5IVXF

Crystal structure of b4.2.3 t-cell receptor and h2-dd p18-i10 complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
234
structure length
234
Chain Sequence
MKVTQMPRYLIKRMGENVLLECGQDMSHETMYWYRQDPGLGLQLIYISYDVDSNSEGDIPKGYRVSRKKREHFSLILDSAKTNQTSVYFCASSLGHTEVFFGKGTRLTVVEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVCTDPQAYKESNYSYALSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An allosteric site in the T-cell receptor C beta domain plays a critical signalling role.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-D alpha chain
total genus 61
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2016-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ivxF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ivxF02
4QXUH 4R4ND 1J8HB 4X98B 2VDQH 2WUBL 4LNVA 2EEDA 1P7QA 1JGUH 5E5UB 5IIEB 4PJFA 4ZOAA 4M1GL 2JB5L 2DWDB 1UYWL 5HYSG 1MRDH 1R0AL 4LMQI 4PIRF 2CDFA 1CBVH 1OGTB 3Q6FA 5HI4D 1U58A 4ODSH 4NWUH 2O5YL 1T5XB 1I85C 1N64H 5BV7C 3JBG7 1IGCL 1QRNB 5I2IA 1FC1A 5C08E 2B5IC 2ADFH 1G7MA 3F8UB 3CLEL 5E2UL 1UXSA 1T5WA 3ZT7A 3LEYL 4E0RA 2XXMB 2MKWA 4EQ3A 2I9LA 2IC2A 4Q9QL 3HLAB 4NSKB 1C08B 2ILLA 2AJYH 4XH2B 3SCMD 4X9HA 4AK1A 5C0DB 3QIUA 5F9JB 4AEHL 5EFIA 1WCBB 1MRFH 3BP4A 1MREL 4EOWH 3BPCB 3IDGB 2F5BL 3VA6A 1LHZA 3OR6B 3OB0K 3GIZH 3EZJB 1QTYT 4G80B 4JR9H 1LP9A 5I1LB 4YHNB 1KCSH 1FO0A 1A6AA 1JPST 1XCTA 1SJEA 2QQLH 3SDDD 1NAML 5KAQF 2MMXA 1K8IA 4PB0L 4YBLB 4GMSH 4MCZA 2Q7YA 2IH1B 3WL9A 3MV9D 4ENED 5GGVL 4N90E 3LN4B 5C08A 1QEWA 5IHUL 1QRND 4KXZH 4B53A 3QQNA 5EN2A 3LEVL 4Y4HA 1PG7H 1AQDB 4K7PH 4BYHA 4U4BA 2A74B 4HZLA 2ZJSL 3VXUA 1TMCB 3MLSH 1T22A 4G6ML 5HD8C 2YUVA 1JE6A 1NGZA 5IR1B 4PRBB 1BIIB 3ARBA 3SCMB 2YPKB 5E99H 4G7YH 1NCAH 1NBZA 2FEDD 2IBBA 3TBYA 2K7PA 3MROA 1LGVA 2WANA 3BT2H 4CBPA 4KVNL 3H9SA 5C08B 1MNUL 3FRPG 2Z31C 4MJ6A 2VDOH 4OF6A 1OWRM 1AIFB 1NMBH 2BOCB 1J10A 3BJ91 2VDMH 4PJCE 3VRIA 5SX5H 1CLYH 1IGFL 3L3IB 3QIBB 4L4TA 2QQNH 4X99A 2VXQH 3I75B 4PJEB 4RDQF 5DK2B 2CK0H 4Z78A 3HI1B 4X9BA 1NJ9A 4EN3D 3LEXB 2KQNA 4FQQA 1T2JA 2X1XR 1CGVA 5CEYB 2YD6A 2W65A 5JHDE 5IMMA 3BIKB 2CDEA 3T2PA 2H2PC 1KJ3H 5B8CB 3T2NL 1INEH 3L3GA 4KRMB 4BA8A 2JK5A 1RURL 3KDMA 4U6HB 1HH6A 5GRWA 1H0DB 3MV8E 1U8HB 1CFSA 5D5MF 1IM3A 2NX5B 4L8SC 1CE1L 5JPNA 4BELD 4TUKH 1UWGL 2EC9U 1U8OB 4HAGA 3WMSA 3CUPA 4PJGE 5D1XC 2DM7A 4I2XE 3QDMA 3I75A 3UTTD 2XN9A 5GQBA 3V52L 5TDOB 3TVMC 4JZJA 3J8F7 3Q3GA 5HPMB 4UBDC 4ZSOA 2J2ZA 15C8L 1BZ9B 1OM3H 2X9YA 5B8CA 3WFCL 1EO7A 1RZ7H 2AKRB 3NH7L 1YEJH 3BMVA 4KROC 4M43H 1FIGH 4X6BA 1P7QD 1A7PL 1H5BA 1XR8A 3MA9L 5GS1C 1E28B 3TPUA 2F54D 4TNWF 1D9KC 3MBXH 1GVIA 2BHZA 3LMJL 1AI1L 4XBPB 4JKPH 4CVZA 1KCVL 4FQ1H 1NCDH 1U3HB 1SEQH 3DRQB 3UC0L 4WWKB 1XGPA 4Z7UE 3CX5K 4WTXA 2HLFC 4XPBL 3NAAH 3PDOA 4MSWB 4N9GB 3UJTH 3W9DB 5J11B 1NGWA 4XRCB 1BFVL 2XV6B 2KH2B 2YWZA 5FUZH 3IVKA 2O61A 2NMSA 1SBSL 4OLVH 4CKVX 2LFGA 3AREB 1CQYA 4HPOL 1CXFA 1OB1B 5HYJB 2QL1A 1DQQA 2ZUTA 1YMHA 4PTTB 3RVVC 5E2WL 5DO2D 4S10A 4KGJA 3V8CA 5BMFL 4OF0A 4G6FD 3RUGE 1KG0A 3VXPB 4P46A 1SJEB 1OAXL 5CSZA 4E41A 1JBJA 2ZUVA 5IK3A 1KN2H 4S1RH 1EMTL 1W0VA 1R5WB 1NLDH 3U4AA 4PJEF 1XR9B 4XC3L 4JRXD 4XNXL 1MUJA 4APQA 3H42H 4PJDF 1DE4B 3LKQB 1HI6B 4KQ3H 1WZLA 4YXKH 3ZKMD 3BXNB 4B50A 4PJGB 1OPGL 2DKSA 3MQIA 4C59B 1ETZA 3QNYA 2ZUWA 3V7AE 5D7IA 2R0LH 4LVEA 1RJCA 2P5EE 3LKRA 3O2DA 1OVZA 1DBBH 2EH7H 2GSIA 5DMIH 4PYHA 1M05B 4K2UH 2A1WH 2EDWA 2VLRA 3ARFC 1GCFA 3DMMC 1PQZA 1YEIL 4LLUB 5DJ6B 4P4KA 1YYMH 3E3QC 1DR9A 4KC3B 3C87A 5E6YA 4OKVA 2ATKA 2UZYB 5IVXE 5JMOC 2MCG1 1HHHA 4BFIA 1ERNA 2RHEA 4KK5C 6CGTA 4UU9A 4MQXC 3P77B 3QR2A 3PHQB 4F3FA 1BQUA 5IP4A 5E8NA 4CGTA 4P2QA 3T0EC 4YX2H 1B9ZA 5DJDB 2C4FT 4XP5L 2J5LC 1KC5H 1TITA 3BQUC 4B41A 1QRNA 1L9NA 2IFGA 5HYQA 2P4AB 5FYKD 2XTJE 2IPTL 2UVFA 3BP6B 1LDPH 4PUBH 1WV7T 2AJSL 1OGAD 5EULV 5FYKE 5LG1A 2OL3A 1U58B 4QT5A 4WEUD 1YN6A 1H15A 5MEQB 1AO7B 3FQTA 2VDLL 2D31B 1N8ZB 5D1ZB 1N7ML 3WEXB 3QT2A 4P9MH 2L0DA 3ROOB 2P5WE 2AV1A 5E7FA 3FO9A 1JNNL 2XQBH 5FA4B 3MRFA 2EECA 3BPOC 3SGKC 3QWOB 2XWTB 4LQFH 1ZT4A 3O4LD 1F4XL 3RHWK 3KPPA 3WJJA 4YHPA 3U9PL 2VAAA 3FB7A 5DC9B 3WFHB 2OL3B 1VSCA 5I71C 5DVNA 4NQSB 1H3WM 2P5ED 1LMKA 2RR3A 1YNTB 3WFDL 2XN9D 5HHQA 1NLBH 4XMPH 3JVGC 1IAOB 4LNRA 3V5KB 2F5AL 2JE8A 2IAMC 4KJPC 3JV6B 3N1QC 1HWGB 2Z93A 4X7SH 3MACH 1MCKA 2EZ0D 5JO5B 2O5YH 3QUYA 4JQXC 4N1HB 3WLBA 3FQRB 4ZFOB 3OTTA 2NXYD 4QTHB 3C60B 4C56B 3WS3B 5DUBB 1RUKL 1T04A 3SKNA 3TP4A 5JPNB 5IVXB 1U8HA 1AR1D 2QEJA 1G9EA 3KPNA 5DJZA 4U3XA 1Q9KB 3EDJA 2GCYA 1Q0YH 4N1CA 4R3SA 5JDSA 3A6OA 4I0PA 1OW0A 3W11C 4CMHB 5CGYD 3NBNA 2UUDK 3MLYL 4X6DF 1H3TA 4NZTL 3O6FD 5CJ8A 5CP3H 4WDIA 4LSUH 4DKDC 4OI8A 1EVUA 1E4WH 1HINL 2ADIB 3CFBA 2HFEB 4BQBA 1FAKT 1TFHA 1QBLL 1S78C 2DTMH 4YGVB 5D7LB 2HKHH 4LLVA 1KB5H 5CMAA 2J88L 1TZIA 2G75B 1I1YB 3WXVL 5I8CA 1CZ8H 4JG1H 1MCNA 2VLRD 1MPAH 3BE1H 2OJZL 1HILB 1L7IL 1VEPA 4UTBH 4P2QB 4XXCA 1HQRB 3UPCA 5T33L 4P2OC 1WISA 4TRPL 3DVGB 1PG7W 5IR1A 4AEIL 3RVTD 3N1FC 1OL0A 5AD0B 4MA3A 5AZ2H 3CFCL 4UIKH 4X4ZA 1GSMA 3G6AB 3QJFA 5DDHB 4RWHA 2YD9A 1TJHH 5K93A 4O9HL 1YDPA 4H8WH 3FQUB 4XRCA 2HG5A 2APTA 1FL5A 2F8XC 3LQZB 2WWKO 3HMWH 2J6EA 1OARL 3QIWA 4EVNB 4MXWH 1G9MC 1MUJB 3GIVB 2DQTH 4X5XA 4WHTB 1EO8L 5C0JA 1U3ZA 3VGDA 1W0VB 2E5EA 1E28A 5EO0B 5KTEH 3I6LD 1MFAH 3VXSB 4WW1A 4OGAC 1G6RH 2YA0A 3IDGA 4DN3H 4EDXA 4MQTB 2C3GA 4TNVK 1IGFH 1R0AH 2JIXD 1XR9A 2LTQB 5KSAB 5FKAB 4QRRB 4JREC 2VE6A 2EEBA 5I73C 1ADQH 2H26B 5BW7A 5I1GL 1CFVH 4ZO6A 5IW6B 4BSJA 1MCIA 3E6FB 4KDVA 3O4LA 4PR5A 3QUXB 4P5TA 1ORQB 2D3VA 3DJ9A 3QSKB 5FGBA 1A14H 1FNAA 2D0HA 3RDTB 4LEOA 1S8DA 4FQLH 1IKFH 5IG7A 3STZA 4BZ1H 4PRAA 4DVBA 4WW2A 4Z5RA 5EO0A 3LS4H 3ALXA 4RSVA 1AO7D 1TCRB 3MOQA 5FGBC 5C09B 4RFOL 2OP4L 1Z6JT 4I3SL 3OQ3B 2V5SA 3CK0L 5A16B 2GJ6D 4X4MA 1QLRA 4MB4A 4MX7B 2GJ6A 5ERWB 1OM3L 3REWA 3BO8B 5TF1L 3ZL4L 3QFJD 2J8UB 3CXHJ 4JKLA 1NGYA 1A7PH 3D1MC 3T0EE 4QWWD 3W2DH 2AGJL 5AUMA 5GJSH 1ZSDA 1U8MB 4WFFE 5FYJD 3BPOB 3MRMB 2Z8VC 5D7KE 3FN3A 4HBQA 3OXRA 1FHGA 1B90A 1JWSB 4OJFL 4ODTH 4Q58C 5DZLA 2XNAB 1D5MB 5EU3B 3BIAX 2DQCL 5C6WH 2XQYK 3VXSE 1Z9MA 4RNRB 1JRHH 1VDGA 1W72A 5B3NA 1A6ZB 8FABA 4EJ1C 4IDJH 3V7MA 1WZ1L 1YY8B 5IFHH 2HFEA 2V5MA 2H26A 2NY1C 2WWMD 2DICA 5KSAA 2ZG2A 4ERSL 2E7BA 3C9NA 5HYQB 1JZ5A 12E8H 3FO2B 1HH9B 2VDOL 1V7NL 5F7NC 3ZO0A 5JR1L 2OQJA 1XF3A 3GJFB 2IBZY 1J12A 4PGCB 5J11C 3S37X 1QBBA 1IGJB 1B88A 3MRLA 3DI2B 5H94A 4AIXA 5K9JH 2GK0B 2ESVA 3PUCA 2BJML 4ONFL 3NFPA 2G9HA 5A2IH 1EFXD 1Q94A 4HT1H 4NQEB 5J4MA 4OKVB 3QIUB 5HGAB 5K9QG 5IMKB 4O2FA 5C09E 3S3SA 1TTUA 1WWBX 3EJYD 4U1LB 3L3DA 5MENB 4AEFA 4NC1E 3AU1A 3LPGA 1BJ1J 1Z2KA 4I4WB 4G8GE 5SV3A 4UI2A 5FDWA 5E08L 4PRID 2V2WB 2VDRL 1IAOA 4RGNC 1BF8A 4FS0A 5GIRA 1NC4D 3O2WH 3P73B 3IU3B 1F02I 3ABZA 3DETC 1TVHB 5DVOA 3GI9L 1K8IB 1M1SA 3DX9A 4G3YH 1J0YA 1YN7B 4OM1H 3ARTA 2IADB 4XBGA 5J13C 5KZCD 2UYLB 2NTFA 2GKIA 4JQXA 3V8OA 2ORBL 3E8UL 2OL3L 4ESKA 5CMAB 5I76B 1FO0B 1XCTB 1J0KA 2ENYA 1SJHA 2EC8A 3A67H 1KTLB 3MNWB 2DQEL 3BKJH 5JUEL 4PJCF 4IM8A 4JKPL 3RA7H 5F7KC 1KENL 2CK2A 3MFFA 5FYLH 2G2RB 3VG0H 5IBTL 2B39A 4XXDA 4R4BB 5FOBB 1WCBA 3HA0A 3MLXH 4HFUH 2P8LA 2XZAL 4QLRA 1ZLWH 2VERN 2O61B 4FQPA 1X7QA 5DHXB 3UPAA 2ATPA 1MFNA 5KW9H 4H26B 5DJZB 1MCHA 5JOPE 5LVEA 4OLVL 3MUHL 3K1KC 5I17B 3MZTA 1E4KA 4D2NA 5I19L 5D72L 3IGAB 5GGQH 4BH7B 1DCLA 2FL5A 4X7EC 4MHHI 1WLHA 1EGJL 5LAXB 1X5AA 2A9ML 1FZKA 3RY6A 3EDDA 3BVNB 3SE9H 3VFGH 5TE6L 1KPRA 3U1SH 5E6ZA 3PWVB 2OJEA 4L3AA 4WI7A 1S5IH 2MHAA 3P30L 4ENEC 1OGTA 3Q6FB 5EIVA 5I1KH 4XNXH 2R29L 4Y5XC 3B9AA 1PX4A 3MBEC 3HZYA 5DJ2A 1YNLH 4R96B 3QI9A 1EGJA 1T7YA 5KJRL 32C2A 5HYFA 3QDAA 1QHPA 4JPVH 5K9QI 4ODBD 1DUZA 3LB6C 1JZ6A 5JW5A 2H1PL 4RMWA 3ARQA 1I8LA 1HEZB 1NCTA 3U2SB 3M8OL 3R4DA 2VLJB 4BKLB 1HH6B 3EGSA 4Z7UF 5GGUB 5GSRA 1MAKA 3KJ6L 1U0QA 5I1HH 2FWOA 1E27B 5J89A 1MFDL 2BNUB 1HK6A 1YMMB 4Y5VB 4YZFF 5BS0D 3BDYL 3LIZH 3V6OE 4XX1G 2PO6D 1RQ5A 1Z0MA 4J4PD 3IDMA 4N8VA 1EFXA 3NCBB 3RRQA 3B9KD 3H2WA 4WWKD 1I3RB 2YD4A 3CD4A 3MA7A 4LVNB 32C2B 5L2KB 2V7NA 2VQ1A 4QGYA 4FABH 1FPTL 3S3JA 4F57H 1CIUA 3O9WD 3RVXC 4PGEB 4UV4H 4YDKL 4D9RD 5I8KH 3QQ3B 1BJ1H 4M7JH 2Y5TB 2YXFA 2G60H 2IPTH 4HXAH 5AAMA 3I84A 3B9EA 3CZJA 1L7TL 3W9EB 5IQ7H 3O3AB 3FB5B 3BAEL 1AE6H 1GOHA 4MD0A 1FSKC 1KELH 2X4TB 3ARBB 5HHVL 4O2FB 4MJ4A 1VPOH 2BSRA 4LGPB 4OCRH 1CG9B 3D0VA 1JPGB 2R0ZL 3M45A 5LAXA 4BUHA 5J13B 3MJ8A 4NO2B 4D0DA 2EIEA 1RUQL 4JO3H 2RIKA 4J3SA 4R4FH 3O11A 2EDLA 1DQLL 1T0MB 2BVEA 4GQ9L 3QO1B 1WAAE 2ICES 2P48B 4LCUA 1W2KT 2PR4L 2KUTA 3T1WA 1OTTD 2R4RL 4Y4KD 2ZWLT 4G6AC 3OZ9H 5HHPB 3CXHK 4M62L 5DRWA 4NKOB 2ZCLL 4L5FL 5DMKB 5L2JA 2FHBA 3PGDA 1KF9B 3MYJA 1KLGB 2Q7YB 4YAQA 2DI8A 2VIRA 3LN5A 4P99A 1UKSA 4EEEA 4QCIA 4TUJA 5DJAA 4QOKB 4RIRA 2DQHH 5KTEL 3O41A 4R97C 4DZ8B 3NCFB 1NUGA 2E3VA 3D25A 4MJ5B 1IGCH 5F1IA 5ANMA 4G8IB 2DS4A 4POZC 3GSNB 1K2DB 2I5YL 3LOWA 5EG6C 3T2OA 3QXUA 1AQKH 4WFHE 1BBJA 1F2XK 3U7YL 2YC1A 4JE4B 5T1LB 4XPHH 2WINB 4JZJC 1BECA 1KIPA 4XPFH 3ULUL 4ZS6C 3WFEL 4M5YL 4CADA 1LNUB 3HUJB 3MLPA 4JFEE 4F9PC 1AFVL 2F19L 3BPNB 3SE4C 2YMXL 1QSFA 3QDGA 4I18C 5B38B 2LTQC 3LS4L 1AGCB 1M7DA 1JZ2A 3CCHA 3D2UB 4Z77A 4OZGB 3HZVA 4DGVL 5IJVA 1LD9B 1QFHA 4NIKB 4NHCH 1FNEB 1NFDE 3CVHB 5FV2A 1H5BB 1L4IA 4HWZA 4JRYE 2YC1B 1F4WH 3DRQA 4HQQH 2OJEB 5ISZD 2QQKH 3L3OB 4EI6B 4PB0H 5DQJB 5I9QC 2WM0A 4PY7A 3KPOA 2G9HB 3EYSL 5FB8A 1S7TA 2FYYA 4WV1B 4V1DA 4ZXBD 4FZ8H 4G6JH 1NGPL 5HDLA 1DUYB 4O5LL 5T33H 1X5JA 2DBJA 2Z31A 3MRHB 4QRSA 4IRJA 1KPVA 3BZDA 5IFJA 5I17A 1U8LB 5F71A 1BMGA 1YY9D 2ZJSH 4PJ5B 3HG1A 1T2XA 1KB5B 4YR6B 2DL2A 2HMIC 4KZEL 2EO9A 3QUKA 2OXHA 2P8LB 1CK0H 2VSCA 3WUWG 3ZDYF 3MXVH 4L3EB 4YDLB 1MFBH 3BPNC 1BZ7B 4K8RH 4QOKE 5SWSA 5FFLA 1MWAB 1UC6A 4K7FA 2XZQL 1AXIB 1BGXL 2GY5A 3VXOB 4QOKD 4YHYC 5FYKH 5C0AA 2DIBA 1BAFH 3U36A 3D2UD 4QRPD 3BP4B 4X7TA 1ZWIB 4PGDB 1CXEA 1EFQA 1UCBH 4R4NC 2HTKD 4KI5C 3VDBA 1MHCB 2FJGB 1JGVH 4Z7QE 2QSCL 3QIBA 1JNJA 3CVIL 5BZDB 4PJ5A 4HFWB 4BH8A 1Q1JH 1UWEL 1UJ3B 1V8HA 3P4NB 4JFEB 2FEEL 3QXAA 1IKNC 5HHNA 3CC5A 2NW2A 1JP5A 1UXSB 1P2CB 3PIQA 1MRFL 3BMWA 1DQML 4JFPA 4JPWH 3GB7A 3GMPA 4G8GA 3RIAK 4M6NH 5IESL 4MXQD 4EI5C 4FQ2H 1CE1H 4Y4KC 3TFKD 1U6AH 1J0HA 5DJXA 1RIVH 3ZTJG 4E42A 3DRTB 3H3PL 4M1DH 2EIDA 4Z6AT 1P5UA 4C4KT 4TUOA 2VE6B 1LO2L 5AG9A 4F7CA 5GSRB 3FCTA 3ARDC 3S97C 2DQJL 3IRZA 1IAKA 1HYSD 3UBXG 4LLMB 2O5XL 2DYPA 1D5ZB 1Z3GH 4ZS7H 3WO4C 2DQDH 3VJ6B 4PRNA 4JFDA 5KS9B 4GW5A 3QNZA 1NUDA 3NIGE 5DHVA 4YNYA 4W68A 3RVXD 4NFCA 4HUUB 5CWSB 1PSKL 1UVQA 4TTDD 1K2DA 3BKJL 2OM5A 4U1HA 2BFVH 1LEIA 1X5IA 1ZGLM 4UOJA 3E6HA 5IW1B 1HSAA 5I8EA 1HQ4B 4L4JA 2FYYB 3MGAA 5IB3B 4G6FB 4S0SD 1HCFX 5HYSB 2D7QA 4PP1C 5FYLE 3MLXL 2B4CL 1D5MA 3MV7B 4NO5B 4GS7C 1TLKA 2DQCH 4H20L 3MYJB 4YAQB 2BC4A 4RAUB 4ZYKA 4F37F 4CN1A 5JORA 2Z93B 5DT1L 1G7MB 1MLBB 1UENA 4KKNA 1JZ4A 5SWZD 1U8MA 1NCUA 3KS0J 5CD5D 3ZHKA 1KN2L 4S1RL 4ELMB 1KN4L 1MY5A 4RFNC 3QUXD 2DB8A 1YYLL 2W38A 4YDJB 5KSBA 2DIJA 5CEZD 1JTPA 2F53E 3K7UA 2Q7NA 3O6FB 2VZUA 2W9LA 4XVUD 2HT4D 4J3VA 4U1JA 2HT2C 4F33B 1N5YL 4DGIL 3RWDA 3MRQB 4XPAL 2GITA 1H3PL 5DQ9B 3X17A 2BNUA 4XVTL 1Q9KA 3L5WB 1GZPA 5J6GB 1FCCA 2NR6C 4I3RH 2W0KA 4UT6H 4G9FD 4WEBL 5B38G 1B0RA 4KTEL 1ZHBB 5F6IC 1WT5C 4ZUSB 2E7LC 3MRGA 4HS3B 4Y88A 1N4XL 4R7NA 1DUZB 1IGTA 3DX7A 4YQXL 5C0GB 1WCQA 1ZXQA 2E6JA 2LAGB 4R0LA 3RZCA 4NKOA 3O2WL 5FA3A 3B4NA 2R23B 1RUPL 4OF8A 2IMNA 1YMMA 5D7IE 3U4BL 1IZJA 4HG4K 1QSVA 2BXZA 4GUPB 5I30L 4FFZL 3BH9B 5C07B 2Z4QB 4GW1A 2VNCA 1T04B 3SKNB 3GI8L 2PW1B 1ZS8B 4UQ2B 5T5NG 5D7IF 2AJSH 4P5TC 3OGCB 2M1KA 4LHUD 3OXSA 2EDHA 4Z76A 1XCQA 2JTDA 5ESQB 1P1ZA 4U0RB 1QA9B 2VDLH 3V95A 3PHSA 5BMFH 3QIWD 3I9GH 2NY7H 2HLAA 2XXCB 4LU5L 4CW1A 5LGJB 5FYLL 3HE6C 2Y5TA 3QNYB 5C3TA 1BFSA 1T1YB 2FSEB 2WIMA 1VKXB 3I6KB 4LHUG 2P5EB 3TO2B 2XQBL 3CFDA 1JF6A 3VRJB 2IBGA 5CZXC 1UG9A 5E2WH 1ZT4B 2EKSA 4KQ3L 5FA4A 1EAPB 1KBGL 3C8HA 1HHKB 4KDWA 4BH7A 1CFQA 2Y07L 2HTLC 4DFHA 5DC0A 4L8DB 3OBAA 5DRXB 2VLLB 4CU6A 3HAEH 3IKCB 4LIQL 3BZFA 1E27A 4U1IB 4AENA 1MFCH 4OZHE 1RVFL 4HK0A 1LILA 1I1YA 1F13A 5EA0H 3NFNB 3IB4A 2A1WL 1FZJA 1UEYA 2D0FA 4HGMA 1ORSB 3QUML 2BVUA 1NAMB 5GS0H 1AH1A 4IRJB 3ARBD 1Z9OA 3UBXA 4PP1D 2AXFA 2APVA 1QUNA 5DWUL 3NZ8B 3SQOL 3IU3A 2Z92B 4FTVE 4XCFH 1M6OA 1II4E 1FLTX 4C55A 3CSGA 1U8KB 2B0SH 4JO2H 2WZPD 2BY3A 2VXTH 3QPXL 4YHMH 4F9LC 4X7CC 4LVOB 2MCPL 5I1IL 2NYYC 1A47A 4OQTH 2OMNA 4ZYKB 4G8EB 1BVZA 3CFEA 3U7WL 5IOPB 2VUYA 2ICWA 2QBWA 3X3GH 1C7TA 4N0FB 2WBJD 1HHIB 5KSBB 4IRSA 3QFDA 3L9RB 3MR9B 1VGKA 2DDQH 3LH2H 2DN7A 1VFBB 1CBVL 3PL6C 4U49A 2DIAA 2A9NL 4XP5H 5ICYB 1KC5L 5JHDA 2EYRA 3VFSB 4MQXD 4GXVH 1X7QB 3BE1L 4S1SH 1DLHB 5CCKL 1JNNH 4G9DA 4L4VE 2YEZA 3QHTC 4L4TE 5BXFB 4HUUA 1U3JA 1YMHB 4PTTA 2UY6A 1Q94B 4NQEA 3QUYC 3ZTNL 4YHIA 4DOHE 2MNUA 4FXLA 1XIWA 1OD7A 5F1SA 1AGBB 3H9SE 2JK5B 4P9ML 3W9DA 3HPLB 4OT1L 4XAKE 3L3GB 1KELL 4ZD3L 3BWUC 3AAZA 5EU3A 2R0ZH 4P3WA 2F5AH 3C9NB 4HHAB 3S88H 2YN5A 4JFOB 4XP9L 4YPGB 1CICA 5C2BL 3WJJC 1OARH 3AC0A 3AY4C 1FL5B 3DVIA 3SKJL 4AMKH 4YE4L 1FVCA 1T20B 1V5JA 4O58H 1GGIH 5I75C 1N59A 1AD9A 1BD2E 1G7LB 3BP7B 3S34L 1V3LA 1U36A 1XF2B 1OAKL 4K23L 4YXHL 3JV4B 2XA8H 1LK3H 1CVRA 1MWAH 3EJJX 1Q1JL 3OX8A 3MGTB 1UWEH 3EYOA 4HLZH 2NY0C 2LE9A 1HILA 1I1AA 1RUKH 3F7VB 4NZTH 2CIKA 4QO1A 5BZDA 4W6WB 4ZPTA 2F74A 2NNAB 4HZLB 2ZNXA 2HP4A 1R3LB 2W60B 5F9OL 4AZ8A 4FNLH 3C09B 3RVVD 2YD3A 1I1CA 1NDMB 4Z7VF 1OQXA 3ARYA 2BVOB 1D6VH 3RWCA 1NCCL 3MA7B 3BP7A 4NJAH 5IMMB 2BSTB 4HWEL 3PF2A 1Q8MA 4HKJA 1W0WA 5EUKA 1R24B 4LCCB 2X9XA 1IT9H 5D2LF 1A02N 2P43B 4Z78B 1QFWL 4JFYB 4KY1L 4YEEA 1G6VK 4FQJH 1FNLA 1YY8A 3GSNH 5DJ8B 5EC1A 5JQ6L 2DLGA 4BQ9A 4XAKD 1FYTD 3R0NA 4GKZB 4CJ1A 1BHGA 4MD4A 5LKNA 5IT2H 1XIWB 1VACB 5H37H 1S7WA 5GGSA 5C0AB 5CUSH 1JVKA 2CKBL 4I18A 4O4YH 3OB8A 2ED8A 4UTBL 2VDNH 4LFHG 1PG7X 3RUGA 1F58H 4R2GC 4W70A 2EE9A 4R0LC 1AHWA 2C3VB 4WENB 5EZIH 3SY0A 3B5HA 5DJ2B 3PGFH 4CUCA 1MHPH 3O2VL 3D39D 5T3XH 1H3GA 5JXAL 5BO1L 2YUXA 2DLHA 1FRGH 5GRUL 3MTRA 4N0FA 5HHOE 3WLWC 4UUJA 4HUKB 3KXFE 2L4OA 2MQ3A 2PN5A 3V0WL 1MJ7H 5FB8B 1BQHB 3VXRA 2PO6C 1G7LA 1CLZH 3ZKXC 1T83A 4GBXA 4OZHA 3MPCA 5FF6B 2P46B 3OHXB 1GPOL 4HD9A 4OCMC 4PS4H 1FJ1B 3S4SB 4Z7WF 4ZFFA 3KHQA 1KN4H 3OV6A 3AMKA 4JDVB 2NXYC 5ADPL 2ZSVA 1C12A 1NSNH 3ULVC 4KRPD 4HWBH 1Q38A 3EO1B 2YUZA 1Q0YL 3ESVF 1KIQA 3P4LA 4NN7B 3QDME 4X6CB 2EDFA 4M4RA 3TBVB 5C7XH 5F72S 4HK3N 4NSKA 3PP4H 1HINH 1NKOA 2ICEA 1S78D 2A6IA 3LRGA 5GS1A 3MNZA 4YUEL 4RMTA 4OIAA 3HNSL 2R0KL 4N1EA 3RVUC 2Z35A 3D48R 4PJXB 4OCLC 2Q8BL 3KPSA 2B1HH 3L9RA 3S8WA 1FE8L 5ALBH 5CJ5A 2HH0L 1J7VR 4KK8D 1F2QA 5EZLB 3WJLA 1XGUA 3G5VB 2AJXH 4UV7L 3T3PE 2XI9A 4L8DA 1X5ZA 1QFOA 4EIGB 5IMLB 1G7HB 1QQDB 3QFDB 1HIMH 5D5MB 2IPKA 4HJJH 5LQBH 5BOPA 5IHBA 3KPQB 4PB9H 1IAMA 3D69A 3U0WL 5L2KD 3ZL4H 1G9NH 1SMAA 3P0VL 4BFEA 3L95B 3SDXE 3PJSB 2PETA 5ESAB 4P57A 4HAFA 5J57B 1S3KH 3HRPA 3GNMH 1OPGH 1BFOB 1U91B 2IG2H 5DMYA 3HC4H 4YZFE 1ZS8A 4Y5YB 1I8LC 5D1ZD 3TIDB 1CCZA 3INUL 3RA7L 3BUTA 4X4YA 4KVNH 2CDFB 2H32B 3HI5H 4UILH 3EJYC 2VAJA 4N5ED 1ZEAH 2BFVL 3QG7L 3TJHC 1EO8H 3AB0B 5C0FB 5LBSH 3D9AL 2IQAB 4RFEB 2JCCE 3FO9B 5DRXA 4J8RB 4NWUL 2OI9B 4HCRL 2W1NA 2NY5C 5HDOA 3VCLA 4E5XB 3UBXI 1CFNA 5I8CB 3EW3B 5HHQB 4JGMA 4K55A 3QQ3A 2DMKA 5D7LA 2FWOB 2VISB 5DEGA 3C60D 3QA3B 4C56D 3GZKA 3FQNB 1IKNA 2VQ1B 3S7GA 3V0VB 1CF8H 5C0CD 3ARBC 1EJOL 2MSPA 3K4ZA 3GRWA 3QFJA 1FN4A 3U0TB 4HKXA 4HDIA 1ZGLP 3OF6D 4DK3A 5DVKA 4TUKL 5C0EB 5JXED 1E4XH 1MFCL 3B9KA 2XTJC 4LAJH 4NQVB 5TDNB 3L7EA 3ULSA 1CD8A 1EVTC 4XBPA 2Z91B 3QHFL 1U2HA 3AY4A 1B6UA 3M17A 2IALB 3IXTB 3RHWF 5DUPL 5CFHA 5FYLD 4K9EC 3LZFL 4HMEA 4JPVL 4YBQD 4X0KA 3TFKC 2R15A 3VFUA 1QR1A 1P4IH 5E94A 2VLRB 1A7NL 3ES6A 3KVQA 4PP2A 2CRYA 4OZIA 2AQ3A 3G5YA 4MA1C 4E0RB 4PJ8A 5EORH 1GZQA 1EPFA 3UTTB 4CDGC 5KVEL 3QIUC 3P40A 3GSWA 1I3GH 1R3HA 1S9KC 3MLVH 4P9HH 4Z8FL 4G6KL 4KMTH 3BEVA 2HLFD 5I8EB 3P11H 4NM8L 1U92A 1X44A 4NZRH 4G6MH 5FO8B 3OR7B 5IFJB 3ROLA 4IHOB 3O3BB 1LQSR 4YC2B 4XCEB 3NCEB 1WC7B 1XEDA 2BRRL 4HPYL 3GM8A 3MRJA 4FXKA 1ULVA 2GJZB 2NY4D 3L5IA 3GBNL 4GXVL 2EXWC 2IQ9L 2GFBA 5TH2B 4PJIA 4Z7QF 4OB5H 5JIKA 4S1QL 4NRXB 1AO7A 2VXVH 1I85A 3OKMB 1CLCA 2MTPA 5J8OA 1NMBL 4DCQB 3SE4A 5J56B 1RK1A 4UBDD 5B3JF 4WU5A 1DQQB 2YD2A 4Y4KB 3CVHA 3MOBL 1LEGA 1WZMA 4I13B 2LAAA 4ERSH 3NIFF 3FB8A 3EFDH 5MEND 4OT1H 1IILE 3O2DL 3D39A 3WLWD 3QQ4A 1NBZB 4TNWK 3VGBA 2BNQD 3VXTA 3QEHA 3GSQA 4G9FB 3WXWH 3GIVA 4XP9H 3U46A 1OLLA 4KKCC 4J3WA 4HIXL 2H9GA 3JZ7A 2MQ0A 5L9DL 4TSBH 4Z95L 3WIHH 4QRUA 2XWJB 4W6YB 4K2UL 4XVUC 4ELMF 3TBSA 2FJHA 3ULUC 5IKCA 4X0KB 1B2WL 3IDYB 5IHZB 1D5IH 1KJVB 3CDYA 5GGSB 1HKFA 1S7WB 2LVCA 2OSLA 1IAIM 3GMPB 5GIRB 1BZ9A 5BVPL 4V2BA 2JKXA 1MWAL 1JYVA 4NKQB 1K3IA 1J1XL 5KVFH 3MZGB 4ALAL 1F6AB 5JOPD 4XPHL 4O9HH 1A7RH 1IGMH 5C92A 1RHFA 4ZMAT 1SJXA 2UWEE 4LSQL 3MCKA 4JVPA 3UZQA 4UOW1 1BWMA 4U2YA 5ACZB 2EDEA 1IAKB 1AC6A 2XKSA 3U79A 2BSED 1C1EL 2D9QB 3GUTB 3UTZA 1VFMA 3HCVA 4F57L 2FX7H 1MFDH 3ECBB 4TVPD 5LJYH 1BWWA 4ZXBC 4F7TA 2DQUH 4M7ZB 4TSAH 4HWBA 5F93C 2ADIA 3CFBB 3DUSB 1XF3B 2J1KA 4PRIE 5JW4M 3K8KA 3TNMA 1QFWH 4IJ3B 3F7QA 1JI1A 1TPXC 3T4AB 3RTQA 1ZT1A 1J1OH 3QRGL 3EYVA 3L6FB 4JFDD 4JHAH 4HZAA 4XNMB 3AB0C 4MDJB 3UYRH 1C5DB 4NZDA 5GJTH 3JXAA 4JFEA 2B20A 5C2UB 5A43C 3RZCC 3FONB 1OAYL 3ALWA 5D72H 5T1KA 1U8JA 1YEHL 1T7ZA 3C60A 4C56A 1GGBL 2VR5A 4U0QB 1URLA 3RWDB 4M61A 3KPSD 2E7LA 1OCWH 5ADOL 1BIIA 4WUUE 1BF2A 1UZ8A 4F2MB 3F58H 3LQMA 3V7AG 1TJIH 4KHTL 1MHEA 3T3MF 5T3XL 4QRPB 3ARVA 1OAZL 2IPUK 3RNKB 3RDTC 1J8HA 3BJLA 1TCRA 3HUJE 3CDFA 3C08H 2IMMA 1FFOB 4BQ6A 4UDTB 3QI9C 2J8UA 2CKBB 1MJ7L 4ZSOB 1XGUB 3HC3L 1I4FB 1H8OA 5EZLA 3ZSSA 5GGTH 5C70A 4MA7H 5AWNL 3SKJH 4NM4H 5F9WC 1HEZA 4ZUTB 1ADQA 2EXYD 1LEKA 1I1AC 4H0IA 3GSVA 3HI6H 2EDJA 2PTTB 3RVUD 1NFDB 2BNRE 3W5NA 2DJSA 1H0DA 2CO6B 1AR2A 5BVJB 3W11D 2FLBT 1RZGB 1VERA 1RSFA 4ZDHA 5C0BE 1E4WL 3T1FA 1BBJB 1BLNA 4I3GA 4TSCH 4IRSB 3VI3F 3LKNB 4TYUA 3DXAD 3V4PH 2ICWB 2YHGA 5I1JH 4NQDE 1KCKA 2AEWA 5IV2A 4PRIB 5L0QB 5FK9A 3BVNA 2R1YB 5EO1A 1I9JH 3GBMH 4GLRH 5SWSE 5LWYL 4DVRH 1CICC 5DC4B 1RU9L 4PUBL 3BP5A 5DGRA 3RU8H 5IF0A 3QHZH 3TH2T 1DEEB 3F5WB 4NOFA 4OCYH 3LQZA 4G9FA 2VQTA 3HG1E 1OP3K 1G7QA 3ET9F 1DLFH 2PXYC 1U95B 4RQQA 4DW2H 2PKDA 5IOPA 2C1OA 1KIUA 1OGAA 3GSUA 4M3JA 1Z3GL 1QFWM 4KJYA 1TJHL 1CN4A 4K3DH 1NAKH 3DROB 3QDJB 5LQBL 4H88L 4WFHD 5CP7B 1TQBB 2Y23A 2DQIL 4Y16C 4WUUB 1MH5A 4I0PC 5GS0D 2AV7A 3N50A 4JO3L 5BS0A 4GG6E 4P46D 1SY6H 4N0YH 3CX5J 3KJ4B 4HIJA 4K3JH 3ARDA 4G6JL 1UCTA 1ETZB 4NQVA 3NZ8A 5IVXF 4HKZA 4PJGF 5L2KA 5IVOA 3I3EA 5HHNB 4NBZB 1EEZB 1YECL 1VEOA 4M93B 3HI5L 4UILL 1JNLL 4IRSC 4Y4KA 2ZUQB 2YK1L 1UCBL 3BEVB 1G7PA 5KSBF 5K59E 4EUPB 1RIUL 3ZE1E 3TO2A 4LKCA 2XWBB 4U1SB 5JXEC 3RBGA 3WO3B 2D7TL 3IKCA 2P8PB 5C0BD 3T4AA 2X6MA 4BSWB 1KUMA 1S7UB 4HF5H 5HY9A 1GZQB 2AV7B 2Z8RA 4ZFGH 2LVEA 1HHKA 3DUSA 2AJZA 4EN3B 1F11A 2DLTA 4QHMA 4RRPG 3ROLB 5BV7L 3DO7A 3G6JF 4R7DA 3QEQB 1OWWA 4XVSH 3QIBC 4LCUB 1CWVA 4BZ1L 1FL3B 5LCVH 3SGKA 2YUWA 3X11B 4FQ2L 4GKSB 3W9EA 1U6AL 2EDNA 1F8TL 1K8DA 2BVPB 4PRDB 1BEYH 3FQRA 5C6TH 2XOTA 2C5DC 5KS9E 2X05A 4DGIH 3CH1A 1JV5B 4KKLD 3B9KB 3O3AA 4YHLL 4GFTB 1QBLH 2DTML 3B9DA 4DAGL 5E4EB 2X4RB 2AEIT 3MYZA 4EKXA 1EEQA 3IAGC 2GW5A 1Q9WB 3PDGA 3CSPA 4ONGL 2H2SD 3LDBB 4XX1E 3ZYIA 1KIRB 5C86A 2H8PB 3MRKA 4NQDA 1GC1C 3EHBC 2ICWJ 2FJHB 4IRJC 3WV0A 4ZO7A 4HXBL 5EBLB 2NLJA 5CEXB 1I3RA 1WFUA 1ZANL 4UINL 4JFOA 3MODL 3CCHB 3D2UA 1Y0LA 4Z77B 1I7RB 2VXSL 2PTTA 2UWEF 1MQKL 4TULL 4LBEB 3VH8B 4JY6B 3K2UH 1QYGH 3MNZB 5FUCE 3ZKQD 5TQ2H 2VRAA 4NFBA 5FHAL 3NTCH 2GI7A 2PYEB 4J3UA 3V6ZB 5KG9A 3EOAB 5MEQA 2NW3B 3HNVL 2HAZA 5DMGC 2FATL 2AJ3A 3HMWL 1KIPB 3BD5A 3AXLA 1KJ2B 1T1XB 2XRAL 4OD1L 5BXFA 1QBML 3A0OA 1VENA 2IG2L 2X10A 4J6RL 5F1NA 3IFLL 3HRZA 1N5AB 1UXWB 4OB5L 1MHEB 1YNKH 4I9WD 3UO1L 1RULL 4LL9A 5JR1H 1ZEAL 3LN9A 1HSBB 3MRNB 2FO4A 3D85A 5D7JD 5CZXD 5GS2D 3MOBH 1YYLH 1WTLA 1EDQA 4F15C 2BOCA 4NZUH 2V7HB 1WT5A 1G1YA 5CBAA 2NY2D 4JGJA 4GSDH 2ESVD 2R9HC 5C0CE 5BW7C 2UV3A 3UTOA 4Q9BA 4PRHE 5KN5B 4P46C 4URTB 3HAEB 5D6CB 5JZ7D 1RJLA 3MGOB 3TWCH 2D7MA 3E0GA 4OGYL 2FHCA 1FQ9C 3BXNA 5TFSL 2N7AA 1FFRA 4M1DL 4PRIA 1N5YH 5EU6E 3JUZA 5T1LD 3QIWC 4HJ0D 3HCVB 4GKOA 1HOCA 1U93A 4X5WA 3QHFH 1KEML 25C8L 3MFFB 3TYGL 1K4DB 2GSIB 3S96A 1CDJA 4KROD 2MPAH 4BK4A 3U4EA 3V0AC 5I30H 3BP5B 2V17H 5IF0B 5IHLB 5I0DA 2FDBP 3ZDXE 3QCVH 3KLSA 4YHKL 4EUPA 1WWCA 4F8QA 5F96H 4NN6B 3SGEH 4LLQB 5CKGA 3V79C 1OT1A 3KPRA 1D6EA 3T77B 1FL6A 3HFMH 5B8CC 4Y4FA 4P2OA 5HYJE 5HXMA 1A1NB 1FFNB 1T1WB 4TSAL 4X7SL 4XTRD 3VWJD 1YUHA 2CKBA 4MAYB 4QGTA 4NT6B 5A40E 5I16B 2F54B 1K85A 5FM8A 4JRXA 1QSEA 2FB4H 1MRCH 3V9FA 4HUWA 4F7EB 5F3BA 3QRGH 2C4FU 4QF1A 3VE0A 4U6TA 5DO2C 5GPRA 3LKPB 3VFNB 2WW8A 2IQAA 2EE6A 4EBQL 4ZO8A 3WIIL 3EOBB 4LKXB 5K9OB 3RGVB 2X89A 2V2TA 3ULVL 5DFWH 1D5XA 5SWQA 3O8XB 1MVUA 3FONA 3TIDA 5FECB 1AFVH 2F19H 5JPMB 2APWA 3MLYH 3VG9C 1HHGB 3WBDA 3PWPB 3Q3GB 4LSRH 3A6CH 2XPGA 1J05A 4K94L 5H94B 5HPMA 3PGCA 2HJKB 3SEPA 5K9JL 5CD5C 3SKUD 1IGYA 2YPLD 4X6EB 2FX9L 2IANE 1BVKA 5TH2A 4YE4H 5GS0L 2FIKB 2X4OA 4ODVH 4NHCL 2I07B 2VWEE 5C09A 2AKRA 3MBEA 3GDBA 5GGTL 4MNGE 3C2AL 2HFFB 2IAMA 3MMEA 4GKZA 1S9VB 1BREA 5IB4B 3JVGA 3Q2CA 3NABH 4YXHH 4J1UA 4I3RL 3V6FB 3E6FA 2XN9B 4JPIA 4Z7NE 3QWRD 3HI6L 3OG6B 5DR5L 3GI9H 3MGTA 3OX8B 3UTTA 4LGRB 1DLHA 4QRSB 2XTLA 1E4KC 1IM3B 4F7PB 4Z7WE 2YRZA 4HV8A 4QRQA 1RFDL 5F9OH 3IF1A 2APBA 4WIQA 1NFIA 5DRZA 1MI5A 2BNQE 4PY7B 1SEBB 5I1JL 1LO0H 4ZQKA 3VMPA 3STLB 5E8PB 4M9PA 2P5WB 1AXSA 4ZFFB 3SCMA 2J8UF 4WI8A 2NY5L 2J8HA 4JRWA 5TE7H 5I75B 5IJVB 2E9IA 3L3IA 1Z9LA 5IBTH 3T09A 2UZIH 3STZB 1PLGL 3QCUH 1NL0H 5EIQA 4Z0BH 5IVZA 5DJ0A 3CVIH 2NY7L 2V9QA 3SDDB 4FQCL 1KV3A 4WU7A 1QO3B 1N59B 1HSAB 2Q76A 4OV6F 3T0EA 5BRZE 2DM3A 3ELAT 4LCWD 1QKZH 4MGXA 3B5GA 3BWAB 5C0IB 3S88L 3IRPX 1U2CA 3TLRA 3OPZH 3SOBH 3A6BH 3TT1L 3QNXA 3SY0B 3GHBL 5K9KA 3L5HA 3WNKA 3FQWB 4L5FH 3I85A 3P9MB 4PLNC 4X6FB 4WW1B 4OF3A 3DVNB 2BCKA 5KVGH 4YDVB 2JJSA 5C0FA 4ODHH 2QQQA 1KGCD 3V4VL 2DQHL 3AS0A 1K4CA 2YK1H 1ROWA 4M6OH 2I25N 1PDKA 2XIDA 1RMFL 4MNGA 2E9WA 1CLZL 4PV9A 3QUMA 3JV0A 3U30C 3L3KA 1FFPA 2ITCB 4XPGL 1KFAL 4LPYA 2DLFH 1W72B 1I7ZA 3SDXA 4CAGA 1NC4A 1FG2A 3OKLB 3W0WD 4FMKA 3IFPA 3NGBB 1LE5A 2YRLA 3GBLA 4XGZB 3KPNB 3CDGB 4MA8H 4LPXA 3TNNA 5F9WB 3UX9B 1FV1A 2P5WA 5LGKA 1EFXB 3MNVB 2QHRL 3IXTA 2DQFA 3NN8A 2FCBA 2P24A 4G8FB 4D9LL 2QLVB 5E8PA 4F58H 5HVWA 3ME0A 4UIMB 4NYLA 3BYTA 3UTQA 4DAGH 3VRLE 1ND0B 1T6VN 3G5YB 4L29B 1DBJL 4LIQE 3RWGA 1RZKL 4LLDB 5TE4L 2HH0H 1UM4L 2DJUA 2DRUA 5F7EL 1P7HL 5MEOA 2ADJB 4LOUD 1A5FL 1YEFL 3FOMA 3MRCA 1T3FB 5KSVA 4LLQA 5D71H 2YD1A 5E1HB 1P84K 2E8ZA 3RVWD 4GBXC 1FGNH 4K71B 4OCYL 4FTVB 2ITDA 1WWWX 3WDHA 1RUMH 4UINH 4IOIA 2GAZA 4XWOC 3RNQA 4PB9L 2J5LB 3O2VH 4M8QA 1FJ1A 4CW1B 4AG4L 1AJ7H 4M8VA 3RKDC 5IVXA 3BZEA 4HT1L 1CL7L 4HUXB 5DUBA 3S35L 4DTGL 5I1DB 2VXUH 1VA9A 4JM2B 4LQ1A 4M1CC 4TOYL 2OR9L 1P1ZB 1AHWC 4ELKA 3AREC 3LKOB 4HH9A 2R4SH 1R3HB 5JNYB 1X4ZA 2P5EA 4LF3A 2X4NB 4ODXB 3QG7H 4RA0C 2AK1H 4GW1B 1UH3A 4TN9A 2R0WH 3WE6B 4OIIL 4G9DB 3CH1B 1H3UA 4X6DA 2SEBA 4JHZA 4L3CB 4BFIB 3IKKA 3EYFA 2HJFB 4FZEL 1ZLVK 5IJKA 3MUGA 4XI5C 2W92A 1FGVH 5E8NB 2G5RA 3AUVA 3QWOA 3H7BB 4PRHA 2UVEA 1C5CH 4UU9B 1A7OL 4NN6C 1AQKL 2ORBH 4JM2A 1I9IH 2NY6C 4L9DA 1EJOH 1MCJA 1I8MA 3FB7B 1KJ2L 4LVHC 4HUWB 2AI0H 4F7EA 1DBML 2BSSA 1VGEL 2DQEH 3KPRD 4H1LH 3T65A 2L7JA 4LPTA 2XWTA 3ALPA 3GMOB 5ADPH 1FCGA 5F8QC 4NT6A 5I16A 4PJDB 1CR9L 3L3KB 1YMMD 3H3PH 4KJQD 5SV4A 3CFJB 4Q6IC 4I0CC 1T1ZA 5DDHA 5GISL 2GITB 2ZPKH 5D6DC 3X14B 1TQBC 4F33A 5B4MC 2DI9A 1R24A 2NR6D 4BSWA 4APQB 4D94A 1GOGA 1A3RH 1A9BB 2NZ9C 1GH7A 2V2XA 3ZZ1A 2IPUG 3D3VA 1FP5A 4KDTC 5A3ID 1DFBL 4HJJL 3D0LB 4Z0XA 4HQQL 4JFZL 3U9UB 4E41B 4LSTH 3P77A 5D96C 1XFPA 5L8KB 1BX2A 1T03L 5GHWL 3PWJB 3SDDC 1FORH 2EDQA 1JFQH 2AEPL 2QQLL 3NACL 5EBLA 5B39G 2DTSA 2WIIA 2NY2C 4HXBH 3FOLA 5FCUL 5BS0B 4OGXH 4JAMB 4X5LA 3HFML 4N5UA 4L8BA 3ZT5A 4WU7B 4PPTA 5CJQL 3LDBC 5GRVK 1HHHB 5EA0L 1AKJA 5ICZB 3MRPB 4KK9D 4AQOA 1YPZB 3FQXB 1Z5LB 1WEJL 4MD0B 5I74C 2DD8H 3TEUA 3T0EB 1AGEA 3N06B 4QRTB 2IQ9H 3E2HC 2W91A 4O51A 1IEAA 5EU4A 2GUOB 4S2SA 1P4BH 5T5NF 3OHXA 4OLYH 4NPYB 3DSNA 3VXNB 5F88B 3MV7A 1BM3L 2FGWL 3ZYOA 4KVCH 1GC1L 5MHSD 2HYMA 3D9AH 3ZHLA 1BVLB 5EUOE 4Y89A 4QXGL 3EFDL 4MA1B 1DN0B 3BN9C 4RMVA 3IJHB 1VESA 2VDML 4JANA 4MD5A 5D70H 3PL6A 4V2CB 3A6CL 4K94H 4Z7NF 5MENE 35C8H 3K0WA 4S1DD 4XWOD 1GAFH 2FD6L 4Y16A 3IFNL 2V9RA 3SKOA 1KJ2A 4IS6B 1A3LL 3GRWH 4JKKA 4JFQA 1SYSB 3TESA 3RKDD 3KG5A 3VRLF 3G08A 2W9EL 4PREB 4M02A 1I1RA 2PXYA 3KYOB 3D3VD 1NEZA 5HHOB 5CBEA 5E8DL 5CAYB 2Y7QB 3HNSH 3TBTA 5ICXA 3FT3A 4KRLB 3NABL 5J7CC 3ROOA 1XF1A 4NFDA 4F7CB 5DJYB 1ZVSA 4GO6B 1BBDH 3L5WA 1UZ8B 3J7HA 5IB2A 2F74B 4F37K 1RUQH 2H3NA 3I6GB 1T21B 4XPTH 2F53D 1U8KA 4MZ2A 4GG6A 5J1AA 5KSVB 4HKJB 2IJ0C 1BQHA 2IWGA 4MMZC 2ZNWA 4IRZH 4GW4B 5E2TH 2R8SH 2QSVA 1D5XB 5SWQB 4U1MB 4ZXBB 4WHYH 1M7DB 4TPRL 4YBQC 4LAQH 5DK0B 4AMKL 2JJVA 3QCVL 3HPJB 1IQWH 1UKTA 3QYCA 4PRPA 1FIGL 4HS6B 1DEEA 3F5WA 4LASH 1UA6L 4K7FB 1I7TA 1R3IH 3JWDH 4QY8B 3WIHA 3WYRA 1K8DB 1CFTA 1KCVH 1W0YT 4G9FE 1PAMA 2VJXA 4N0RA 1UT9A 1A0QH 2F54A 4U1IA 2YZ8A 4Y4HB 3S36H 4N8CL 1QLFB 3NAAL 3HE7C 4J2XA 4EDXB 2FBJH 2Z31B 3MRHA 4KTYA 4XPFL 1NC4B 4JLRB 1A6UL 3F6LA 3MRRB 3GSXB 1QKZL 3WFEH 1Z9SA 5TGBA 4HPOH 5BJTB 4ZS6D 4JO1H 4Y16D 2P8MA 3BKCL 3GEWB 1BQLL 3QPQC 5DJAB 3KWWB 3DO3A 4PJHB 5E00A 4XNYH 1INQB 3H9SD 5DQJA 1B4RA 4GRMA 1AP2A 3GHBH 4XHQA 1F6FB 3F58L 1CDCA 4AIOA 2BNRA 4KHXL 3C60C 4PJBA 4HHAA 3ZKND 3QNZB 3AAZB 4M7LT 4X9GA 5DEFA 1BFTA 1K3ZA 1JMZA 2V6HA 3RGHA 3QQ9C 4WW2C 2X1QA 5I18L 3V5DA 1HNGA 2BCKB 4PGBB 3S3PA 2OTWA 4P2RE 5JQ6H 1XAUA 3QAZB 2ID5A 2QQKL 1NGZB 2EDTA 3F65A 4LCCC 4XVTH 3RTQC 3GJFH 2R56L 2XTJD 4NJ9H 4NM4L 1CE6B 2JCCB 5CUSL 5F8RC 3HUJA 5IKCB 1NC2D 3CMOL 3TJEH 1FBIH 1NGPH 5EOTB 3WNMA 3BKMH 3KPLA 1B2WH 5AYUH 5KSAD 3NFSL 1AQDA 4NCDA 3FT2A 3VFSA 1JNHB 1JPFA 2FEEI 3DOSA 2AK4E 5T1KD 5I1IH 4MHHG 1ED3A 2G75A 4HC1L 3RZCB 4KGLA 3G6JA 1M6OB 3O3DA 4LLVB 3WD5H 2CPCA 2M2DA 5KVDL 5EU5B 3PXJA 3G6JE 3W0WA 3L7FA 3U4BH 1G1CA 1HSBA 2NZ9D 4CADB 3CSYA 3BSZH 4ZAKA 3UPRB 3TYFB 4G6KH 1IGIL 1A1OA 2O93L 3RL1B 1QHOA 1BGXH 1GHFL 1UXWA 3R0MA 2Y4SA 4MQ7A 1BX2B 1RU9H 1CDGA 4Q7DA 5GS0C 1S9YB 4JCLA 3P0YL 3D85B 4X8XA 3U9UA 2BRRH 4ZOCA 4PJDA 5DURB 2DQUL 5I66B 5I1CH 1DQDL 4WY7H 1DLFL 4JLRA 3EOAA 3RGVD 2VB5A 1BZ7A 3AXLB 4JY6A 3BFOA 2YEZB 1JWSA 3RJQB 4LFHD 4KK9C 4U6XA 5F1OB 4LRNL 3SO3C 4XXCC 4WV1C 1KLUA 4U6HA 3VGAB 4OFYD 5DFTA 3TVMA 5F9AC 4L3CA 5B21A 3S5LG 5AG8A 4NZJA 2OYPA 1D3CA 1C8PA 2YPLB 1T5XA 3FAXA 4G7VL 2I07A 4OZIB 1EZVX 4TQEL 2Y5EA 4KPHL 3DLQR 3TBSB 3REWB 4NN7C 3U9PH 2NLJB 1CGXA 2AK1L 4YWGL 2FH8A 1MHHB 3M1BB 4ZUUA 3RPIB 3TH4T 3TZVB 3QUMH 1OW0C 5DD0L 2X5PA 1F4AA 2YBRA 1PVHA 3IFOB 4POZD 3VXTB 3NA9H 2GTWA 3UCRA 3WNLA 1QFPA 4N8VG 2NTSP 4QYOB 4LCIH 2ARJA 4HMDA 1F45A 1YPZA 3P0VH 4FNLL 4X98A 5E2JA 1OP3H 1KJ2H 3RWEA 4NKMA 1IC7L 2PW1A 3LKPA 3VFNA 4EI5A 2CUIA 4IBLT 3QPXH 3MV9E 2Q6WA 1NCCH 3BZ4A 4J23A 3RDTD 4HWEH 3LVEA 1WZKA 4PJ8C 1CR9H 1OQOA 1C1EH 2V5YA 1SJHB 1GZPB 5JIIA 3TA3A 4U0RC 5JHLH 4FQJL 4EXKA 3EYUL 5IFAL 1MCQA 5ABDE 2EDKA 4M9OA 1PY4A 3QUZA 2MHAB 4G8FA 3V4PL 5ENWB 1SQ2N 2A9NH 5FYKU 3VWJA 5CEZH 2APXA 4ONGH 2XZCH 3MCKB 4JJ5B 1CT8A 1MFEH 3JWNC 2HT3D 4KKCD 2EH8H 4LLDA 3QXWA 4P2RA 4HUNB 4PJHF 5DJDA 7CGTA 3CAFA 5ELIA 3FO1B 3PGDB 1G7IA 4M6MH 2C3XA 5EZIL 4ZTOL 3FKUS 3PABA 2IPKB 3N0PB 4OF5A 4X5WB 5DQ9A 4GKNA 1YQ2A 2APFA 1QQDA 2UWEB 4PJBE 2CMRL 4AEIH 3ETBF 3NCYP 5JXAH 4R26L 1FRGL 4EQ2A 2HVJB 2CDGB 2BNQA 2X4PA 1AKJB 3OWEA 5ID0B 1DE4A 5FOBA 2R2CA 5IQ9A 3BKYH 1CD0A 4L8BB 4XVJL 3IDXH 1B4JH 3KNBB 3MJ7A 2NX5E 1PKQE 5E6IB 3KLHD 1IC4L 2FR4A 3MRLB 1P4IL 1O7VA 3WKMH 5CLWA 1KG0B 2HFTA 4LHQB 1A7QL 5D7SH 2P47B 1MF2L 3NPZB 1NSNL 4U33A 5D93C 4XP1H 4AEEA 1AY1L 4P4KC 3RGVC 1NCWL 2E7CA 1CGWA 4FFZH 1MEXH 3KYNB 3QISA 5BVJA 4G43B 4WFGE 3IDMB 4N8VB 3LKNA 1AGFB 3VGHA 5I76A 2M26A 3GSOB 1A3LH 3GRWL 1C5CL 1A6PA 5BV7H 5JZ7C 2ZSVB 1J11A 4QKXB 1IL1B 5FKPA 3G5XB 4XVSL 4F9PA 5GRJH 4UB0H 3UAJD 1V3JA 3T65B 5GSVB 4JRYA 4S0TD 3MV9A 4QYOA 1OSZA 1RZJL 3C5ZB 3DX9B 3GKWH 4Y19E 3HZVB 4NKDA 3WJLC 4C4KO 1IT9L 4ZQKB 7FABL 4Y1AE 4GG6F 3DBXA 4OZFB 4IOSD 3MRCB 1JPTH 1MI5B 1DANT 1MLCA 2ZPKL 4RWYH 1MREH 3CNKA 1ODAA 4DUXA 1W72L 1ZANH 4KUZL 4QRPA 3RPIA 4MNHB 1YQVL 2EICA 1R3JA 5E9DA 3VXSD 3VD4A 3OAUH 2COQA 1ITCA 2XYCA 3U0WH 1ACZA 5E94B 4WI4A 1A6TA 4M61B 3STLA 5IMLA 5MI0B 2BVQA 3LD8C 2HRLA 1CFSB 1I9RH 5FYJL 5KSBE 3MUZ1 1G7JA 5DS8A 1IQWL 1RZGA 3KPRE 1WIPA 5B22A 5BRZD 3W2DL 3MLWH 3QEUA 4PRPD 3BESR 4KAQH 3TCLA 4OTXH 5DZNA 4OD3L 5TQ2L 3SN6N 4L3EA 4WCYL 1T83C 1WITA 4P5TB 4UNVA 4CU7A 3HHRB 1UYWH 2V9TA 3G08B 3ARGA 1BQHG 4L4VB 4WFEE 4B5EA 4G5ZH 4TVPL 1WEJH 3JTTB 2FATH 1YEEH 3DIFB 5I1AA 4NWTH 1KGCE 1ZWIA 1QBMH 4PGDA 3VFTA 1TZGL 2AVGA 4JDZA 1N64L 1I75A 1XH3A 4J3XA 5J1TC 3DURB 4LSQH 4PJ7A 1P4BL 3BT2L 4ZPTB 4CMHC 3UTSB 3OJDB 2V2TB 3W39B 3DVNA 1N6VA 1NBYB 4X5XB 1E4XL 2FX7L 3UTZB 1P5VA 4MNQB 4G42A 3HAEG 4YXLH 1YEKL 4PJ9C 4OKDA 5I1EL 3BI9X 2R2BA 1U8JB 2D9CA 5INDA 4OZ4A 1JPSL 4XHJD 4RCAA 4Y19B 3QRFM 3W0WE 1I8IB 2HT4C 1P84J 5IUSA 4S1SL 2DI7A 4APQD 5DK0A 5SX4H 1BD2B 2BVTA 4XGZA 4HULB 3PJSA 3JV4A 4YUEH 1D5BB 3TBWA 3T4YB 1F42A 2E9JA 4XAWH 5DVMA 4XMLL 2EYSA 5J0BA 1NEZB 1CE6A 5HHOA 5SWZE 4NHUB 4W81A 3O3EB 5F7YC 4DQOH 5EOCH 1WFTA 3DROA 3QDJA 2VLJD 1ZHKA 1HWHB 4JO4H 3R8BB 4OSUH 3P4MB 4NQXA 5DLML 1NANH 1QR4A 4Z8FH 5D9SB 1AGCA 5IHUH 4KHTH 2EYTA 2K9UA 1MQKH 4TULH 5DRZB 5AAWA 2EC9T 5DUML 2PXYB 3KYOA 2RAMA 1FVEB 2VC2L 3RY6C 5IW3A 4Z7VB 3HLAA 4FP8H 2ZOLA 3FN0L 5DHYA 3OKNA 3TM6A 4Z7OF 5GRVL 4X6CA 2A0LC 5F70A 3QWQB 5J6HA 3VFWB 1T7WA 4OD1H 1N0LA 1MVFA 4UMGA 4JM2F 1ZE3C 3UC0H 3VDCA 1JHKH 1NDMA 3GSOA 1LK3L 1OSPH 5E6IC 4LDEB 2EYRB 3HR6A 1FAIH 5C0AE 3QWRA 4UTAL 4J7RA 4WVRA 1BVLA 3QJFB 1RULH 2GT9A 1S9WA 2CKNA 3EAKA 3K80A 2E7MA 2PTUA 2Y25A 2IFFH 4LEXH 3GJFK 4PLOB 1KLGA 4DKAA 2VXQL 1EIBA 4CNIB 3LS5L 3ULVH 4KKBC 5F7HA 3HS0B 3MRBB 5E5RB 1BQLH 1HHGA 1XIWC 2PYEE 3D85D 4TQEH 1HYRC 5D7JA 2EIZA 2CLZB 3GMLA 4KROB 1ZHNB 1OD9A 4DJMA 5HGHB 43C9A 3KXFB 3IF1B 4JFFA 2X09A 2IALA 3U1SL 4GMTH 1FVDA 4NRZA 1FNGB 3IXAB 3MJGX 1NBQA 2BNQB 2GJ6B 2Z91A 2B8OT 1LNUA 3O45B 1ZVSB 3GO1H 3RUGB 4N0UE 5DUPH 2I9TB 2H3NB 4XI5D 3CFJA 4I18B 1WC7A 1W8OA 4L1HA 3TYGH 2PCPB 2RB8A 1RD6A 1B0GA 3DXAA 3RWHB 5J9PB 1J5OH 4D0BA 1JTOA 4OLEA 2HRPL 4JG0L 4K3JL 4N0CC 3SPVB 1CGSH 3IDUA 4LEOB 3ZKNC 3TO4D 3G04B 2CDEB 1CT8B 2VISA 5DEGB 4F9LA 2HT2D 2NY0B 3OAZH 4Z7WA 3SGJC 4AH2B 3LEXA 4ZNEE 1F3JA 2ADGA 2L7UA 3B8YA 2XICA 2H32H 2VDKL 1WBZA 5JHLL 1NH6A 3CIQA 3OF6A 2JJUA 4RGOL 2X4SB 3V0WH 1FZOA 4NNXA 2DAVA 1RIUH 3ARDD 5E2VH 3GGWA 1AIFA 1HYSC 1L9MA 4XMKH 3H9SB 4ORGB 3VCLB 3PWVA 5KSAC 1A5FH 4DKFL 3IU4L 3HR5B 1AGDB 4WO4D 4TTDC 2CLRA 4H1LB 3BH9A 4EBQH 2H41A 1GOFA 2CLVA 4P57B 5JOFA 2JB6B 4HS8L 2HWZH 4IOFD 3WHE1 3RIFF 1EUTA 1FH5H 2ADGB 3B2VH 1I7UB 1IEAB 5ICZA 3DYPA 4M8QB 1WGOA 3B83A 1YZZA 3H7LA 4ZNEA 2XTJB 4Y0GA 3DMMB 4N68A 2AXFB 3VDAA 4JGUA 3B2UD 5MERB 5INCB 4JCMA 2NY2B 2Z8SA 4XVJH 2XWJA 1GXEA 5MEPA 2O5ZH 3IJSB 3TT1H 1F11B 4QHMB 5C0BA 2G2RA 3P0GB 3GIZL 3WN5B 4XCCH 3MCLH 4HK0B 4ZUSA 1DSFH 2W07A 3DVGA 3MRNA 3WKML 3NZHL 1DP0A 1NAMH 4LCYA 2CR3A 6FABL 4J12A 3ULUF 2C7UA 4UIMA 3TBVA 3QDHA 3S35X 1T0NA 5EU7E 1RMFH 3KYKL 1MJ8H 1UWXK 3RWJA 4GAJL 1RIHL 4CVXA 1PG7L 3KLDA 2XY2A 2J8UE 4BFBD 2VZOA 3OKMA 3FOMB 3VFMB 1DVFB 2YA2A 3MRDB 2DKUA 3UYOD 2FECI 3PWPE 5JOEA 1VGEH 1MLBA 5FGSA 2VITA 4YDJA 3I3BA 4WGVB 1SYVB 4GAYA 3HNTH 1DN2A 3LKRB 4XHJC 2GCYB 1J9CT 2Y6SD 3AU1B 5GISH 1NCAL 4Q0XH 2JJTC 4KK5D 3V6BR 3ARED 4C56E 3OL2A 4OCNC 3HR5A 1TQCB 1JPTL 1Q72H 4MDIA 1TETL 3PWUB 3QZWB 3JWOC 2E9BA 5IFAH 1UVQB 1NL0L 1IAIL 4LCWA 2R2EB 5J6HB 3PG2A 1U9KA 1N2RA 1U8NB 3JV6A 1E6JL 1UM4H 4F7PA 4LNRB 3V5KA 2EDYA 2WBKA 2YD7A 1JFQL 2AEPH 5D2LB 3G5ZA 2NYYD 2ADFL 1GIGH 3O4LE 4XNQA 3KR3H 3CXDH 4M7LL 3MV01 4CU8A 3PWLB 3NFNA 4NO3A 5BQ7A 3MLWL 3Q0HA 3DX8A 3C2SA 1L6XA 4YDVA 5TFSH 4GLRI 1MI5D 4YLQT 4PGCA 4U1GC 5HHME 1NLBL 4XMPL 2EO1A 4GXUM 1YJDC 3ZYJA 1RJZA 4RAVB 3ARFD 2WWMC 3QH3A 1TVBB 3THMH 1CK0L 2MQCA 4Y2DA 3MXVL 2BVOA 3N9GL 4GRMB 3VRJA 1NANI 5I1GH 1G7PB 4QHKI 4QT5B 5D1ZC 4JRXE 1KCSL 2YS4A 2VQUA 1CICD 3NH7H 1BAFL 4Y5VC 3UROR 3RY4A 5EUKB 1QACA 4KRPC 5F96L 1RY7B 4UZGA 3KLHC 3D18A 4XP4H 3W81A 4FFYH 1G6RL 3T4YA 5FDWB 1CDYA 2PTVA 2MKLC 35C8L 4HGKC 5K33A 5DRNB 1DBAH 5K9OA 1X5KA 1IARB 2OMBA 4MNQA 4PJXE 3IFNH 5JIPA 1R3LA 2W60A 3ULVD 1X5HA 3DYOA 4OZ4B 4F8TA 3UJTL 3VD9A 2A77H 1UM6L 4LLYA 5D1XD 1ZHLB 5DFVC 3ZT6A 2X2YA 4JQIL 3CLFL 5DI8B 5IMOB 5CINL 4P48A 2EXYC 4YIQA 4HCRA 3VFVB 4H5SA 2BOBB 2VYRE 1XF2A 3ZSTA 2X4SA 1S7XB 5TE4H 4B0MM 1D6EB 3OMZA 5EOCL 3IJYB 1KACB 4MCYB 1U3HD 5DHYB 1YEDA 4ZAKB 5JW4N 3B9VA 3AMLA 5EO1B 1RZKC 1RUML 4AM0A 2VZSA 1DBKH 1CICB 2QQNL 4U6VL 3O8XC 3P9MA 5I71B 3VFRB 4D0CA 1K4CB 1VADA 3U82B 3HE6B 3F62A 3WNPA 4ETQB 4LASL 1JK8B 2X1WL 2ZCHL 5HHMB 1TJGH 3Q48A 2CO7B 5DS8B 2ZKHL 3QUXA 2J4WL 1S7QB 2Z31D 3BISA 4YHIB 1UM5H 3EOTH 3S37L 4DN4L 1JGUL 4JFQB 2VL5A 4YC2C 2D7NA 4EUPG 3S36L 4JRXB 4OD3H 3TN0D 1J1XH 3DUUB 5KVFL 2VDPL 1LD9A 4MDIB 2CK0L 4RGNE 5I2IB 4LRIC 3BGFC 3S4SA 4CVWA 3EOBA 4OCWL 2BC4B 4IIQB 2J12B 4L1DA 4LEXL 4NNPL 4RAUA 4M93C 1QSFB 3QDGB 5T1LA 1INEL 5JHDD 1LO0L 4BZ2L 1AGFA 5T3ZH 1MJJA 4XC1L 4WI5A 3BQUA 3MA9H 1OAQL 5LCVL 4HKBB 4A6YB 1P7KB 2AJUH 4JY5L 2FGZA 5FKPB 1DVFA 5EBGA 1F8TH 3TT3L 5IG7B 3PWLA 4LPCA 2A38A 4NO3B 4JFXA 4Y5YC 3LN4A 2HKFH 3E3QE 1J1OL 3UJJH 3MLZL 5F1IB 2VTFA 2I24N 3OB0H 4LP4A 4KJQC 1QLEH 2X4UB 4GRLD 5FIEA 4XP6H 3HZKB 4XNMA 5HHPA 2E6QA 1BOGA 4GRLA 1U8PA 1SBSH 5DMGD 3W39A 3ARFA 3QEGH 2HA1A 2VIRB 3RX5A 2GJZA 5GRYA 4XAWL 1RHHB 4XNUH 5TPWL 5D2NB 1T5WB 4LSDA 4OV5B 2J6EL 1Y6MR 3N1PC 4KK6D 2DQGL 4KWUA 1CGSL 4V1DB 5ADOH 5ID0A 5EFIB 3QIUD 4UDTA 4KV5F 4P4KD 5E1AA 5MERA 4PBVC 3VMOA 1NGQH 5C9JB 2IANA 3RNKA 1RI8A 4APQC 4MWFA 1PY9A 2FB4L 2VLRE 3SDXF 1GHFH 4M6OL 5FM5M 3HI1A 1CG9A 3D0VB 1F4YH 5DD3L 1C5BL 4R8WH 5JDSB 4M7KL 1S5HA 4QHUA 2AJVH 3F7PC 3CU7A 4PG9A 1JV5A 3RFZC 4JHWH 1ZA3A 3VFPA 4JY4A 3C8KB 4HDIB 2NY1B 2NNAA 4QWWC 5I19H 1IFHH 2Q3ZA 2EEAA 3BKCH 1BP3B 3MREB 3DXAE 1HDMB 3UAJC 3QDJE 5C71A 5C0AD 3CDCA 1BM3H 1QSFE 2FGWH 2HWZL 3OKYA 3QDGE 5FO7A 3ULSB 3IDYC 2IAMD 5L88H 4LBEA 3KPMA 3QUZB 3LHPL 1XGRB 3MV8D 4MD5B 2FX9H 1A9EB 2WBWB 3R8QA 5GZOD 2UUDH 5HDQL 5BS0E 5I1KL 1FN4B 3KHOA 4PTUA 3TA3B 5CJBA 4LKCB 3D39B 3GMNB 2HFGH 1H15B 3GK8L 3UDWA 4N5EC 4OZIF 3C2AH 3QUKB 5A2KH 4KK6C 5HSFA 1D9KA 2RFXA 1CU4H 2A9MH 1YPZE 5KJRH 3JUYA 3F7YA 1H5BC 5DMIL 1B3JA 1EXUB 5KSUA 4QXWA 5I1DA 2YXMA 2K1MA 5EWIL 4G8GD 5JA9A 4E5XA 1KNOB 2R29H 2VKWA 4YHNA 4Z7UA 3VGFA 3C5JA 3MJ9L 4WO4C 3S36X 3SHSA 3KPQA 4ONOA 4DUWA 4FQXC 4UQ2A 2R56H 5C6PB 2NY4C 5CP7A 1MCOH 4K7PX 4KRNA 1A4KA 1S7RA 4JVWA 1JYWA 3DARA 1G84A 1QZ1A 5I15L 1P6AB 4P4KB 4L8SA 1YJDH 2KDGA 4PJIF 2ADJA 2AQ1A 4O00A 2VDQL 2WUBH 5JMRA 2X4RA 2WBJC 4LSVH 1U95A 5T3XE 1I1AD 2CR6A 5E9DB 2QSTA 3WSQH 5TDPB 2OL3H 4PJXA 4MLSA 4UV4L 3D0LA 4LSPL 1SEQL 2WMPA 2AXGA 4YH6A 2A6IB 1SMOA 5GS1B 4C57C 4WY7L 2FO4B 2P7TB 4K07A 2VOTA 2NY1D 4WHYG 5FUZL 3DXAB 2VLJE 3C5ZC 3RWHA 4DZBA 5J9PA 5L7XL 5ILTL 1NKRA 1J8HD 4KMQA 4Y5XA 4GG8A 4I5BB 4HKZB 4M7JL 4OQTA 4PJFB 4QRPE 1CXIA 3V6OA 1NQBA 3OKNB 2ICEB 4OFKA 2NW3A 1A6VH 1FFPB 2ITCA 4JO1L 4PRNB 5GGSY 3V6ZA 5KG9B 3MRJB 4FXKB 2BX5A 1BEYL 5C6TL 1EMTH 2ERJC 2Y36L 3SE3A 1D5ZA 3O0RH 3U0TA 4IIQA 2EIZB 2WP3O 4HBCH 3HN3A 1ZKAA 4RBPK 2RFXB 3GJEB 4LGSB 1CXLA 3RAJH 3H0TA 4Y2OA 3ZKSD 2WBJB 3E1F1 4YXKL 1LO4L 4HEME 4WUKH 1IC4H 3ZDYE 5CGMA 2CGRL 1J18A 2FR4B 1YEGL 1P9MC 2LV4A 5CSZB 3KNBA 5HGAA 3SBWC 2J88H 2PYFA 2ZUQC 5D7SL 2BHYA 4LCWE 3MJ6A 1GGIL 5IB3A 4BQCA 2NCMA 2Q8AH 1JK8A 1MCFA 2WLZA 3CZFA 4PJ7F 1EEUA 5AYQA 5DD0H 1QBAA 2CRZA 1ZTXH 1HH9A 4D0CB 4NDMA 3TIEB 5HI5C 3VFRA 5C0CB 2YKLL 4HIEB 3KYKH 5AZ2L 4LCIL 4ODTL 1RFDH 4IOIB 4CVZB 2DD8L 4WHCA 5JQHC 4ZFOL 1XZ0A 4HK3J 1AXSB 3FMGL 2Y9RT 5CEZL 4PTUB 2BNRB 2BVPA 3LB6D 3QFJB 4O02H 3SO5A 3HNTL 2C1PA 4POYA 1INQA 2A6DA 2FJGA 1MNUH 3UO1H 2BOBA 1HZHH 4Q9RL 1X5YA 2NY5H 3B6SB 3AGVA 4FA8A 1X6NA 5BJTA 1W72H 1GC1H 1ND0A 3Q5OA 4KUZH 1YQVH 4JFED 4P23C 4PV8A 1QSED 5ACZA 4JFYA 2CD0A 2OK0L 3VXPA 4WI9A 4NZUL 5ALCH 1MFAL 5KOVC 5F7DB 3CUPB 1QD0A 1U8PB 4OF7A 3VXRD 4JFPB 3O45A 3OKEB 3L3JA 5DD6A 2R9HD 2JLLA 3BPLC 2H32A 1MQ8A 4KZEH 2F58H 4Y1AA 1B4JL 2WQ8A 1S5HB 3TZVD 5ACLA 4MJ6B 1DQLH 2HT3C 3G6JB 1SY6A 4Y19A 2W9DL 1IC5L 2R4SL 2ZCHH 4JFXB 4O5LH 5IHZA 3F7VA 4RMSA 4Y4HD 3HC0A 3PQYA 1PYWA 2X70B 1ZGLB 3EYOB 4UOW0 4ODHL 1CGTA 3M1BA 1F3RB 1NJ9B 3GHEL 5CJXC 2JCCA 3OKDB 2E27L 1QP1A 4GG6B 3TF7C 2CH8A 1FZMA 1PJ9A 1BQSA 2OBGA 4LP5A 1UQSA 4J3OC 5GRUH 3CFKB 3HZMB 1MOEA 5D2NA 4P3DB 5E5MB 3WN5C 5JA8B 1RHHA 1OGAE 2VLME 5D7JB 5JPMA 4CN4A 5EDXA 2C4XA 1JL8A 3DECA 4LPWA 1HKLL 1ED3B 2YPVL 5I1AB 4KTDH 5F3HB 4Y1AB 1AGBA 2WP3T 3QJHA 2BXYA 5E2TL 2R8SL 1E6OH 3WNNA 2Y06L 4RGMB 5GZOC 1JGEB 4FQLL 2ZG3A 1YEKH 1AR1C 3LEVH 3P9WB 4AIZA 1KTDA 2FIRT 2LU3A 2P8MB 5C07E 4FOMA 4FRWA 1S7TB 4OZIE 3QEQD 1A3RL 4WWKC 4NQCD 1EBAA 1ZLVH 4FQXD 4TUJB 1XGQB 3QEQE 2QHLA 2ZCKL 4KMLB 2RQ8A 4X4XB 1T66D 1M7IA 3RL2A 5HVHB 5L2JB 4MJ5A 5E99L 1EX0A 4PJBF 1MCBA 1AP2B 5TF1H 5DK2A 5KANI 4QRUB 4R97B 3QEGL 2HG5B 1A8JH 4JQIH 1QVOB 1T89C 3PNWB 4ISVB 4XB7A 1AGEB 1L7IH 2DQDL 4QRTA 3F7RA 2HN7A 4JFFD 4LARH 5D71L 5EZJA 2NY3B 2B1HL 4AQ1B 1PZ5B 4FXGA 3T2NH 5GJSL 4ZUTA 4S2SB 3O6KH 3VXRB 3DNKA 1EA9C 4PY8I 3DMMD 3OAUL 5D1QA 1QLFA 1XT5A 3FT2B 5EB9A 5KVMC 1J8HE 5I8OH 3QO1A 4U1LA 2QTEA 1AC0A 1M7XA 2P1YA 3S35H 1MCWW 2BJMH 4DTGH 4MAYD 2OR9H 3FT4A 1JRHL 4QY8A 3IDXL 4WI3A 1TZIB 5ACMA 3B5TA 5HBBA 4YHOH 3K3QA 3QB7C 4Z7UB 1FBIL 3F12A 1CVSC 1FO0L 3VWKD 1ZAGA 3INUH 2HTLD 1I8IA 3EYVB 3L6FA 3ZE2E 5CP3A 4M4PA 3VFOB 3ZKXB 1UZ6E 2VDRH 1K5NA 3WIFB 4H0GA 4MDJA 3BGMA 2DL9A 3T2QA 1GRWA 1AI1H 1IGYB 5I6XB 4YFLI 5LBSL 4XCNA 4FQ1L 4U05A 4RGND 2R1WB 5L88L 2VDPH 4OFDA 1NC2A 5IEKA 1AY1H 4S1DC 1CFVL 4CL7A 3O9WA 1OTUC 4MJIB 2V5RA 1YEJL 5H37G 4YEFA 1ZVYA 2LQRA 4XPAH 5H35B 1CLOH 4PBWD 4OQ1A 3LSOA 3ZMRA 3EKCA 2F53A 3OJ2C 5ESVA 5JO5A 1IEBA 3IT8D 5GGUA 4UB0L 4AL8H 4XC1H 2A6JB 1X5FA 4OZHF 1TNMA 1ZHLA 1A3QA 4YR6A 1PKQB 4IIQC 4JN2A 4WEBH 2OZ4A 2UWEA 4YDLC 1ZLUK 1A2YA 1JJUA 5E4IA 1ZSDB 3SDAB 5DQDL 4HIEA 1YNTA 3ZE0E 1TENA 2FZ3B 2OP4H 4MAYC 4OLWL 5FAAA 4HFUL 3V6OC 1T7VA 4WEMB 5ESQA 2WAHA 1JGLL 1NBVL 1YC7A 4XP6L 4CN6A 3QUZD 1J5OL 3H9ZA 2LABA 1ACYL 1BPVA 2O5XH 3A6BL 4WWID 2BVQB 3FB6A 4A6YH 2F54E 1OAXH 3VXNA 4HUXA 4NKDB 1UJ3C 4XNUL 2VAAB 1R5IB 4H25A 2X40A 1HXMA 1X5LA 3EO0B 3WSQL 1U8QA 2CJUH 3TN0B 3OKKB 4P2YA 4OGXL 5T3ZE 2QADC 5HTSA 4WTZA 1P7QB 2AP2A 3WHE0 2EH7L 4ODWB 5T3ZD 3OSKA 3RPKA 3H42L 3S4SG 3T8XA 1ONQB 3T0XA 4YGVA 5T5FL 4ACPA 4XMKL 4MYWB 1F4YL 3TN0C 1A6UH 2H2PD 3O6FA 4PJCB 2AXHA 1K6QL 3O6LH 3WS6C 4R7DB 1LE9A 4OLYL 3TZVC 2AK4A 1AO7E 3HAEA 4I0PD 3EO1A 4BSVA 3KJ4C 4N0UB 4RZCB 4Z0XB 5TE6H 3WO4B 1MJJB 4LSSL 4LHUB 1J1PL 5CEZE 1RJYA 4LSUL 1A22B 3DWTA 4D9LH 4F58L 4HBCL 3DV6A 2P24B 3TVMD 3O8XD 1OT2A 1KCRL 3SE8H 4KXZI 2O5ZL 4Z9KB 3C8KA 4P2OD 4DGYL 1UJTA 2H6PA 1YN7A 3D5OF 1F3DJ 1KPUA 4P5KA 1YDPB 3NZHH 5MENA 1MELA 3CMOH 1F4WL 4NN5C 5AYUL 4Q6IB 4KKBD 4MZ3A 1I8KB 4XMLH 2VL5B 5E08H 3MJ8B 4NO2A 4JPKL 4HC1H 5IM7B 1QNZL 1IJ9A 1DANU 3UBXB 1TZHB 1MCPL 4B7IA 3OXSB 3RP1A 1KIQB 3BRGC 3WDJA 5BVPH 1G6RB 1C12B 4NO0B 2BRQA 4XCFL 1CGUA 4R4FL 1MAJA 4OAWB 3P4OA 5E2VL 1F4XH 5DJ8A 4TPRH 5EC1B 4GW5B 2DYPD 2D31A 3NCMA 4HIHB 5KBNC 5IK3B 3BGAA 3L7FB 3K1DA 2VC2H 3SDCC 1WVZA 2CRIA 3WHXB 3DMMA 3FAWA 3JWDL 4R7NB 3GKZA 3NCJH 3S98A 1L7TH 3WCYA 1TETH 4M00A 5EBMB 3GB7B 3H3KA 3BZEB 3X12A 1B0RB 5D7LE 1MAML 2XFXA 1BD2A 4HS8H 4L29A 1FGVL 4RFEA 3NCYS 4OCRL 1RZ8B 4N8CH 4RNRA 1E6JH 5JLZA 3DRTA 4UTAH 5ITFA 5F7UA 1HDMA 5L6YH 1AGDA 1KXTB 4ZPVA 1ZV5A 1JGDB 3KPMB 3GMRB 4DWHA 2X1OA 2G5BB 3KR3L 2KPNA 4G7VH 4YFEA 4U1NA 4NP4L 5C2BH 1QFUL 3LS5H 1IQDB 3L95A 3BO8A 4M6NL 3V2AR 3U36B 3S6CA 4M48H 5T3XD 3WXVH 1GGBH 3BHBA 2Y07H 2I27N 4OLZH 2VKXA 4J4PC 1JZ3A 5CILH 2ICCA 4LHJB 3DUHA 3IDIA 2V5TA 1KJMA 1KPUB 1LO2H 4XZUA 1RVFH 2XY1A 3DX6B 3LKOA 1Y6KR 3U83A 1DFBH 5IROC 5E56A 1YNLL 4S11A 3MV11 1IEBB 3BEWA 4QNPF 4LSTL 3MCLL 1S8DB 1C16B 1FNHA 3TH3T 4LLAA 5H35A 2D0GA 3MO1A 1KYOK 1MCDA 3NFSH 1E6OL 4OCXH 4NRYA 4JZNB 1A6WL 5I66A 4LVOC 4X6DE 3TV3L 4PJEA 5D5ME 3EFFA 5J3HD 4JG0H 4BSVB 1FNGA 3B43A 4FZ8L 2HJKA 2LU4A 2X4QA 2Z35B 1RIHH 3WD5L 2W65B 5GS3A 1I1AB 4JQVC 4KAQL 3PQYE 4OTXL 3G5ZB 4OLUH 1UH4A 1BOGB 4GRLB 4P9HC 3VFOA 4PY8J 4ODSL 1WAAA 4UNTA 2H45A 4CRPA 1CFBA 1KCLA 4FG6D 1SM3L 4XCYA 4G5ZL 4TVPH 3BQUB 1MFEL 4K3EL 5IMOA 1JWUA 5CSBA 4CNIA 1MIMH 2CLZA 1HCVA 3GMLB 4JZOA 5IB1B 5IT2L 4WJ5A 5IFHL 4JRYD 5D1XA 5EO9B 1NEZG 4ODWA 5C0RH 5D9SA 1RPQA 1EHLL 3T3PF 4YDKH 1QVOA 3TN0A 2WLYA 1Q72L 3ARGD 1QSEE 4KY1H 1SHMA 3I50H 4M7LH 4EIZC 2ED9A 1FL6B 3D3VE 4YXLL 5LXGL 3PGFL 4OFVA 1NFIB 1MHPL 2H2SC 5CBEB 1AD9B 1KCUH 3Q1SH 3FO0L 5AZEH 4JZJB 1ZLSH 2Y6SC 5J12B 2DJ4A 1T66C 1NDGA 3L3JB 4H88H 4X8JA 3QDMD 5KOMC 1HE7A 3T0AA 3QAZC 4JR9L 4Y4FB 2EXWD 4P3CL 1F58L 2YOCA 5IMKA 4G80A 4PLJC 1PEWA 4OAWA 3CXDL 1QOKA 1JZ8A 3T0ED 2I60H 1LWRA 1SY6L 4N0YL 1TPXB 4QXTA 3QUYD 5M7QA 4EUPH 3CPLB 4HGWA 1S7QA 1FO0H 1BBDL 1QPXA 2GK0A 2IAMB