5IVXF

Crystal structure of b4.2.3 t-cell receptor and h2-dd p18-i10 complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
234
structure length
234
Chain Sequence
MKVTQMPRYLIKRMGENVLLECGQDMSHETMYWYRQDPGLGLQLIYISYDVDSNSEGDIPKGYRVSRKKREHFSLILDSAKTNQTSVYFCASSLGHTEVFFGKGTRLTVVEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVCTDPQAYKESNYSYALSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-D alpha chain
publication title An allosteric site in the T-cell receptor C beta domain plays a critical signalling role.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 61
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2016-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ivxF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ivxF02
5DRWB 4W81A 4GAGH 4PJXF 4GAJL 3SE9H 2CRYA 1UXWA 5EUOF 2YK1H 4JY4A 4XP4H 3SKOA 2VLRD 3CFJB 5KTEL 3LB6D 3GMLA 1NGXA 4XRCA 5CSZA 4F58L 1QSEB 5J13B 2CIKB 3ULUD 2Q8BL 3TV3H 4HJJH 4A6YB 1EXUB 3VWJD 3TZVB 4I0PA 4X6FA 1JZ5A 1KTDB 4FABH 3V79C 1QVOB 5F71A 2A9MH 3T0EC 3HG1D 2RQ8A 5GS0D 3IGAB 4OCNC 4U2ZA 4KVNL 1QQDB 1QSFD 4TULH 3FCTA 2H2PC 4NQCE 1IGCL 3ZSSA 3VXRD 3PV6A 4QHLB 5GRZA 2O5YL 2DMKA 4W68A 1QRNE 5F89A 1U6AH 1RHHA 3WDJA 1G7LB 3HUJF 1TETL 5GIRB 3MXVH 3HAEG 1FFNB 1LK3H 9CGTA 1CN4A 4IRJA 5HGGS 3V0WH 4A6YL 4C54A 4ZAKA 3GBLA 1ZVYA 4BUHA 2IQAA 2B7DT 4HZLB 5DRZB 2L0DA 1KENL 3GMOA 4NQDD 1MFBH 5GISL 2BVTA 3BRDA 3I85A 1LVEA 1PZ5B 3NFPA 3ZO0A 1V7ML 5C0CB 1E28B 3VRIA 3T0VA 5B38G 3LOWA 3GSQA 3KXFE 2BY2A 3TVMB 2Z31C 1AGDA 3U30B 2GJ6E 1Y6NR 2YC1A 4QCIA 1S9XA 5C08E 1I1CA 4HD9A 1NSNH 3TCLA 5E5RB 2WIIA 4NSKB 3QUYA 2IAMD 3JTSB 1MJJA 1PAMA 4HPYL 3NTCL 3B8YA 4JN1L 1X5LA 5TDOA 5LGHH 3MV8D 2EECA 1WAAF 2R0LH 1RFDH 1JMXA 2VC2L 5KSBB 4UMGA 3IFLL 1KTLB 2J88L 4BFEA 3T2QA 5T1MA 4ZMAT 5IV2A 3L3OA 3SDDC 4UIMB 1T2JA 4NT6B 5GGTL 2CLRB 2E7MA 2OQJA 2HJKB 4PJXE 5FEBA 5F7KC 4WO4B 2XRAH 2CK0L 3CVHB 3IFPB 4PJGF 4I3RL 5F97E 1Q8MA 6CGTA 4WFFD 4GJTB 2M8XA 4OFYD 4OQTL 43C9B 4S1DC 1HN1A 4AL8L 5DI8B 1N59B 4JO2H 3LN5B 1ZEAL 5EC2B 3D25B 3L5WB 2C1OA 1U8LB 4G80A 3OB0K 2HMIC 2OJZL 3MBEB 5MEOA 2I9LB 2VRAA 4MWFB 5JPNB 4ZNCD 2DM7A 3FHQA 3V5DB 1ED3A 4HXAH 3O9WA 1A1OB 3ZKMC 4MD5B 4WUUA 1ZOXA 2MOVA 1NCCL 1BZ9B 4MD4A 1Z6JT 1CG9B 1B0RA 3ZE2E 2LQRA 1QKZL 2YHGA 4FXGB 1RUQL 1JN6A 4PG2C 1CD0A 3QYCA 4URTB 5I19H 4Z7QE 4YPGB 3ZE1F 1P7KB 2DBJA 3HUJE 3E6HA 5FUOH 2QQQA 5F6HJ 5JZ7C 4JQIH 2P49B 4R7DA 5CINL 4LSSL 5DQ9B 4BK5A 3WIIL 3QIBD 1JGVH 3ARGB 4X8JA 1KJ2B 1O7VA 1NBYA 3RA7H 3TBVA 3MJ8A 5DJAB 4J1UB 3H42L 4IDJL 3S4SA 1AD0A 4LCCC 4G8GE 4ONGH 4PJ7F 4NQED 4K2UH 2JK5B 3AC0A 3EO9L 3RVXD 3ZKND 3BYTA 4OB5L 3TN0B 3T0EE 2A1WH 5T5NG 4U33A 2WW8A 4MXWH 1VGKA 2J7LA 4OGAD 2YS4A 3TNNA 3REWA 3HMWL 1QBML 2I5YL 2CGRL 4FMKA 1MH5A 4LIQE 3HB3D 4RISH 4PRDB 2FX9H 3QDGD 4PJ5B 3K8MA 4LKXB 3BZ4A 3KPRA 4Y2DC 4Z9KB 1T83C 2X4OB 1HZHH 2X1WL 2EDRA 1T7VA 4LSRH 4PRHD 1C12B 43CAA 4GQ9H 4DEPB 1YA5A 1EO8L 3RWGB 3WKMH 3U0TB 1P9MC 3UO1H 4JFEB 3IDYC 1GVIA 4WI5A 4ZNEA 4YBQC 2ZG3A 4P46B 2VWEC 3EO0B 4NZRL 3C08H 3EYOA 5HVWA 3RKDD 5HI4D 4U6XA 2B4CC 1KXTB 5FECA 5HPMB 1KEML 5DO2C 4WJ5A 3GM8A 3BP4B 1AGBA 1IGJB 4LLVA 3HNTL 3PP4L 5F7DB 2RAMA 5CLWA 1EGJA 3MA7A 4OCXH 5DDHB 5T1LB 2EDEA 4YJZL 4JZNB 4KHTH 1SYSA 1MRFL 2ZSVA 3WXWH 5LCVH 3O6LH 1GOFA 4JG1H 2MQCA 4EVNA 1E4KC 2Y06L 1S9YB 4ZO8A 4YUEH 1YMMA 3JBG7 4NC1C 2A83A 5HYSG 1NCAH 1Q0XH 3B9KD 4V1DB 1I1YA 4YC2B 3ZE1E 1A6VH 2BNRA 5GS3A 2YBRA 4X5WB 1ZLSH 5IW1A 4RGMB 4IMKC 5EUOB 5GJTH 2ENSA 1UA6H 3LDBC 1MCFA 3UDWA 5HHPA 1IEBA 3D9AL 3T4AA 2F54A 2H2SD 4X80H 3O2VH 4O2CA 4GXVL 3B4NA 3T0DA 1HHJB 3BT2L 5DVOA 3PGDB 2RR3A 5I8KH 1XCTB 3WFZA 1E6OL 3VXRB 1J8KA 1S7RB 2QKIB 4I3SL 5EO0B 2X2YA 3TNMA 4XCYA 1K3IA 3VXPB 3T4YB 3NA9H 1CICB 3QEGL 4XNXL 1W0WB 3VWKA 4PTUA 1QFPA 3VFNA 1NMCB 4Q0XH 1JYXA 4LK4A 4XHJD 3MYJA 2NY6D 4N5UA 1U92B 2YPKA 5DHXB 4WRLA 5E56A 1HXMB 2OTWA 4JKKA 1GGBH 4MQXD 4MSWB 3G5VB 3LCYA 4F37K 1FZOB 1YPZF 3VFMB 4JFQA 5ALBH 5E5UB 2LAAA 2ERJC 2V2WA 1FH5H 2BY0A 5GS0L 5EBWA 3CSYA 1S7WA 2VLKA 3G5YA 1BQLH 5GZNC 1VA9A 4F7MB 5IFAH 4JDTL 3FRUB 3MV9D 3VGBA 5HVHC 1R0AH 3O6MH 3LKOB 5FXCH 1AGEB 3IJHA 2XPGA 4S1QL 4A6YA 5EA0L 1YN7A 3DUUA 3ZYZA 5FUCC 5ACMA 4LSDA 4P48A 5E99H 5FYLE 2XTLA 4OGYL 5LQBL 2DICA 5A3ID 3H8NA 5GJSL 1XR8A 3INUL 4I48A 2NW3A 2OCFD 1VHPA 3OXSA 4TQEL 1LO5A 5C09D 1NBQA 5CEXB 1WBZB 4X6CF 1VB9A 2YPLE 4P9HH 2Y07L 1QQDA 2VDLH 3PNWB 5K33A 2E9JA 2ESVD 1WF5A 5HXMA 5IBTL 3UYRH 1D6EA 4EQ3A 5D6CA 2VITB 4FS0A 1S5HB 5C8JB 4JB9L 4OLWL 3RU8H 3QCVH 1AXSB 1LD9B 3MLZL 2ZCHL 3VXOA 1P5VA 1OCWH 3ULVH 4I0PC 2ADJB 4EN3A 3WHXB 3KLHC 1LO4L 1ORSA 1ORQA 4KI5D 3CC5B 4PJGB 4GBXD 1IQWH 4G5ZL 4LOUC 4MJ5A 3VE0B 1UKSA 4J8RB 4JFDA 2YD4A 2VWEE 1JTPA 4PJEA 5GGTA 5HHOD 3QI9D 2ZUQB 3CZFB 4OLUH 3HE7B 4J12A 1IGFH 4O51A 3BZEB 2FSEB 1T66C 4KMTH 5J11C 3S88H 1MHPL 1H0DB 3D48R 3HHRB 2IMMA 3K74B 1OARL 3V8CA 3D87B 3NZHL 4OQTA 3U9PL 3IDUA 3KNBA 1RZIA 3TM6A 5L7XH 1TQCB 1RZKH 2R4SL 3BQUA 4CMMA 3LKSB 2B0SH 4ZAKC 4MD0B 1RUML 4PJHB 3RAJL 4NC1E 3LKRB 5JA8B 3WIHH 2KUTA 1A0QL 5J89A 3NPSC 3QIBB 5KSBA 5IFJB 3HR5A 3HKFA 5GRYA 3VFTB 2HJLA 3BJLA 4GG6E 1FAKT 4GKNA 4PGBA 1PJ9A 4U1HB 1F6AA 3CMGA 2GW5A 1GIGH 3ARZA 4N0FA 4PJFA 1GZPB 1INDL 4H8WH 2YMXH 4YX2H 1R3LA 3ZKXB 3R06A 3IFOA 3QUYC 3WFDH 3W5NA 1PSKH 1Y18B 5IW6A 1EV2E 3HAEA 2NY5C 5T33H 4MX7B 5EUKB 3KHOA 2BVEA 1ZHLB 3V0VB 1SQ2N 3NIFF 1ZHNB 3QFJA 1KJMB 3D25A 3HZVA 3WLBB 4EDWH 5CAYB 4FN0A 1NAMB 3QNZA 1CTOA 5I9QB 1PZUB 3MFGB 1AQKH 5IP4A 1KPUA 4X6CE 1P6AB 5C6WH 1D5BB 2BNQA 3MRCB 1ZLUH 4MA1B 5B38A 3ZE0E 3BUYB 4PUBH 1MRCH 4JFHD 4CRPA 4L4TE 4LAQL 3MLVH 1VGEL 1MFCL 1UCBH 2ENYA 4RBPH 1J1PL 3N1GC 1P1ZB 3DX8B 1FNEA 5J1AA 1LP9B 2C3XA 1SM3L 3HMXH 4M5ZL 3SGDI 2DLFH 2PYEA 1AY1L 2VL5B 1DLFH 1UJ3A 4U1KB 1P7KA 3QQ4A 5I1KH 4GMSH 5FCUL 1LO0L 3RRQA 1FV1B 3R4DA 1GHFH 1PYWA 2Q86A 3B6SB 4UOJA 4NJ9H 4DOHE 1C16B 3ROLA 1OT1A 1L7IL 1YNKL 1JF1A 4KKBC 3P0YL 2Y23A 2X4SA 4U6TA 2IG2L 3QJHA 5FUCE 5FKAA 1F4XH 1XZ0B 5MERA 1ZV5A 3O9WC 1GJIA 1DQLH 1B4JH 1TCRB 5EBGA 3V52L 5E2WH 4GSDL 4JKPH 1T4KB 3BKML 3JXAA 3B9KB 3SY0A 4HS8H 3BDYH 4ONFL 3VU2A 3QXWA 3ET9F 5I30L 2C7UB 4OCRH 3MNWB 4QRQA 3VRJA 2BSRA 1YEJH 4S11A 1KIQB 5IESH 5J8OA 1D9KA 3MRJB 2IAND 3K2MC 4OM1L 2X4OA 3BKYL 4GUPB 3DHJA 5LWYH 5HYQA 5IB1B 1S9KC 2BSTB 4H5SB 1IAII 2R1WB 5TDNA 4TNWK 2DQJL 3CLEH 4WU5B 4X7EC 3ALWA 4PTTA 1U8NB 3LEXB 3E6FB 5CHNB 3RWEB 4ZTPH 1T20B 1YN6A 4U4BA 4Z7OF 1HINL 1IILE 3PJSA 2A6DA 1J1OL 2A2QT 4XPHL 2BY3A 3TJEL 5F9WB 5BQ7A 4FQCL 2B39A 1AXIB 1DEEB 2XY1A 4LPUA 2HVKB 3UROR 1NC4D 1YYML 3TBTB 2RCSL 5BVPH 4FXKB 3QEHA 5HYFA 3R0MA 3L3KB 3K2UH 2J6EH 4P5KA 4GW4A 5DDHA 3U48A 2R56H 5C0FB 3STZA 1ES0A 1VKXA 4XX1G 5C7XH 3BMWA 2FBOJ 2IFFH 1CE6B 1WCBB 1R24A 4BQBA 4JHWL 4UDTA 5TFSH 4DZ8A 5IVXB 4PGDB 4K94L 3T0AA 2VLRA 1LDSA 3JWNC 1RUKL 3MV9B 4YBLC 3K81A 4X7TB 3GIVB 2R2HB 4RMSA 3V95A 4OKDA 4PRPD 3VWJA 1ZHKA 4HKJA 4OJFL 1IC5L 3RY5A 4RSVA 2XFXA 1HI6B 3SCMA 3U82B 5JLZB 3KS0J 3TJHC 4PRBA 1CDIA 3GSRB 4YHPA 5I74C 3HG1A 3CFEA 4KRPD 5ESQB 1U91B 3G5ZA 4CNIB 5HGDB 4PG9A 4FQJH 3A6CH 5D2LB 5F44A 4BELD 5E00A 4UTAH 2CIIA 1QSFA 1R3KB 1KNOA 1AI1H 5K9QI 2ESVB 1B0GA 3U4EB 3U4AA 3V6ZB 1J05A 1KCRL 2WZPD 3WCYA 2WBKA 3SGDH 1JWUA 4NHUA 4ZUWB 4MAYD 1A7NH 3O6KL 4QXGH 1CFVH 3L1OL 2APWA 4QRSB 5EZOH 2H9GA 4PJCB 3AMKA 2VJXA 3L7FA 2EH7H 3C9NB 4TVPH 4CBPA 4JVWA 5AUMA 1BAFL 4DKEL 3UDWC 1GOGA 2FO4B 3NCJL 2DF3A 2Q7YB 5BO1H 4LCUB 2Z92A 3FB6B 4NQDA 2F9BT 4QHKI 3QI9B 3RGVB 4G8EB 4P23A 4PS4H 2R2EA 3VFGH 1SJXA 4N9GB 3X3GL 2CO6B 2Y7QB 3E2HC 2PW2B 5HYSA 4Q2ZA 3L3GB 3PWPB 4HIXH 4MCYB 4JM2D 1DQQB 5K9OB 1NCWL 1CE1H 1TNMA 3C5SB 4XCCH 5SWQA 1EUUA 3VWKC 1JZ2A 1KLFA 3RHWF 3KR3H 2IAMA 5T1KB 4HMCA 4HEME 4WUUE 4LSVH 5I1IH 2VO5A 1V3MA 3MV8A 5C0RL 4ODWB 4HIJA 3L3JB 4LASL 2R4RL 3MA9L 2EDKA 2XTJC 1CS6A 3EZJB 4K3DH 3ZTJH 2R69H 3CFBB 1ZE3C 4XWGH 2X4NA 1WSST 3UEZA 2ZOLB 5C0JA 1RJYA 3V8OA 2MCPL 4YFDB 2AI0L 3SGEI 1U8HB 3DETC 5I17A 5F9DC 1MJUL 2AK1L 3SDYL 3S37H 5C8JA 1FC2D 4WCYL 3BPCB 1MVUA 4K3HA 4BSVB 1Z5LB 1ZGLP 3S34H 3OGCA 3X17A 1J11A 4QWWC 3B2UC 1N5AB 4LQFL 5DJXB 3MGTB 1IFHL 3FB5A 4I0KA 3BEWB 3FFDA 3RDTA 3U46A 2UVEA 2ZCLL 3DBXA 4I13B 5CCKL 2XZCH 1BM3L 1S3KH 4I77H 2PTUA 4N9OB 4KROC 3U0WH 4Y19D 3RX7A 5IQ9B 3MROB 5C9KA 3MV7E 3KPRE 3MCG1 5E2TL 1OY3B 5D7LD 5JIHA 4UV7L 4DKFH 3CH8A 2Y36L 3BPOC 5EZJB 4XC1L 4PRNA 1E6JH 1LEKB 4NQSB 2BVOA 4Z78B 3GHBH 4KJQC 5JNYA 2AJ3A 3LKSA 2WWMD 3WKNA 4RBPK 5INDA 2W9EL 4EN3C 1JK8B 2HWZH 1F11A 3MOBH 2UWEA 3DGGA 2CXGA 2Y1VA 1UWGL 4ZNEE 3SKMB 4P4KB 5FYJD 1IZJA 5TQ0H 4NC0B 2XA8L 5ANME 5T3XE 3MODL 2HT4C 4YHIB 4JY5L 1HHHB 1I8KB 3LMJL 4EBQL 2B1AH 4QNPE 3PGFH 5DJDB 2AJXH 4BK4A 4NQEA 1CK0H 4M1DH 4XNYH 4X7DC 2XNAB 3WFEH 2GYSA 3FB7A 5M7QA 5D7IF 1BEYL 1IM3A 2UYLB 4C57C 5BJTB 2PN5A 1MPAL 1XGQB 3BQUC 5AD0A 1MFDH 3QPQD 5CLTA 4TUKL 1WJ3A 5JUEH 1YMME 1RZJL 1C5CH 3LQAH 4DW2H 1QR4A 4YFLF 5DLMH 1FRGL 1FZMB 3QDGA 2I07B 2BNRE 1VACA 4TOYH 1OP5K 2IANB 3BPNB 1BOGB 3DX6B 1OM3H 3MXWH 1EBPA 2AJVH 4RWYH 4PJEF 1XR9B 1CWVA 1V7NL 4Q9QH 2F54E 5DK0A 4OF5A 1VPOL 4PRHA 4O5LL 1T1WA 2YXFA 3CFCH 2VE6B 3FQXB 5LAXB 4MMXC 2ADIA 1WBXB 5CIPB 1A14L 3A6OA 4NQXA 3B3IA 4L8SB 1A2YB 1XF5B 1NLBL 1YC8A 3ZKSD 3BAEL 2Y6SC 5JR1L 3EFDL 2DD8L 1BFOA 4S0TD 2XKSA 4DWHA 3WFBL 4P5TB 3WEXA 3CAFA 3D2UD 2FL5B 3F65A 3S3PA 5JHDA 4KTEL 5EZIH 3FZUD 1MRDL 1NC4B 2NLJB 3KPTA 2VR5A 4JFOB 5EOQL 1G7IA 1N64L 3LHPL 2H1PH 3V5HA 1OLZA 4NM4H 4AIZB 5D1QB 1YEIL 5JW4R 4HK0B 1YEDB 4X0KB 5FGRA 2ZUXA 3SGEH 3F7QA 3TH4T 1DANT 1RUAH 3KJ4C 2P7TB 4DAGL 5JPMA 1CFTB 2JB5H 2XTJE 3OZ9L 3QT2A 1LDPH 2ICCA 2CLZB 1JZ3A 1UJ3C 2AXGA 3QWOA 3UXFA 5GGRB 1A3LL 1YY9D 2VLKE 3JWDL 2XICA 4X9BA 1FORL 4KK5C 5C07B 3NH7H 3GBML 3QO1B 4HXBH 4PRPB 3EO1B 5BV7B 1NUFA 3JZ7A 3Q6FB 3QDHA 3QPXL 5DEFB 3MOQA 1BZ7A 2M26A 3DVIA 3L3IB 1XMWA 4I9WE 4KRPB 2X9XA 5CZVH 3T1WA 3SN6N 3AM8A 4YQXH 4LSPL 1RIHL 4ZXBD 1T0MA 3MUGB 2YKLL 5MP6L 2D2OA 4DUWA 5IEKB 3WN5A 2R0WL 3NMEA 1A6AA 4PLJD 4MAYB 2JELL 1Q0YH 2HTKD 4KJWD 1OAKH 1ZXQA 5FO8A 4FP8H 3F12A 4PREA 5EU5A 5IVNA 4G6KL 3VRLE 1J0ZA 1TZGH 4OF6A 1N26A 4MAUH 1D9KC 4YHMH 3T3PE 5F7YC 2AABL 4YE4H 4TSCL 2HFTA 3IDIB 3OQ3B 3MR9A 3DXAA 5C9JB 3KPOA 5FUZH 5DD6A 1P4BL 3MLPA 2OP4H 3QUML 2BNUB 1CR9H 1RZ7H 1IGTB 1KXVC 2Z91B 4JFDE 1H8NA 1CU4H 4PJEE 2V9QA 1A3QA 3W9EB 5J6HA 5JHLL 3I2CL 3IU4L 3MUJA 2W9DL 2F5BL 5C0CE 1BIIA 3ARFB 1ZT4B 4WVRA 3B9DA 3VXUB 3QUKA 1BP3B 1P69B 1JE6A 4XXCA 2MKLC 2D9QB 2XXCB 1KLUB 3ZDZF 1NFDB 4L9DA 2GJJA 3OXRB 3QFDA 5C09A 2OL3B 5ENWA 5DRNA 3HPJB 1SVCP 4N8VG 1G6VK 2CLVA 1DDHA 3EOTH 5KSBE 4I2XA 4YDKL 1SYVB 1JYNA 5CJQH 1OLLA 3S6CA 1I7ZB 2DKUA 4JPVL 2EIZA 3LB6C 1EIBA 1F42A 2R2BB 3GFUA 2IH3B 4PJFE 3IXTA 3VWJC 4LLAA 3DVNA 1YJDH 1A47A 3SCMC 4XCEB 2NYYD 4Y7MA 1FIGH 1XCQB 4AENB 2QQKL 3HPLA 4GBXA 4HUXB 5GS0C 4BYHA 1YMHA 3QIWB 1N6QL 5HHOA 3QFJE 2OJEA 3WV0A 4LDEB 4PJAA 5J12B 4R7NA 4JKMA 2ZP0T 1ZGLM 2AEQL 3D0VA 4UIKH 5D7LB 4ZOAA 2BNQE 3VG9B 4QRRA 3BW9B 2A73A 1NUNB 4Z77B 2EKSA 5T5NF 5L2KD 5MEPA 3IB4A 1NMCC 1X5FA 2EYSA 1RSFA 3GEWB 3OKLB 4XP1H 4OAWB 1JTOA 4GRMB 4WWKB 2KBGA 3TBWB 1JFQL 2PYEE 5EWIH 1A7RL 1IL1B 2XN9A 3QWRD 1FJ1B 1VSCA 2FJFB 3U4BH 2IWGA 5F96H 3PV7A 4HHAB 4Z0XB 4F33A 3P30L 2X6MA 1VENA 4O58H 4P23C 2NW2B 1MCSA 2J4WL 3FB8B 4L3EB 3DUSB 4XVUC 3GDBA 3LSOA 35C8H 4KPHL 1A64A 4G6JL 1KN2L 1LEGB 2DQEH 1JHTB 2IAMC 4K7FA 4FQXB 4QHUA 2W60B 2FATH 4YXLH 1MCQA 1OAYL 3TBSB 3JUZA 3QUZD 5DJXA 1NLDL 1NDMB 4QXTB 1AXTH 1D5MB 5DUML 3OKNB 1LK2B 5AAMA 5DMYA 3UC0H 4G3YL 2G5BB 5DJCB 2W38A 5C0BA 5I76A 5D7IB 2X9WA 3GSOA 4XPTH 5FYJL 2C9AA 3VGAC 5LG1A 2HFFB 3AAZB 1EERB 4KZEL 4K3JL 2ZUTA 5T3ZH 3CFKB 3TIEB 1RULH 1KLGA 4WI4A 1JGEB 1EJ6A 5MEQB 5EZJA 5JOPD 5KSAA 2XZAL 2DIJA 3QZWB 1CIDA 4F7TB 3S35L 4LSUL 2YUVA 2HN7A 3RWJB 4JPWH 3GJFH 1BFVH 4WEBL 5IVZB 1SBSH 5IB5B 4G8FA 5D72H 5JXAL 2C5DC 5TQ2L 4F9LA 5KW9H 1R3IH 4D9LL 1PY9A 1EEZB 1KIUA 3RDTC 2CQVA 4KDTA 3AU1B 4FNLH 3RWHA 3IJYB 1IAOA 3FQNA 4L4VD 3RBGA 1N0LA 4Q74A 3HC4H 1TCMA 1WUNT 1MCWM 3MNVA 3GIZL 4RFNC 5IHZA 2P43B 3WLWD 1FBIL 5DS8B 5JXEA 3CFIC 5E08L 1A22B 3QHZH 1X5KA 1CLYH 3SE9L 2G60H 1A9EA 2YK1L 4I18B 1QFHA 2VLRE 5IMKB 5I1DB 3RNQA 1WLHA 3QP3A 1KB5H 5IMOB 3P9LA 5HHMD 1G9MH 5D2NA 1H8OA 3TV3L 2IANA 3DJ9A 3U83A 3O4LD 1T7YA 3GBNH 4DN4L 2AERT 1H3PL 5JQHC 1PLGH 1RHFA 2E6JA 1Q9KB 3ZKNC 4ZXBB 1Q72L 3S7GA 4KXZI 3B2VH 2VTFA 1H3GA 3HG1E 2I24N 4RA3A 1QP1A 4JO3H 2A9ML 5JIPA 4OLYH 1I3GL 3CX5K 1WBXA 2PXYD 4I0CC 1HQRB 4OGAC 1QSFE 3FO1A 3DX9A 1S7TB 4K8RD 5LGJB 1J0IA 3QQ9D 4TULL 5I66A 4YR6B 4NOBA 2X4RA 4LMQI 1I9JL 5I9QC 4BH7A 4KU1A 1U6AL 5EU6B 4WTXA 3QULB 3MXVL 4AEHL 3TESA 3NZ8B 4DVRH 5I2IB 1A7PH 5CP3A 3B9AA 3WNMA 2J3SA 1RAMA 4XWOD 4NQDE 1X5JA 1SHMA 2X4UA 1TTGA 1E27B 2E9WA 3WNKA 4W6YB 1OGTB 3DX7A 5TDPB 3DV6A 2VLJD 3NGBC 5HDBE 3WE6A 5JOFA 1UB5B 3L6FB 4XP5H 1BX2B 4MNHB 1N0XH 1KG0B 32C2B 3GI9H 1DQJB 1J5OH 3MLXH 4OFDA 3IDXH 4KK6D 3SO5A 1KGCE 5IM7B 5FGBA 1HK6A 3ULVD 4WW1A 2RHEA 2G9HA 1XGYH 3QUMA 5INCB 3QXDB 1MOEA 3C6SA 3MV8E 2VZ3A 1CF8L 4BQ8A 2RIKA 3N0PB 3BDXA 3JTTB 5HSFA 3ARXA 3BH8A 1ZWIB 1JV5A 3MRQA 1WBYA 4QF1A 4XZUB 4Z76A 1AKJD 1UB6B 5F93C 2XRAL 5C6PB 3GMRB 1E4WH 4GRWF 4WFFE 4N8CH 2CDEA 2DQTH 1PBYA 3RPIB 3L7EB 4XPBH 2H2SC 3AM8C 2VQ1B 4UV4H 4JM4H 1T2XA 4JZOA 3K3QA 1K2DA 2B2XH 4K94C 3WN5C 4P3DA 5F1KC 4KKAD 4NQVA 3WNLA 4E42B 5E8EB 2AXFB 4MZ2A 1ZS8B 4JM2A 1XH3B 3QEQB 2F53D 3DSNA 4HXAL 5FYKU 1BD2D 3UBXI 1QOKA 4XHJC 2CMRH 2NY6C 1HEZB 1M1SA 4NQUA 3RQ3A 1UM4H 2R8SH 4ZFGH 2BZDA 2DDQH 4FFVD 5I19L 1D5IH 2V7NB 2UWEE 3VXMB 4D8PA 4QGYA 1MI5D 5KSVA 4KXZH 3IDGA 4JQIL 5DRXA 5HYJD 5F7WC 4H26B 1ZKAA 3RA7L 3QXTA 4NQEE 4XH2A 3AXLB 3Q5YA 1G7QA 4ONGL 2P1YA 2YD7A 4K2UL 3BWAA 4XVTH 4XXCC 2A1WL 2G75A 4Z7VA 1HXYB 4MNQD 2YSSB 3QUZB 1MREL 3I6KB 5IB2A 5A3IC 4MXWL 5IOPA 3N1MC 3BN9D 4L9LA 3P0VL 5EN2A 2J5LB 3LQZA 2Q76B 3LV3A 1MF2H 5LBSL 3DIFB 4Y19A 1EAPB 3QDGE 2JB6B 5SX4I 2H8PB 1FCCA 2FX9L 2Z93A 3OJMB 2FWOA 3VI4F 1X6NA 1IAMA 4HMEA 4WI3A 5EPMB 4PJ9D 4JREB 2EC9U 3O6FA 2AV7A 3NPZB 5IEHB 1OWWA 4LSRL 1AO7B 4C56A 4PRHE 4HBCH 3LKQA 2JE8A 3MRDB 5BXFA 4GRMA 4GQ9L 4G6MH 4GRWE 2FECI 3RL1B 2WBWB 2IQ9H 3OHXA 4HF5H 4KI5C 4X9GA 4MJ6B 2HG5A 4GBXC 5F9OH 4ZFZA 3UO1L 3GJFK 1DBJH 2VDKH 5CS7A 2X1QA 4N8VA 3C08L 2NW2A 1REIA 3FQRA 5DJ2B 4ZS7H 1G6RH 2IEPA 1ROWA 5C86A 4L4VB 4YK4C 3RIFK 4PJ8A 5TE4H 4X7SH 2X5PA 3UTTB 1O5DT 4GRLD 3SPVA 3J7HA 2KQNA 3I6GB 4S0SD 4XNZB 4OCXL 1EEYB 1NCBH 2FR4A 3BD3A 1KC5H 4KHTL 1IARB 1TQBB 1ZA6A 3WXWL 4NC2B 3HC0A 4LVNB 3K8KA 3O6LL 3OJDB 3CK0H 4JG1L 5D7KD 4K7PY 4R2GC 1FPTL 1TVBB 3G6AB 4QXTA 4UT6H 4YUEL 1P7QB 1NCAL 1Q0XL 1U8KB 3RTQA 4Y2OA 3UJIL 5ID1B 1P4LA 1HH6A 5KG9B 1SVZA 3BZFB 5A40E 4WI6A 1QSVA 2W92A 4N0CD 2BXZA 5GJTL 1CFBA 1J8HD 1ZLVH 2X4QA 3KYNA 3C8HA 2V5RA 3NFNB 2A9NH 3MFFB 1W0VA 3S97C 3ARWA 1BF2A 4PJAF 1AH1A 3O2VL 3QEUB 3PWLB 5D1ZB 2F15A 4NGHH 5JDSB 4EUPH 2WBJB 5I8KL 3ZKQD 2DQDH 1JHLH 3DRQB 5IB5A 5GSVA 4F7PA 4MQSB 1CDUA 3KJ6H 1X44A 4WDIB 4O9HH 5KVGL 2AVGA 3NA9L 3EYSH 3D2UA 3T77B 4WGVB 4IMLB 4KMQA 2A6KB 2EDXA 3HTLX 5EBLB 1NMBH 4M00A 4Q0XL 1DQTA 2Z35B 4MMZC 1QG3A 3Q3GB 2GITA 1JL8A 3P11H 4FQLH 3DXAE 1GGBL 3AS3A 4KUCD 3VI4E 3KPNA 15C8H 1HE7A 1IM9A 1BVZA 1TPXB 5KSAC 1M7IA 3QXVA 5DHYA 2VABB 1RZJC 3PABA 5ALBL 1UVQA 3IDJA 2P8MB 2VLJB 3TH3T 4Q97A 1FNLA 4Y4FD 1K8DA 2MMXA 5IVXE 1U93A 1F6LL 3KYMB 1BQLL 4D0BA 4F9LC 5FF6A 5IFAL 4J3WA 3MV9E 5DUBA 4KDTC 1UENA 4TVPD 5FGSA 3O6ML 5HYIA 1CD8A 5IVOA 5SX4H 1DLHA 5LVEA 1NJ9B 1UCTA 1R5WA 3FOLA 1S7QA 5E99L 5E9DA 4D0CB 4U2YA 1T1ZB 2IGFL 3C2AL 5C09E 5JXEC 3LN4A 4HGWB 4EIZC 1JPGB 4I2XE 4F8QA 1AGCA 2ESVE 2VDLL 1B6DA 5E8PB 4J23A 1BBDL 3UYRL 1U58B 4FQQA 4HUVB 2VDRH 5E6ID 5D2NC 2PYFB 5FOJA 3ARTA 8CGTA 3IDMA 2V17L 4HKXB 1W8NA 3MO1B 3BPNC 4OKVB 1OCWL 1BREA 3DV4A 3GMQB 4QXUH 4KI5E 3G6JA 4HJGB 4X4ZA 1G7PB 4JFYA 3K4DA 1HHGB 1M7DA 2ZOKB 1KF9B 1IQWL 3ARBA 5HHOE 4XX1E 2ZUVA 3NOIA 3JWDC 4OLUL 3RVTD 4JDZB 4PJAE 1IGFL 1FO0H 4KMTL 3D0LA 2F53B 3S88L 4DK6A 4GG8B 1JPFB 4QRRE 4F15C 1BX2A 2NY2B 1KELL 32C2A 4CMHC 4ZUTA 1IE5A 3RIAF 4O2EB 3O2WH 3UTSD 5TE7H 5DD3L 1RZKL 4PY7B 4J3XA 4BSJA 4M6NH 1GZQA 4LLMB 5L8KB 1MI5B 2XN9E 1AJ7H 1OQXA 5HYJB 3EYVB 2E9IA 2P45B 4HH9A 3K80A 1HHKB 3DYMA 3C60D 4HDIB 1MCPH 4XCFH 5H37H 3QIUD 1B4RA 1MFAH 3FHAA 5ADPH 3MRKB 3TO4B 4ETQA 1GIGL 3GUTA 4YX2L 2YMXL 2J12B 5DC4B 5E94A 2W0FA 4ELKA 4YFEA 3WS6A 5FGBC 3WFDL 4ODUA 1PSKL 3A0OA 2ARJA 5L2JA 2XY2A 5T33L 2FJGB 2VLMD 1V3JA 1MQKH 3DO7A 1TVHA 1MJ7H 3EDJA 3WO4C 2QQNH 4W6WB 2E7BA 1F3JA 3O8XA 3LPWA 4OM0H 4EDWL 5I8EA 2CDGB 3ELAT 4GLRI 3PWUA 4ZQKA 5B22A 4F2MA 3CDFA 1AQKL 1FL3A 1I7RA 2IPTH 4KY1H 5I1JH 1ZS8A 4NCC2 4FG6D 4QEGA 4PGZA 2GTWA 4NO0D 3SDCB 5L2KA 3EJJX 4PUBL 1MRCL 2YD6A 3U2SB 2ICES 3EGSB 3LD8C 5JOEA 1HEZA 1MIMH 1UCBL 2BSSA 5DEZA 3I3DA 4YHOH 2GAZA 5IKCA 2BXYA 1J0HA 1E4XI 3QWRA 2APTA 3NCBB 3HMXL 3H7BB 5GRXG 2DLFL 4GAFB 5I1KL 3U9UB 1GHFL 1FN4A 2AGJL 4KHXH 4NJ9L 1NDGB 4IOFC 1WC7B 4QHKJ 5DUPH 1NBZB 2Z4QA 3NABL 1L9MA 4JM2C 4NP4H 3P4NB 4FQ1L 4GT7A 4DGIH 5E4IA 3RY4A 1F4XL 1IC1A 1EMTH 1B4JL 1RK1B 5EU3A 3EOBB 1U8PB 3HNVH 2XWJA 5E2WL 4YAQB 4JKLA 4JKPL 1EFXA 3V5KB 3D39D 1K85A 2I27N 3EDFA 2NXYC 2AJUL 4MLIA 4HS8L 3BDYL 5C0ND 3S96B 2ATPA 5D1XD 4U6HA 2E27H 2IF7A 2O93L 4K07A 2HT2D 2P8PA 5D2NE 1N3NB 1YEJL 4V2CB 1FLTX 1J8HB 2IANE 2DQFA 4YIQA 5IESL 3PWVB 3MJ7A 2BVPB 1PEWA 3HS0A 3P77A 4EI6B 4ZPVA 5LWYL 1ZT1A 1YNTB 1NGZB 1ZLVK 3W9DB 4H20H 3K8LA 5ERWB 4HV8A 2X4PB 4PLOB 4CUCA 5KZCD 3F5WA 2H32A 4ZFFA 3CLEL 2VLLA 4JM2F 1H15A 5FO9B 2COQA 4MJID 4ZTPL 4QHNA 4U6VH 1EHLH 4F3FB 4G43A 1VFAB 4ERSH 2AP2A 1GSMA 1CXKA 2I60L 1TLKA 3UTOA 1X5AA 3ULSB 4U0RC 1JI2A 2HH0H 3CXDH 5DSCA 4L4VA 2JLLA 5BW7A 3QRFM 4R97B 3QDJB 3PDOA 1K6QH 1P2CA 3H9SB 3QDMB 1F5WA 5K9KB 2F74A 5DHVA 1QBLL 3SDXF 4BZYA 5E7BA 2GI7A 1AQDB 1C5DA 3O6FC 3ZTJG 3WL9B 3BGAA 1O7SA 1U8MB 2R56L 1E4JA 4BKLB 3CX5J 2IFFL 3MRPB 3FT2B 3ILPB 4M61B 4Y4FB 5HGBB 4OCSL 3R0NA 4NWUH 1MFEH 3C09C 1CT8A 4YHLH 3DRTA 4LHUA 4R4BA 1Z3GH 4YHZH 2YPVH 4YDJA 4Z7VF 3GJEA 4TUJA 4PRPE 3O4LA 4PJ8C 5IQ7H 3X13A 1KCLA 4OZHA 4GLRH 2H6PB 4LEOB 1NGYB 4Y5XB 4X99A 3QPQC 2WP3T 2PXYA 4BQCA 5I8OH 3PWLA 3FQUB 4FQJL 3A6CL 4UTAL 4OFKA 4Y4KD 1HDMB 1AI1L 3MGOA 4XP9H 1BLNB 5BZWB 1E4XH 3PL6D 1Z0MA 3QXUA 3RTQC 1A7NL 5GGQH 2AS5M 2VAJA 4QXGL 4RGND 5IK3A 5EZOL 2QSCH 2D03H 2FEDD 4I4WA 3VXQB 2BOBB 4LCYB 5EBLA 3TO2B 4TVPL 2VZOA 5SV3A 4ZTOH 2A6JA 4EI5B 1IT9H 2BFVH 4LPYA 1F2QA 3PWNA 5ILTH 2IJ0C 5BO1L 1DSFH 4UOW0 4ODXA 1JPTH 5LXGL 1ZMYA 5K9QG 1KYOK 1FVCA 4PS4L 2D0HA 3MNZB 3VFGL 2VLJA 3JV0A 4WV1B 2E3VA 2WINB 1BQHB 4GW1A 2DLHA 5CBEB 2Q3ZA 2OTUA 1IKNA 3QJFA 5FO7B 1IAIM 1CE1L 1C1EH 3UTSB 3KR3L 1DE4A 1AD9B 2FGWL 3BXNB 3ULUH 1RZ8B 2NY1D 3VD7A 4LLYB 5EC1B 4XAKD 1I7TB 5GXBB 4LSVL 3QISA 5I1IL 1NFDE 4UT9H 4P3CH 3KPQB 2DWDA 3WNPA 3ZL4H 4K3DL 5J6GB 5BS0A 2VISA 1LEIB 3C60B 3I84A 2Y5TA 1IAIL 2R69L 4OZIA 1YY9C 2WUBL 4XWGL 1LILA 5BRZD 5C0DB 1AKJA 2A6IB 3UTPD 2JIXB 3QAZB 3OG6B 1W0YT 1HSBA 1ULVA 2R9HD 3VFWB 2NY0D 1U3HD 4OCYH 5D9SB 4R8WL 1U58A 4P2RD 1I8LA 5FDWB 5I1LA 2J8UA 3S37L 1BECA 2A0LC 4Z7VE 3UTQA 2AK4D 3FO2A 4HBQA 3S34L 1QLEH 3PHQB 1G0YR 1WFOA 4BH8B 5GGVH 3TF7C 1KPVB 1S5IH 2ITDB 1UM5H 3I02A 3OR6A 2D3VA 5F1IA 4PLJC 3KPLA 1U3JA 3TA3A 2HTKC 4JZJA 4I77L 1S3KL 4KJWC 4Y19E 5FHAH 3U0WL 4ODBD 4XBGA 3ARED 4NO0B 5D7JD 1BD2A 3KYAA 4LPCA 3MLSH 5LKNA 3WIFA 4KK8C 2X1OA 1CGTA 4DKFL 3OAYK 3V7MA 2VDMH 4C56E 1E6JL 2OS7A 1WGOA 2VH5L 4U6YB 4P59H 5DVKA 3NIDE 2CKBB 2HWZL 3MOBL 4LNRB 5FYJE 4AQOA 5F6IB 4BA8A 1JGLH 4HIEB 3ARBC 5TQ0L 1TIUA 3JV4B 3OKMA 5T3ZD 5CJOL 5DF0A 4CW1B 4HUNB 2B1AL 3GSNB 3PGFL 1CZ8H 2AJXL 4HX1A 3T0BA 4M1DL 1FNGA 2NY3C 4XNYL 1MHHB 4JR9H 3P9MA 2VXSH 1U9KA 4M5YH 5IB3A 3V4UH 2QADC 3KVQA 3RL2B 1JNHA 3HMXA 2CRZA 4MNQA 2BCKA 5FB8B 3VFOA 1MFDL 2V5SA 2FJGA 2HRPL 2FCBA 5D1XB 1I85A 1R3JB 1X7QB 5JUEL 4X83A 1C5CL 1W72H 7CGTA 1VFOA 2V7HB 4LCIL 4PP2A 1CD9B 4DW2L 5DLML 2AEPL 5IBLD 4LLDB 2XV6B 4TOYL 5C92A 1DBMH 1PVHA 4PJ9A 1V3KA 1QR1A 3O11A 4XPAL 1OM3L 4IOSD 3SHSA 2AJVL 5KZCB 4RWYL 1ADQH 4Q9QL 1GGIL 1MJ8H 5KJRH 4BFIA 5GS1B 3HLAB 5KSUB 3WS6C 2NYYC 5ICXB 4X4XA 4NN5C 4P5MA 4D0DA 3MJ6A 1HH9A 3RVUC 3G5XB 4DCQB 1AP2B 1G7JB 1CBVH 1S78D 3O8XC 2VIRB 1J1XH 4G42A 5HGHB 2PKDA 1WQVT 1B88A 1OD9A 3EDEA 1WV7T 4XNMB 4L8CB 5EZIL 2VR9A 1YUHA 3X12B 4GRLA 4MGXA 1KIRA 3VCLB 2H1PL 5I75B 1A6ZB 5CBAA 4NM4L 3UAJC 1VDGA 2ZJSL 3P0GB 4NKMA 3MMEA 4Z6AT 5IJVA 2X4TB 2PCPA 5ADOH 1YZZA 3W11C 1OB1B 1RUAL 1CI5A 4CN6A 1OF2A 1LDPL 5CWSB 1QLRA 3SDXB 1A1NB 1HQ4A 4JLRB 2OYPA 4ZUUB 4ONOA 1KJVB 3NH7L 4UNUA 4H1LB 2EH8H 1N3NA 4PV8A 3MREA 4RAVA 4Y1AD 4M8VA 1NAMH 3NBNA 3PWVA 4LIQL 3QHTC 2WLYA 3BIKA 1ODAA 3O3AB 4N0UA 5BZDA 2OR9H 5CZVL 4P2OA 1A7OH 3VH8G 1S8DA 1UXSA 4YQXL 4JGMA 5E9DE 5DQDH 5ERWA 3UZVB 1T5XB 3FT4B 4QY8A 5FA3A 1Q0YL 3KDMB 1KIPB 4RGNB 1OAKL 3DYPA 2J5LC 4GMTH 4ZS6D 3BRFA 1MCJA 1VEPA 5FHBH 2V2TB 1ACYL 1CGUA 4WHYH 3P4MB 4JO4H 1CLZH 1YYLH 4YHML 4YE4L 1EBAA 3EYFB 4B50A 1UACH 3C87A 4J4PD 3X14B 2VAAB 3FTGA 4YHKL 1NCNA 1MAML 1MLCB 3G6JE 1U8MA 2OP4L 1GGTA 1CR9L 1RZ7L 3L3DA 3PDDA 2OTPA 1RJZB 1DN0A 3GGWB 1N2RA 2D0GA 1WVZA 3HCVB 3X3FL 1S9VA 2XIDA 5F9JB 4G9FD 2X70A 4HIIA 4EDXB 2ITCA 5EU7C 1MCBA 2L4OA 4DFIA 1DR9A 2LV4A 5BW7C 2NZ9C 1Y0LB 2E6PA 4PRAA 5EOTB 2G2RA 1AR1D 1JGDA 4LEOA 3SE3A 1NGYA 4OD2B 4CVZB 3GSXA 1HSAB 2D0FA 5JA9A 3N1FC 1ITBB 4NBZB 5DXWA 2AEIT 4DJMA 2E6QA 4KRNA 4ELMB 1UYWL 3EOTL 4AK1A 5BRZB 1HDMA 5CJQL 2NY0B 1U3HB 4H88L 1D5ZB 1QFUL 5KS9F 2VZ1A 1T3FB 5D93B 4YHYB 2KKQA 3MCKA 5E6IA 4FQ2H 1UKQA 4X5XB 3VFUA 3CDGA 2DM4A 5DQJA 5K93A 2J8OA 4OZFH 2AK4B 2W91A 1YJDL 3MACH 2B4CH 4D94A 5DZNA 3RZCB 4LLQB 2GFBB 4QYOB 1I9IH 3QHFL 3GM0A 4TN9A 2BX5A 3HE6D 2FZ3B 5ESVB 2PXYC 1WEJH 4D9RD 1AHWA 4JRYA 5DJZA 1ETZB 3AS1A 5IIEA 3QQ9C 3H3PH 4RMRA 3QRGH 1FL5B 3AREB 2KL6A 5D7JB 2JTDA 1I8IB 3BYYA 3MRGB 3MRRA 3UPRB 4UIKL 1F8TH 2HFEB 3PE9A 2WSKA 5L2KE 2ZUUA 5DWUL 4F57L 2WP3O 1IAKB 4BJLA 4JJ5B 2XQYK 5MI0B 5F7EL 4QTHB 5E8OB 5EWIL 3IKKA 4BUGA 3UZEA 1S7SB 1F45A 4GW5B 4CADB 4O58L 5DVNA 4QKXB 3C60A 1LEIA 5ISZD 4PY8I 3QIUA 4JJHA 3D3VD 4NRXA 3WSQL 2VXUH 4JY6B 4JFFD 5C0IA 1IKNC 2N1KA 3FN3A 2C3VB 4ONHB 4R90L 2ICEB 1T04A 3D5OF 1ZTXH 2DLTA 2GT9B 3QH3A 3ZHLA 3N1QC 2DQEL 4KK6C 5C08A 4HS3B 2UZYB 5J3HC 3GJFB 4Y88A 1I1FA 5FGCE 2FATL 4YXLL 2DQUH 3LRSA 1K5NA 2XWTB 5EZLA 5TGBB 1B2WH 3FFCD 3LN9A 4IS6B 5CEYA 1FNSH 3O3EB 4X9HA 1XGTB 4XPTL 4D3CH 3UJTH 1CDBA 3G9AB 2GJZB 4R3SA 1FG2B 2CUIA 4LCWD 4NO0A 1WFTA 1PD6A 1NBVH 1I8LC 1RULL 1I1AD 1HOCB 1T21B 2HJFA 5I1EH 5BOPA 5IG7B 3GZKA 5JOPE 1RZKC 3L5HA 5ESAB 5GRUH 3JWOL 1L0QA 4GKSB 4XXDB 5E8NA 2GSGA 4X98A 1BFVL 4JFZH 3GMNB 1PG7H 2P5WA 1KB5B 4KKAC 2BJML 1RU9L 3EKCA 3U7YH 1R3IL 3VMOA 5KW9L 1TJIL 3JUYA 3TA3C 4JZJC 1MHCA 4L4VE 4FNLL 2FJHA 1IEAB 1XIWD 3BO8A 1LGVA 3MRIB 5I16A 3HC4L 3DROA 1NL0L 5GGUA 1G1YA 2H3NA 1X3DA 5E4EC 3GRWH 1JPST 4OZIF 3IFNL 3C5JA 4PGCA 3MV01 3D39A 1ONQA 4M93C 4NKOA 1IZKA 5SWZD 3NN8A 3UPCA 2AJZB 3QHZL 5IB4A 5CUSH 5J06A 1CLYL 4UU9A 3TFKD 3UYOD 4OLVH 2J8UF 5HHME 4NCC1 4EJ1C 3QO0A 2IMNA 4LDOB 3QNXB 1LO2H 1G9ML 4Y1AB 4QHMB 3O4LE 5I6XB 2EZ0D 3EOAB 1NC2D 3MLRH 3GBNL 1ITCA 4NRYB 4OZHE 4I8DA 1OAQL 3BIAX 1PKQB 4HIHB 1PLGL 4G8GA 2VXQH 5E5MB 2VQUA 5F3HA 2C1PA 3B2VL 3RUGA 4JO3L 4AMKL 3STBA 1IKFL 5GS1A 3CCHB 4OLYL 3SO3B 1I3RA 5FKPA 3IF1B 4S10A 1LE5A 4MJIA 5ABDE 2UZIH 2VERN 4LLWA 1KTRL 5HY9A 2C3GA 1I85C 2D4FA 3S5LA 4AZ8A 4YXHH 1F4HA 4P49A 3PQYD 2PTTA 4OZGB 4B7IA 3V6FA 3ARUA 5J9PB 2XACC 3QUXB 4MDJB 1H5BA 2JJUA 4PJ9C 2OZ4H 3STLB 1DBAL 2MPAH 3KPSB 4DVRL 1ND0B 1OGAD 2EC9T 1F90H 1OTTC 2NQCA 1DN2A 4F8TA 3FO0H 4XBPB 4BSWA 4OIIL 3DURA 1FSKC 1N8ZA 5DK2B 2WAHA 2IALA 4G9FB 4WEMB 2VLJE 4JFXB 2NY5H 1JUFA 5D5MA 3LKPA 4JLRA 5JO5B 2IPKA 1OVZA 4JPIA 2B20A 1WWWX 2C3WA 3W39B 1N0XL 5IMLB 1MSPA 4FFWC 3GI9L 4N1HB 1J5OL 3MLXL 4HKZB 3IDXL 2HVJB 4ZYKB 3GSUB 4NDMA 5SWSB 4OI8A 4GRLC 4U1GC 3U1SH 4I5BA 2YUWA 2GSIA 1XGYL 5C71A 1L7TH 2BVYA 1A7QL 4ZO6A 3H9ZA 5JW3H 2WUCH 5KN5A 4M7KH 1KYOJ 2AV1B 4Y4KA 2QV2A 1G7MB 3PL6A 1CD1A 2E5EA 3QR2A 4NN6C 4WW2B 7FABH 4OD1H 4OZIE 4M1CC 5D6DA 3RX8A 5CIPH 1CDHA 4JG0L 4N0CC 1E4WL 1FL6B 2J8UE 2PR4L 3OAUH 3P4OB 1ZHBB 1GCFA 1QACA 2DQTL 3DVGB 3EYFA 1F4AA 2AXJA 2OSLA 2VDOH 3LH2H 3VFPA 5KS9B 4XPBL 3HE6B 4P2OC 1KPRA 12E8H 2EXWD 4U49A 4DQOL 2B2XL 5ETUB 1MCEA 4YO0B 1EHNA 3QCTH 2B5IC 2PO6A 3HCVA 1R5VB 4HT1L 4KKCC 2F53E 4QT5B 3RWIA 1BD2E 3V6BR 4ZUVA 1I8MB 5KOVC 5ITFA 3BP7A 4KKLC 2CMRL 5IF0B 3T2NH 5JQ6L 1C7TA 5BV7H 1UM4L 3T65A 4AIXA 3SKNA 1AGFB 1ZSDA 4ZFGL 2DDQL 1DBKH 4ORZC 2EXYC 1MI5E 5E2VL 1DUYA 3EJYD 3BP5B 3VH8A 4JN2A 5HYJE 4XGZB 2EDHA 3CUPB 5ISZB 3F58H 3D3VB 3FO9B 4U1SA 5E1HB 1MEXH 4G7VH 5E1AA 5CKAA 5EO1B 3ROOA 4HAGA 3QWQB 3C5ZB 2OLDA 3MX0A 3MRHB 4P2RA 2HKHH 3UBXG 1DVFD 5DR5H 3H7LA 2LU4A 3B5GA 3TVMD 1TFHA 4EUPG 4HMDA 4PGEB 3SGJA 3KPPB 4RMQA 4MNQE 4PRID 4HUWB 4U7KA 2Q6WA 1KFAH 1LMKA 4N0RA 4MNGA 3H3KA 3SE3C 1SJEA 1OSPL 4Y5XC 2W1NA 4G7YH 3O4OC 1QA9B 2ZG1A 2WK2A 4RDQF 2NX5D 1J7VR 2QSTA 1MF2L 4R0LB 4GFTB 1TDQA 2YPLA 1HYSD 4NWTH 3MRLB 2O61A 1FE8H 2FDBP 2FD6H 2P8LB 1QO3B 4XNQB 4S2SB 3X11B 2HFEA 1QHOA 4Z7WA 5E6IC 3F7VB 4XB8A 2UY6A 4WO4D 5F8QC 2BC4A 4YFLI 4HBCL 4S1SH 3OKEA 2APVA 3ES6B 3M17B 4G6ML 5I1AA 2IQ9L 4HF5L 2ZG2A 5F9OL 2D31A 2IBZX 3ZDXF 1DBJL 2VDKL 1IGIH 3M45A 1FVEA 5A43C 1AHWC 3REVA 1OW0A 2XWBB 3RVTC 5I73C 3AB0B 5L8JB 1EHXA 4FQHB 2MNUA 2OL3H 4ZS7L 3ARDD 5CD3B 1G6RL 3NFSH 3RVWC 2E7LA 5TE4L 4Z8FH 3MBED 1UZ8B 4X7SL 4HKBA 3UYPA 5F3BB 3UBXB 1EUTA 4UQ3B 2XKNA 4KJPD 4E41D 2ZNXA 3H9HB 1NCBL 3BGFB 4JHZA 3IJSA 3V6OA 4PJIA 1MUJA 3CK0L 3CX2A 3KYKH 5L8LB 4P2QB 4UT6L 1GRWA 5EORH 4RWHA 3Q5TA 1JRHL 4HUUB 4I1NB 4OSUH 4OT1H 3BIBX 3IXAB 5IJKA 3C60C 5DT1H 3QIUC 3LKNA 4FFZL 1I7UA 3L3HA 1BQSA 4GG6A 3W0WD 5K59E 4XVSH 2HLAB 4M48H 5HHNA 2Q8BH 2A9NL 3RWDB 3D85D 4GAYB 4G6FB 3RNKA 3DUHA 3TN0D 3OR7A 4NGHL 3GMPA 5DEGB 5IMMB 1NGPL 3PQYB 2NTFB 3U36B 1X5IA 3M8OH 4XCNA 4N5ED 3KJ6L 3BH9B 4KVNH 4O9HL 3EYSL 4U1IB 4NYLB 4MA3B 2A74A 3GMMA 2FGZA 1K8IA 3D18B 4NQCD 5JDJA 1OGAB 1Q94A 4HQQL 5JW4Q 5F1NB 3PWJA 1TVDA 1WFNA 1DL7H 2YXMA 3P11L 1WT5A 5E70A 4RMUA 3U0PB 2ZSWA 3DTXB 5F1OB 2NY4C 3O45A 2KZWA 5H37G 4YZFF 5H94B 3ETBF 2AJZA 3L95B 4KJYA 3CXHK 3IKCB 3W81A 3T0XA 3WNOA 1LE9A 3Q1SL 2ORBH 4P46D 2P5EA 1BJMA 4R4ND 4TVPE 1JZ6A 1F4WL 2DI9A 3ZDXE 3D69A 2KH2B 4PJDA 1CGWA 1BVKB 1CFQA 1FZJB 3T1FB 4ZSOA 4UILH 2R1YA 1RZFL 2YEZB 2EDDA 2IADA 4RFEA 3AVEA 3UTZA 5EFIB 2NXZB 4POZD 2F58H 3O0RL 3ILQD 3NVQA 3QXAB 1FO0B 1VFBA 4R26H 1Q9LA 4NQTA 2RJMA 3KYOB 3NTCH 5CILH 5C0NC 4NO3A 1T22B 3N9GH 1OSZA 2VC2H 1S7XB 1PY4A 1G7HA 5C0EB 3TIDA 2HT2C 3O3BA 2J88H 3JVGA 2VDRL 4V1DD 4FTVB 4UINL 1U95A 3T09A 1SJHB 5J9PA 3B9VA 4YNYB 3PIQB 1JHKH 5AAWA 1CXLA 4JE4B 3MRMB 4J4PA 4K23H 5GPRA 1ND0A 4QXUL 3FAWA 3PHOA 3VFSB 2RFXA 3OMZA 5GS1C 4UTBH 1JVKA 3QQ3A 3TEUA 1KT2A 3VJ6B 3FOMA 4JRYE 4NUJB 5DJYB 5J57B 1ZANH 3SJVA 2SEBB 4QTIL 1CFSA 4AEEA 4UUJB 3ZE2F 3K4AA 4BQ9A 1CICD 3VD3A 5DTFA 5DMGD 1T1XB 2HVJA 3O2WL 4Z7QF 5IR1A 1DFBH 5TE7L 1H5BC 1OTSC 5FCSH 2XA3A 3H0TB 4M6NL 5FYKH 1NCCH 3BGMA 4LVOC 3HZKB 3SDAA 1QKZH 2ADGA 1JPSH 2Q8AH 4MQ7A 1ZA3B 4PLKC 1DUZA 2FNBA 3HAEH 3C8KB 5KVFH 1X4YA 4XCFL 1MCPL 4QOKB 3B43A 5I18L 3RUGF 1DVFB 1MFAL 4YZFE 5ADPL 3EFFB 1R3HA 4NPYB 4PRIB 3IETB 5EIIB 1QUNA 4YDIH 5E8DH 5ICZB 1PQZA 3BD4A 4LF3A 2VLME 4L29B 2JJSA 5EBMB 3EO9H 5KAQF 3ECBA 3HE6A 4JAMB 4PR5B 5CMAA 1MQKL 2OR8A 1EZVX 5DJ6A 4Q6IA 3T8XA 1MJ7L 2NX5B 3S3SA 1S7UA 2QQNL 2VSDA 4Y4KC 1TTUA 1YY8B 3BX7C 4OM0L 4YO0A 2EYRB 5SV4A 4Y16B 3PL6C 4GXUN 3OKOB 5TPWL 1YQVH 1U8IA 2XYCA 4QRTB 2IPTL 4QT5A 5D6DC 5I1JL 5IROA 2FEDC 2OI9C 4GS7B 4HUKB 1UM6H 5A16A 2PTVA 3LPFA 1X5YA 4P3WA 4PJBB 3VD4A 5IF0A 1MIML 3OJVC 3WS3A 1INQA 4YHOL 1DCLA 3KWWA 5C0GB 4Z7UA 4MA7H 5D5MF 3R1GH 2YRPA 1AGFA 2EIEA 3OKYA 3W5MA 1IGYB 1G9NL 4R96A 4WI9A 1UQSB 2P5WE 5TH2A 3O3UN 4NZUH 3BHBB 2WQ8A 3ARDB 3G04A 2DS4A 1BBJA 3QCUH 2UUDH 5I1HH 5I8CB 5EO1A 1UWEH 4JFFA 1XGPB 4KHXL 2ATKA 2PO6C 3FT3B 5DUPL 2RBLA 5I15H 3BP6A 3HE7D 3TCXA 3RHWK 4NP4L 5DYOB 4AH2A 3IU3A 2FIKB 4Y5VB 4B41A 1LNUB 2MHAA 4E41B 1C08A 4DZBA 3HZYA 1YJDC 2CDFA 2EDFA 2NY1C 2QL1A 2O5ZH 5FK9A 3FN0L 4ZO7A 4NM8H 2NCMA 3CVHL 3HNVL 5F7NC 2DLEA 2YWYA 5L88H 3FFCA 3D39E 3HNTH 3PP4H 5C2BH 3CSBA 5DMKB 4UAOC 5ACZA 1FYTB 1MRFH 3ME0A 2X7LA 5HJ3A 1G6RA 2E27L 1WFUA 4HWZA 2EO1A 3V4VL 1FVDA 5DJ8A 3HRPA 4LCWA 4HFWB 5DC0A 3W0WB 3QQNA 1QO3A 3GNML 4RIRB 1I1AA 3EDDA 4OZ4B 4PIRF 1XF4B 2HKFH 2FBJH 1IQDB 2JCCA 3D85B 4NN7C 1V05A 2DQHH 3RUGE 3OBAA 4L8BB 1NGWA 4H20L 3SGJC 1YC7A 4AYFA 5B21A 4Y5YA 4UT7H 1SEBB 4MJIE 4QRUB 3OG4B 3D9AH 1U8QB 2BVQA 4KTYA 4S1DD 1QEWB 2ICWB 4U6VL 1EHLL 1UT9A 3MLTA 4ERSL 1HILA 4YDLB 5CEZH 1XIWA 4RZCA 2HH0L 5L0QC 3CXDL 3QG6A 1OL0A 3FQWB 3BRGC 4I3SH 4NQCB 5C0AA 3IVKA 3V4PH 1KJ2L 4NKDB 4U1LA 1RJLA 5DK3A 3MV7A 4O2FB 3ZKMD 3BKCH 3H9HA 3HZMB 2LTQB 2DMBA 2IH1B 4EUPA 3PP3H 5SWZA 3M1BA 1JP5A 5D96C 4JFPB 5EIVA 25C8L 3DSFH 3DI2B 4OUUB 3SGKA 2DBLL 5D5ME 1MFEL 1FFRA 3VXSD 4YHLL 3BPLB 1KTKE 1QRKA 4U1JA 1OW0C 4JANB 3O41A 4YHZL 1AIFB 2YPVL 5ANMA 1M6OB 1NC2A 2E7LC 4IRSB 4OI9A 4CVXB 3KXFB 3CNKA 5HHQB 1G9EA 2X40A 1L6XA 3O3DA 4L3CA 1EJOH 2GJ6B 1P7HL 1ZT7A 1XF3A 3F7YA 3BE1H 1IRAY 1F58H 3JWOC 4S1QH 3RWDA 3AS2A 4XBEH 5EA0H 2FEEI 4WU7B 2DN7A 2OXHA 3V6OC 5I8OL 1XF2A 1GL4B 3SKJH 3KPMB 2FYYB 3S37X 1GPOH 4OGYH 2EIBA 1QLFB 4XP9L 1YEHL 1F02I 1CVRA 3LZFH 3PQYA 2NTFA 4O4YH 4TQEH 2XQYG 4XI5D 5GGQL 4JVUA 4ORGB 5IBLC 1GYAA 4JRXA 4XNUL 4ZPTB 4X6DA 1T0NA 2Y07H 4K3GA 5IJKC 2V2XB 2D03L 3IDNA 1B6UA 1OPGH 2R2CA 1JWMB 4RQQA 4LKCA 4PJXB 3TBYA 4F7CB 3D18A 4LDLB 3OX8B 4RAHA 1IT9L 2BFVL 4JB9H 4OLWH 3HI1A 4RGOH 3MLZH 5ILTL 4NNYA 4N90D 1XAUA 1MHEA 4OV5A 4MDIB 1DSFL 5JTWA 4W6XB 1NKRA 1JPTL 4YGVB 3L9RB 1HHIA 1T89A 3PGCB 5FOBA 1IC7H 4XMKH 2NNAA 1G9MC 4H0HB 1WTLA 4YBQD 2DWEB 4YDVA 5J56B 5CSBA 1TZHB 3C6LB 1C1EL 4PJIF 3VDBA 3I9GL 4M9OA 4N1CA 4RAUA 4XAKE 1WWBX 3ULUL 1MHPH 1IBGH 4GKZB 1OARH 1K4CA 4QRPD 5GGSA 1NAKH 1WT5C 3NZHH 4WHTB 3U9PH 2GK2A 5EDXA 4IJ3B 1MNUL 4UT9L 4LVHC 2R4SH 4MCZA 3ZL4L 4K71B 5CKGA 4BFBD 4GG6F 4TTDC 1RUMH 5DRWA 3HUJB 3UTPE 4ETYA 1T22A 3MV11 2VNCA 1A0QH 5JMOC 4K8RH 3W82A 1YEFL 4P2RE 4OCYL 5J1SC 4G8IB 2DIAA 3CFJA 4TUOB 4YHNB 4RNRB 3VXNB 1QSEA 2CIKA 4Y4HD 2R23B 3WFHB 4XMLH 3WYRA 1EXUA 1M05B 3TZVA 1KJ3H 1QLEL 4MNGE 1KTDA 5HHVH 1QVOA 3ZT7A 4G9DB 5GGVL 3T0EB 4OFVA 4M7LL 3HRZB 3EIFA 1A4JB 1UM5L 2ZNWA 5CD5C 1NKOA 3IGAA 1T5WB 1WZLA 3ZE0F 3I75B 5FHAL 1U8JB 1A3RH 3MRFB 4ISVB 5F7MC 4Z7WE 3MLSL 3JVGC 4QHLA 3WUWB 4U1NB 1YQ2A 2QQLL 2VDML 4PP1D 5AG9A 2ZPKH 1OTUD 1G7LA 1OQOA 1A4KB 5GIRA 4NO2B 4J4PC 4O00A 1FFNA 4IEFB 4LAQH 5AYUH 1W72B 1VGEH 4P59L 3WNNA 4DGVH 4HZLA 4XMPL 2VYRE 5DRZA 3NACH 4LBEB 1JGLL 4WUKH 4M5ZH 1D7FA 1AY1H 3WHE0 5EOCH 3CFDB 3RGVD 3UJJH 2EEAA 4L8DB 5FCUH 1PW3A 1LO0H 1PZ5A 2UUDK 5FA4B 5C0CA 1E28A 1A6TB 4E5XB 5GZND 1CZ8L 2W65B 3TVMA 3DMMD 4JR9L 3PWPD 4M5YL 3V4UL 2CPCA 2P24B 1L7IH 3BVNB 2FHFA 3P0YH 4NSKA 5F9AC 5T1KD 1AR1C 1FFPB 2PW1B 1VFUA 3JTSA 2BK8A 3V6OE 2H41A 4PJIE 3SE8L 3VXTB 5E95B 5A2JH 1KCUH 1RURH 4ZUSB 4H25B 1DEDA 2NX5A 3AY4A 3SDAC 1W72L 4A2MA 4DVBB 1U8OB 3VMNA 4WHYG 4HSQA 4ZO9A 3H9YA 4JHBA 1Z9OA 1KTLA 3VFRB 2V9TA 1UJTA 3SDDB 4NCDA 5I30H 5FM8A 4UIMA 4NT6A 1DBML 2CLRA 2MQ0A 3T0WA 2HJKA 3E1F1 3MCLH 4WO4A 3CVHA 3IFPA 2H26B 1YDPB 1ADQL 2PETA 2EYTB 1MJ8L 1RZGB 5KJRL 4OM1H 3BKYH 1V3LA 2JJSC 3VFVB 43C9A 3HE6C 2NMSA 4LRNH 4Q6IC 5DI8A 1N59A 4PJ7B 3LN5A 2DQJH 2VZTA 4YBHA 4C83B 5M95B 4P57B 3RBSA 1MCWW 3KLAB 3QNYB 3ARDA 3L5WA 1J1XL 1U8LA 4LOUD 5EC2A 2QLVB 3MBEA 2I9LA 1K4DB 4MWFA 5C3LD 5JPNA 1T66D 3VI3F 5IROC 2Q87A 4XPHH 3V5DA 5MHSD 5IFHH 4E41A 2BMKB 4FQCH 3K4ZA 1A1OA 4MD5A 3E0GA 5GSRB 1BZ9A 1TITA 1I4FB 1YYMH 1CFNB 4LPWA 5ADOL 1CG9A 1YECH 2VN7A 3MLYL 4FXGA 3PP3K 1TZIB 4IRJD 4YPGA 4ZAKD 2N56A 3VXSB 4OI7A 1P6FA 4Q6YA 2NPLX 3I50L 3OKDB 1F3RB 4OZFG 4IOIB 4JHWH 5DQ9A 4P4KD 2P5EE 3FQTB 3ARGA 4K94H 1KJ2A 2EH8L 2DKSA 4KVCL 3W0WA 4PJDE 2ZCKH 5DJAA 5J7CC 2W0KA 1NAML 1H3WM 4DFHA 4J1UA 4LCCB 4ZSOE 5ID0B 5M94B 4PY8J 2GY7B 1XF4A 3T3MF 1HIMH 2OR9L 4WY7L 1HWHB 1A7OL 2JK5A 4L8BA 2GCYB 3GSVB 3TN0A 1CXEA 3D6GA 4OBRA 1CTNA 3K46A 3FAXA 2DOCA 2Z8RA 2L7JA 2ZKHH 3OKKB 3CXHJ 5BMFL 1UH2A 2AJYH 2YR3A 5I1CH 4KUZH 1VFMA 1CL7I 4GMTL 4OZGE 4LLUB 3NCFB 4Z7UF 2XXMB 4RRPG 4PRDA 1QFWI 3O6KH 3L1OH 4PJ5A 2YA1A 4JO4L 4Y2DB 1I1AC 1CLZL 2X05A 4LKXA 5F88B 5JORB 5JW5B 1RVFL 1UACL 4POYA 1D5XB 4KAQH 3QB7C 4ODVH 5KBNC 3BISA 4GXUM 1BAFH 4DKEH 4OLZL 4JHAH 1C12A 4Y5YC 1BZQK 3VGHA 3RWGA 8FABB 1T1YB 2EDYA 3IDYB 1CYGA 4JFPA 3U0TA 4JFEA 3SJVE 4U0QB 2IBBA 4ZFOB 4P46A 2ILLA 4LRIA 3EO0A 2P46B 4OZFB 4AT6B 5I71B 1DQMH 1XIWC 3X3GH 4TSBH 4QRPB 4PV9B 1BHGA 1H3UA 2V9RA 4P5TD 1EO7A 5HPMA 4KKBD 3BP4A 1IGJA 1PDKA 5F7DA 4CJ0A 2XKUA 3VI3E 5T1LA 1PGRB 4JZNA 4POUB 5D1QD 4OIAA 4WUUD 4EEEA 4AEFA 4IHOB 5C0RH 1S9YA 4KI1A 1HWGB 2R4RH 2GEEA 2JCCF 5B39B 4EQ2A 3SGKC 4V1DA 3MRBB 3TPKA 2QJDA 4FQ2L 4MA8L 3AMLA 4Y4HB 1Z9SA 2EZ0C 1YPZB 1H3XA 2K9UA 5C07D 3FJTA 1NFIB 4X5WA 4HS6B 2O26U 3EZ8A 2EE6A 1UWXH 2FB4H 3LDBB 3MACL 1FFOB 5CP7B 5EUOA 3CU7A 5KANI 3SDYH 3ZLQC 3QA3B 1I9IL 2RB8A 5DZOA 2YZ8A 4D9RE 1W2KT 5KVEH 2VXTL 1R5IB 1J88A 3T3ME 2E7HA 1HKLL 1QBBA 3FONB 4LQFH 4WENB 1HHJA 1VADB 3HI6L 3H3PL 1IFHH 3PGDA 2EO9A 1XCTA 3QRGL 3VXRA 1S7RA 2QKIA 5EO0A 4NRZB 5H2BB 3VXPA 2ZCLH 5DGRA 3T4YA 1Y6MR 1BM3H 1CICA 4U05A 2QHRH 4LMQE 1W0WA 4KRMB 3ARQA 4YH6A 4X6CB 1A6UL 2V5TA 1U92A 3FKUS 3L5JA 4P2CG 4Z7UE 4KGJA 1HXMA 2BOCB 2Y36H 4WHTA 3S9DB 4NO5B 4WNQB 4ZD3H 4MSWA 3G5VA 1B90A 3RWCB 5HGAB 1FZOA 4ZDHB 2ERJB 1DTUA 3VFMA 1X5GA 2GUOB 4QNPF 1T89C 4JFFE 4YXKH 4X6BB 5IT2H 3CH1B 4JDVB 1FZKB 3DMMB 3A67H 4LSTL 4F7MA 1JNLH 3BKJL 1ZTXL 4DOHB 3ARFD 3FRUA 5HVHB 3VXNA 4AM0B 1CL7H 4FXLA 2GK0B 3LKOA 5FM4A 2BRRH 3VXUD 1AGEA 1MWAB 1TXKA 1ZVSB 3HFMH 3FFCE 5I0ZA 4X4YB 1QFWH 3RWFB 1B2WL 4MB3A 3TJHD 1FNSL 4WFED 1UC6A 3ZZ1A 1BVLB 3TPUB 4MXQD 4TUKH 4M6OH 5CEXA 1EX0A 1WBZA 1UXWB 4D3CL 4BZ2L 4LCWE 1BIHA 4JY4B 3SKOB 1YMMD 3PNWA 4FZ8H 3V0AC 2QSVA 4OTXH 1FGVL 1FRGH 3GMLB 1NGXB 4XRCB 5CSZB 2VITA 2JCCE 1S5HA 5I1EL 4M43L 5J13C 1WAAA 4KH2A 1RIUH 3S36L 1AXSA 5GRUL 1LD9A 4OFYA 5IHUL 3ARSA 1LO3H 4I0PB 4X6FB 3E8UH 4D9QD 3TZVC 3EHBD 5IBUB 3LVEA 4ESKA 2ADJA 1T03L 1W72A 4MB5A 3WHXA 1VPOH 1PG7L 4EXPX 2EXWC 3MJGX 4MVBD 2F54D 3CC5A 3MGAA 4PJGA 2DQIH 3VGGA 3VE0A 4J8RA 1H3VA 3NCYS 1IC4H 3QIWD 3AS0A 3CZFA 1ZAGA 4CU7A 3HE7A 4L8DA 5E24E 1NLBH 3FCTB 5J11B 3BZEA 2FSEA 5C0AE 3BAEH 3EJZD 3PV6B 5GGRY 1A6TA 1ADQA 1H0DA 3EFDH 1WCQA 2DD8H 2OMNA 5F89B 1ZLUK 3VWKD 3GRWL 1RHHB 5B8CB 3O2DL 1JCKA 4NJAL 1C5BH 5SWZE 4IRJB 1NMAH 4J7RA 4ZAKB 1YEIH 2IQAB 5CUSL 5E2UH 4WWKD 4MD0A 4PJHA 3DO3A 3HNSH 3WMSA 2BVUA 3LKRA 3NPSB 3GMOB 3MJ9L 4OLVL 3QIBA 3OZ9H 4MB4A 5IFJA 1LO2L 3NFPB 3VFTA 1A3LH 4U31A 4O02H 2CH8A 4HLZH 4L3ED 1FORH 2OMBA 2FX7H 2VOTA 3GSQB 1AGDB 3BWUC 4U1HA 3TVMC 1L0YA 2VXQL 2YC1B 4QCIB 3U30C 5ITBH 1MY5A 1S9XB 4CVWA 3TCLB 2WIIB 1GZPA 3QUYB 5IWLA 1HNFA 1G9NC 1UZ6E 1MJJB 4FQXD 1Y18A 4MX7A 5EUKA 2UZIL 5TDOB 3VRLF 1ZHLA 3BDBA 4DKAA 3V0VA 3AY4C 3DVFA 3PQYE 1ZHNA 4YXHL 2CKBH 2QEJA 1KJMA 4FZEH 4B7LA 3WLBA 1HYSC 4JRXE 4X6DE 3T3PF 2Z8VC 5T1MB 1NAMA 5IV2B 3L3OB 5T1DH 1CDYA 1K4DA 5DZLA 4KROD 1D5BA 2OZ4L 1OGAE 3MRCA 3GK8H 3BUYA 2MPAL 4WO4C 2BMKA 4GS7C 1F90L 3GSNH 2ZZUT 1P1ZA 3DX8A 4MS8D 1LP9A 4KJQD 2VL5A 4EN3D 4DTGH 4U1KA 2C1OB 3MC0A 1FV1A 4G80B 3ARDC 4JFDD 5JHLH 2DJ4A 5MEOB 2NTSP 2EC8A 3B6SA 3MBEC 4DUVA 2F5BH 2XZQL 1C16A 4J6RH 1ED3B 5ID0A 2X09A 3PXHA 4KJPC 1P5UA 4HW6A 1XZ0A 1DQDH 3IAPA 4WUUB 5KSBF 4CGTA 4MLSA 4MD4B 1TCRA 4P4RB 1B0RB 4P2YA 1L7TL 6FABL 2R0ZH 4IIQB 5JW3L 1JN6B 4M7KL 1T4KA 3BQUD 3J8F7 3E6HB 3B9KA 4OD1L 1KN4H 4OF0A 4R7DB 4PJFF 2ZWLT 2MCG1 2C7UA 4YDKH 4X8JB 3MNWA 3ARGC 4WTZG 1QSEE 1IEHA 3TBVB 3OAUL 4JPVH 3OJ2C 1UKTA 3S4SB 1KIQA 1AD0B 1MCCA 3MRJA 4GUPA 4PBWD 3LH2L 1UWXK 2VDOL 5FYKD 1I9RL 1L9NA 5IB1A 2YOCA 2BSTA 3TN0C 4H5SA 2R1WA 12E8L 1FCGA 4WU5A 1VGKB 1P4IH 1U8NA 3A6BH 3E6FA 2EDQA 3LEXA 5CHNA 3RWEA 5GZOC 3KAAA 1T20A 4N5EC 4BFGA 4KZDL 1N6QH 3TNNB 4KK9D 2Y6SD 5DGQA 4QRPA 1IMHC 3T2NL 1KULA 3BZ4B 1DEEA 3KPRB 4H1LH 4B0MM 5BV7L 2HVKA 3TBTA 3PXJA 1X4ZA 4FXKA 5EU6D 5DD1L 1J87A 4HWNA 1DBKL 3BFOA 3L3KA 4XPGH 3EUUA 1A6WL 2I25N 5C0FA 1T2QH 1CE6A 1DZBA 1WCBA 5D7SL 2DL2A 3F58L 4M6MH 1MEXL 4G7VL 4DEPC 3ZTNH 1OT2A 2P42B 5IVXA 4PGDA 1KCVL 4YBLB 4KQ3H 4P46C 2HKHL 1EEUA 3EYOB 4LRIC 4R4NC 2AXHA 3MV9A 5DR5L 4X7TA 3GIVA 4U6XB 2R2HA 1J0JA 5FECB 2EDNA 4RRPA 1AGBB 4LLVB 4G6JH 1KN2H 1HI6A 1QBAA 4HC1H 4J3TA 4HWBL 5I74B 3QDAA 5JLZA 3MA7B 3QSKB 4POZC 3GSRA 3ILQC 5ESQA 1U91A 4IM8A 4CNIA 1SYSB 2NX5E 2ZSVB 5HGDA 5DD0L 3JV6B 3LEYH 3CIQA 5D2LA 4EVNB 3CDYA 2J8HA 1NLDH 4FQPA 1R3KA 4LL9A 1YMMB 4JVPA 5DUMH 2A83B 2ESVA 4OLXH 4NWTL 4K9EL 3U4EA 3V6ZA 4G3YH 2FD6L 4ZUWA 1I1YB 3GKWL 4QRSA 4NBXB 4YC2C 1SEQH 3ULUC 4M7JH 2BNRB 2FRGP 4PJCA 2YBRB 4KZEH 5IW1B 3C9NA 4S1SL 4X6EB 4RGMC 1D9KD 1MIEL 5HHPB 1IEBB 1JZ7A 1X5HA 2FO4A 4OF7A 3T4AB 2F54B 2XZAH 3E3QC 2BRQA 1NQBA 2Q7YA 5HGAA 1NEZG 4LCUA 4LSUH 3S35H 3FB6A 1RUPH 4U3XA 3QI9A 3RGVA 4G8EA 2I26N 3TT3H 4WEBH 2OL3L 3FRPG 4N9GA 3VW3H 3E2HB 5TQ2H 3TNMB 2Z9TA 2D7TH 2D9CA 1FZKA 2Y7QA 3DMMA 2PW2A 3RIAK 3ZYOA 3L3GA 3PWPA 4MCYA 1KOAA 3VWKB 1DQQA 1CICC 4PTUB 4E41E 3QEQD 5K9OA 3P3YA 3C5SA 4UZGA 4HWEL 3MYJB 5T1KA 3QZWG 4EKXA 2YPKB 5F7FA 3GIZH 1XT5A 2OTWB 4OUOA 3MZGB 3KYKL 1JNJA 4HCRH 5FM5M 3ULUF 1FBIH 4ODWA 3L3JA 2XTJB 5F7UA 5JW4N 4JFQB 2V2WB 3VXMD 4K71C 4OSUL 5CEZD 4OT1L 5EBWB 3CSYB 5DT1L 1S7WB 3CFBA 3K1KC 4B53A 2VLKB 3G5YB 3W0WE 1RK0B 2D4DA 2ZOLA 4JPKH 4TSAH 1Q38A 3GRWA 2W07A 3O2DA 4XVSL 1U8HA 4M48L 1CIUA 1GGCL 2IC2A 3IJHB 5EULV 2XPGB 2A77H 4DN4H 3BSZL 1H3PH 2WLZA 3IYLW 1YN7B 3BPCA 3DUUB 1JNNL 4BSVA 2EICA 1Z5LA 1Q72H 3SCMD 3MJ9A 1N5AA 3RGHA 1XR8B 2NW3B 4I48B 3MGTA 1TENA 1I3GH 3OXSB 1LO5B 3M8OL 4HULB 1NEZB 4HH8A 3BEWA 1AFVL 4LPVA 5DVLA 3BUTA 2Q3AA 1EDQA 4KROB 1INEH 4LEXL 5IQ9A 4PJ5E 1D6EB 5D6CB 3MROA 1I9JH 1DL7L 5D70H 2BDNH 5DMIH 3BPOB 4M62H 3B5TA 1FP5A 5KVMC 5B8CA 3VXOB 4AEHH 3CLFH 4Z95L 1PKOA 4NQSA 1LEKA 1AO7D 4Z78A 4EN3B 5HDBF 4HK3N 1JK8A 4XPFH 1ORSB 1ORQB 5F72S 4JFEE 4MJ5B 4JFDB 1OP3H 3SKMA 4PJEB 4P4KA 3LS5H 4OFPA 3EW3B 2ORBL 1YEKH 4P23D 4DK3A 2R29H 2ZUQC 4O51B 1BGXL 3HE7C 4CN1A 2OZ4A 2F8XC 4XVUD 4YHIA 1HHHA 1I8KA 3KLDA 3THMH 5DJDA 1MAKA 4UILL 3VG0L 1PFCA 2XNAA 3F6IA 3UTTD 3KNBB 1RZIB 2F58L 2UYLA 5BJTA 3BQUB 4CMMB 1KGCD 1XGQA 1TQCC 4R26L 1VEMA 4GAGL 5CILL 1CF8H 1WIUA 3N9GL 1CDJA 3F7PC 2NR6D 4XP4L 3QIBC 4V1DE 1P7QD 2D7PA 2VXVH 3HR5B 4OCMC 3ABZA 3ULUE 2HT3D 1FZMA 2HJLB 2I07A 4GKNB 4NHCH 4PGBB 4HJJL 1JHKL 1F6AB 5EUOE 1BOGA 3DX6A 2KZ1B 4K23L 3RVXC 4PJFB 4N0FB 3E3QE 4FABL 1R3LB 3R06B 1XR9A 3IFOB 1SY6H 5IWLC 3ZKXC 1RMFH 4UTBL 1CVSC 5IW6B 3HAEB 2VE6A 3FQXA 5LAXA 3I3EA 4J3VA 4K55A 1MVFA 5CIPA 5D1ZD 2JJTA 1ZANL 2JJVA 4L8SA 1A2YA 2WBJD 3QFJB 1N7MH 1XF5A 3VXRE 1JIBA 1HKFA 3HZVB 3U6RB 1FGNH 4M4RA 2C4XA 3NCEB 3QNZB 3HB3C 3RDTD 1ZLWH 3GB7B 5KOMC 4XTRD 4P5TA 1KPUB 2OR7A 2FL5A 2NLJA 1NC4A 2BNQB 2H45A 1DFBL 4JFOA 2HFGH 4PJHF 5B38B 2UWEF 3CVIH 4MA1C 3LIZH 1LK3L 3V0WL 1L0XA 4AIZA 5D1QA 2YWZA 3MUZ1 4HK0A 1YEDA 5FYKL 4X0KA 4P4RA 3KJ4B 1FNEB 5J1AB 4IIQA 2P7TA 1CFTA 2PYEB 1MFBL 1JPSL 1UJ3B 2Q8AL 4OCLC 3QQ4B 2CLZA 3DPBA 5KVFL 5T5FH 5GGRA 4N0YH 1PYWB 2Q86B 2AW2A 3RKDC 1RD6A 2XI9A 5C07A 3QO1A 3OF6D 5HI4C 4PRPA 3EO1A 1QFOA 4XAWH 3ROLB 1NSNL 3Q6FA 1JF1B 4YDIL 5E8DL 2LABA 2X4SB 5DEFA 3B9EA 3QJHB 5E6ZA 5DD5H 5FKAB 5MERB 3L3IA 2K7PA 3H3BC 1MCKA 3B8SA 5B4MD 2HTLD 3MUGA 5LGHL 1MREH 5IEKA 2R0LL 1RFDL 5EOCJ 3P0VH 3SY0B 3B9KC 4MAYA 1YQVL 4LARH 4XI5C 5LJYH 5LBSH 2UVFA 4QRQB 3VRJB 1UM6L 2BSRB 1LP9F 1Q9WB 1WAAE 4HWBA 5CGYD 1D9KB 2DRUA 4TPRH 1NGQH 4MA7L 3R1GL 5HYQB 3IDIA 1Z9LA 5C9JA 3DECA 5TDNB 2HLFD 4JO2L 4NZUL 4PJGE 3WDIA 2YA2A 3MPCA 4PTTB 2BNUA 5TF0A 1IGTA 2Z91A 1KSRA 3QCUL 5I1HL 3W9EA 1YN6B 1UWEL 1JWSB 2K3TA 4S1RH 3PJSB 5I15L 2A6DB 4HK3J 3ARFA 4U3HA 1ZT4A 2VDPH 1EEQA 5I71C 5BQ7B 1I3UA 3VXUA 5F9WC 2NY2D 4WTZA 2O5ZL 4G6AD 2IBZY 4NM8L 5JHDD 5L88L 4ODSH 1Z9MA 3VGEA 3QEHB 1KLUA 4DGYH 5C2BL 2N7AA 4MQXC 5DVMA 4P5KB 3P4LA 4GW4B 5TJWK 1NFDA 2R15A 3STZB 1ES0B 1VKXB 3OXRA 4PJHE 5FUOL 2C4FU 2OL3A 1R24B 3HPJA 3JV6A 4UDTB 1KCSH 1FPTH 2H32H 1XFPA 4DZ8B 3Q0HA 1JGVL 1SYVA 2VLRB 4GKOA 3UJIH 4GOSA 1I7ZA 3C2SA 3G6DH 5J1TC 2HKFL 2FBJL 4Y4HC 4J3SA 2R2BA 3SEPA 2DQHL 2IH3A 3VWJB 1ZHKB 4HKJB 3TO4D 3EDKA 2XFXB 3SCMB 4X6EA 4UT7L 4XCEA 4PRBB 4YHPB 1YEGH 3HG1B 5DHVH 3CFEB 4KV5F 1XCQA 3G5ZB 4U3CA 3ZHDA 4AENA 4BZ1H 4HUXA 2XZZA 4PJ7E 2MTPA 4PG9B 2R0KH 3QIWA 5E00B 2CIIB 1QSFB 1KNOB 4U1MB 5CEZL 1B0GB 1J05B 1JWUB 1UH4A 4NHUB 4RISL 4AG4H 4NNPH 5HDLA 5KVGH 5D7LA 3V4PL 1Q1JH 4F9PA 3BW9A 2H9GB 4Z77A 1F13A 1HZHL 3L7FB 2GHWB 4PP1C 5BOZG 1OTUC 1YEEH 3SDCD 3N1PC 3BKCL 5AUMB 3V7AG 2WM0A 3Q6GH 3OKLA 5D71H 4OAWA 5IVXF 4WWKA 1CQKA 1LP9E 3N50A 3OSKA 3TBWA 3ARRA 5GHWH 3DXAD 3WKML 3OPZH 1IL1A 2Z92B 4NQDB 1FJ1A 3VXSE 3DSFL 2X44D 2FJFA 3MBXH 4HHAA 3ZT5A 4Z0XA 4P23B 3ORJA 3QI9C 2ED9A 3RGVC 2R2EB 1A02N 1OP3K 1NANI 4FFYH 3FB8A 4L3EA 3DUSA 5MEND 1B3JA 3EYQD 1CDGA 1RK0A 2DTSA 2YRLA 4R9HA 5HYSB 1AR2A 4Q2ZB 3DMMC 1EJOL 2KQMA 5SWQB 3BE1L 3RI5K 3S3JA 2MSPA 2IAMB 1LEGA 1F58L 5D2LF 1JHTA 4FQXA 4XBEL 1U2HA 2W60A 2VSCA 5LCVL 3SKJL 4M3JA 3TBSA 1GPOL 3MV8B 4HIJB 2IGFH 3C2AH 1Z0NA 1NDMA 4KTDH 4CAGA 1D5MA 3OKNA 1LK2A 3LZFL 4O4YL 4PJCF 3OAZH 2CJUH 1NEZA 2G5BA 4MXVF 5DJCA 3VGAB