C 3BGFB 4X8JA 3OAUH 1YC7A 3PHQB 4XB8A 4OTXL 4XP1L 1IAIL 1AE6L 3HUJA 4PJDB 4LNVA 3RWDB 5HXMA 1GAFL 3W11C 4LLYA 3SKUD 2DN7A 5HHMD 2F54B 3KPSD 3MUZ1 4NQCA 5C08D 1ES0B 4R4ND 1G1YA 3TBWA 3MJ9H 4OGZA 1RUMH 3UTSB 3ARDD 4WV1B 1NKOA 4Y4KA 3CU1A 4LAJH 2F74B 1IAKA 3CFDB 3MRPB 5D7LD 2O5XL 4PY8J 3MRFA 4L3EE 3QEGL 4OV5A 3ARTA 4FQHA 5FUZH 2IAMD 1AGBB 1BBJA 4JDZB 1CICC 2X4NB 4QXUL 4BKLB 2DM4A 3ALWA 4CRPA 1CIDA 1ZGLP 4KMLB 2ORBH 3B8SA 4LOUD 1QQDB 2BSED 1RJZB 4NFCA 4ZUWA 3CDGA 1SEBB 2DQTH 4P0DA 4P9HL 4FFVD 4FA8A 2A83B 3G9VA 4PJEE 4QNPF 3WNPA 4CDHA 5HYJB 5DEGB 5CZVL 5F7WC 3BRFA 3IDYC 5DT1L 2BRRL 3WNMA 3O6FB 5AUMA 3T3ME 3NBNA 25C8H 3MNVA 3QI9A 1LO3H 4HUVA 1JHTA 3CVHL 1N5YH 3SJVE 4PJ9A 5FGCB 2RQ8A 4ACPA 1I1AD 1FLRL 1NCTA 5F3HA 1DBAL 1MREH 2JCCA 2FJHB 3HR5B 2YOCA 1UM4L 4ODWA 3RTQD 4M7ZB 1YEEH 3UZQA 1TQBC 3JWOL 5F7EH 3HE6D 1KN4L 2VABB 1YA5A 4PLKC 4X6DE 5GGQL 5ISZE 2BVQB 3BFOA 5KN5B 2J12B 3WLBB 2BNUA 3WIHA 5EB9A 2KDGA 4DCQB 5L2KD 1JTPA 1LMKA 4RISL 2CK2A 4PLJD 1SEQH 2IC2A 4JFYA 3O9WA 5I2IB 5FECB 1L7TH 3QG7H 4JO1H 4KUZH 1NANH 1GC1C 3U79A 1MHHB 2CKBH 2PXYA 4BFIB 1A4JB 4EBQH 2E9IA 4ONHB 3BXNB 3FL7A 5F9OL 5DHXB 1EV2E 4GRLD 1BIIB 1EH9A 2F5AH 4PRPE 1OWWA 3LPWA 5FIEA 3MREA 2V7NA 2R1WB 2CLZB 5I16A 3LKPA 3OAZK 2FSEA 1JPTL 2AEIT 4WEMB 2DIAA 2LU4A 4MD0B 2VWEC 1YEJH 4G6KH 2RB8A 4HXAL 1XF4B 4WNQA 2FJFB 4LVOC 2EE3A 3N0PB 2ZSWB 2R0KL 3DXAD 4WUKH 5EIIB 3MOBH 1IC5H 3EIFA 2DLFH 4JCLA 2DI8A 2EYTA 3O4LA 4GT7A 3D48R 3K1DA 2DQEL 4Z8FH 5DTFA 1U41A 2VXVL 1ADQL 4HGMA 5C07A 5KSUB 2R0ZH 4HPOL 2FIRT 3KHOA 1FNGB 3IFOA 3B2UC 3WFCH 5T33L 1YC8A 5I1EH 2V7HA 1X7QA 2NR6C 1V3KA 2BNRE 4DQOH 2V5YA 4ZDHB 1CXHA 4BSVB 1IBGL 3SDDB 1XF2A 2AK4E 4HS3B 4Z7NE 1DQTA 5T1DH 1DUYB 1I3RB 2NW3A 4C4KO 5C0AA 3GHEL 4X4XA 3BT2H 4XXCA 5KAQF 4PV9A 2Y5TB 4MNQE 2FX7H 3L3HA 4S1DD 4KK6C 2VYRE 4L8BA 4H88L 4Y16B 4O02L 1EVTC 4HK3N 2JF1A 2FBJL 4OJFL 4KKNA 4K8RL 2IANB 4OZFA 3CFEB 1A6WH 1JGUH 3NZ8A 3V6ZA 5A2LH 4WFHD 2UV3A 4U33A 2H8PA 4DGVH 4ZODA 4ZFFA 4J3UA 4LPXA 5ALBL 3F7YA 4UDTA 4PJXE 1F90L 2IAMA 1N6UA 5EIQA 2Q8AL 4X0KB 1G9NL 3DUHA 4JM2C 4LFHG 2H45A 3KDMB 2WMPA 2NY4D 1U95B 3S96A 2DLEA 2EZ0D 1KB5H 4KTEH 3T65B 3HG1D 4JJHA 1PD6A 4Y5YC 1T4KB 3BO8B 1U8NA 4PRAB 5B8CA 2DL2A 4P2OB 4MCZB 5M7QA 2LTQB 1I1FB 4GMTH 4G8EA 1IQDA 2EYSA 1YY8A 2YPLE 2VH5L 1CDIA 2K1MA 4ISVA 1RI8A 3B2VL 5EZIH 3RIFK 3LPFA 3C5JA 2SEBB 1ZLVK 2VLRB 3CVHB 2I07B 3GJEB 4K71B 3RWEB 3PV6B 5EO9B 3L9RA 3G6JA 3V5HA 1I1RA 4BFGA 4HFUH 1DQLL 3JTTB 2XTJC 1VSCA 5IW1A 4J8RA 1IC7H 3SDAC 2Y23A 4R6UA 1NJ9B 4PB9H 1FO0L 1FG9C 3MLVH 3SE9L 3WNKA 5A1AA 3UDWC 1Q38A 1R5VB 4YUEH 1CI5A 1CL7H 4ETYA 4YR6B 1T2JA 2W9LA 2J6EL 5ANME 5DHVB 3BUYB 5D8JH 2X89D 3LHPL 2Z35B 3V52H 1YN7A 2VKWA 3OG6B 1CD1A 5EU4B 2A0LD 4X98A 2WLZA 1HSAA 4Q2ZA 4YHZL 2X4UB 2C1PA 3MLTA 5LCVH 3MRIA 3KNBB 1SMOA 4F9LC 5EC1A 2MMXA 4QHKJ 3W9EB 4CVWA 1IC4H 1G7MA 4C58B 3NAAH 2E7HA 4WI6A 2R69H 3HAEH 2A2QT 5DDHB 5C3LD 1U3HB 5HVGB 3R1GL 4PG9B 3ARRA 5C2BL 3DXAA 3MV11 1PGRB 1N4XH 3ZKND 2EXYD 1MCWW 1S7RA 3FZUC 1X3DA 3OAUL 1PLGH 1QFUH 1KULA 3MGTA 4QY8A 4OZIF 1BJMA 4MD4B 4EI5D 3MOAH 1DLHA 4U4BA 4CMHB 1MHCA 4PRPB 1CVSC 2WP3T 5TFSH 3VFMA 3T3PF 1JF1A 4NBYB 5FF6A 4KI5D 1N6VA 3BAEH 2A6KA 3MJ9L 3BMVA 3GI9H 4R97C 1RUML 4MDJB 2AXFA 2V9QA 4APQA 3MRDA 5JXEC 2YZ8A 1JGVL 4K3JL 5FUZL 1I7UB 1VDGA 5IHLB 2W60B 3VWJB 1WWAX 1HYRC 3DX6B 2MOVA 2X1XR 1D9KA 4HBCL 5DD1H 1S7XA 1NBZB 2OZ4H 3BJLA 2NZIA 3ZYZA 4YO0A 5KTEH 2LVCA 3ARPA 3TYFB 2HJFB 2DM2A 4YHPA 1R24B 2AEPH 3WS3B 1H0DA 2DQFA 4D0CA 1K85A 4H8WL 3VXPB 4GKZB 3HI1B 4AT6B 3NA9H 4NZJA 3PWPA 25C8L 1LO3L 3QRGL 5EA0H 1N5YL 4PJBF 5CP3A 1N59B 4MNQB 4IBLT 4ZS6C 1E28A 3QWOA 1HIMH 4K7PH 3QWQB 1MREL 4JRXE 4S1SH 5GGVH 5DR5H 1M1SA 4P5TD 1YEEL 4PRDB 2X1OA 1UT9A 5F7EL 4LSTH 4MA8H 4EI6B 2IPUK 4Q6IB 4XWOC 3C8KB 2BHYA 1JYWA 3DTXA 2FL5A 3FFCD 3CC5B 1C5DA 3BWAB 4LCIH 2B5IB 4Z76B 3D39D 3IKCB 3F5WB 3O11B 1F6FB 3OAYK 4RIRB 1MI5A 1HI6A 4U1HB 3HMXA 1IE5A 4U6HB 1YPZA 2VDMH 2VLKE 2HT3C 3QG7L 5E94A 4JO1L 4KUZL 2IPKA 2BNQB 4YZFE 2YPKA 5KVMC 4OD1H 2CKBL 2CXKA 1J1XL 1P53A 1ORSB 1A1OA 1W0YT 4PRHB 1D5MA 4Y88A 4X6CE 4EBQL 3ARFB 3V6OA 1J8KA 3TBVA 1NANI 1A6ZA 3DSNA 3Q6FA 5T1MB 1H5BB 1MFAL 1M05A 2AI0H 3H42H 1WC7B 1XGUB 4OB5H 5LAXA 3AY4C 2EDJA 1UZ8B 5JHDE 5ITBH 2NNAB 4XGZB 3SE4C 3RL1B 3BP5B 3C60D 4LU5H 3F12B 2Q6WB 3BD4A 3VXRB 1WZ1H 3MRHB 5EFIB 5E6IB 4G6KL 1NFDA 3WXWH 3CLEH 4N68A 2FWOB 4KJWD 4XWGH 3BUTA 2HRPH 2R29H 3FT3A 4R4BB 3SDCC 4JRYE 2MHAA 4WUKL 4XNQB 1TJIH 1HQ4B 5K9JL 3MOBL 1IC5L 1DVFB 1T7ZA 4ELME 5ACZA 2DLFL 3U2SA 1I7RB 2Y1VA 4PJ7B 3GBMH 1LD9B 4R0LB 5DJAA 1R3HB 4D0BB 4Z7WA 3DX8B 5DFWH 3RZCB 1RVFL 2NZ9D 1GSMA 2GY7B 2R0ZL 1CE6B 1DEEB 4UV4L 3WFCL 4YC2B 5I1EL 4O2EB 3ARWA 4ZUTB 4DQOL 1UG9A 4RMVA 5DMKB 1XCQA 4O2FA 3LS5H 3O3DB 1BOGB 3QIWC 4OSUH 4F7MB 2Y7QB 4PREA 4XBPA 2E7LA 2BFVL 4HH9B 4B7LA 4A6YH 3B3IA 2A74A 4Y19A 4RGNC 4LGRB 4F7TA 4RMRA 1JZ3A 3RAJH 4M5ZH 3BKYH 4XB7A 1A6WL 3RI5K 1J8HB 1JGUL 5IFJB 4H5SB 4GKSA 2AK1H 3KXFA 2VDQH 5C9JB 2IQAA 1IEBA 3UAJD 2ADGB 3FB7A 2ARJQ 3X3GH 1WBYA 2ZUWA 3QISA 4I0PC 4MA1C 3FQTB 3HB3D 3DUUB 4LMQE 3GB7B 1QP1A 3V79C 2C4FT 3TCLB 4NQSA 1EZVX 4P57A 2FZ3A 5GZNC 5KSAA 4PJ5D 5CBAA 3ALPA 1KB5L 4P9HC 4HLZG 3OKNB 1D3CA 1SYVB 4DEPB 2CKNA 3PGDA 4KI1A 3ARGC 1YYMH 5SWSD 3LOWA 4PGDB 4RNRB 3W0WD 4BQBA 4JHZA 3QUXC 5FYJU 1WCBA 2W9EL 5C0JB 3P73A 4GAJH 2VN7A 1GZQB 3DVIA 1X5ZA 3BSZH 1RJLA 5AG8A 5GS1A 3B9KC 5HD8D 5EZIL 4AL8H 3MV9A 2QKIB 2YD6A 3QXAB 5IM7B 3JWOC 1JI1A 5IVXF 2GJ6D 4Z78A 1IGYA 4IOFD 4LCWD 1IGCH 5HHNB 3RIAF 3WUZA 2V2XB 3BZ4B 1S5IH 2ZWLT 2P5ED 3EFFB 3KPSE 3JWDH 4K23L 2EE6A 2XWJB 3D6GA 1OW0A 1U93A 1RSFA 4Y4HD 4F7CB 2OJEB 3N1MC 5IMKA 5EO0A 5I17B 1IC7L 3GJFA 3KPRB 1FZJA 3ILPB 3QIUA 3MLVL 2FDBP 1ODAA 3U4EA 1ZVSA 2OTUA 1IAIM 3JUZA 1DQQB 4YUEL 1JF5A 4CN6A 1CL7L 2IH3A 4E9LA 1KEML 5IIEA 4JPKH 1Z2KA 5D8JL 4N1EA 3EFDH 3IAQA 4Z95L 1S7TB 1KF9B 2EXWC 4MLIA 4BUGA 1KJMB 1CL7I 3C6SA 3IDGA 4UOW0 3RHWF 3V52L 5HYSG 3CH1A 4NM8H 1QRNE 4JE4B 1MAKA 3NH7H 4WHCA 1A6PA 1J1PH 3PWLB 4TSBH 3UTZB 4Y8DC 4M93C 3ULUF 1FJ1A 5EOQH 4PYHA 5IOPB 1NGZB 5F7DB 3MNZB 1QBBA 2JB5H 4X7CC 5LCVL 3W11D 2P43B 5KVDL 1JV5A 3L1OH 2EDBA 4WWKC 1NGYA 1IC4L 4OCNC 5FOBA 4EUPA 2R69L 3QPXH 3QNYA 4XCFL 1YMHB 3OKKA 2YPVH 4S0SD 5AZEH 4AH2B 3BP4A 3CZFB 1N4XL 4WUUD 1UM6H 2NY2C 3MRCB 4P2QB 3G5VB 5T3XD 4P49A 5C09B 3ARQA 1DBMH 1VPOH 3P30H 2WBJA 2A9NL 4S2SA 1A6UH 4WO4C 4JN1H 3MOAL 4Z77B 2IH1B 1LP9A 2C7UA 3PE9A 2O61B 2WUBL 2ZUQB 3G5XB 5TFSL 2APVA 3EUUA 5L2KE 4ZO8A 4HGKC 4WJ5B 3IU3B 4UIMB 2QR0A 3BAEL 3VA6A 3GI9L 1JBJA 3VW3L 5DSCA 4YEFA 2Q1EA 4L4VD 4MCYA 3GMOA 1X5JA 3B43A 3QDGA 3UJTH 1T21B 1OPGL 3GSOA 2YC1A 5KSBB 5D7KD 1NGQL 2HTLD 2Y25A 1P7QB 1I1CA 1MFDH 4OZGE 4JY4A 8FABA 1U8PB 4JGUA 4EIZC 4K8RC 1AD9A 4N0UB 43C9B 2OZ4L 2XG5A 4NKDA 4OAWB 4DGIL 1DP0A 2DI9A 1CGUA 1I9JH 2C3GA 1IGTA 2OXHA 5KSVA 5JW5A 4LHUA 4X83A 3FN0H 4I0KA 1JPGB 1SY6L 1CFVH 4K7PY 1GZPB 4WTZG 5GGVY 3EYVB 1JHKH 3MRLB 4YWGH 3BRGC 3REVB 5I18H 4BH7B 3D3VA 1XGQB 1NKRA 1G9NC 4JFDD 5EA0L 2ATKA 1A6TB 5IR1A 1HIML 4K7PL 2YEZA 3B4NA 3DO3A 4IDJL 5GGVL 4S1SL 2VR9A 5DR5L 2P45B 3T0VA 1KLGA 1WT5C 4O2CB 4LSTL 4UU9B 3SPVB 2JB6B 4MA8L 4RBPH 5DZNA 1YPZF 5LWYH 4G9FB 3VFRB 3KGRA 3VXSE 3ARBC 3DV6B 5GRUL 4Y2DD 5I76B 4HV8A 5HYEA 3TIEB 2VXQH 5DZLA 3ROLA 4HBQA 2AABH 2VDML 3DYPA 1GHFL 3QDJE 1ZEAL 1DLFH 3ECBB 4JDVB 4QT5A 4OM1L 1YY9C 3H9HB 4ODTL 2BVTA 4PJAB 2H2SC 1EX0A 2AI0L 3H42L 2XN9D 2P8LB 5ACLA 4OB5L 2PO6C 4WW2A 2Y06H 2FO4B 3O2WH 5ITBL 5JDSA 2NR6D 4YDIL 4LU5L 5EULV 1YYLL 3WDJA 4XP5H 3C6LA 1OSZA 4F9PC 3CLEL 1OM3L 4M3KB 5FV1L 5DRWB 3WN5B 2HRPL 3AM8C 4DKFH 3S4SG 3CH8A 4HWZB 3F8UB 1TJIL 4H1LG 3DUSB 3W9DA 2R56H 3MFGB 1XIWD 3MRRA 5MERB 1AGDA 3WHXB 3NZHH 5FDWB 3GBML 3BIBX 3PQYE 5FO8B 1YNLH 5HHQA 4CN1A 1FDLH 2DMKA 3VH8G 2GFBA 2GJZB 2VDKH 1T0MA 3ARSA 5D71H 4QF1A 3HKFA 4QRRB 4K3DH 3RFZC 1CICA 4OSUL 1PZ5B 4PJFE 4EVNB 3RWIB 1KFAH 3IJSB 5GRVL 1MVUB 2H3NB 4PJ8B 4Z7UB 4JM2D 1QLEH 1DBJH 4A6YL 4L9LB 2E7BA 4L8SC 1CGSH 4WDIA 3LKSB 4K3HA 5HGAB 5DJ8B 5SV4A 1Q9KA 3A6BH 4MJ5B 4PRIA 1JTTA 5DJZB 4UBDC 3RAJL 4G6MH 4M5ZL 3BKYL 1I4FA 1XF3B 3HI6H 2B20A 4P2RA 1FL3B 1Z3GH 2AK1L 3Q6GL 3QAZB 3MV7A 2JE8A 1IRAY 4LARH 4LASL 2X9WA 1RZJH 2VDQL 4Z7VE 3ZYOA 4JZJC 4U3XA 4GRMB 3VFSB 4EN3D 3VDAA 3X3GL 3MBEB 1FCGA 1NC4D 3GZKA 4V1DD 2XNAB 2Z91B 2Y07L 3BZFB 3AS3A 4LCYB 1AI1H 1R5IB 2HFEB 2VLMD 4W81A 3PDDA 2WM0A 2JK5B 3GSRA 1I9RL 4FRWA 3NFPA 5I15H 4ZPVB 3GSNB 4G6JH 1CZ8H 1Q0XH 5F9WB 3BPLC 3F7VB 4XRCB 3VRLF 3WJJA 2XTJD 2VQ1A 3T0EE 4AM0A 1RY7B 4KRNA 2WK2A 32C2A 3SDAD 5D1ZB 4H8WC 3TJHC 1FV1B 3JV0A 4C57C 5I71C 1ZLSH 1KIRB 1OHQA 3IDNA 5K9QI 1JIBA 2ZSVA 4FTVB 1Q1JH 1T20A 4GAJL 1MQ8A 1ZGLM 3BSZL 3D2UA 3P77B 1IAOB 1JK8A 4POZC 5I1DB 4AL8L 3FCTB 4HS6B 1BEYL 1A4KA 1ETZA 1LK3H 4KMTL 1BZ9B 3F7RA 2PYEA 3G9AB 4ZFZB 3P11H 1IGCL 3QNXA 1S5IL 5I1GH 3JWDL 4GLRH 4KI5E 1LO5A 4OGXH 1NH6A 3PWUA 5EU7E 1TFHA 3BGMB 1JP5A 3IFLH 3WO4C 2BZDA 1TENA 1KELH 2YBRB 3AUVA 4FQ1H 3DMMA 3PIQB 3TBTA 1FIGH 4Y1AB 3VFTB 2V5SA 3SDXA 5H94A 3MGAA 3TFKC 3EFDL 3ARVA 3TGXA 3SQOH 4ERSH 3EYUH 2I9LB 3CK0H 4NM8L 3FZUD 4Y4FC 5IK3A 3H9SB 3SGEH 4ZNEA 4PTTA 4YAQB 4L9DA 5JLZA 1CR9L 3G6DH 2APWA 3HZVB 3QHFH 4OUUB 3QQNA 3L1OL 5DK3A 2MCG1 3U6RA 5IV2B 3FT2B 3QPXL 4HQQH 2DWEA 4M6AA 1AXIB 4GBXB 1LP9F 2YPVL 5AZEL 5BZWA 3H0TA 4N0YH 2ID5A 4OZHB 4GKNA 3K2UH 4U3HA 5IQ9B 1C8PA 2NMSA 1NMCC 4LPWA 1DBML 3P30L 1LE9A 3FB5A 1A6UL 4KRPC 1AHWB 2PCPA 5D5ME 1EUUA 5GGRB 4JN1L 2KKQA 1VESA 3GSQB 4KROC 4NQED 1WJ3A 3T08A 4CNIB 3U0TA 2APFA 4LQ1A 1OSPL 2Z31C 1HQRB 5FCUH 5MENE 1Q0YH 4UAOB 2IGFH 3UJTL 4X5WA 4JGMA 5LGJB 1XGPA 2DS4A 2YD2A 3NIDE 3O2DA 3EOTH 5C0CD 1MFDL 3HC0A 4KDTA 3PWNA 3OJDA 5J6HB 4HIIB 3NVQA 4XNMB 3T2PA 1MSPA 5BS0A 3OMZA 4Y5YA 4JFFB 1I9JL 3QUMH 1AGCA 3WIIH 4XWOD 3FN0L 2ED9A 1CFVL 5C0IA 3BP7A 4GRWF 3V0WH 3RGVC 1YEKL 1JHKL 3VMOA 1UFUA 4YWGL 4WRLA 5I18L 1HKLH 1II4E 5FYJD 4I1NB 4MZ2A 3P0YH 3K81A 2GUOB 4MNGB 7FABH 4BQ9A 3QDMB 3SE8H 2X4OB 3MQIA 2PW2A 2HT3D 2IEPA 5GSVA 4D3CH 3BQUA 1PYWB 2BHZA 3U36B 5GQBA 3LKQA 1NCDH 4Z7OF 3E6FB 4PYGA 2X5PA 2Z8VC 4G8IB 5E5MB 2AV1A 3SKMB 1GXEA 5JIIA 5LWYL 2JJTC 1AY1L 2B1AH 2ICWA 5FB8A 3DVFA 3MA7B 3GIVA 3ZE0E 2H26A 3DLQR 2MKWA 1J0ZA 3QQ3A 1T89C 4X7SH 4UI2A 2VXQL 3OB8A 3OB0H 3SGDH 4L4JA 1I3VA 2AABL 1UZ6F 4CN4A 5GRWA 5CEYA 3ULVF 1ONQA 4WW2F 5IFAL 3PHOA 1QSEA 4CADB 5J12C 1DLFL 1EXUB 3VGHA 1W0VB 4WEBH 4OD2B 1U6AH 1D5ZB 3HC4H 2CUMA 4ZTPH 4ORGB 4P3DB 4GAFB 5SWQA 2O5ZL 5GGUA 2KZ1B 1S5HB 3WUWA 2N1KA 4FQXB 4MDIB 3SO3B 2Y06L 3O2WL 3PHQA 5I0DA 4PUBL 4Y5XB 5C92A 4XP5L 3FTGB 1CN4A 2R4SH 4PJDA 3O4OC 2NXZB 3RWDA 3IJHB 5INCB 3QIWD 1RZGA 3LV3B 2F54A 4DKFL 1ES0A 4OI7A 2PKDA 5MP6L 3TVMC 3UTSA 4WV1A 2R56L 4PY8I 1JPST 2F74A 3CFDA 3V6FB 3IJYA 1A5FH 4RGND 3NZHL 4C56D 2CLRA 4JDZA 1FDLL 1ND0B 2X4NA 3OR7B 4YLQT 5BXFB 5CILH 4BKLA 5E56A 1Z9MA 1RUAH 5JXEA 4MB4A 4LLUB 1QQDA 43CAB 1UH3A 4K3DL 2NX5E 3OGCB 2HFTA 5DD0L 2VO5A 3K3QA 3HRZB 3RIFF 1KFAL 1FG2A 2A83A 5HYJA 5L0QC 3FQXB 1MJ7H 1PZUB 1MWAB 1VFAA 5DEGA 2V2TB 1QLEL 1DBJL 1QPXA 4C54A 1CGSL 3O6FA 5GZND 3K2MC 5CD5D 2P46B 3DRTB 3A6BL 3UXFA 1VCAA 4GMSH 3KPQB 4G6ML 3HI6L 4JQVC 2YD8A 4YDKH 1Z3GL 1T1XB 2Q76A 3RKDD 3QUXD 4LARL 5E6YA 2FJHA 1QBLH 2NTSP 4UT9L 3B9KD 4QCIB 4ONFL 9CGTA 5CJOH 3MODH 2R8SH 1AI1L 1OQOA 1AKJB 3OXSA 5I9QC 4MQTB 2BVQA 5KN5A 2P5WE 4HG4K 4KHXH 3TNNA 2C1OB 1MCNA 3WLBA 5DK0B 4DCQA 1FNFA 3QEHB 2FEDC 4WI8A 3DX7B 1CZ8L 1Q0XL 1TTFA 1JE6A 1MCWM 5JPMB 4YDVB 5I2IA 5FECA 5DD6A 2DIJA 1Q9OB 5J11B 5GZOC 1ZLSL 1A4JA 1A7PH 4NQXB 1DSFH 3OHXB 4ONHA 3CXHK 5HGBB 3BXNA 3RVTC 3FN9A 4MQSB 1Q1JL 4KRLB 4L3CA 4O00A 1W0WB 3BYYA 1GRWA 3CNKA 5T3XE 1PW3A 4ZSOA 4F37F 5EORL 3PHSA 2ESVE 3LMJH 1MUJA 1ZHLA 1GGYA 5SV3A 4KJQC 4LPUA 1LK3L 1TLKA 4XMKH 5I75B 3NCJH 2R4RH 3P11L 4FZ8H 4MD0A 1BAFH 4HCRH 5E5UB 5I1GL 3TZVB 5C0BB 3HPJB 4OGXL 1XF4A 3U0PA 3AY4A 4LQFH 4KK8D 3MCKB 2FJFA 2R23B 2ZSWA 5EIIA 5I1IH 4GLRI 1KELL 1H3TA 3SCMB 3W39B 1FIGL 4NZRH 3SDCA 1N3NB 3VGGA 4R2GC 3BGAA 1HXYB 5KSUA 3SQOL 1CTNA 3ZTNL 4TVSa 1S7VA 4ERSL 2NY2D 1E4KC 3EYUL 1FNGA 3Q48A 5JORB 3OKOA 4NO5B 3VXMA 1WWBX 1MCEA 4ZDHA 5EBWB 1AH1A 4M6OH 4BSVA 3DX9A 5J4MA 4I3RL 1B4RA 2K7QA 4EIGB 3JWNC 2Q7YB 1DUYA 1I3RA 2D7TH 5JW4N 1HOCA 1EO7A 1I85A 4RMWA 3SGEI 5HSFA 2Y5TA 1AQKL 2NYYC 1DANT 4JFDE 4Y16A 1YMMA 2V6HA 1D5IH 5CWSB 5HDQH 4HQQL 3P4NB 4MAUH 1YEIH 5I1KH 1DTUA 3CFEA 5F8RC 4N0YL 4M8QB 1XGYH 4ODHH 3S36L 1NEZG 1RZ8B 3S5LG 4K8RD 1QBMH 1OQXA 2E7MA 4NM4H 5L6YH 1D6EB 3F65A 4ZFGH 5JMRA 3MRMB 1FCCA 1B0WA 2F53D 4LKCA 4X0KA 2W91A 1BQUA 4JM2F 3NCFB 4NKQB 3ELAT 2XWBB 3BOVA 1T22B 3KWWB 4NKIL 3LN4B 1JNJA 3KDMA 5IROC 1M7XA 3IAPA 4KU1A 4X6EA 1LHZA 3E3QC 1N7MH 3TT1H 2EIZB 4I0PA 5KJRH 1Q0YL 3L7EB 3T65A 2WQ8A 3FQNB 1TZIB 1HHIB 3RY5A 4G8GD 4ZS7H 1T4KA 4PRAA 3CFBB 1F6LL 4P2OA 3EOTL 3BN3B 1AR1C 4X5LA 1DE4B 1ZA6B 2VZ1A 5HHOB 3NGBB 4G9DB 4YHYB 4WHYH 4GW5B 2NTFB 2CRYA 3ARGA 2IMNA 2R0LH 3QUML 2SEBA 3WIIL 2VLRA 3CVHA 3RY6A 2I07A 4W6XB 3RWEA 3ARBD 3PV6A 3V0WL 5EO9A 5EOCJ 4UIKL 1C08B 1HKLL 4GFTB 5B3NA 3QUZB 3P0YL 5E2VH 3N9GH 1CQYA 3EKCA 2J8UB 3JTTA 1GPOH 2CDGB 3SE8L 5IJVB 2BSSB 4NN5C 4KQ4H 3MRGB 1T3FB 1Y6NR 4RMQA 5EDXA 3HE7B 1BWWA 1F2XK 2Y36H 4OQ1A 3NN8A 1R5VA 2OR7A 5FO7B 4YR6A 3CSGA 1NCDL 3O8XC 3IF1B 5IMMB 5DHVA 3BUYA 2H2SD 1PFCA 2Z35A 1U2HA 1OP5H 2PO6D 5GS0H 1I8KB 4N8VB 1F6AA 4HAGA 3S4SB 5TH2A 5B39B 5IF0B 2AQ3A 3WS6A 1KNOB 3GSVB 2J88H 2NY0B 3CMGA 4LCUB 4R90L 3KNBA 3L5WB 5IKCB 3JXAA 4YE4H 3JWDC 5EUOB 4NUGH 2E6JA 2OS7A 5IBUG 3SGDI 5DD5H 1U6AL 5ADPH 1FORH 3HC4L 4IRSB 5DDHA 1TVDA 4PJDF 4UTBH 4ZYKB 3VH8B 1PQZB 12E8H 4M9PA 4ZTPL 1JNLH 1BIHA 4FQCL 4WWKA 1T7WA 4JAMA 3UO1H 3A6CH 2DTMH 1T5WB 4KY1H 4GQ9H