5IVYA

Linked kdm5a jmj domain bound to the inhibitor n16 [3-(2-(4-chlorophenyl)acetamido)isonicotinic acid]
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
317
structure length
300
Chain Sequence
EFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEVKSFRFTPRVQRLNELEAMTQAVREYTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGSGFPVKDGRRKILPEEEEYALSGWNLNNMPVLEQSVLAHINKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIMNPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 5A
publication title Structural Basis for KDM5A Histone Lysine Demethylase Inhibition by Diverse Compounds.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 91
structure length 300
sequence length 317
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5ivyA00
4UF0A 5FV3A 5FZ3A 5K4LA 5FYIA 5FZ8A 4D6RA 5A3TA 2XMLA 4QX7A 5FZHA 3LDBA 4NUBA 5FZBA 5FJHA 3PDQA 4CCJA 5FPAA 4BU2A 5IWFA 5A7OA 5FUPA 5F3GA 4LXLA 5F5IA 5FZ7A 5A3WA 3PTRB 2YU1A 5F2SA 5F3EA 5FZLA 5FXXA 5FYYA 4E4HA 4EZHA 5FZ4A 3PUSA 4Y4RA 4V2WA 5A7NA 3PURA 4D6SA 5FP4A 5F37A 4IGOA 4QXCA 4CCMA 5FY0A 3AL6A 2GP5A 5FZGA 4CCLA 5FZEA 3ZLIA 4GJZA 4XDOA 4CSWA 5IVVA 5FPUA 2XUEA 5A1LA 2YBPA 4UF0B 5FYBA 5FYUA 4LIUA 5IW0A 3RVHA 3PUAA 5CEHA 5IVFA 3NJYA 5FWJA 2XXZA 5FZ9A 4D6QA 3PU3A 5LY1A 3DXTA 5FXWA 5FPLA 5A80A 5KR7A 5FXVA 4QXHA 2OQ6A 5FZDA 5FJKA 3PUQA 5FZ1A 5FP7A 3LD8A 5FP8A 5FYHA 2Q8EA 5F39A 4DO0A 3OPTA 4IGQA 5A7WA 4AI9A 4QU1A 3N9PA 2XDVA 5E6HA 2YBKA 5FZKA 4EYUA 3N9QA 4CCKA 3K2OA 3KVAA 5FY8A 3PU8A 5LW9A 2P5BA 5FUNA 5FY9A 4GAZA 5FY5A 5A7SA 5IVYA 5F3CA 3KV9A 4C8DA 5FZAA 4CCOA 5FYTA 5F5AA 4GJYA 2Q8DA 5IVBA 3N9MA 2YPDA 2WWJA 3N9NA 4ASKA 3DXUA 5FZ6A 2YU2A 3KVBA 5FZOA 5FP3A 5FP9A 5FYZA 2OX0A 5A7PA 3KV4A 3AVRA 3K3OA 5ISLA 4QXBA 5A3PA 4BXFA 4DIQA 5F3IA 5FY7A 4URAA 2WWUA 2YBSA 3UYJA 5A1FA 3KV5A 5FZMA 5FYMA 5FZIA 4HONA 5FZFA 2GP3A 3N9OA 3ZPOA 1VRBA 2PXJA 5FWEA 5IVJA 4LITA 4Y3OA 4HOOA 3N9LA 5A3NA 5F5CA 3K3NA 4CCNA 5FBJA 5IVEA 2Q8CA 2OT7A 4EZ4A 2OQ7A 4Y33A 5FXZA 5FZOB 4XDPA 5FYVA 4LIVA 4CUGA 5FYSA 3AVSA 5A7WB 3KV6A 2OS2A 3AL5A 5FPBA 4GD4A 5LWBA 5FZ0A 4QX8A 3OPWA 5F32A 2W2IA 5FZCA 4TN7A 4QWNA 5FYCA 5FY4A 3U78A 5IVCA 5FPVA 5F2WA 5LY2A 4V2VA 5FY1A 3U4SA 4AAPA 4BISA 2VD7A 5A7QA 4IGPA 5ANQA
chains in the Genus database with same CATH superfamily
1UIKA 2CWMA 1RJ8A 4UF0A 2VW0A 2XJVA 2J1VA 4OUSA 3VLBB 2RR11 1QJY3 2ZGUA 3RZGA 1SHWB 2WNVA 3GJBA 3WY6A 5F3GA 5F5IA 1J58A 4IEUA 1N47A 4UFHA 4XUQA 1IG3A 3PUSA 1REFA 2DVBA 4QXKA 4R9DA 2EXHA 5FP4A 5L9RA 2WO3A 2ZKNA 5JIAA 4AI2A 4Y1VA 4CCMA 1NCRC 4CCDA 5AVAA 2B9UA 2C9AA 4Q0PA 4JKMA 2WNUA 1WLCA 2ZZQA 4DFSA 2BGPA 2PHRA 1KRIA 3BTAA 1CAWA 2BOIA 4UW6A 5G05L 2VZUA 5LRSA 1DLLA 1L7QA 2HH9A 2JDKA 1H9PA 4QB6A 2LTNA 4CDQB 2XXZA 3MDPA 3NNJA 5FOJB 3T3YA 3ZPYA 3I3BA 4AGGA 1GZ9A 1UX7A 1SZBA 5KXCA 2OQ6A 1SFNA 1VPHA 3TRSB 1BLZA 2E26A 2FHRA 3P1IA 1YNAA 4TLFA 4ATFA 3APBA 4MHUA 3Q8BA 1AYM3 4IGQA 3SCGA 4JQTA 2XKOA 4Y1UA 5I93A 1XOYA 1YWKA 3WCSA 4LO8A 4QAWA 1RC6A 3POGA 1J83A 1SBFA 3JB4C 5KXDA 3LEKA 5EQUA 4LKDA 3IDAA 2AC1A 3OD0A 3AMNA 3C2UA 4GAZA 4L9BA 2NPIA 2HBTA 4BIOA 4IERA 5F3CA 5HCBA 3VBHC 3M3OA 4JDOA 1CR7A 3KT7A 2F6BA 3FLPA 3SNMA 4QM9A 2HWB3 3FUOA 4XFGA 4R4XA 3WG3A 1ALYA 4KMQA 3O1MA 2WS92 2JG9A 3J7NA 2SBAA 1RUG2 5H9PA 1JZ6A 3AJYA 1C3HA 3KQ4B 2Z42A 1MZ5A 4FPLA 5FY7A 1JBCA 3FBYA 3HNBM 3OUHA 4DUVA 5EIYB 4CDWB 4PQ9A 3WP6A 3KV5A 5T3NA 3LIHA 2QDRA 1VAKA 3ZSEA 5CFDC 1C8M3 1KFXL 3BU7A 3HWJA 4JKKA 5D8AA 4H55A 1FPN2 1LOEA 4BQ4A 3FJSA 4KGGA 2J1SA 4GKXA 1KITA 2FZ1A 3RS6A 4E2QA 4FOVA 4IDZA 5JI9A 1ZRFA 4XFFA 5KXBA 2ZGLA 4GA9A 1LEMA 4XXAA 5JXJA 4CUGA 1VBE1 4LBNA 1HRV2 5K0UA 3SH5A 1AXYA 1CPMA 3DKQA 3O0VA 4QMAA 2OS2A 3WINE 5DZFA 5FLJA 4AF9A 4FBFA 2QDNA 4JHZA 4QX5A 1AZDA 2W47A 1QNYA 2YY1A 2EXJA 5FYCA 5IVCA 4EJRA 1K12A 3FHIB 4A6SA 4EWEA 1RL3A 1XRUA 4QPWA 4QT6A 3N7JA 4Y26A 1DQ2A 4IGPA 2RR12 1G86A 4Y20B 3VBHB 4AR2A 3OGSA 3VBFC 4AEDC 1LKNA 3OGVA 4META 1FMD3 3RYRA 2IZWA 3T4VA 3I2GA 3T2PA 3AKSA 4GIQA 4XIKA 2VC9A 1H1IA 2VQAA 4CEYC 3V65A 4A3XA 1OLMA 3SHRA 2EALA 1LJ7A 1TMF1 1ZA7A 3AZZA 4Q4V3 3JQWA 1G9FA 1LENA 3GALA 3I2KA 3ZR6A 4AXOA 5B4XA 3DECA 4P08A 2WLPA 2ZBJA 4UBHA 1J3QA 3I59A 5GLTA 1SLTA 1UU4A 2MEV3 2XLGA 5CAZA 2BBAA 1J1LA 4XDOA 5LK7B 4YG0A 3EB7A 2XUEA 1EY2A 4RR3B 5C9AB 1JZ7A 3VD3A 4N53B 2UWCA 1HQLA 4M3CF 5FYUA 3URFA 5CKMA 4FPJA 5FUIA 1DGRN 5EFUA 3THTA 1HRI1 4L97A 3MBWA 5C3QA 5FWJA 2WNOA 3KM5A 3WX5A 3ZYRA 1QOOA 1HIXA 3UETA 2VUAA 2NLRA 4CEWC 5FXVA 4Q0SA 5IFTA 1YUDA 2RS33 3IWZA 3MIBA 3NAPC 4WM7A 3BU0A 3LD8A 1ST8A 3M4FA 3VZOA 2C0ZA 2VCBA 1W6MB 4DXRA 1W2NA 4D8MA 4TXWA 2V73A 2IXHA 4AW7A 4HMZA 3T2TA 5KHJA 5LBCA 1GOFA 3VBRC 1GQPA 3WQ7A 2W1QA 3CJIA 2DF7A 1W90A 5CKNA 4DUXA 1OA3A 1VBC1 4N90A 4QKBA 1W8ZA 2DCYA 4I30A 2BU9A 3OUJA 5IAVA 3USUA 1QGLA 1DZQA 4KU7A 4XCAA 1QDCA 3ZXJA 3NV2A 5EXOA 4AHYA 4FQZA 2QQLA 4KBBA 4AK3A 1HW5A 1Y43B 3B94A 4WM8B 5DG1A 5A32B 5E89A 5J37A 2BP6A 1MQTB 1TQ5A 2XB6C 1HJGA 1R091 5BNNA 2W39A 3AP6A 3AVRA 3POFA 1KDMA 2VQUA 1QWRA 4QKFA 4UFJA 4RD7A 4CUCA 4QD2A 5A3PA 4E27A 4PLOA 1QJX1 1ASJ1 3LQCA 3ZIXA 5KHHA 2C24A 2WZR3 1POV1 3NMBA 5CIRA 2PLV3 1TZOA 3WP5A 3OGJA 3FN9A 5SV5A 2E32A 4XF4A 2HWE3 4HKLA 1YYNA 2FCUA 1QJY1 2L9LA 2WNEA 4LITA 2ILMA 4RQPB 5BNOA 1Z0HA 2B9VA 3B9CA 4CP9B 4MH0E 3N9LA 4LBOA 3OBAA 3ZSKA 2OT7A 3JQXA 3IDCB 3LEGA 4MGKE 1VBE2 1WGPA 3U0ZA 1JI6A 5AVPA 3POWA 5FXZA 1AXKA 1LODA 1W04A 1J1TA 2C1FA 5C71A 2ZHLA 5L7OC 2BOJA 2WKKA 4XFCA 2ZACA 2SLIA 3UGHA 2NP0A 1ND2C 1LOCA 1XSRA 4RGAA 2VZ1A 4QX8A 1BMV1 1H8VA 3L2YA 1WLTA 2RJ2A 5LK5A 1GLHA 4AFAA 4JAAA 1G6NA 4ZZ8A 2VQTA 3BOPA 4B7KA 3CEWA 1QQP3 1DGLA 1X8EA 1UZWA 2Y34A 4Q1PA 5EYXA 3RZJA 3POYA 3WQBA 3U1XA 2G1MA 2PA7A 4CUAA 4A3ZA 3P5BA 5GM0A 3SH3A 3WW3A 1W6QB 3MW2A 1VR3A 4ET7A 4CDQA 1AYM1 2KXLA 5CG8A 1ONAA 1TMF2 3VDDC 2P34A 2Y0IA 1ZNPA 2XGXA 5FMBA 3MZHA 1NZCA 1W9WA 1DU3D 4XW3A 4IGOA 4FFGA 1FV3A 4WVWA 4NAMA 5FY0A 3GF6A 3WR0A 1YI9A 3LEMA 4GMP3 3SLIA 4CSWA 4PT6A 1PVC3 4QPIC 2IFRA 5A1LA 5E1RA 4LR4A 1OVSA 4JRAA 1HRI2 1XU1A 3RVHA 3B5LB 3E97A 5JMCA 2HWB1 3NJYA 3NNMA 4RGGA 2D97A 4FPEA 3I2HA 2BDRA 3DCQA 4IV3C 3IPVA 4JC1A 4P5HA 5FO7B 4W6YA 1DQ5A 1NE6A 5DUXA 1TVGA 4Q1RA 5DDJ3 1GWMA 4HBNA 3I2JA 4RFRB 5FP7A 5IT6A 5FCCA 2OZJA 3DL3A 1A6CA 3N36A 3RGBA 3SISA 4QU1A 2VW2A 1W2OA 2D3SA 1W9SA 4I0AA 4XAEA 1PX3A 1H1MA 1C8M1 4CCKA 1VBC2 3B69A 2HYXA 5CFDB 1O3TA 2QKDA 4F7ZA 5FUNA 4Y5SA 4CUBA 5FY5A 1ZBA3 1AX1A 1YEWA 4UAPA 1NQDA 2Y6JA 4AYUA 3M8LA 1ULPA 2WRAA 2X53S 5CADA 2D6NA 1JYNA 2BYVE 4TSVA 3BUCA 3MIEA 2A3YA 2VVDA 2VU9A 5L73A 1R092 5FP3A 1H2KA 1BK0A 2K2SA 1NE4A 1ASJ2 4OFGA 3POEA 3A23A 4NVPA 1UMZA 4OHVA 4BA6A 3HEIA 3UYJA 5GZDA 2VOTA 5J1XA 2IXKA 1QJY2 4HPKA 2VECA 1OOPC 4YW4A 3K77A 4XQDA 3X29B 1FMD1 2C4XA 1LOBA 2ZXQA 4XDQA 4AEDB 5CYYA 2GNBA 4BQWA 4FAGA 1NLQA 3AZYA 1WLDA 4XFHA 5I8SA 1GP5A 1OF4A 2N7GA 1D2SA 2X09A 3MI8A 3O5SA 5T5LA 4RN5A 3VBFA 2TBVA 4DXZA 2ZCWA 2BZDA 4Q4V1 5EJZB 1YQ6A 2ORZA 5FYSA 4O9EA 3S0MA 3EMRA 2MEV1 3ZSLA 5I0SA 1PO22 1Q43A 5IAXA 5A70A 2VCCA 4YM1A 4UFMA 2YG0A 1GQHA 2QQUA 3HPNA 5HV0A 4LORA 3IZOA 3BB6A 4E2SA 3KT4A 3UNPA 5KHIA 4YW3A 2YC0A 4EV0A 5ANQA 2X5IC 1WCKA 1UO9A 3C7HA 3JZVA 5K4LA 2WSUA 2RS31 1AYM2 3NAPB 2W94A 1L7LA 2PELA 4CEWA 1H30A 1UIJA 2XJRA 4G4FA 3JBG3 4NIGA 1R64A 4UWDA 5LASA 4LHKA 4XBNA 1VAMA 4JV4A 2GNDA 1H2MA 3D0SA 1HQNA 2DBNA 3OEAA 3VBRB 3F2ZA 2YGLA 3GZAA 3HJRA 3S5QA 2P2KA 3B01A 2FBEA 3HAGA 2R1BA 4W8JA 3W20A 5M0TA 1I1EA 3BKZA 4GJZA 2TUNA 1UNBA 5FPXA 3AKTA 1YJKA 3GHMA 1G8WA 1ULGA 4FP2A 3TEXA 2O8OA 2VZOA 3FL7A 2HWB2 1W6NA 1PM4A 4PDWA 4DNYA 3AP4A 1JZ3A 2UY9A 2XJTA 2HKXA 2I45A 4WVMB 5CEHA 2W1UA 2YUEA 1YFWA 2VMDA 2D6KA 4IEZA 4AGVA 5JOWA 5A3LA 3WUCA 5KR7A 3DPRA 4QDRA 4DY5A 1B09A 3FHQA 1CAUB 5FO9B 3ZXEA 3TB0A 1WKYA 1UY2A 2HWC3 2WZR1 5BNQA 3J9SA 4FFFA 1C8M2 3PTYA 2PLV1 1GBGA 4GWNA 4CDUA 5DZEA 3ORJA 1CIWA 4HL0A 4P00B 2HWE1 3M7AA 3MLLA 2HWD3 1CX4A 1FX5A 4XF9A 1Y3TA 4D7SA 3VBUC 3AP9A 3WHTA 2BWCA 4CP1A 4X8PA 4PF5A 3J7HA 4KNCA 3VN4A 5IK5A 1BEV3 1FXZA 1BBT3 2J7MA 2W91A 1HB2A 2D93A 3LOIA 4QX1A 3WNXA 4COUA 2JICA 4EWAA 2VMFA 1V6MA 1OH3A 5CZKA 3O1SA 1U12A 1GNYA 4BHPA 3LEIA 4BPZA 1BYHA 4Q8KA 4YM3A 5JLVA 1Q3EA 2PAEA 2WNVC 3AYCA 1FATA 5L7OA 3GDBA 1VBA3 3FHAA 5HPOA 2UY8A 1QKQA 1ND2A 3K3OA 2WZPP 3ZVXA 2AUYA 4YW7A 3MYXA 5FDBA 5ISLA 3NQHA 1SLAA 4IEPA 3T2OA 1OKQA 4W65A 1QQP1 3E6CC 1I5PA 2VULA 4ZXKA 5JR2A 3ES1A 3EJKA 2BVVA 5LRRA 2KD7A 1FMD2 2ZHKA 3AKQA 4AI3A 3OB8A 3C7OA 5I0UA 3WG1A 2BERA 3Q9OA 4ES8A 1ZRCA 3HQXA 1Q8QA 2ZMKA 3B02A 4LHLA 5GALA 3Q8AA 4CP2A 1XPWA 5IJRA 2XLFA 5C3RA 2IFWA 1W28A 3W9AA 1CAVA 4Q4V2 3VZNA 4HANA 2RDQA 1VIWB 4QB1A 4GALA 4AI1A 5KC6A 5FZOB 1NCQA 4XHBA 1X50A 2MEV2 3WG2A 3KV6A 2CGPA 3PHMA 2VNOA 3QBQA 1ZZCA 4I09A 5FQ0A 4GH4C 3AZXA 4GMP1 4M3CE 5JZGB 4OUMA 2XPJA 1PVC1 2OPKA 1LGBA 4K21A 3VKNA 1SLBA 2RJKA 4QPIB 4RFT0 2XQRA 4K7JA 2WO7A 2JDPA 1DYKA 5FPVA 1KEXA 2XJSA 3AJZA 4HT1T 2X29A 4YRDA 2X10A 2A3WA 1ACCA 2RS32 3IDEA 2BNOA 4HK8A 4IV3B 3ASIA 2OUHA 1NY71 3MHZA 5DDJ1 5LEKA 4NUBA 5FJHA 2A6VA 4XBLA 2XOMA 2Z4FA 4Q26A 2YHJA 5IWFA 5A7OA 2R32A 1Z78A 3IDBB 1PO13 1F35A 3HBZA 3J8F3 5FZ4A 4EE2A 2JG9C 3CZJA 1GMMA 4Q4Y3 4BXSV 2Y0OA 2XJUA 1GWKA 2DUQA 1LHNA 1ZBA1 3PIJA 1US3A 3ZFEA 3LGRA 1QOSA 1O6UA 1WUVA 4DOUA 2V5DA 3RWKX 2OYZA 3UGGA 1QIQA 2V5YA 1IPKA 1LESA 5FYBA 4MG2A 2V4VA 3BALA 3TN92 2ZGPA 4HG6B 4COVA 5LEJA 4QX2A 1JZ4A 1HKDA 2DFCA 5D8AC 1T6BX 1U5YA 3RDIA 3BTYA 5FZ9A 1LHUA 3MICA 4XUPA 4EWDA 3O1PA 4OHZA 2Q1ZB 2ZX4A 5CFCA 4JCKA 2CU5A 4EN8B 3ELNA 4N9IA 4ZHNA 4IESA 3LWCA 4CCCA 1PZ7A 2WZR2 4CPBA 4OZOA 2G4IA 1YJLA 2GMPA 1C57A 1E5IA 1SPPA 1XE0A 2PLV2 1VBD3 1YC61 5JOZA 3ME2A 2HWE2 2PQQA 4PBOA 3N9PA 4IW3A 3T0DA 2EIGA 1RXFA 1WMDA 1OD3A 1OOPB 2ERFA 3CBNA 3CU7A 3LKJA 2WAAA 2ZABA 4K40A 3RZZA 3UKNA 2DVGA 1W99A 3AFGA 4SLIA 1U5XA 4AVSA 1RINA 1IHMA 5FY9A 4A4AA 5J7MA 1PGW1 4LO7A 4DRVA 2XVLA 1OQDA 5GJ6A 3CDZB 3D3AA 1OA2A 1AR72 3N9MA 3VKLA 4DB5A 2A73B 4FFHA 1W2UA 2D98A 5ABJC 1DIWA 3KGZA 4GB33 1OSGA 4YZ3A 1UX6A 1K5MA 1ZZBA 2DUPA 2MPFA 4ORFA 1QQP2 2ADEA 3ZOIA 3S7EA 1W2TA 4AI8A 1LAJA 4Z92B 1O4YA 3LAGA 4NHXA 2WWUA 3NV1A 3RYPA 2D6OX 3R05A 3QACA 4JGZB 3H50A 5FZFA 3BN6A 1SDWA 3N9OA 3ZPOA 3RYKA 1OLRA 1MS8A 2X5IA 2WZ8A 2J22A 3ZMOA 3JBG1 2VZRA 1T6GC 5A3NA 5F5CA 4YFWA 3I49A 4EROA 3DYPA 1RYYA 3PMSA 3A0NA 5KWRA 4BE3A 4HN1A 3JXSA 4IQPA 2CL2A 2B45X 4CCEA 3MPPG 3SITA 2F4PA 2VL4A 3MUY1 2A71A 4YZ2A 4WM7C 1PVC2 1R083 4KWUA 1R1A3 4GD4A 5JPMB 3OGRA 1ZM1A 4CU8A 3H1YA 1ULDA 4UT5A 2BNMA 1AVBA 5F32A 3O1RA 5FMOL 4E4ZA 1KQRA 2RDNA 3H8XA 1S0GA 4XUOA 4EN0A 1QJZA 1DBNA 3OYWA 1NY72 5A7QA 4CTEA 5DDJ2 1MS4A 4DUWA 4YG6A 4FPHA 5B2GB 4JTNA 2ARAA 5ERLA 4PHZA 3T09A 4DZGA 1C28A 2QQMA 5FPAA 1JUHA 2HWC1 2QFEA 1YIFA 1V00A 3P3PA 2I74A 4LXLA 1H6YA 5FXXA 5F3EA 4Y22A 4LPLA 1HLCA 1ZBE3 3S6PA 2RS13 4YW2A 1PMHX 1J3RA 2HWD1 3ZYPA 4LT5A 1ZBA2 2K9ZA 2PHFA 5BNNC 4CP0A 4Z2AA 5HXMA 1CZTA 1VP6A 3RG0A 3OY8B 3RJ2X 3VBUB 4HVOA 4QPGA 2DCKA 1W06A 1ZYBA 1RXGA 1V6LA 1BEV1 1IS5A 1D2QA 1BBT1 1B35C 2EIDA 3WHUA 3V0BA 3OBTA 3I4IA 2EIEA 1W8HA 3IKWA 4UF0B 4XVHA 5FK8A 1M4WA 2DVAA 4FPFA 4N43A 3TNQA 3USSA 3WD5A 5BNOC 1WW5A 4FPKA 4EN7B 3BPZA 2WNVB 1VBA1 2VTFA 2P17A 3GM8A 2P4EA 2R1DA 2DTWA 4O61A 4RA0A 4CVUA 5LY1A 2ET7A 3C8XA 4I0WB 4YGEA 1WCDJ 3KZ4C 2RM23 4I2OA 4A2UA 5FYHA 1HXS3 2ZGRA 1OPMA 2JIJA 4CDXC 1KS5A 1LTEA 2XDVA 2QCSB 4A44A 5F1RA 1OI6A 1N3PA 2WNUB 4EYUA 2FMDA 3T4HB 2ZZJA 3K2OA 3DEMA 1CAWB 1PGW2 1XSQA 2OZ6A 4ZONA 3WF2A 2VOKA 1NLSA 1ZRRA 1PO23 3GHNA 1TNFA 2QZ2A 2Y6FA 2QE3A 4IV1A 2CGNA 2YPDA 3VZMA 4ASKA 1LR5A 1HQWA 3AB0A 1A34A 1FI2A 4AHZA 2Y64A 2CNAA 3LA7A 1QXPA 1JZ8A 3DN7A 4ZPIA 1X8MA 1NZIA 2NQYA 4U36A 3QH6A 3JD72 4GH4A 3WP4A 1JODA 1RUE3 2RDRA 3POSA 1A8MA 5FPZA 4ISQA 2GSYA 3MIHA 1RUJ3 1O3QA 4OHXA 1W6OA 1YFXA 3I7DA 3WT3A 3ZXAC 4XHXA 5KHGA 5BNPA 5C3PA 1XU2A 3JUUA 1V6KA 1SLCA 3JBG2 4MHRA 2Y8KA 2WC2A 1MEC3 5I8YA 4E8DA 2CYFA 3KGLA 4KG8A 3WXPA 4C0HA 1UOFA 1PO11 3J8F1 4Q0QA 5F6LB 4HZFA 4LK6A 4E9KA 2KA3A 4Q4Y1 2JG9B 2VVEA 1AR93 5KXEA 4C90A 3ZN4A 5F9TA 4MXWB 1F31A 5I91A 1QOTA 2B39A 1XNAA 2W46A 4R9BA 2VNVA 2GU9A 3NV4A 5T5PA 3OJBA 4HVQA 3NW4A 1NT0A 5IK8A 2AREA 3H3LA 1XYOA 3M2MA 4YW5A 4M00A 1L7RA 1JYVA 4Y24A 4IUGA 4QQ2A 3VDBA 3V0AB 1SBDA 2JD9A 5F2WA 2VO5A 5LY2A 3UGFA 3RZKA 4L8QA 1F5FA 3MIGA 3IAPA 1QY4A 3CLPA 1HV0A 1V9U3 3H9AA 1D0GA 1HDKA 4K8RB 2WUHA 4OMCA 5C4WB 1V6OA 2HWC2 3AK0A 2P1BA 4QGLA 4QX7A 5JXHA 2DCZA 2JECA 4NROA 3PDQA 4YFZA 4GWJA 1VBD1 2GC0A 2LW8A 4UOJA 5K0UB 1DP0A 1UY1A 3KCYA 2K0GA 1ZZ7A 1JU3A 2W1WA 4YLZA 5FZ7A 5A3WA 1OMIA 2HWD2 3WDUA 5LZ6A 4AEJA 1V6IA 3WEZA 5JSRA 1UAIA 5EJ1B 3PURA 3D0JA 2JE8A 3A21A 5FLIA 4P9YA 3PIGA 4ZU5A 1BEV2 5FZGA 4BCUA 1BBT2 2VQ0A 4FPCA 4OYUA 1BJQA 4I3PA 1MS9A 3ZLIA 5A6ZA 1PM7A 3AKPA 5LA0A 4AAXA 2WO1A 3WUDA 4A45A 3LIGA 1YQ8A 1BCXA 1VBA2 2VZPA 1WW7A 4FT8A 1X33A 2JE9A 2XHKA 3KF3A 3PU3A 4GB31 4JDNA 2ARCA 5FXWA 5L9BA 1XNTA 1W8OA 3SH4A 1S4CA 1GV9A 1UQXA 5FJKA 4OZXA 1MZFA 4XQ4A 4Y1XA 5ABJA 3U4XA 1ZZ6A 1GOGA 3MEPA 1AR63 4XACA 2Q8EA 3OPTA 2GNMA 5JI7A 3J26N 4IEYA 1LHWA 2ARBA 2YBKA 3WNMA 5I8TA 3VL8A 3TEZA 3KF5A 3ZXKA 1W2AX 5CU1A 5EZWA 2NMOA 5FY8A 5J09A 1Z7S3 4FI9A 2JDHA 2JDNA 3OTFA 4KG0A 1HN0A 3AP5A 1DQ4A 5C3OA 2JDMA 2XVGA 3VBHA 5FYTA 3ACHA 3ROUA 5HI0A 1JZ2A 5JWPA 3DXUA 1R081 1UU5A 2IWGB 1Q8VA 2P3JA 4LTAA 4WM7B 1R1A1 4OHYA 2Q1MA 3FLRA 4Z07A 1VMHA 2WL1A 3R4DB 2QQJA 3BYWA 3KV4A 3HN1A 3FFQA 3GBFA 1UXXX 4PLNA 3CO2A 3D82A 1YQCA 4LBMA 3E6BA 3CJIB 3EBRA 4P5YA 4P9WA 4QHOA 5E8AA 2HYKA 1XB9A 2A7AA 1PMIA 2JDYA 3MLJA 3OUIA 1NA1C 3GCXA 3USUB 1UXZA 3E1F1 1UOBA 1PNGA 1FNYA 2D6LX 1UYYA 5IVJA 4GKYA 2YV8A 4FPGA 3U75A 4EQVA 4PDWC 5CG9A 4HOOA 1PO12 2VXJA 3J8F2 3ZFGC 3KMHA 1VALA 2ZGOA 5F8PA 2Q8CA 4Q4Y2 1ND3C 1ZBE1 2OQ7A 2RDSA 2RS11 3ZN6A 4AI0A 5BV6A 5C8CC 3I2OA 2VBPA 3DPRC 5CA6A 4Z2WA 3BTZA 3VKMA 3H1MA 4XC9A 2YC2A 1VE0A 1WW6A 1YLLA 3TN93 5KBFA 1XNKA 1XXNA 3WVJA 1S0IA 5DABA 2QUOA 4UW4A 5DAXA 4RS5C 2ZMLA 1I9RA 4ES9A 1GR3A 3C3VA 3MF9A 4CDUC 3I54A 2VZTA 4ASLA 3KCXA 5L36A 3JCIA 1B35A 5T5OA 2NN8A 4LHNA 5BNOB 2GZWA 3QH7A 3VD9A 3FMGA 2DDUA 1U0AA 2QQNA 3ALQA 3RWNA 3ZXLA 3ZIWA 1VBB3 3LSEA 3MO4A 4AQ2A 4H7MA 5FZ8A 4NHLA 3SEPA 1CGPA 1LOFA 1VBD2 4BM8A 2FDGA 1W9FA 4YVWC 1GZCA 2B4KA 2RM21 4Z82A 3DYMA 4YVSC 4S2FA 5FZBA 1HXS1 5C5UA 4DXSA 5JAXA 1IQDC 1CIYA 4WM8A 4YM0A 2AGSA 1MQTA 4W6XA 4IE6A 5BYNA 2VPVA 1NCRB 1Q5OA 3MPBA 4V2WA 4CDXA 1AR73 2OUJA 2VXRA 3UT0A 1RUC3 3SC7X 1LU1A 4LBQA 4CCLA 5AFBA 1WA6X 2OPWA 3SXWA 1PO21 3TEWA 3BIEA 1YHFA 4HVRA 3RZLA 1H8TA 1S2KA 3D5OA 3KQRA 4RHV3 4YWAA 2EAKA 1LU2A 1GZTA 1NX9A 1GNHA 2LROA 1XBFA 4RQPA 4GB32 5IVFA 2GC1A 3FBMA 4XEZA 2ZS6B 3H7YA 2UYAA 3WW2A 5A3OA 1QJFA 1XE7A 2XONA 1GZWA 5F5QA 5L9VA 3TOJA 3LDKA 3VKFC 1OA4A 1DZRA 1RUE1 2WINB 4FAHA 4NIAA 1NCQC 2EAAA 2P6HA 1LHOA 1RUJ1 1OVPA 2PFWA 3ENRA 1RTVA 4XF3A 2B8MA 2VNGA 4CZSA 3AP7A 1W8FA 3F95A 3N9QA 4YYOA 1MEC1 4QPYA 4PQQA 1F4HA 1NXMA 3IIIA 4MGQA 1DZTA 4ATEA 2XG3A 4Z8BA 2LRPA 1JHJA 4YW6A 4CA9A 1I5ZA 1UF2C 2VOVA 1AR91 3B00A 1R082 3IPVB 4MV2A 1QH6A 2JG8C 1R1A2 3E5XA 4AVBA 1FT9A 3ETPA 2JEMA 1QHDA 4XCBA 3VD4A 3ZX7A 3PUIA 2ZA9A 2YMZA 4QHBA 5B4NA 2CAVA 1JZ5A 1FOD3 5C3SA 1PGL1 4X8NA 4URAA 5A1FA 1ENSA 3ILRA 1QXJA 3BIWE 1V9U1 3N7MA 3ZFEC 1POQA 2WQ8A 4YSFA 4HFSA 2NMNA 5APAA 2IC1A 2XL9A 4N8MA 1RIRA 1S0FA 5EWSA 1AL23 5JCTA 2B42B 2Y6KA 1ZBE2 1AJKA 1UD1A 2RS12 2YROA 1JS9A 3M3EA 4AQTA 1W39A 2A3XA 2G9ZA 4Q4W3 3ZSMA 4S2HA 5CFCC 1N1SA 4AQ6A 2IVJA 3THPA 2NZ9A 3OG2A 1BQPA 3AVSA 4CXYA 1UY3A 2VTXA 2WA4A 1RMU2 3NRUA 3POIA 2ZGNA 4AFBA 3AL5A 3MF6A 3ABZA 5GLZA 2DU1A 3PMEA 4MSVA 4HPKB 5HV4A 2E53A 3I3MA 2BGOA 1BZWA 5C5TA 4Y5Z0 5EPAA 1O5LA 3PLQA 3WF0A 1YI7A 2WJSA 1O4ZA 4UFKA 4YZ4A 3DF0A 2LM3A 1N3QA 3VBFB 4AZZA 4C0BA 4R52A 2RM22 5EHDA 5LCWL 5K7PA 1HXS2 2XMLA 1W03A 1ULEA 5D2AA 3U11A 5ANNA 2Y33A 1AR61 3BTXA 1V70A 4CEYB 5I0DA 4BU2A 4LKSA 1JYIA 5T54A 4PJYA 4B1MA 4L99A 1SG3A 4INDA 4P14A 5LBEA 3I2IA 2JE7A 3NNLA 1JXNA 1K5MC 4N7IA 1IKPA 1JOJA 3LF7A 5T52A 1ZRIA 1VB4A 1DCSA 3ZR5A 1Z7S1 1EPWA 3VZJA 3S5AA 4FVVA 5IVVA 3VB9A 4AEMA 4F8AA 3OPZA 2QBXA 5BUVA 1K5JA 3JD73 1H4HA 3AXDA 2BGCA 4AWDA 4I0BA 4AG4A 2QQIA 1QF3A 1KFUL 4P9GA 3BI3A 1S2BA 4CEWB 5JSPA 3O14A 1RUE2 2VBDA 4E2GA 2DFBA 2BRTA 1RUJ2 1XNBA 1SDDB 2OA2A 4NHKA 4LE3A 3RQ0A 2E7AA 1E5HA 1WMFA 1N1YA 2DYCA 2O14A 3GCWA 1RUI3 2I07B 1LB2A 5F39A 5JOYA 1H6XA 1V6JA 2VUJA 2ZPXA 1Q56A 1POV0 3I8TA 1MEC2 3H8UA 1RHI3 4ITCA 1F9KA 3ZYJB 1ZX5A 1OC1A 1S0DA 1XYPA 1NA1A 2GC2A 3A22A 3WLUA 1W6NB 2C6SA 4PDWB 4FTSA 1SFYA 2FMYA 3M70A 2X05A 4LUKA 3WW1A 1H4GA 3U14A 1AR92 3VBOC 1IGOA 2R7EB 3ZFGA 3I97A 5EP9A 3DPRB 4P9IA 2PHUA 3TN91 3J7MA 2P6CA 1ND3A 4YNIA 2UURA 5C8CA 4P9XA 2ZHNA 2LALA 1CZSA 1G9CA 1S0JA 2D5FA 3WV6A 1HB3A 5FO8B 1SMVA 2WR9A 4RGKA 3OD4A 4ZXEA 3RSJA 3B9IA 4CDUB 3R0RA 1PGL2 1S2EA 2WLQA 4RS5A 2V4AA 3WSOA 2D44A 4ISRA 1BVVA 1V9U2 5F3IA 5T5JA 1GSLA 2YDEA 4AFDA 5A3MA 1RVF3 4MGYE 4OHWA 5H9SA 1CQ9A 3VBSC 4QPGC 1VBB1 1EV13 2VG9A 2JDAA 3S7IA 1APNA 2ZEWA 1ENQA 1VRBA 2E63A 3CHXA 2IVIB 2G9GA 4PI2A 4Y3OA 4Z1VA 3DGTA 4W6WA 4CPBD 4N43C 1RUH3 3A4UA 2ZAAA 2AH2A 4YVWA 5IVEA 4YZ1A 4YVSA 3H0OA 2ZEYA 1L3JA 1T2XA 2FCVA 3IMNA 5L7OB 3I3EA 1SLLA 1AR71 2BV4A 1ND2B 4L92A 1EAH3 1RUC1 3RI8A 1V0AA 3H3ZA 3ZKYA 2WYFA 1K3IA 4FPYA 3ZYBA 4DXTA 2GN7A 1JOBA 3AMMA 3CJXA 4HLTA 3T2QA 3GXUA 1GU3A 4FOQA 1UWWA 2P37A 4RHV1 3RMYA 1TNRA 1COV3 4OI2A 2IXJA 1VMJA 5J98B 3O7OA 4IE0A 2JJ6A 2PHTA 4GULA 2FQPA 3QOPA 5H9QA 1KD7A 2VD7A 4A7KA 3WF3A 1CAVB 1N1VA 3HOBA 4Y1ZA 1MPXA 2RS53 1AR62 2XUMA 5BY5A 1NCQB 5F6KA 2WFF3 4IV1C 3VDDB 1O3RA 4LEJA 2D40A 3TBDA 4DY3A 2J42A 3T1LA 5FQ0B 5IK7A 1C1FA 1OBNA 2CSGA 1W8WA 2VR4A 4Y4RA 1LOGA 1Z7S2 1X82A 3KS7A 2HLEA 3CKHA 4JX0A 5GLVA 4QHZA 4PIYA 1W0OA 5FIXA 1X9TA 4XJWA 5LATA 1VRH3 1UZYA 3ZFFA 4MGSA 5BNPC 1SBEA 3IAQA 5IK4A 3GJAA 5IW0A 2RE9A 3MFCA 4XJ9A 3D6EA 1AYN3 3NJXA 2C5DA 4JVAA 4DPNA 3WNLA 4B7EA 2JG8A 4D6QA 4M4RA 4E8CA 5A80A 4NHYA 4CDQC 4PIZA 4W50A 3VDAA 1CPNA 3GZEA 4FTEA 4QKDA 3FUQA 3N35A 1FOD1 3ZYGA 3BODA 3UV9A 2NYYA 1KGYA 5JZGA 3GZTB 4NJ4A 2DWRA 3J7LA 2VCAA 3ZFEB 5GZGA 1W6PA 1PK6A 1Y9MA 1A3KA 2CAUA 1AL21 3I3QA 1LHVA 3OSDA 3PU8A 4K9SA 4AVAA 1W05A 2VUDA 4D0QA 1GKBA 2ATFA 4I3GA 2CDPA 2GMEA 2Z79A 4Q4W1 4NR1A 4XTPA 5CFCB 1J59A 5IVBA 4FXGB 1Q8SA 1D4VB 2R043 3N9NA 4XPVA 3KVBA 4AOCA 1UW8A 3CIHA 3MV01 3HQRA 5FREA 1SPPB 2WO2A 1CONA 3UK9A 2AZ5A 2YB7A 3VL9A 3K4AA 3NJZA 1MS5A 3OBZA 1VBB2 4E4DX 3VD5A 4M3CA 1GP6A 2JIGA 4Q0UA 3WCRA 1PNFA 4B29A 3N7LA 4AVTA 2HWF3 5I0TA 4JGYA 3B3QE 5FWEA 4B1LA 1XNDA 5LA9A 1V6NA 1URXA 3AMHA 1UY0A 3LFIA 4Q29A 5FBJA 2FDFA 2GN3A 3IMMA 1Y9GA 1YFUA 1YXWA 4XJ8A 4UXAA 1DQ0A 1MS3A 5FYVA 1RUC2 3J4UH 3HN3A 4NAOA 1K5MB 1W8UA 2B46X 3NSTA 4MGIE 5A7WB 1HB1A 2VM9A 4RHV2 5FPBA 4RSUA 4XJZA 5E16A 1UYPA 4XMAA 5J96B 1S1AA 1MS0A 1WZXA 2JENA 3JD71 3O0XA 2XJPA 2R30A 3ST7A 2O0OA 4FP3A 3U78A 2X5IB 1XNCA 2YXSA 2WN2A 1W9TA 4UFLA 3VKOA 1IG0A 2BFUL 3C7GA 4BLIA 3PNAA 4QGMA 5A3TA 1K42A 1KDKA 4FQ4A 3GBGA 3MW3A 1PX4A 2PHDA 2VZQA 1WWYA 1RUI1 3H7JA 1CJPA 2Q5TA 2UWAA 3H42B 5FZHA 4NIIA 5IFPA 4O65A 1W9YA 2HEVF 4CYDA 3WF1A 1UZ0A 1KXGA 3ACLA 2YU1A 3NNFA 3NWKA 3PTRB 1RHI1 5FFOC 2VTXJ 4Q2FA 3HBKA 1CAXA 2WDBA 4UW5A 5BPXA 4XOGA 1KJLA 4TWTA 3WNPA 4LE4A 3AL6A 2R0FA 4K1ZA 1ULCA 3M1HA 2YC4A 4BZ4A 5FZEA 4Q4X3 3WF4A 1ZA4A 4XFBA 5AC93 2Y60A 3OYWB 4PCRA 1DQ1A 2AENA 5AFEA 4RR3C 3VBOA 2D3PA 1MACA 3HNYM 4N53C 4BH9A 4DEVA 2FZ2A 4N9HA 1EP0A 2DVDA 4LA2A 1AF9A 3DXTA 3FC0A 2CV6A 1D7PM 4NE9A 1FOD2 1J3PA 3OF1A 4QXHA 4XABA 5FZDA 1WMXA 3PUQA 4XAAA 2Q8OA 1PGSA 3ATGA 3VD7A 1GP4A 1US2A 1RVF1 4AI9A 1EUUA 4KH9A 4K1YA 4A6OA 1EV11 4QPGB 1AUYA 1NKGA 4LLOA 1AL22 3WZ1A 3EYPA 4IETA 4UI9L 1HN1A 3VBSA 3V0BB 4QQHA 2BVBA 2DCTA 4TLGA 1RUH1 5LA1A 2P5BA 5LW9A 1RMU3 4N43B 4Q4W2 3ZDVA 3IN9A 3ZYIB 4LBJA 5FMDA 4N7UA 4HSJA 3U37A 4C8DA 4CCOA 2OKXA 3EO6A 3PVNA 1LOFC 1W8TA 1EAH1 1WCUA 3HVDA 4H3WA 4IE5A 5DUUA 2P3IA 2D5HA 3T1MA 4WM8C 3O12A 4GMP0 5H9RA 5JIUA 2JDUA 5FP9A 1GYKA 1MQTC 5C70A 5JXIA 2ZEXA 1AJOA 4HK9A 1COV1 4GXLA 1GUIA 1EPZA 4COYA 2BQPA 1AL0G 3NJVA 1BKZA 3LOBA 2TNFA 3CF6E 1ULOA 5GLUA 3O0WA 2F4LA 4GZ9A 4KU8A 1O3SA 1RUD3 4YM2A 5A33A 1S0BA 3LE0A 2RS51 1O59A 2CTVA 2W68A 1H8TC 1YIPA 4M0NA 2WFF1 4XETA 4X6RB 1AXZA 4IV1B 2R6QA 3CMGA 4RQPC 1H9WA 1S55A 1SEFA 3ILNA 4L0PA 3KWVA 2YGMA 2EIBA 1XYNA 4LNVA 2AEZA 3I2FA 5DG2A 2A6WA 1X36A 3UESA 4LIVA 2E6VA 2RJLA 5K8SA 4H7LA 4GH4B 2ADDA 2WBKA 5GKAC 3KB5A 3LB9A 1VRH1 1W6OB 2W87A 4NO4A 2O1QA 4IEVA 5J36A 3ES4A 5BNPB 1UPIA 1PZ9A 4K20A 3PVEA 5A6XA 3NKGA 1J84A 1O8SA 3FLTA 2VW1A 5BXXA 1AYN1 2E7TA 3N3HA 1REDA 2W08A 3QCWA 4V2VA 5FY1A 2AYHA 4OULA 1DGWX 4A42A 1OUSA 2BTVC 2W95A 3PVOA 4KI5M 1RUI2 2V72A 2VVFA 1RUOA 3TWIA 3WNNA 1OQ1A 1FAYA 1PIV3 3IIAA 1QJU3 3R6SA 2Z69A 1X9PA 4O7XA 2CHHA 2ZTNA 2QVSB 4GWMA 4MADA 4YZ5A 1RHI2 1LRHA 2QTWB 5FUPA 2A6YA 4KGQA 1JTZX 3S30A 5F2SA 4QX3A 2ORXA 4E4HA 2Y38A 5EV7A 1U5ZA 1P8JA 2J1EA 3INAA 3AZVA 4P9LA 2IXCA 2W3JA 1O7FA 4NRPA 1UKGA 5FMCA 3ZN5A 4FCAA 2AEYA 4TZDA 1DF0A 2XJQA 4JRLA 5ACA3 2Q0AA 5JR7B 3PJQA 3AMPA 5D8AB 2FCTA 4LIUA 2R041 3PUAA 1G9DA 1GICA 1TG7A 5J3UA 3H8RA 3PVBB 1WMEA 3AZWA 4NMIA 3O1UA 1QDOA 1PZ8A 1OLME 2UU8A 2FDJA 3WNOA 4PLMA 2GH2A 1JN2P 5JOXA 1UKRA 1HV1A 1RVF2 4QB2A 1OFNA 3OOXA 3V64A 2BPA2 5FP8A 4MXWA 4AGRA 4DO0A 1EV12 2WIIB 1YCIA 3LDRA 4QM8A 2JKXA 3HNMA 5JPNB 1BVP1 2ES3A 4X6QB 4MGZE 2LS6A 2XLAA 2HWF1 3ACFA 4NOTA 3ZSJA 1RUH2 2YYOA 2GAUA 4JDMA 2FDIA 2I2SA 2CWSA 3KVAA 1SFPA 2WQ4A 4CDWA 3V0AA 1ODNA 4BQ5A 3W21A 5SV8A 3ON7A 2ZJCA 4XIOA 3KV9A 1EAH2 2RV9A 2FDHA 2DVFA 4F83A 1EUTA 5C4WA 4CRQA 2Q8DA 1OURA 2DBIA 4YGDA 5FZ6A 5ABJB 2YU2A 1IS6A 1O4TA 2KM2A 1RUF3 3A7QA 2VNRA 3D4KA 1S0CA 4BLJA 1COV2 4LBQD 1RJ7A 4DINB 4EN6B 2EA7A 4MYEA 4PBPA 2ZGQA 3NNGA 1LEDA 5GZCA 3HT2A 5A3UA 1FYUA 2J1AA 3VHOA 1SQ4A 3I59B 4NN0A 3K46A 1YFYA 4TTGA 4HKWA 2RS52 2EICA 5TSWA 3NO8A 1AHSA 1AX2A 4UBGA 2WFF2 4HONA 2GP3A 2QNKA 3VHRA 1JUIA 2G19A 3AMQA 5DAWA 4XQWA 4FPOB 1VJ2A 4Y20A 4WVZA 1RUNA 1PVXA 3MFAA 3EXUA 5DAQA 1LOAA 1DYPA 1H2LA 2DUOA 4KBZA 4OVEA 5EJ3A 4COWA 2D7FA 2XVKA 5A6QA 3KLSA 1VRH2 5LBBA 4B3NA 4D7YA 3MIDA 4Q4X1 3ZXDA 1OF3A 5JUVA 1N3OA 3FX3A 3M3CA 2QQPA 2VMGA 5AC91 4CU7A 4ARXA 1AYN2 2IXIA 4O9GA 1LNSA 5FY4A 5CB7A 5JVVA 1GFF2 1STMA 4FOWA 3AYEA 5LBFA 3NKTA 4ONUA 5HCHA 1CESA 2ENRA 3O1VA 4CXWA 4AAPA 1Q8PA 1W0PA 4RR3A 5C9AA 1QNWA 4N53A 5T55A 2H6CA 5FV3A 1DYOA 5FYIA 1QMJA 2RHPA 3AYAA 2A5ZA 2KR2A 2MHFA 1XC6A 1MVEA 3ZN6B 4D7TA 4DMIA 3LSDA 3B93A 3MGUA 3LDBA 5G04L 4RL7A 3LFMA 4QQPA 2VUCA 3IB3A 5A1AA 1NUKA 5CVRA 2GALA 1DG6A 2CY6A 4H14A 1Y7BA 2XH6A 5BNNB 1TEIA 4IXLA 5A7NA 1CWPA 2P3KA 1E5RA 5F37A 4QXCA 1QU0A 2JKBA 1W6MA 1RMU1 4JKLA 1B35B 3L9JT 4LO6B 4OQ8A 2VH9A 4ZS3A 3IBMA 4J25A 2EXKA 1W3XA 4OMDA 1IZ3A 2R042 1ZZ9A 2D3RA 1S0EA 2W52A 2PAKA 4S2DA 3POJA 3KT1A 5DXDA 2WABA 2WN3A 2XKPA 1SLIA 3ZO0B 1O91A 4A7ZA 4AQSA 1G7YA 5FOBB 1OKOA 1AR83 2XHNA 4J1XA 2XBO3 3KCCA 5A32A 4BMBA 4AHXA 3ECQA 1H1AA 1NXD1 1FNZA 4MVTA 2H6BA 4XURA 1OT5A 4CDXB 3T08A 4LBKA 2J1RA 1WLWA 2HWF2 1RUD1 2VMIA 3KSCA 4LBQB 1CX1A 1UMIA 2ZKLA 3EHKA 1SACA 1W8NA 3N4MA 1H8TB 1UN1A 1DQ6A 2GDFA 4ASMB 1OPOA 2W92A 4HN0A 4TYSA 3VV1A 2GC3A 2A6XA 2J1TA 4LHSA 1LULA 2H0BA 2XR4A 2WT1A 3LA3A 5IVYA 4LMFA 3RNSA 3E5QA 2VMEA 2QQKA 1GZWB 5FZAA 1REEA 4YW1A 4MGTA 4CP9A 3HQUA 1MZEA 2W1SA 2B7YA 3GYDA 4B4RA 5DMYA 3S57A 4JZRA 1Y4WA 4CCJA 1VAVA 5HCAA 2ZGKA 3HT1A 2VZSA 5FYZA 2OX0A 2BJSA 2PHLA 1DGWA 4XE9A 2PQSA 1AX0A 1KS4A 1C8NA 2JD4A 4NPRA 3UJQA 3VZLA 1H0BA 1NCRA 2C9KA 2JB4A 3ACGA 4QXBA 5C7GA 4DIQA 1KJRA 4BYYA 4UFIA 4YPJA 1TME3 3O1TA 1JYTA 3DUIA 1IKQA 3AFKA 2DURA 3K48A 5CNAA 4OI1A 3UL2A 3ZFFC 1C5HA 1PIV1 2DTYA 4KWLA 4L11A 1QJU1 5I0RA 3H8OA 2QJVA 4LBLA 1O5UA 1ENXA 3AKRA 2VGDA 4LO5B 1DFQA 1YQ2A 2ZOEB 2DU0A 3K3NA 4LJHA 5IYYA 4EZ4A 5FR3A 3LPFA 4BQ3A 3ACIA 2VBBA 1W6QA 2Q4SA 4XDPA 4XUTA 3VDCA 2OIIA 2BWAA 2ZX0A 1CZVA 2R073 4K6BA 4K3UA 4L2NA 4Q4X2 3T30A 3WOGA 1D4M3 3NV3A 4IE7A 5HCFA 3RFRA 5AC92 4ZU4A 2CDOA 2DV9A 4LA3A 5ACA1 1W3VA 2VOXA 1SCSA 3H1WA 3OPWA 5JZGC 5DUVA 1NQJA 4NPMA 2R063 4M01A 4QQLA 3ZKUA 1WD3A 3VHNA 5E88A 1PK6C 1E5SA 3UJOA 2QQVA 4BK5A 2EXIA 4COZA 4DRRA 4OUEA 3HD8B 4ZY9A 4B4QA 4D6RA 4H2AA 3POBA 3TNPB 1UYZA 1NOVA 2A6ZA 2JB8A 3HR9A 3P3NA 3SQOA 3ZDSA 4FXKB 1E57A 5JDBA 4IL7A 2UWBA 4EZHA 1NYWA 5FZLA 1UCXA 2WT2A 5K9YA 1CN1A 4D6SA 1DLCA 4XJAA 1WBLA 1ZVFA 3E5UA 4MLOA 4AVCA 4C91A 3WQ1A 2ZMNA 4NPLA 4Q27A 5FRAA 4LULA 1LCLA 5CISA 1JMUB 1F5JA 5CFDA 2YBPA 2W0XA 3ZXGA 3RZMA 2XWBB 4SBVA 3V56A 1JYXA 4JGYC 1Y9QA 3SKVA 4KQ7A 1RUF1 1C1LA 4ZKTB 2PMWB 1WCQA 4I02A 4OCTA 3ZXFA 2D43A 4XYXA 2RMU3 3K4DA 4XZUG 2V09A 3AXEA 5DAPA 3SCFA 4BQ1A 3K51A 5FZ1A 3BOWA 3WG4A 1GNZA 1QJX2 1RUD2 2WWSA 3I2DA 4R4ZA 1RITA 1X7NA 4CE8A 4HETA 1NLRA 1IQAA 5E6HA 1ZRDA 2HEYF 1OUXA 4IE4A 4R8HA 1GQGA 4PF1A 3U10A 2ETEA 4JQRA 3PL0A 4YARA 3Q8FA 3KD4A 4YGCA 4XXPA 1ZZ8A 4AE2A 3W59A 4BB3A 4IEXA 2YPJA 4AEDA 5KHKA 3HMYA 4QDSA 1GOHA 1Q8OA 1UZVA 2XQXA 4Y1YA 2UYBA 4KWKA 2Q30A 2R49A 4CEYA 3H3UA 3BGAA 1G9AA 4Y5TA 1BMV2 1GWLA 1CD3G 3UKTA 1OXCA 4QGNA 4XZPA 1UMHA 4BK4A 2ZHMA 5D1IA 4B4PA 3TEYA 3GBWA 1YRZA 4HKOA 4XFAA 3CQOA 3OCPA 3MIFA 2D6PA 5HXVA 1NA1B 1YO8A 3HIFA 4BDVB 3U07A 1NG0A 1F4AA 2WZEA 3JB8A 4R9CA 5IHRA 1F15A 1PIV2 4WZFA 5FYMA 1QJU2 2E9QA 5FZIA 3RPQA 3FZ3A 1F8VA 3MUZ1 4JGZC 4GQ7A 3ZFGB 3ZYHA 3SKJE 2RG4A 4PI0A 4QKNA 3LCPA 2A70A 4LOTA 1ND3B 2IXLA 2A1XA 1JYWA 4WZCA 5C8CB 4MX3A 5T50A 2Y6HA 1FV2A 4HSLA 3NAPA 5JXGA 2TEPA 2W9XA 1W0NA 2R0HA 5ACA2 1BHGA 4RS5B 1IS4A 1ODMA 2QQOA 2FDKA 5L19A 4PIXA 5DUWA 3SMHA 5DAVA 3VBRA 4ARYA 2E7QA 2WS93 3LPGA 4NRMA 1YQ5A 3KHCA 1RUG3 1G9BA 4AL9A 1JYCA 4M0HA 5DQ0A 5KC5A 1IOAA 2Q1FA 1MZ6A 1AR81 1O8PA 2PHWA 1UYXA 2PTMA 2XBO1 4YVWB 5HBAA 4XUNA 4YVSB 3K4ZA 1LGCA 4WVMA 5A6YA 1DDLA 1UY4A 4LO4B 1H2NA 4LQRA 2HBUA 3ITQA 2BBVA 4C1XA 4E4SA 1R1ZA 1FPN3 2GH8A 2ZX3A 3QLQA 5LWBA 5FYYA 1CAUA 1I3HA 4OQ9A 1UOGA 1A8DA 1QEXA 2YFZA 4FTBA 2ET1A 3ZMNA 2GP5A 3NL1A 1ENRA 1JHNA 4BQXA 1HRV3 2BFUS 5FPUA 1WW4A 3EQEA 4M4PA 4WV8A 1BK1A 1LECA 2BNNA 3G6JB 2EVXA 1RUF2 1UL9A 4U2AA 4QU2A 3SCHA 2IUWA 2VCMA 3CL1A 4J1WA 2Y6LA 4JTOA 3TAYA 3THCA 3T0BA 4BWOA 2ARXA 5FK7A 5FPLA 3THDA 4LOSA 2A75A 3M3QA 4D69A 3RMXA 2RR13 4QX0A 1JW6A 2NM1A 3WDWA 2HEWF 2YZ4A 4XBQA 1PMJX 5FMOS 2PYTA 1TME1 5D21A 4DQAA 1MVQA 4IEWA 1IPSA 2BEOA 4YGBA 5FZKA 3ZFFB 1RB8G 2X8KA 2G9FA 2JDZA 3QD6A 3Q8CA 1K45A 2VOWA 4XTMA 5JSOA 1F2NA 2WNUC 4FO9A 3WNKA 4W4ZA 5C8WA 1UZZA 1C5IA 2QZ3A 4A7YA 2RVAA 3DV8A 5A7SA 4G9SB 4S2GA 5DN2A 2VZVA 2JG8B 3WDYA 4BMEA 1GANA 2R071 4GJYA 4ZU7A 4D94A 2PN5A 1D4M1 1M06G 1OD5A 5JMOA 2ZEZA 2ZGMA 2QQWA 2BUKA 3VDDA 5LA2A 4ZS2A 2CGOA 1HJFA 3OBRA 4XMIA 5FZOA 4G3YC 4BIFA 2JX9A 2Y26A 2R061 3ILFA 4NWWA 2FD8A 1VB2A 3VUOA 1BXHA 4BXFA 1W6PB 1PK6B 2AR6A 4LUMA 3AC0A 5FAXA 3L2HA 4LLFA 4RYDA 5F7UA 2JXAA 4JHTA 2VMCA 4QPIA 4OI0A 5FZMA 3VHPA 1RGSA 1ULFA 2ID4A 2PXJA 3MV11 4FFIA 3IT8A 4URTA 5FLHA 1OFSA 3AX4A 4AFCA 3ETQA 3T0AA 5GZEA 4BJ0A 1TE1B 2PAMA 5GZFA 1QH7A 5CBLA 4IV3A 5GLWA 4EN9B 3WDVA 4FOYA 1UPSA 2XL7A 5DPNA 3ZM8A 5C6CA 3FE5A 4MOAA 3GZUC 3LZZA 2F17A 2R16A 2D6MA 4AHWA 3WQ0A 2C26A 2Z2SB 5FKCA 4CU6A 1WA4A 2O8QA 1PHMA 2OVUA 2ZAHA 4UYBA 3VGIA 1UU6A 3NVCA 3A0KA 4M3CB 4CU9A 2W2IA 4TN7A 4DS0A 4XJUA 1SCRA 1IPJA 4NIHA 4JGYB 1AR82 2XBO2 3C7EA 2H0VA 4K8FA 4BISA 4CDWC 1LGNA 3W5NA 1CVNA 3ZYFA 1OQEA 2RMU1 1XJAA 5FZ3A 2VY0A 4A41A 2WQZC 3W58A 2BW8A 5DZGA 1XE8A 2WA3A 5C4WC 1U5IA 3WDTA 1HB4A 1VLNA 4P9JA 4WBBA 5K0UC 3R4SA 1MR5A 3RZHA 3AYDA 4WVVA 4NIDA 4GWIA 2VZ3A 1VBE3 3LA2A 4J6GA 3GNEA 3R4UA 2E33A 3UKVA 4B8EA 3SEEA 3BPSA 1OOPA 3MW4A 3JU9A 3P6BA 4Y4YA 3K75B 3OGGA 4OI4A 4NHMA 1XQNA 3FWEA 1WBFA 1NAEA 4MZUA 2WYSA 2OW4A 4MXVA 2ZGTA 2EF6A 1A78A 3Q8EA 4Q5OA 4KWJA 3DYOA 2JWPA 3E6DA 3PJYA 4AFMA 2Y6GA 3AM2A 1TME2 2WFPA 1CAXB 4DEQA 1DHKB 3GGLA 3OEBA 5A7WA 3RJRA 5C33A 2Z5WA 3N7KA 5CKQA 2E31A 4CXXA 2HJIA 3TYJA 2PHXA 2GNTA 1TMF3 4NWVA 2GMMA 5FBZA 2B5HA 4BOWA 4IEOA 4KL1A 3VBOB 3IM0A 2K46A 4F3JA 2VMHA 2LUWA 4JGZA 4Q8LA 3WDXA 4MUVA 2R072 1N1TA 2VE1A 5C9AC 4ZZ5A 1D4M2 5FKBA 1ZREA 2VJXA 3PUHA 4UW3A 5F5AA 4NRQA 2VAUA 4LKEA 2WWJA 2XWJB 3CZUA 5IATA 1HRI3 1JU4A 4QDQA 2R062 4Y22B 2ZX1A 3B7MA 2P3YA 4LK7A 1OLQA 3D8CA 4XF0A 5IUQA 1JH5A 4R9AA 1C4RA 1D0HA 5A7PA 1QXRA 4P02B 3M3IA 4AVVA 3KHBA 2WS91 1UOJA 3VZKA 3FFZA 1WCSA 1RUG1 4OLLA 1I6XA 1WD4A 2AACA 3DKWA 3VBSB 2YBSA 1IS3A 3I3DA 5J48A 1EYBA 4HXCA 2ZX2A 3CJIC 3O1OA 2E51A 2J1UA 3BCWA 2MNGA 4V1PA 4BQ2A 2YFUA 3CNAA 2OXBA 4BQYA 4YG3A 3BVCA 2DCJA 1VBC3 4XF1A 2WSVA 4CCNA 1FPN1 3C7FA 4I01A 3WP3A 2W5FA 4Y33A 1JOPA 4MO3M 4Q0VA 5EYYA 3RI9A 3RRDA 1MS1A 1HX6A 2ZGSA 4QQOA 1OH4A 1OHFA 3MLKA 1HRV1 3G7DA 1VMFA 5FZ0A 5LB6A 4AEKA 4C1WA 4D3WA 1DGRA 2WT0A 5FZCA 1R093 4QWNA 5A33B 3OY8A 3VBUA 4IEQA 3WW4A 1QJEA 4XFIA 1QJX3 1ASJ3 4LKFA 5FTTC 3U4SA 3W5MA 1CJDA 2RMU2 2WAOA 4FSJA 4XILA 1POV3
chains in the Genus database with same CATH topology
4UF0A 5FV3A 5FZ3A 5K4LA 5FYIA 5FZ8A 4D6RA 5A3TA 2XMLA 4QX7A 5FZHA 3LDBA 4NUBA 5FZBA 5FJHA 3PDQA 4CCJA 5FPAA 4BU2A 5IWFA 5A7OA 5FUPA 5F3GA 4LXLA 5F5IA 5FZ7A 5A3WA 3PTRB 2YU1A 5F2SA 5F3EA 5FZLA 5FXXA 5FYYA 4E4HA 4EZHA 5FZ4A 3PUSA 4Y4RA 4V2WA 5A7NA 3PURA 4D6SA 5FP4A 5F37A 4IGOA 4QXCA 4CCMA 5FY0A 3AL6A 2GP5A 5FZGA 4CCLA 5FZEA 3ZLIA 4GJZA 4XDOA 4CSWA 5IVVA 5FPUA 2XUEA 5A1LA 2YBPA 4UF0B 5FYBA 5FYUA 4LIUA 5IW0A 3RVHA 3PUAA 5CEHA 5IVFA 3NJYA 5FWJA 2XXZA 5FZ9A 4D6QA 3PU3A 5LY1A 3DXTA 5FXWA 5FPLA 5A80A 5KR7A 5FXVA 4QXHA 2OQ6A 5FZDA 5FJKA 3PUQA 5FZ1A 5FP7A 3LD8A 5FP8A 5FYHA 2Q8EA 5F39A 4DO0A 3OPTA 4IGQA 5A7WA 4AI9A 4QU1A 3N9PA 2XDVA 5E6HA 2YBKA 5FZKA 4EYUA 3N9QA 4CCKA 3K2OA 3KVAA 5FY8A 3PU8A 5LW9A 2P5BA 5FUNA 5FY9A 4GAZA 5FY5A 5A7SA 5IVYA 5F3CA 3KV9A 4C8DA 5FZAA 4CCOA 5FYTA 5F5AA 4GJYA 2Q8DA 5IVBA 3N9MA 2YPDA 2WWJA 3N9NA 4ASKA 3DXUA 5FZ6A 2YU2A 3KVBA 5FZOA 5FP3A 5FP9A 5FYZA 2OX0A 5A7PA 3KV4A 3AVRA 3K3OA 5ISLA 4QXBA 5A3PA 4BXFA 4DIQA 5F3IA 5FY7A 4URAA 2WWUA 2YBSA 3UYJA 5A1FA 3KV5A 5FZMA 5FYMA 5FZIA 4HONA 5FZFA 2GP3A 3N9OA 3ZPOA 1VRBA 2PXJA 5FWEA 5IVJA 4LITA 4Y3OA 4HOOA 3N9LA 5A3NA 5F5CA 3K3NA 4CCNA 5FBJA 5IVEA 2Q8CA 2OT7A 4EZ4A 2OQ7A 4Y33A 5FXZA 5FZOB 4XDPA 5FYVA 4LIVA 4CUGA 5FYSA 3AVSA 5A7WB 3KV6A 2OS2A 3AL5A 5FPBA 4GD4A 5LWBA 5FZ0A 4QX8A 3OPWA 5F32A 2W2IA 5FZCA 4TN7A 4QWNA 5FYCA 5FY4A 3U78A 5IVCA 5FPVA 5F2WA 5LY2A 4V2VA 5FY1A 3U4SA 4AAPA 4BISA 2VD7A 5A7QA 4IGPA 5ANQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UF0 A;  5FV3 A;  5FZ3 A;  5K4L A;  5FYI A;  5FZ8 A;  4D6R A;  5A3T A;  2XML A;  4QX7 A;  5FZH A;  3LDB A;  4NUB A;  5FZB A;  5FJH A;  3PDQ A;  4CCJ A;  5FPA A;  4BU2 A;  5IWF A;  5A7O A;  5FUP A;  5F3G A;  4LXL A;  5F5I A;  5FZ7 A;  5A3W A;  3PTR B;  2YU1 A;  5F2S A;  5F3E A;  5FZL A;  5FXX A;  5FYY A;  4E4H A;  4EZH A;  5FZ4 A;  3PUS A;  4Y4R A;  4V2W A;  5A7N A;  3PUR A;  4D6S A;  5FP4 A;  5F37 A;  4IGO A;  4QXC A;  4CCM A;  5FY0 A;  3AL6 A;  2GP5 A;  5FZG A;  4CCL A;  5FZE A;  3ZLI A;  4GJZ A;  4XDO A;  4CSW A;  5IVV A;  5FPU A;  2XUE A;  5A1L A;  2YBP A;  4UF0 B;  5FYB A;  5FYU A;  4LIU A;  5IW0 A;  3RVH A;  3PUA A;  5CEH A;  5IVF A;  3NJY A;  5FWJ A;  2XXZ A;  5FZ9 A;  4D6Q A;  3PU3 A;  5LY1 A;  3DXT A;  5FXW A;  5FPL A;  5A80 A;  5KR7 A;  5FXV A;  4QXH A;  2OQ6 A;  5FZD A;  5FJK A;  3PUQ A;  5FZ1 A;  5FP7 A;  3LD8 A;  5FP8 A;  5FYH A;  2Q8E A;  5F39 A;  4DO0 A;  3OPT A;  4IGQ A;  5A7W A;  4AI9 A;  4QU1 A;  3N9P A;  2XDV A;  5E6H A;  2YBK A;  5FZK A;  4EYU A;  3N9Q A;  4CCK A;  3K2O A;  3KVA A;  5FY8 A;  3PU8 A;  5LW9 A;  2P5B A;  5FUN A;  5FY9 A;  4GAZ A;  5FY5 A;  5A7S A;  5IVY A;  5F3C A;  3KV9 A;  4C8D A;  5FZA A;  4CCO A;  5FYT A;  5F5A A;  4GJY A;  2Q8D A;  5IVB A;  3N9M A;  2YPD A;  2WWJ A;  3N9N A;  4ASK A;  3DXU A;  5FZ6 A;  2YU2 A;  3KVB A;  5FZO A;  5FP3 A;  5FP9 A;  5FYZ A;  2OX0 A;  5A7P A;  3KV4 A;  3AVR A;  3K3O A;  5ISL A;  4QXB A;  5A3P A;  4BXF A;  4DIQ A;  5F3I A;  5FY7 A;  4URA A;  2WWU A;  2YBS A;  3UYJ A;  5A1F A;  3KV5 A;  5FZM A;  5FYM A;  5FZI A;  4HON A;  5FZF A;  2GP3 A;  3N9O A;  3ZPO A;  1VRB A;  2PXJ A;  5FWE A;  5IVJ A;  4LIT A;  4Y3O A;  4HOO A;  3N9L A;  5A3N A;  5F5C A;  3K3N A;  4CCN A;  5FBJ A;  5IVE A;  2Q8C A;  2OT7 A;  4EZ4 A;  2OQ7 A;  4Y33 A;  5FXZ A;  5FZO B;  4XDP A;  5FYV A;  4LIV A;  4CUG A;  5FYS A;  3AVS A;  5A7W B;  3KV6 A;  2OS2 A;  3AL5 A;  5FPB A;  4GD4 A;  5LWB A;  5FZ0 A;  4QX8 A;  3OPW A;  5F32 A;  2W2I A;  5FZC A;  4TN7 A;  4QWN A;  5FYC A;  5FY4 A;  3U78 A;  5IVC A;  5FPV A;  5F2W A;  5LY2 A;  4V2V A;  5FY1 A;  3U4S A;  4AAP A;  4BIS A;  2VD7 A;  5A7Q A;  4IGP A;  5ANQ A; 
#chains in the Genus database with same CATH topology
 1UIK A;  2CWM A;  1RJ8 A;  4UF0 A;  2VW0 A;  2XJV A;  2J1V A;  4OUS A;  3VLB B;  2RR1 1;  1QJY 3;  2ZGU A;  3RZG A;  1SHW B;  2WNV A;  3GJB A;  3WY6 A;  5F3G A;  5F5I A;  1J58 A;  4IEU A;  1N47 A;  4UFH A;  4XUQ A;  1IG3 A;  3PUS A;  1REF A;  2DVB A;  4QXK A;  4R9D A;  2EXH A;  5FP4 A;  5L9R A;  2WO3 A;  2ZKN A;  5JIA A;  4AI2 A;  4Y1V A;  4CCM A;  1NCR C;  4CCD A;  5AVA A;  2B9U A;  2C9A A;  4Q0P A;  4JKM A;  2WNU A;  1WLC A;  2ZZQ A;  4DFS A;  2BGP A;  2PHR A;  1KRI A;  3BTA A;  1CAW A;  2BOI A;  4UW6 A;  5G05 L;  2VZU A;  5LRS A;  1DLL A;  1L7Q A;  2HH9 A;  2JDK A;  1H9P A;  4QB6 A;  2LTN A;  4CDQ B;  2XXZ A;  3MDP A;  3NNJ A;  5FOJ B;  3T3Y A;  3ZPY A;  3I3B A;  4AGG A;  1GZ9 A;  1UX7 A;  1SZB A;  5KXC A;  2OQ6 A;  1SFN A;  1VPH A;  3TRS B;  1BLZ A;  2E26 A;  2FHR A;  3P1I A;  1YNA A;  4TLF A;  4ATF A;  3APB A;  4MHU A;  3Q8B A;  1AYM 3;  4IGQ A;  3SCG A;  4JQT A;  2XKO A;  4Y1U A;  5I93 A;  1XOY A;  1YWK A;  3WCS A;  4LO8 A;  4QAW A;  1RC6 A;  3POG A;  1J83 A;  1SBF A;  3JB4 C;  5KXD A;  3LEK A;  5EQU A;  4LKD A;  3IDA A;  2AC1 A;  3OD0 A;  3AMN A;  3C2U A;  4GAZ A;  4L9B A;  2NPI A;  2HBT A;  4BIO A;  4IER A;  5F3C A;  5HCB A;  3VBH C;  3M3O A;  4JDO A;  1CR7 A;  3KT7 A;  2F6B A;  3FLP A;  3SNM A;  4QM9 A;  2HWB 3;  3FUO A;  4XFG A;  4R4X A;  3WG3 A;  1ALY A;  4KMQ A;  3O1M A;  2WS9 2;  2JG9 A;  3J7N A;  2SBA A;  1RUG 2;  5H9P A;  1JZ6 A;  3AJY A;  1C3H A;  3KQ4 B;  2Z42 A;  1MZ5 A;  4FPL A;  5FY7 A;  1JBC A;  3FBY A;  3HNB M;  3OUH A;  4DUV A;  5EIY B;  4CDW B;  4PQ9 A;  3WP6 A;  3KV5 A;  5T3N A;  3LIH A;  2QDR A;  1VAK A;  3ZSE A;  5CFD C;  1C8M 3;  1KFX L;  3BU7 A;  3HWJ A;  4JKK A;  5D8A A;  4H55 A;  1FPN 2;  1LOE A;  4BQ4 A;  3FJS A;  4KGG A;  2J1S A;  4GKX A;  1KIT A;  2FZ1 A;  3RS6 A;  4E2Q A;  4FOV A;  4IDZ A;  5JI9 A;  1ZRF A;  4XFF A;  5KXB A;  2ZGL A;  4GA9 A;  1LEM A;  4XXA A;  5JXJ A;  4CUG A;  1VBE 1;  4LBN A;  1HRV 2;  5K0U A;  3SH5 A;  1AXY A;  1CPM A;  3DKQ A;  3O0V A;  4QMA A;  2OS2 A;  3WIN E;  5DZF A;  5FLJ A;  4AF9 A;  4FBF A;  2QDN A;  4JHZ A;  4QX5 A;  1AZD A;  2W47 A;  1QNY A;  2YY1 A;  2EXJ A;  5FYC A;  5IVC A;  4EJR A;  1K12 A;  3FHI B;  4A6S A;  4EWE A;  1RL3 A;  1XRU A;  4QPW A;  4QT6 A;  3N7J A;  4Y26 A;  1DQ2 A;  4IGP A;  2RR1 2;  1G86 A;  4Y20 B;  3VBH B;  4AR2 A;  3OGS A;  3VBF C;  4AED C;  1LKN A;  3OGV A;  4MET A;  1FMD 3;  3RYR A;  2IZW A;  3T4V A;  3I2G A;  3T2P A;  3AKS A;  4GIQ A;  4XIK A;  2VC9 A;  1H1I A;  2VQA A;  4CEY C;  3V65 A;  4A3X A;  1OLM A;  3SHR A;  2EAL A;  1LJ7 A;  1TMF 1;  1ZA7 A;  3AZZ A;  4Q4V 3;  3JQW A;  1G9F A;  1LEN A;  3GAL A;  3I2K A;  3ZR6 A;  4AXO A;  5B4X A;  3DEC A;  4P08 A;  2WLP A;  2ZBJ A;  4UBH A;  1J3Q A;  3I59 A;  5GLT A;  1SLT A;  1UU4 A;  2MEV 3;  2XLG A;  5CAZ A;  2BBA A;  1J1L A;  4XDO A;  5LK7 B;  4YG0 A;  3EB7 A;  2XUE A;  1EY2 A;  4RR3 B;  5C9A B;  1JZ7 A;  3VD3 A;  4N53 B;  2UWC A;  1HQL A;  4M3C F;  5FYU A;  3URF A;  5CKM A;  4FPJ A;  5FUI A;  1DGR N;  5EFU A;  3THT A;  1HRI 1;  4L97 A;  3MBW A;  5C3Q A;  5FWJ A;  2WNO A;  3KM5 A;  3WX5 A;  3ZYR A;  1QOO A;  1HIX A;  3UET A;  2VUA A;  2NLR A;  4CEW C;  5FXV A;  4Q0S A;  5IFT A;  1YUD A;  2RS3 3;  3IWZ A;  3MIB A;  3NAP C;  4WM7 A;  3BU0 A;  3LD8 A;  1ST8 A;  3M4F A;  3VZO A;  2C0Z A;  2VCB A;  1W6M B;  4DXR A;  1W2N A;  4D8M A;  4TXW A;  2V73 A;  2IXH A;  4AW7 A;  4HMZ A;  3T2T A;  5KHJ A;  5LBC A;  1GOF A;  3VBR C;  1GQP A;  3WQ7 A;  2W1Q A;  3CJI A;  2DF7 A;  1W90 A;  5CKN A;  4DUX A;  1OA3 A;  1VBC 1;  4N90 A;  4QKB A;  1W8Z A;  2DCY A;  4I30 A;  2BU9 A;  3OUJ A;  5IAV A;  3USU A;  1QGL A;  1DZQ A;  4KU7 A;  4XCA A;  1QDC A;  3ZXJ A;  3NV2 A;  5EXO A;  4AHY A;  4FQZ A;  2QQL A;  4KBB A;  4AK3 A;  1HW5 A;  1Y43 B;  3B94 A;  4WM8 B;  5DG1 A;  5A32 B;  5E89 A;  5J37 A;  2BP6 A;  1MQT B;  1TQ5 A;  2XB6 C;  1HJG A;  1R09 1;  5BNN A;  2W39 A;  3AP6 A;  3AVR A;  3POF A;  1KDM A;  2VQU A;  1QWR A;  4QKF A;  4UFJ A;  4RD7 A;  4CUC A;  4QD2 A;  5A3P A;  4E27 A;  4PLO A;  1QJX 1;  1ASJ 1;  3LQC A;  3ZIX A;  5KHH A;  2C24 A;  2WZR 3;  1POV 1;  3NMB A;  5CIR A;  2PLV 3;  1TZO A;  3WP5 A;  3OGJ A;  3FN9 A;  5SV5 A;  2E32 A;  4XF4 A;  2HWE 3;  4HKL A;  1YYN A;  2FCU A;  1QJY 1;  2L9L A;  2WNE A;  4LIT A;  2ILM A;  4RQP B;  5BNO A;  1Z0H A;  2B9V A;  3B9C A;  4CP9 B;  4MH0 E;  3N9L A;  4LBO A;  3OBA A;  3ZSK A;  2OT7 A;  3JQX A;  3IDC B;  3LEG A;  4MGK E;  1VBE 2;  1WGP A;  3U0Z A;  1JI6 A;  5AVP A;  3POW A;  5FXZ A;  1AXK A;  1LOD A;  1W04 A;  1J1T A;  2C1F A;  5C71 A;  2ZHL A;  5L7O C;  2BOJ A;  2WKK A;  4XFC A;  2ZAC A;  2SLI A;  3UGH A;  2NP0 A;  1ND2 C;  1LOC A;  1XSR A;  4RGA A;  2VZ1 A;  4QX8 A;  1BMV 1;  1H8V A;  3L2Y A;  1WLT A;  2RJ2 A;  5LK5 A;  1GLH A;  4AFA A;  4JAA A;  1G6N A;  4ZZ8 A;  2VQT A;  3BOP A;  4B7K A;  3CEW A;  1QQP 3;  1DGL A;  1X8E A;  1UZW A;  2Y34 A;  4Q1P A;  5EYX A;  3RZJ A;  3POY A;  3WQB A;  3U1X A;  2G1M A;  2PA7 A;  4CUA A;  4A3Z A;  3P5B A;  5GM0 A;  3SH3 A;  3WW3 A;  1W6Q B;  3MW2 A;  1VR3 A;  4ET7 A;  4CDQ A;  1AYM 1;  2KXL A;  5CG8 A;  1ONA A;  1TMF 2;  3VDD C;  2P34 A;  2Y0I A;  1ZNP A;  2XGX A;  5FMB A;  3MZH A;  1NZC A;  1W9W A;  1DU3 D;  4XW3 A;  4IGO A;  4FFG A;  1FV3 A;  4WVW A;  4NAM A;  5FY0 A;  3GF6 A;  3WR0 A;  1YI9 A;  3LEM A;  4GMP 3;  3SLI A;  4CSW A;  4PT6 A;  1PVC 3;  4QPI C;  2IFR A;  5A1L A;  5E1R A;  4LR4 A;  1OVS A;  4JRA A;  1HRI 2;  1XU1 A;  3RVH A;  3B5L B;  3E97 A;  5JMC A;  2HWB 1;  3NJY A;  3NNM A;  4RGG A;  2D97 A;  4FPE A;  3I2H A;  2BDR A;  3DCQ A;  4IV3 C;  3IPV A;  4JC1 A;  4P5H A;  5FO7 B;  4W6Y A;  1DQ5 A;  1NE6 A;  5DUX A;  1TVG A;  4Q1R A;  5DDJ 3;  1GWM A;  4HBN A;  3I2J A;  4RFR B;  5FP7 A;  5IT6 A;  5FCC A;  2OZJ A;  3DL3 A;  1A6C A;  3N36 A;  3RGB A;  3SIS A;  4QU1 A;  2VW2 A;  1W2O A;  2D3S A;  1W9S A;  4I0A A;  4XAE A;  1PX3 A;  1H1M A;  1C8M 1;  4CCK A;  1VBC 2;  3B69 A;  2HYX A;  5CFD B;  1O3T A;  2QKD A;  4F7Z A;  5FUN A;  4Y5S A;  4CUB A;  5FY5 A;  1ZBA 3;  1AX1 A;  1YEW A;  4UAP A;  1NQD A;  2Y6J A;  4AYU A;  3M8L A;  1ULP A;  2WRA A;  2X53 S;  5CAD A;  2D6N A;  1JYN A;  2BYV E;  4TSV A;  3BUC A;  3MIE A;  2A3Y A;  2VVD A;  2VU9 A;  5L73 A;  1R09 2;  5FP3 A;  1H2K A;  1BK0 A;  2K2S A;  1NE4 A;  1ASJ 2;  4OFG A;  3POE A;  3A23 A;  4NVP A;  1UMZ A;  4OHV A;  4BA6 A;  3HEI A;  3UYJ A;  5GZD A;  2VOT A;  5J1X A;  2IXK A;  1QJY 2;  4HPK A;  2VEC A;  1OOP C;  4YW4 A;  3K77 A;  4XQD A;  3X29 B;  1FMD 1;  2C4X A;  1LOB A;  2ZXQ A;  4XDQ A;  4AED B;  5CYY A;  2GNB A;  4BQW A;  4FAG A;  1NLQ A;  3AZY A;  1WLD A;  4XFH A;  5I8S A;  1GP5 A;  1OF4 A;  2N7G A;  1D2S A;  2X09 A;  3MI8 A;  3O5S A;  5T5L A;  4RN5 A;  3VBF A;  2TBV A;  4DXZ A;  2ZCW A;  2BZD A;  4Q4V 1;  5EJZ B;  1YQ6 A;  2ORZ A;  5FYS A;  4O9E A;  3S0M A;  3EMR A;  2MEV 1;  3ZSL A;  5I0S A;  1PO2 2;  1Q43 A;  5IAX A;  5A70 A;  2VCC A;  4YM1 A;  4UFM A;  2YG0 A;  1GQH A;  2QQU A;  3HPN A;  5HV0 A;  4LOR A;  3IZO A;  3BB6 A;  4E2S A;  3KT4 A;  3UNP A;  5KHI A;  4YW3 A;  2YC0 A;  4EV0 A;  5ANQ A;  2X5I C;  1WCK A;  1UO9 A;  3C7H A;  3JZV A;  5K4L A;  2WSU A;  2RS3 1;  1AYM 2;  3NAP B;  2W94 A;  1L7L A;  2PEL A;  4CEW A;  1H30 A;  1UIJ A;  2XJR A;  4G4F A;  3JBG 3;  4NIG A;  1R64 A;  4UWD A;  5LAS A;  4LHK A;  4XBN A;  1VAM A;  4JV4 A;  2GND A;  1H2M A;  3D0S A;  1HQN A;  2DBN A;  3OEA A;  3VBR B;  3F2Z A;  2YGL A;  3GZA A;  3HJR A;  3S5Q A;  2P2K A;  3B01 A;  2FBE A;  3HAG A;  2R1B A;  4W8J A;  3W20 A;  5M0T A;  1I1E A;  3BKZ A;  4GJZ A;  2TUN A;  1UNB A;  5FPX A;  3AKT A;  1YJK A;  3GHM A;  1G8W A;  1ULG A;  4FP2 A;  3TEX A;  2O8O A;  2VZO A;  3FL7 A;  2HWB 2;  1W6N A;  1PM4 A;  4PDW A;  4DNY A;  3AP4 A;  1JZ3 A;  2UY9 A;  2XJT A;  2HKX A;  2I45 A;  4WVM B;  5CEH A;  2W1U A;  2YUE A;  1YFW A;  2VMD A;  2D6K A;  4IEZ A;  4AGV A;  5JOW A;  5A3L A;  3WUC A;  5KR7 A;  3DPR A;  4QDR A;  4DY5 A;  1B09 A;  3FHQ A;  1CAU B;  5FO9 B;  3ZXE A;  3TB0 A;  1WKY A;  1UY2 A;  2HWC 3;  2WZR 1;  5BNQ A;  3J9S A;  4FFF A;  1C8M 2;  3PTY A;  2PLV 1;  1GBG A;  4GWN A;  4CDU A;  5DZE A;  3ORJ A;  1CIW A;  4HL0 A;  4P00 B;  2HWE 1;  3M7A A;  3MLL A;  2HWD 3;  1CX4 A;  1FX5 A;  4XF9 A;  1Y3T A;  4D7S A;  3VBU C;  3AP9 A;  3WHT A;  2BWC A;  4CP1 A;  4X8P A;  4PF5 A;  3J7H A;  4KNC A;  3VN4 A;  5IK5 A;  1BEV 3;  1FXZ A;  1BBT 3;  2J7M A;  2W91 A;  1HB2 A;  2D93 A;  3LOI A;  4QX1 A;  3WNX A;  4COU A;  2JIC A;  4EWA A;  2VMF A;  1V6M A;  1OH3 A;  5CZK A;  3O1S A;  1U12 A;  1GNY A;  4BHP A;  3LEI A;  4BPZ A;  1BYH A;  4Q8K A;  4YM3 A;  5JLV A;  1Q3E A;  2PAE A;  2WNV C;  3AYC A;  1FAT A;  5L7O A;  3GDB A;  1VBA 3;  3FHA A;  5HPO A;  2UY8 A;  1QKQ A;  1ND2 A;  3K3O A;  2WZP P;  3ZVX A;  2AUY A;  4YW7 A;  3MYX A;  5FDB A;  5ISL A;  3NQH A;  1SLA A;  4IEP A;  3T2O A;  1OKQ A;  4W65 A;  1QQP 1;  3E6C C;  1I5P A;  2VUL A;  4ZXK A;  5JR2 A;  3ES1 A;  3EJK A;  2BVV A;  5LRR A;  2KD7 A;  1FMD 2;  2ZHK A;  3AKQ A;  4AI3 A;  3OB8 A;  3C7O A;  5I0U A;  3WG1 A;  2BER A;  3Q9O A;  4ES8 A;  1ZRC A;  3HQX A;  1Q8Q A;  2ZMK A;  3B02 A;  4LHL A;  5GAL A;  3Q8A A;  4CP2 A;  1XPW A;  5IJR A;  2XLF A;  5C3R A;  2IFW A;  1W28 A;  3W9A A;  1CAV A;  4Q4V 2;  3VZN A;  4HAN A;  2RDQ A;  1VIW B;  4QB1 A;  4GAL A;  4AI1 A;  5KC6 A;  5FZO B;  1NCQ A;  4XHB A;  1X50 A;  2MEV 2;  3WG2 A;  3KV6 A;  2CGP A;  3PHM A;  2VNO A;  3QBQ A;  1ZZC A;  4I09 A;  5FQ0 A;  4GH4 C;  3AZX A;  4GMP 1;  4M3C E;  5JZG B;  4OUM A;  2XPJ A;  1PVC 1;  2OPK A;  1LGB A;  4K21 A;  3VKN A;  1SLB A;  2RJK A;  4QPI B;  4RFT 0;  2XQR A;  4K7J A;  2WO7 A;  2JDP A;  1DYK A;  5FPV A;  1KEX A;  2XJS A;  3AJZ A;  4HT1 T;  2X29 A;  4YRD A;  2X10 A;  2A3W A;  1ACC A;  2RS3 2;  3IDE A;  2BNO A;  4HK8 A;  4IV3 B;  3ASI A;  2OUH A;  1NY7 1;  3MHZ A;  5DDJ 1;  5LEK A;  4NUB A;  5FJH A;  2A6V A;  4XBL A;  2XOM A;  2Z4F A;  4Q26 A;  2YHJ A;  5IWF A;  5A7O A;  2R32 A;  1Z78 A;  3IDB B;  1PO1 3;  1F35 A;  3HBZ A;  3J8F 3;  5FZ4 A;  4EE2 A;  2JG9 C;  3CZJ A;  1GMM A;  4Q4Y 3;  4BXS V;  2Y0O A;  2XJU A;  1GWK A;  2DUQ A;  1LHN A;  1ZBA 1;  3PIJ A;  1US3 A;  3ZFE A;  3LGR A;  1QOS A;  1O6U A;  1WUV A;  4DOU A;  2V5D A;  3RWK X;  2OYZ A;  3UGG A;  1QIQ A;  2V5Y A;  1IPK A;  1LES A;  5FYB A;  4MG2 A;  2V4V A;  3BAL A;  3TN9 2;  2ZGP A;  4HG6 B;  4COV A;  5LEJ A;  4QX2 A;  1JZ4 A;  1HKD A;  2DFC A;  5D8A C;  1T6B X;  1U5Y A;  3RDI A;  3BTY A;  5FZ9 A;  1LHU A;  3MIC A;  4XUP A;  4EWD A;  3O1P A;  4OHZ A;  2Q1Z B;  2ZX4 A;  5CFC A;  4JCK A;  2CU5 A;  4EN8 B;  3ELN A;  4N9I A;  4ZHN A;  4IES A;  3LWC A;  4CCC A;  1PZ7 A;  2WZR 2;  4CPB A;  4OZO A;  2G4I A;  1YJL A;  2GMP A;  1C57 A;  1E5I A;  1SPP A;  1XE0 A;  2PLV 2;  1VBD 3;  1YC6 1;  5JOZ A;  3ME2 A;  2HWE 2;  2PQQ A;  4PBO A;  3N9P A;  4IW3 A;  3T0D A;  2EIG A;  1RXF A;  1WMD A;  1OD3 A;  1OOP B;  2ERF A;  3CBN A;  3CU7 A;  3LKJ A;  2WAA A;  2ZAB A;  4K40 A;  3RZZ A;  3UKN A;  2DVG A;  1W99 A;  3AFG A;  4SLI A;  1U5X A;  4AVS A;  1RIN A;  1IHM A;  5FY9 A;  4A4A A;  5J7M A;  1PGW 1;  4LO7 A;  4DRV A;  2XVL A;  1OQD A;  5GJ6 A;  3CDZ B;  3D3A A;  1OA2 A;  1AR7 2;  3N9M A;  3VKL A;  4DB5 A;  2A73 B;  4FFH A;  1W2U A;  2D98 A;  5ABJ C;  1DIW A;  3KGZ A;  4GB3 3;  1OSG A;  4YZ3 A;  1UX6 A;  1K5M A;  1ZZB A;  2DUP A;  2MPF A;  4ORF A;  1QQP 2;  2ADE A;  3ZOI A;  3S7E A;  1W2T A;  4AI8 A;  1LAJ A;  4Z92 B;  1O4Y A;  3LAG A;  4NHX A;  2WWU A;  3NV1 A;  3RYP A;  2D6O X;  3R05 A;  3QAC A;  4JGZ B;  3H50 A;  5FZF A;  3BN6 A;  1SDW A;  3N9O A;  3ZPO A;  3RYK A;  1OLR A;  1MS8 A;  2X5I A;  2WZ8 A;  2J22 A;  3ZMO A;  3JBG 1;  2VZR A;  1T6G C;  5A3N A;  5F5C A;  4YFW A;  3I49 A;  4ERO A;  3DYP A;  1RYY A;  3PMS A;  3A0N A;  5KWR A;  4BE3 A;  4HN1 A;  3JXS A;  4IQP A;  2CL2 A;  2B45 X;  4CCE A;  3MPP G;  3SIT A;  2F4P A;  2VL4 A;  3MUY 1;  2A71 A;  4YZ2 A;  4WM7 C;  1PVC 2;  1R08 3;  4KWU A;  1R1A 3;  4GD4 A;  5JPM B;  3OGR A;  1ZM1 A;  4CU8 A;  3H1Y A;  1ULD A;  4UT5 A;  2BNM A;  1AVB A;  5F32 A;  3O1R A;  5FMO L;  4E4Z A;  1KQR A;  2RDN A;  3H8X A;  1S0G A;  4XUO A;  4EN0 A;  1QJZ A;  1DBN A;  3OYW A;  1NY7 2;  5A7Q A;  4CTE A;  5DDJ 2;  1MS4 A;  4DUW A;  4YG6 A;  4FPH A;  5B2G B;  4JTN A;  2ARA A;  5ERL A;  4PHZ A;  3T09 A;  4DZG A;  1C28 A;  2QQM A;  5FPA A;  1JUH A;  2HWC 1;  2QFE A;  1YIF A;  1V00 A;  3P3P A;  2I74 A;  4LXL A;  1H6Y A;  5FXX A;  5F3E A;  4Y22 A;  4LPL A;  1HLC A;  1ZBE 3;  3S6P A;  2RS1 3;  4YW2 A;  1PMH X;  1J3R A;  2HWD 1;  3ZYP A;  4LT5 A;  1ZBA 2;  2K9Z A;  2PHF A;  5BNN C;  4CP0 A;  4Z2A A;  5HXM A;  1CZT A;  1VP6 A;  3RG0 A;  3OY8 B;  3RJ2 X;  3VBU B;  4HVO A;  4QPG A;  2DCK A;  1W06 A;  1ZYB A;  1RXG A;  1V6L A;  1BEV 1;  1IS5 A;  1D2Q A;  1BBT 1;  1B35 C;  2EID A;  3WHU A;  3V0B A;  3OBT A;  3I4I A;  2EIE A;  1W8H A;  3IKW A;  4UF0 B;  4XVH A;  5FK8 A;  1M4W A;  2DVA A;  4FPF A;  4N43 A;  3TNQ A;  3USS A;  3WD5 A;  5BNO C;  1WW5 A;  4FPK A;  4EN7 B;  3BPZ A;  2WNV B;  1VBA 1;  2VTF A;  2P17 A;  3GM8 A;  2P4E A;  2R1D A;  2DTW A;  4O61 A;  4RA0 A;  4CVU A;  5LY1 A;  2ET7 A;  3C8X A;  4I0W B;  4YGE A;  1WCD J;  3KZ4 C;  2RM2 3;  4I2O A;  4A2U A;  5FYH A;  1HXS 3;  2ZGR A;  1OPM A;  2JIJ A;  4CDX C;  1KS5 A;  1LTE A;  2XDV A;  2QCS B;  4A44 A;  5F1R A;  1OI6 A;  1N3P A;  2WNU B;  4EYU A;  2FMD A;  3T4H B;  2ZZJ A;  3K2O A;  3DEM A;  1CAW B;  1PGW 2;  1XSQ A;  2OZ6 A;  4ZON A;  3WF2 A;  2VOK A;  1NLS A;  1ZRR A;  1PO2 3;  3GHN A;  1TNF A;  2QZ2 A;  2Y6F A;  2QE3 A;  4IV1 A;  2CGN A;  2YPD A;  3VZM A;  4ASK A;  1LR5 A;  1HQW A;  3AB0 A;  1A34 A;  1FI2 A;  4AHZ A;  2Y64 A;  2CNA A;  3LA7 A;  1QXP A;  1JZ8 A;  3DN7 A;  4ZPI A;  1X8M A;  1NZI A;  2NQY A;  4U36 A;  3QH6 A;  3JD7 2;  4GH4 A;  3WP4 A;  1JOD A;  1RUE 3;  2RDR A;  3POS A;  1A8M A;  5FPZ A;  4ISQ A;  2GSY A;  3MIH A;  1RUJ 3;  1O3Q A;  4OHX A;  1W6O A;  1YFX A;  3I7D A;  3WT3 A;  3ZXA C;  4XHX A;  5KHG A;  5BNP A;  5C3P A;  1XU2 A;  3JUU A;  1V6K A;  1SLC A;  3JBG 2;  4MHR A;  2Y8K A;  2WC2 A;  1MEC 3;  5I8Y A;  4E8D A;  2CYF A;  3KGL A;  4KG8 A;  3WXP A;  4C0H A;  1UOF A;  1PO1 1;  3J8F 1;  4Q0Q A;  5F6L B;  4HZF A;  4LK6 A;  4E9K A;  2KA3 A;  4Q4Y 1;  2JG9 B;  2VVE A;  1AR9 3;  5KXE A;  4C90 A;  3ZN4 A;  5F9T A;  4MXW B;  1F31 A;  5I91 A;  1QOT A;  2B39 A;  1XNA A;  2W46 A;  4R9B A;  2VNV A;  2GU9 A;  3NV4 A;  5T5P A;  3OJB A;  4HVQ A;  3NW4 A;  1NT0 A;  5IK8 A;  2ARE A;  3H3L A;  1XYO A;  3M2M A;  4YW5 A;  4M00 A;  1L7R A;  1JYV A;  4Y24 A;  4IUG A;  4QQ2 A;  3VDB A;  3V0A B;  1SBD A;  2JD9 A;  5F2W A;  2VO5 A;  5LY2 A;  3UGF A;  3RZK A;  4L8Q A;  1F5F A;  3MIG A;  3IAP A;  1QY4 A;  3CLP A;  1HV0 A;  1V9U 3;  3H9A A;  1D0G A;  1HDK A;  4K8R B;  2WUH A;  4OMC A;  5C4W B;  1V6O A;  2HWC 2;  3AK0 A;  2P1B A;  4QGL A;  4QX7 A;  5JXH A;  2DCZ A;  2JEC A;  4NRO A;  3PDQ A;  4YFZ A;  4GWJ A;  1VBD 1;  2GC0 A;  2LW8 A;  4UOJ A;  5K0U B;  1DP0 A;  1UY1 A;  3KCY A;  2K0G A;  1ZZ7 A;  1JU3 A;  2W1W A;  4YLZ A;  5FZ7 A;  5A3W A;  1OMI A;  2HWD 2;  3WDU A;  5LZ6 A;  4AEJ A;  1V6I A;  3WEZ A;  5JSR A;  1UAI A;  5EJ1 B;  3PUR A;  3D0J A;  2JE8 A;  3A21 A;  5FLI A;  4P9Y A;  3PIG A;  4ZU5 A;  1BEV 2;  5FZG A;  4BCU A;  1BBT 2;  2VQ0 A;  4FPC A;  4OYU A;  1BJQ A;  4I3P A;  1MS9 A;  3ZLI A;  5A6Z A;  1PM7 A;  3AKP A;  5LA0 A;  4AAX A;  2WO1 A;  3WUD A;  4A45 A;  3LIG A;  1YQ8 A;  1BCX A;  1VBA 2;  2VZP A;  1WW7 A;  4FT8 A;  1X33 A;  2JE9 A;  2XHK A;  3KF3 A;  3PU3 A;  4GB3 1;  4JDN A;  2ARC A;  5FXW A;  5L9B A;  1XNT A;  1W8O A;  3SH4 A;  1S4C A;  1GV9 A;  1UQX A;  5FJK A;  4OZX A;  1MZF A;  4XQ4 A;  4Y1X A;  5ABJ A;  3U4X A;  1ZZ6 A;  1GOG A;  3MEP A;  1AR6 3;  4XAC A;  2Q8E A;  3OPT A;  2GNM A;  5JI7 A;  3J26 N;  4IEY A;  1LHW A;  2ARB A;  2YBK A;  3WNM A;  5I8T A;  3VL8 A;  3TEZ A;  3KF5 A;  3ZXK A;  1W2A X;  5CU1 A;  5EZW A;  2NMO A;  5FY8 A;  5J09 A;  1Z7S 3;  4FI9 A;  2JDH A;  2JDN A;  3OTF A;  4KG0 A;  1HN0 A;  3AP5 A;  1DQ4 A;  5C3O A;  2JDM A;  2XVG A;  3VBH A;  5FYT A;  3ACH A;  3ROU A;  5HI0 A;  1JZ2 A;  5JWP A;  3DXU A;  1R08 1;  1UU5 A;  2IWG B;  1Q8V A;  2P3J A;  4LTA A;  4WM7 B;  1R1A 1;  4OHY A;  2Q1M A;  3FLR A;  4Z07 A;  1VMH A;  2WL1 A;  3R4D B;  2QQJ A;  3BYW A;  3KV4 A;  3HN1 A;  3FFQ A;  3GBF A;  1UXX X;  4PLN A;  3CO2 A;  3D82 A;  1YQC A;  4LBM A;  3E6B A;  3CJI B;  3EBR A;  4P5Y A;  4P9W A;  4QHO A;  5E8A A;  2HYK A;  1XB9 A;  2A7A A;  1PMI A;  2JDY A;  3MLJ A;  3OUI A;  1NA1 C;  3GCX A;  3USU B;  1UXZ A;  3E1F 1;  1UOB A;  1PNG A;  1FNY A;  2D6L X;  1UYY A;  5IVJ A;  4GKY A;  2YV8 A;  4FPG A;  3U75 A;  4EQV A;  4PDW C;  5CG9 A;  4HOO A;  1PO1 2;  2VXJ A;  3J8F 2;  3ZFG C;  3KMH A;  1VAL A;  2ZGO A;  5F8P A;  2Q8C A;  4Q4Y 2;  1ND3 C;  1ZBE 1;  2OQ7 A;  2RDS A;  2RS1 1;  3ZN6 A;  4AI0 A;  5BV6 A;  5C8C C;  3I2O A;  2VBP A;  3DPR C;  5CA6 A;  4Z2W A;  3BTZ A;  3VKM A;  3H1M A;  4XC9 A;  2YC2 A;  1VE0 A;  1WW6 A;  1YLL A;  3TN9 3;  5KBF A;  1XNK A;  1XXN A;  3WVJ A;  1S0I A;  5DAB A;  2QUO A;  4UW4 A;  5DAX A;  4RS5 C;  2ZML A;  1I9R A;  4ES9 A;  1GR3 A;  3C3V A;  3MF9 A;  4CDU C;  3I54 A;  2VZT A;  4ASL A;  3KCX A;  5L36 A;  3JCI A;  1B35 A;  5T5O A;  2NN8 A;  4LHN A;  5BNO B;  2GZW A;  3QH7 A;  3VD9 A;  3FMG A;  2DDU A;  1U0A A;  2QQN A;  3ALQ A;  3RWN A;  3ZXL A;  3ZIW A;  1VBB 3;  3LSE A;  3MO4 A;  4AQ2 A;  4H7M A;  5FZ8 A;  4NHL A;  3SEP A;  1CGP A;  1LOF A;  1VBD 2;  4BM8 A;  2FDG A;  1W9F A;  4YVW C;  1GZC A;  2B4K A;  2RM2 1;  4Z82 A;  3DYM A;  4YVS C;  4S2F A;  5FZB A;  1HXS 1;  5C5U A;  4DXS A;  5JAX A;  1IQD C;  1CIY A;  4WM8 A;  4YM0 A;  2AGS A;  1MQT A;  4W6X A;  4IE6 A;  5BYN A;  2VPV A;  1NCR B;  1Q5O A;  3MPB A;  4V2W A;  4CDX A;  1AR7 3;  2OUJ A;  2VXR A;  3UT0 A;  1RUC 3;  3SC7 X;  1LU1 A;  4LBQ A;  4CCL A;  5AFB A;  1WA6 X;  2OPW A;  3SXW A;  1PO2 1;  3TEW A;  3BIE A;  1YHF A;  4HVR A;  3RZL A;  1H8T A;  1S2K A;  3D5O A;  3KQR A;  4RHV 3;  4YWA A;  2EAK A;  1LU2 A;  1GZT A;  1NX9 A;  1GNH A;  2LRO A;  1XBF A;  4RQP A;  4GB3 2;  5IVF A;  2GC1 A;  3FBM A;  4XEZ A;  2ZS6 B;  3H7Y A;  2UYA A;  3WW2 A;  5A3O A;  1QJF A;  1XE7 A;  2XON A;  1GZW A;  5F5Q A;  5L9V A;  3TOJ A;  3LDK A;  3VKF C;  1OA4 A;  1DZR A;  1RUE 1;  2WIN B;  4FAH A;  4NIA A;  1NCQ C;  2EAA A;  2P6H A;  1LHO A;  1RUJ 1;  1OVP A;  2PFW A;  3ENR A;  1RTV A;  4XF3 A;  2B8M A;  2VNG A;  4CZS A;  3AP7 A;  1W8F A;  3F95 A;  3N9Q A;  4YYO A;  1MEC 1;  4QPY A;  4PQQ A;  1F4H A;  1NXM A;  3III A;  4MGQ A;  1DZT A;  4ATE A;  2XG3 A;  4Z8B A;  2LRP A;  1JHJ A;  4YW6 A;  4CA9 A;  1I5Z A;  1UF2 C;  2VOV A;  1AR9 1;  3B00 A;  1R08 2;  3IPV B;  4MV2 A;  1QH6 A;  2JG8 C;  1R1A 2;  3E5X A;  4AVB A;  1FT9 A;  3ETP A;  2JEM A;  1QHD A;  4XCB A;  3VD4 A;  3ZX7 A;  3PUI A;  2ZA9 A;  2YMZ A;  4QHB A;  5B4N A;  2CAV A;  1JZ5 A;  1FOD 3;  5C3S A;  1PGL 1;  4X8N A;  4URA A;  5A1F A;  1ENS A;  3ILR A;  1QXJ A;  3BIW E;  1V9U 1;  3N7M A;  3ZFE C;  1POQ A;  2WQ8 A;  4YSF A;  4HFS A;  2NMN A;  5APA A;  2IC1 A;  2XL9 A;  4N8M A;  1RIR A;  1S0F A;  5EWS A;  1AL2 3;  5JCT A;  2B42 B;  2Y6K A;  1ZBE 2;  1AJK A;  1UD1 A;  2RS1 2;  2YRO A;  1JS9 A;  3M3E A;  4AQT A;  1W39 A;  2A3X A;  2G9Z A;  4Q4W 3;  3ZSM A;  4S2H A;  5CFC C;  1N1S A;  4AQ6 A;  2IVJ A;  3THP A;  2NZ9 A;  3OG2 A;  1BQP A;  3AVS A;  4CXY A;  1UY3 A;  2VTX A;  2WA4 A;  1RMU 2;  3NRU A;  3POI A;  2ZGN A;  4AFB A;  3AL5 A;  3MF6 A;  3ABZ A;  5GLZ A;  2DU1 A;  3PME A;  4MSV A;  4HPK B;  5HV4 A;  2E53 A;  3I3M A;  2BGO A;  1BZW A;  5C5T A;  4Y5Z 0;  5EPA A;  1O5L A;  3PLQ A;  3WF0 A;  1YI7 A;  2WJS A;  1O4Z A;  4UFK A;  4YZ4 A;  3DF0 A;  2LM3 A;  1N3Q A;  3VBF B;  4AZZ A;  4C0B A;  4R52 A;  2RM2 2;  5EHD A;  5LCW L;  5K7P A;  1HXS 2;  2XML A;  1W03 A;  1ULE A;  5D2A A;  3U11 A;  5ANN A;  2Y33 A;  1AR6 1;  3BTX A;  1V70 A;  4CEY B;  5I0D A;  4BU2 A;  4LKS A;  1JYI A;  5T54 A;  4PJY A;  4B1M A;  4L99 A;  1SG3 A;  4IND A;  4P14 A;  5LBE A;  3I2I A;  2JE7 A;  3NNL A;  1JXN A;  1K5M C;  4N7I A;  1IKP A;  1JOJ A;  3LF7 A;  5T52 A;  1ZRI A;  1VB4 A;  1DCS A;  3ZR5 A;  1Z7S 1;  1EPW A;  3VZJ A;  3S5A A;  4FVV A;  5IVV A;  3VB9 A;  4AEM A;  4F8A A;  3OPZ A;  2QBX A;  5BUV A;  1K5J A;  3JD7 3;  1H4H A;  3AXD A;  2BGC A;  4AWD A;  4I0B A;  4AG4 A;  2QQI A;  1QF3 A;  1KFU L;  4P9G A;  3BI3 A;  1S2B A;  4CEW B;  5JSP A;  3O14 A;  1RUE 2;  2VBD A;  4E2G A;  2DFB A;  2BRT A;  1RUJ 2;  1XNB A;  1SDD B;  2OA2 A;  4NHK A;  4LE3 A;  3RQ0 A;  2E7A A;  1E5H A;  1WMF A;  1N1Y A;  2DYC A;  2O14 A;  3GCW A;  1RUI 3;  2I07 B;  1LB2 A;  5F39 A;  5JOY A;  1H6X A;  1V6J A;  2VUJ A;  2ZPX A;  1Q56 A;  1POV 0;  3I8T A;  1MEC 2;  3H8U A;  1RHI 3;  4ITC A;  1F9K A;  3ZYJ B;  1ZX5 A;  1OC1 A;  1S0D A;  1XYP A;  1NA1 A;  2GC2 A;  3A22 A;  3WLU A;  1W6N B;  2C6S A;  4PDW B;  4FTS A;  1SFY A;  2FMY A;  3M70 A;  2X05 A;  4LUK A;  3WW1 A;  1H4G A;  3U14 A;  1AR9 2;  3VBO C;  1IGO A;  2R7E B;  3ZFG A;  3I97 A;  5EP9 A;  3DPR B;  4P9I A;  2PHU A;  3TN9 1;  3J7M A;  2P6C A;  1ND3 A;  4YNI A;  2UUR A;  5C8C A;  4P9X A;  2ZHN A;  2LAL A;  1CZS A;  1G9C A;  1S0J A;  2D5F A;  3WV6 A;  1HB3 A;  5FO8 B;  1SMV A;  2WR9 A;  4RGK A;  3OD4 A;  4ZXE A;  3RSJ A;  3B9I A;  4CDU B;  3R0R A;  1PGL 2;  1S2E A;  2WLQ A;  4RS5 A;  2V4A A;  3WSO A;  2D44 A;  4ISR A;  1BVV A;  1V9U 2;  5F3I A;  5T5J A;  1GSL A;  2YDE A;  4AFD A;  5A3M A;  1RVF 3;  4MGY E;  4OHW A;  5H9S A;  1CQ9 A;  3VBS C;  4QPG C;  1VBB 1;  1EV1 3;  2VG9 A;  2JDA A;  3S7I A;  1APN A;  2ZEW A;  1ENQ A;  1VRB A;  2E63 A;  3CHX A;  2IVI B;  2G9G A;  4PI2 A;  4Y3O A;  4Z1V A;  3DGT A;  4W6W A;  4CPB D;  4N43 C;  1RUH 3;  3A4U A;  2ZAA A;  2AH2 A;  4YVW A;  5IVE A;  4YZ1 A;  4YVS A;  3H0O A;  2ZEY A;  1L3J A;  1T2X A;  2FCV A;  3IMN A;  5L7O B;  3I3E A;  1SLL A;  1AR7 1;  2BV4 A;  1ND2 B;  4L92 A;  1EAH 3;  1RUC 1;  3RI8 A;  1V0A A;  3H3Z A;  3ZKY A;  2WYF A;  1K3I A;  4FPY A;  3ZYB A;  4DXT A;  2GN7 A;  1JOB A;  3AMM A;  3CJX A;  4HLT A;  3T2Q A;  3GXU A;  1GU3 A;  4FOQ A;  1UWW A;  2P37 A;  4RHV 1;  3RMY A;  1TNR A;  1COV 3;  4OI2 A;  2IXJ A;  1VMJ A;  5J98 B;  3O7O A;  4IE0 A;  2JJ6 A;  2PHT A;  4GUL A;  2FQP A;  3QOP A;  5H9Q A;  1KD7 A;  2VD7 A;  4A7K A;  3WF3 A;  1CAV B;  1N1V A;  3HOB A;  4Y1Z A;  1MPX A;  2RS5 3;  1AR6 2;  2XUM A;  5BY5 A;  1NCQ B;  5F6K A;  2WFF 3;  4IV1 C;  3VDD B;  1O3R A;  4LEJ A;  2D40 A;  3TBD A;  4DY3 A;  2J42 A;  3T1L A;  5FQ0 B;  5IK7 A;  1C1F A;  1OBN A;  2CSG A;  1W8W A;  2VR4 A;  4Y4R A;  1LOG A;  1Z7S 2;  1X82 A;  3KS7 A;  2HLE A;  3CKH A;  4JX0 A;  5GLV A;  4QHZ A;  4PIY A;  1W0O A;  5FIX A;  1X9T A;  4XJW A;  5LAT A;  1VRH 3;  1UZY A;  3ZFF A;  4MGS A;  5BNP C;  1SBE A;  3IAQ A;  5IK4 A;  3GJA A;  5IW0 A;  2RE9 A;  3MFC A;  4XJ9 A;  3D6E A;  1AYN 3;  3NJX A;  2C5D A;  4JVA A;  4DPN A;  3WNL A;  4B7E A;  2JG8 A;  4D6Q A;  4M4R A;  4E8C A;  5A80 A;  4NHY A;  4CDQ C;  4PIZ A;  4W50 A;  3VDA A;  1CPN A;  3GZE A;  4FTE A;  4QKD A;  3FUQ A;  3N35 A;  1FOD 1;  3ZYG A;  3BOD A;  3UV9 A;  2NYY A;  1KGY A;  5JZG A;  3GZT B;  4NJ4 A;  2DWR A;  3J7L A;  2VCA A;  3ZFE B;  5GZG A;  1W6P A;  1PK6 A;  1Y9M A;  1A3K A;  2CAU A;  1AL2 1;  3I3Q A;  1LHV A;  3OSD A;  3PU8 A;  4K9S A;  4AVA A;  1W05 A;  2VUD A;  4D0Q A;  1GKB A;  2ATF A;  4I3G A;  2CDP A;  2GME A;  2Z79 A;  4Q4W 1;  4NR1 A;  4XTP A;  5CFC B;  1J59 A;  5IVB A;  4FXG B;  1Q8S A;  1D4V B;  2R04 3;  3N9N A;  4XPV A;  3KVB A;  4AOC A;  1UW8 A;  3CIH A;  3MV0 1;  3HQR A;  5FRE A;  1SPP B;  2WO2 A;  1CON A;  3UK9 A;  2AZ5 A;  2YB7 A;  3VL9 A;  3K4A A;  3NJZ A;  1MS5 A;  3OBZ A;  1VBB 2;  4E4D X;  3VD5 A;  4M3C A;  1GP6 A;  2JIG A;  4Q0U A;  3WCR A;  1PNF A;  4B29 A;  3N7L A;  4AVT A;  2HWF 3;  5I0T A;  4JGY A;  3B3Q E;  5FWE A;  4B1L A;  1XND A;  5LA9 A;  1V6N A;  1URX A;  3AMH A;  1UY0 A;  3LFI A;  4Q29 A;  5FBJ A;  2FDF A;  2GN3 A;  3IMM A;  1Y9G A;  1YFU A;  1YXW A;  4XJ8 A;  4UXA A;  1DQ0 A;  1MS3 A;  5FYV A;  1RUC 2;  3J4U H;  3HN3 A;  4NAO A;  1K5M B;  1W8U A;  2B46 X;  3NST A;  4MGI E;  5A7W B;  1HB1 A;  2VM9 A;  4RHV 2;  5FPB A;  4RSU A;  4XJZ A;  5E16 A;  1UYP A;  4XMA A;  5J96 B;  1S1A A;  1MS0 A;  1WZX A;  2JEN A;  3JD7 1;  3O0X A;  2XJP A;  2R30 A;  3ST7 A;  2O0O A;  4FP3 A;  3U78 A;  2X5I B;  1XNC A;  2YXS A;  2WN2 A;  1W9T A;  4UFL A;  3VKO A;  1IG0 A;  2BFU L;  3C7G A;  4BLI A;  3PNA A;  4QGM A;  5A3T A;  1K42 A;  1KDK A;  4FQ4 A;  3GBG A;  3MW3 A;  1PX4 A;  2PHD A;  2VZQ A;  1WWY A;  1RUI 1;  3H7J A;  1CJP A;  2Q5T A;  2UWA A;  3H42 B;  5FZH A;  4NII A;  5IFP A;  4O65 A;  1W9Y A;  2HEV F;  4CYD A;  3WF1 A;  1UZ0 A;  1KXG A;  3ACL A;  2YU1 A;  3NNF A;  3NWK A;  3PTR B;  1RHI 1;  5FFO C;  2VTX J;  4Q2F A;  3HBK A;  1CAX A;  2WDB A;  4UW5 A;  5BPX A;  4XOG A;  1KJL A;  4TWT A;  3WNP A;  4LE4 A;  3AL6 A;  2R0F A;  4K1Z A;  1ULC A;  3M1H A;  2YC4 A;  4BZ4 A;  5FZE A;  4Q4X 3;  3WF4 A;  1ZA4 A;  4XFB A;  5AC9 3;  2Y60 A;  3OYW B;  4PCR A;  1DQ1 A;  2AEN A;  5AFE A;  4RR3 C;  3VBO A;  2D3P A;  1MAC A;  3HNY M;  4N53 C;  4BH9 A;  4DEV A;  2FZ2 A;  4N9H A;  1EP0 A;  2DVD A;  4LA2 A;  1AF9 A;  3DXT A;  3FC0 A;  2CV6 A;  1D7P M;  4NE9 A;  1FOD 2;  1J3P A;  3OF1 A;  4QXH A;  4XAB A;  5FZD A;  1WMX A;  3PUQ A;  4XAA A;  2Q8O A;  1PGS A;  3ATG A;  3VD7 A;  1GP4 A;  1US2 A;  1RVF 1;  4AI9 A;  1EUU A;  4KH9 A;  4K1Y A;  4A6O A;  1EV1 1;  4QPG B;  1AUY A;  1NKG A;  4LLO A;  1AL2 2;  3WZ1 A;  3EYP A;  4IET A;  4UI9 L;  1HN1 A;  3VBS A;  3V0B B;  4QQH A;  2BVB A;  2DCT A;  4TLG A;  1RUH 1;  5LA1 A;  2P5B A;  5LW9 A;  1RMU 3;  4N43 B;  4Q4W 2;  3ZDV A;  3IN9 A;  3ZYI B;  4LBJ A;  5FMD A;  4N7U A;  4HSJ A;  3U37 A;  4C8D A;  4CCO A;  2OKX A;  3EO6 A;  3PVN A;  1LOF C;  1W8T A;  1EAH 1;  1WCU A;  3HVD A;  4H3W A;  4IE5 A;  5DUU A;  2P3I A;  2D5H A;  3T1M A;  4WM8 C;  3O12 A;  4GMP 0;  5H9R A;  5JIU A;  2JDU A;  5FP9 A;  1GYK A;  1MQT C;  5C70 A;  5JXI A;  2ZEX A;  1AJO A;  4HK9 A;  1COV 1;  4GXL A;  1GUI A;  1EPZ A;  4COY A;  2BQP A;  1AL0 G;  3NJV A;  1BKZ A;  3LOB A;  2TNF A;  3CF6 E;  1ULO A;  5GLU A;  3O0W A;  2F4L A;  4GZ9 A;  4KU8 A;  1O3S A;  1RUD 3;  4YM2 A;  5A33 A;  1S0B A;  3LE0 A;  2RS5 1;  1O59 A;  2CTV A;  2W68 A;  1H8T C;  1YIP A;  4M0N A;  2WFF 1;  4XET A;  4X6R B;  1AXZ A;  4IV1 B;  2R6Q A;  3CMG A;  4RQP C;  1H9W A;  1S55 A;  1SEF A;  3ILN A;  4L0P A;  3KWV A;  2YGM A;  2EIB A;  1XYN A;  4LNV A;  2AEZ A;  3I2F A;  5DG2 A;  2A6W A;  1X36 A;  3UES A;  4LIV A;  2E6V A;  2RJL A;  5K8S A;  4H7L A;  4GH4 B;  2ADD A;  2WBK A;  5GKA C;  3KB5 A;  3LB9 A;  1VRH 1;  1W6O B;  2W87 A;  4NO4 A;  2O1Q A;  4IEV A;  5J36 A;  3ES4 A;  5BNP B;  1UPI A;  1PZ9 A;  4K20 A;  3PVE A;  5A6X A;  3NKG A;  1J84 A;  1O8S A;  3FLT A;  2VW1 A;  5BXX A;  1AYN 1;  2E7T A;  3N3H A;  1RED A;  2W08 A;  3QCW A;  4V2V A;  5FY1 A;  2AYH A;  4OUL A;  1DGW X;  4A42 A;  1OUS A;  2BTV C;  2W95 A;  3PVO A;  4KI5 M;  1RUI 2;  2V72 A;  2VVF A;  1RUO A;  3TWI A;  3WNN A;  1OQ1 A;  1FAY A;  1PIV 3;  3IIA A;  1QJU 3;  3R6S A;  2Z69 A;  1X9P A;  4O7X A;  2CHH A;  2ZTN A;  2QVS B;  4GWM A;  4MAD A;  4YZ5 A;  1RHI 2;  1LRH A;  2QTW B;  5FUP A;  2A6Y A;  4KGQ A;  1JTZ X;  3S30 A;  5F2S A;  4QX3 A;  2ORX A;  4E4H A;  2Y38 A;  5EV7 A;  1U5Z A;  1P8J A;  2J1E A;  3INA A;  3AZV A;  4P9L A;  2IXC A;  2W3J A;  1O7F A;  4NRP A;  1UKG A;  5FMC A;  3ZN5 A;  4FCA A;  2AEY A;  4TZD A;  1DF0 A;  2XJQ A;  4JRL A;  5ACA 3;  2Q0A A;  5JR7 B;  3PJQ A;  3AMP A;  5D8A B;  2FCT A;  4LIU A;  2R04 1;  3PUA A;  1G9D A;  1GIC A;  1TG7 A;  5J3U A;  3H8R A;  3PVB B;  1WME A;  3AZW A;  4NMI A;  3O1U A;  1QDO A;  1PZ8 A;  1OLM E;  2UU8 A;  2FDJ A;  3WNO A;  4PLM A;  2GH2 A;  1JN2 P;  5JOX A;  1UKR A;  1HV1 A;  1RVF 2;  4QB2 A;  1OFN A;  3OOX A;  3V64 A;  2BPA 2;  5FP8 A;  4MXW A;  4AGR A;  4DO0 A;  1EV1 2;  2WII B;  1YCI A;  3LDR A;  4QM8 A;  2JKX A;  3HNM A;  5JPN B;  1BVP 1;  2ES3 A;  4X6Q B;  4MGZ E;  2LS6 A;  2XLA A;  2HWF 1;  3ACF A;  4NOT A;  3ZSJ A;  1RUH 2;  2YYO A;  2GAU A;  4JDM A;  2FDI A;  2I2S A;  2CWS A;  3KVA A;  1SFP A;  2WQ4 A;  4CDW A;  3V0A A;  1ODN A;  4BQ5 A;  3W21 A;  5SV8 A;  3ON7 A;  2ZJC A;  4XIO A;  3KV9 A;  1EAH 2;  2RV9 A;  2FDH A;  2DVF A;  4F83 A;  1EUT A;  5C4W A;  4CRQ A;  2Q8D A;  1OUR A;  2DBI A;  4YGD A;  5FZ6 A;  5ABJ B;  2YU2 A;  1IS6 A;  1O4T A;  2KM2 A;  1RUF 3;  3A7Q A;  2VNR A;  3D4K A;  1S0C A;  4BLJ A;  1COV 2;  4LBQ D;  1RJ7 A;  4DIN B;  4EN6 B;  2EA7 A;  4MYE A;  4PBP A;  2ZGQ A;  3NNG A;  1LED A;  5GZC A;  3HT2 A;  5A3U A;  1FYU A;  2J1A A;  3VHO A;  1SQ4 A;  3I59 B;  4NN0 A;  3K46 A;  1YFY A;  4TTG A;  4HKW A;  2RS5 2;  2EIC A;  5TSW A;  3NO8 A;  1AHS A;  1AX2 A;  4UBG A;  2WFF 2;  4HON A;  2GP3 A;  2QNK A;  3VHR A;  1JUI A;  2G19 A;  3AMQ A;  5DAW A;  4XQW A;  4FPO B;  1VJ2 A;  4Y20 A;  4WVZ A;  1RUN A;  1PVX A;  3MFA A;  3EXU A;  5DAQ A;  1LOA A;  1DYP A;  1H2L A;  2DUO A;  4KBZ A;  4OVE A;  5EJ3 A;  4COW A;  2D7F A;  2XVK A;  5A6Q A;  3KLS A;  1VRH 2;  5LBB A;  4B3N A;  4D7Y A;  3MID A;  4Q4X 1;  3ZXD A;  1OF3 A;  5JUV A;  1N3O A;  3FX3 A;  3M3C A;  2QQP A;  2VMG A;  5AC9 1;  4CU7 A;  4ARX A;  1AYN 2;  2IXI A;  4O9G A;  1LNS A;  5FY4 A;  5CB7 A;  5JVV A;  1GFF 2;  1STM A;  4FOW A;  3AYE A;  5LBF A;  3NKT A;  4ONU A;  5HCH A;  1CES A;  2ENR A;  3O1V A;  4CXW A;  4AAP A;  1Q8P A;  1W0P A;  4RR3 A;  5C9A A;  1QNW A;  4N53 A;  5T55 A;  2H6C A;  5FV3 A;  1DYO A;  5FYI A;  1QMJ A;  2RHP A;  3AYA A;  2A5Z A;  2KR2 A;  2MHF A;  1XC6 A;  1MVE A;  3ZN6 B;  4D7T A;  4DMI A;  3LSD A;  3B93 A;  3MGU A;  3LDB A;  5G04 L;  4RL7 A;  3LFM A;  4QQP A;  2VUC A;  3IB3 A;  5A1A A;  1NUK A;  5CVR A;  2GAL A;  1DG6 A;  2CY6 A;  4H14 A;  1Y7B A;  2XH6 A;  5BNN B;  1TEI A;  4IXL A;  5A7N A;  1CWP A;  2P3K A;  1E5R A;  5F37 A;  4QXC A;  1QU0 A;  2JKB A;  1W6M A;  1RMU 1;  4JKL A;  1B35 B;  3L9J T;  4LO6 B;  4OQ8 A;  2VH9 A;  4ZS3 A;  3IBM A;  4J25 A;  2EXK A;  1W3X A;  4OMD A;  1IZ3 A;  2R04 2;  1ZZ9 A;  2D3R A;  1S0E A;  2W52 A;  2PAK A;  4S2D A;  3POJ A;  3KT1 A;  5DXD A;  2WAB A;  2WN3 A;  2XKP A;  1SLI A;  3ZO0 B;  1O91 A;  4A7Z A;  4AQS A;  1G7Y A;  5FOB B;  1OKO A;  1AR8 3;  2XHN A;  4J1X A;  2XBO 3;  3KCC A;  5A32 A;  4BMB A;  4AHX A;  3ECQ A;  1H1A A;  1NXD 1;  1FNZ A;  4MVT A;  2H6B A;  4XUR A;  1OT5 A;  4CDX B;  3T08 A;  4LBK A;  2J1R A;  1WLW A;  2HWF 2;  1RUD 1;  2VMI A;  3KSC A;  4LBQ B;  1CX1 A;  1UMI A;  2ZKL A;  3EHK A;  1SAC A;  1W8N A;  3N4M A;  1H8T B;  1UN1 A;  1DQ6 A;  2GDF A;  4ASM B;  1OPO A;  2W92 A;  4HN0 A;  4TYS A;  3VV1 A;  2GC3 A;  2A6X A;  2J1T A;  4LHS A;  1LUL A;  2H0B A;  2XR4 A;  2WT1 A;  3LA3 A;  5IVY A;  4LMF A;  3RNS A;  3E5Q A;  2VME A;  2QQK A;  1GZW B;  5FZA A;  1REE A;  4YW1 A;  4MGT A;  4CP9 A;  3HQU A;  1MZE A;  2W1S A;  2B7Y A;  3GYD A;  4B4R A;  5DMY A;  3S57 A;  4JZR A;  1Y4W A;  4CCJ A;  1VAV A;  5HCA A;  2ZGK A;  3HT1 A;  2VZS A;  5FYZ A;  2OX0 A;  2BJS A;  2PHL A;  1DGW A;  4XE9 A;  2PQS A;  1AX0 A;  1KS4 A;  1C8N A;  2JD4 A;  4NPR A;  3UJQ A;  3VZL A;  1H0B A;  1NCR A;  2C9K A;  2JB4 A;  3ACG A;  4QXB A;  5C7G A;  4DIQ A;  1KJR A;  4BYY A;  4UFI A;  4YPJ A;  1TME 3;  3O1T A;  1JYT A;  3DUI A;  1IKQ A;  3AFK A;  2DUR A;  3K48 A;  5CNA A;  4OI1 A;  3UL2 A;  3ZFF C;  1C5H A;  1PIV 1;  2DTY A;  4KWL A;  4L11 A;  1QJU 1;  5I0R A;  3H8O A;  2QJV A;  4LBL A;  1O5U A;  1ENX A;  3AKR A;  2VGD A;  4LO5 B;  1DFQ A;  1YQ2 A;  2ZOE B;  2DU0 A;  3K3N A;  4LJH A;  5IYY A;  4EZ4 A;  5FR3 A;  3LPF A;  4BQ3 A;  3ACI A;  2VBB A;  1W6Q A;  2Q4S A;  4XDP A;  4XUT A;  3VDC A;  2OII A;  2BWA A;  2ZX0 A;  1CZV A;  2R07 3;  4K6B A;  4K3U A;  4L2N A;  4Q4X 2;  3T30 A;  3WOG A;  1D4M 3;  3NV3 A;  4IE7 A;  5HCF A;  3RFR A;  5AC9 2;  4ZU4 A;  2CDO A;  2DV9 A;  4LA3 A;  5ACA 1;  1W3V A;  2VOX A;  1SCS A;  3H1W A;  3OPW A;  5JZG C;  5DUV A;  1NQJ A;  4NPM A;  2R06 3;  4M01 A;  4QQL A;  3ZKU A;  1WD3 A;  3VHN A;  5E88 A;  1PK6 C;  1E5S A;  3UJO A;  2QQV A;  4BK5 A;  2EXI A;  4COZ A;  4DRR A;  4OUE A;  3HD8 B;  4ZY9 A;  4B4Q A;  4D6R A;  4H2A A;  3POB A;  3TNP B;  1UYZ A;  1NOV A;  2A6Z A;  2JB8 A;  3HR9 A;  3P3N A;  3SQO A;  3ZDS A;  4FXK B;  1E57 A;  5JDB A;  4IL7 A;  2UWB A;  4EZH A;  1NYW A;  5FZL A;  1UCX A;  2WT2 A;  5K9Y A;  1CN1 A;  4D6S A;  1DLC A;  4XJA A;  1WBL A;  1ZVF A;  3E5U A;  4MLO A;  4AVC A;  4C91 A;  3WQ1 A;  2ZMN A;  4NPL A;  4Q27 A;  5FRA A;  4LUL A;  1LCL A;  5CIS A;  1JMU B;  1F5J A;  5CFD A;  2YBP A;  2W0X A;  3ZXG A;  3RZM A;  2XWB B;  4SBV A;  3V56 A;  1JYX A;  4JGY C;  1Y9Q A;  3SKV A;  4KQ7 A;  1RUF 1;  1C1L A;  4ZKT B;  2PMW B;  1WCQ A;  4I02 A;  4OCT A;  3ZXF A;  2D43 A;  4XYX A;  2RMU 3;  3K4D A;  4XZU G;  2V09 A;  3AXE A;  5DAP A;  3SCF A;  4BQ1 A;  3K51 A;  5FZ1 A;  3BOW A;  3WG4 A;  1GNZ A;  1QJX 2;  1RUD 2;  2WWS A;  3I2D A;  4R4Z A;  1RIT A;  1X7N A;  4CE8 A;  4HET A;  1NLR A;  1IQA A;  5E6H A;  1ZRD A;  2HEY F;  1OUX A;  4IE4 A;  4R8H A;  1GQG A;  4PF1 A;  3U10 A;  2ETE A;  4JQR A;  3PL0 A;  4YAR A;  3Q8F A;  3KD4 A;  4YGC A;  4XXP A;  1ZZ8 A;  4AE2 A;  3W59 A;  4BB3 A;  4IEX A;  2YPJ A;  4AED A;  5KHK A;  3HMY A;  4QDS A;  1GOH A;  1Q8O A;  1UZV A;  2XQX A;  4Y1Y A;  2UYB A;  4KWK A;  2Q30 A;  2R49 A;  4CEY A;  3H3U A;  3BGA A;  1G9A A;  4Y5T A;  1BMV 2;  1GWL A;  1CD3 G;  3UKT A;  1OXC A;  4QGN A;  4XZP A;  1UMH A;  4BK4 A;  2ZHM A;  5D1I A;  4B4P A;  3TEY A;  3GBW A;  1YRZ A;  4HKO A;  4XFA A;  3CQO A;  3OCP A;  3MIF A;  2D6P A;  5HXV A;  1NA1 B;  1YO8 A;  3HIF A;  4BDV B;  3U07 A;  1NG0 A;  1F4A A;  2WZE A;  3JB8 A;  4R9C A;  5IHR A;  1F15 A;  1PIV 2;  4WZF A;  5FYM A;  1QJU 2;  2E9Q A;  5FZI A;  3RPQ A;  3FZ3 A;  1F8V A;  3MUZ 1;  4JGZ C;  4GQ7 A;  3ZFG B;  3ZYH A;  3SKJ E;  2RG4 A;  4PI0 A;  4QKN A;  3LCP A;  2A70 A;  4LOT A;  1ND3 B;  2IXL A;  2A1X A;  1JYW A;  4WZC A;  5C8C B;  4MX3 A;  5T50 A;  2Y6H A;  1FV2 A;  4HSL A;  3NAP A;  5JXG A;  2TEP A;  2W9X A;  1W0N A;  2R0H A;  5ACA 2;  1BHG A;  4RS5 B;  1IS4 A;  1ODM A;  2QQO A;  2FDK A;  5L19 A;  4PIX A;  5DUW A;  3SMH A;  5DAV A;  3VBR A;  4ARY A;  2E7Q A;  2WS9 3;  3LPG A;  4NRM A;  1YQ5 A;  3KHC A;  1RUG 3;  1G9B A;  4AL9 A;  1JYC A;  4M0H A;  5DQ0 A;  5KC5 A;  1IOA A;  2Q1F A;  1MZ6 A;  1AR8 1;  1O8P A;  2PHW A;  1UYX A;  2PTM A;  2XBO 1;  4YVW B;  5HBA A;  4XUN A;  4YVS B;  3K4Z A;  1LGC A;  4WVM A;  5A6Y A;  1DDL A;  1UY4 A;  4LO4 B;  1H2N A;  4LQR A;  2HBU A;  3ITQ A;  2BBV A;  4C1X A;  4E4S A;  1R1Z A;  1FPN 3;  2GH8 A;  2ZX3 A;  3QLQ A;  5LWB A;  5FYY A;  1CAU A;  1I3H A;  4OQ9 A;  1UOG A;  1A8D A;  1QEX A;  2YFZ A;  4FTB A;  2ET1 A;  3ZMN A;  2GP5 A;  3NL1 A;  1ENR A;  1JHN A;  4BQX A;  1HRV 3;  2BFU S;  5FPU A;  1WW4 A;  3EQE A;  4M4P A;  4WV8 A;  1BK1 A;  1LEC A;  2BNN A;  3G6J B;  2EVX A;  1RUF 2;  1UL9 A;  4U2A A;  4QU2 A;  3SCH A;  2IUW A;  2VCM A;  3CL1 A;  4J1W A;  2Y6L A;  4JTO A;  3TAY A;  3THC A;  3T0B A;  4BWO A;  2ARX A;  5FK7 A;  5FPL A;  3THD A;  4LOS A;  2A75 A;  3M3Q A;  4D69 A;  3RMX A;  2RR1 3;  4QX0 A;  1JW6 A;  2NM1 A;  3WDW A;  2HEW F;  2YZ4 A;  4XBQ A;  1PMJ X;  5FMO S;  2PYT A;  1TME 1;  5D21 A;  4DQA A;  1MVQ A;  4IEW A;  1IPS A;  2BEO A;  4YGB A;  5FZK A;  3ZFF B;  1RB8 G;  2X8K A;  2G9F A;  2JDZ A;  3QD6 A;  3Q8C A;  1K45 A;  2VOW A;  4XTM A;  5JSO A;  1F2N A;  2WNU C;  4FO9 A;  3WNK A;  4W4Z A;  5C8W A;  1UZZ A;  1C5I A;  2QZ3 A;  4A7Y A;  2RVA A;  3DV8 A;  5A7S A;  4G9S B;  4S2G A;  5DN2 A;  2VZV A;  2JG8 B;  3WDY A;  4BME A;  1GAN A;  2R07 1;  4GJY A;  4ZU7 A;  4D94 A;  2PN5 A;  1D4M 1;  1M06 G;  1OD5 A;  5JMO A;  2ZEZ A;  2ZGM A;  2QQW A;  2BUK A;  3VDD A;  5LA2 A;  4ZS2 A;  2CGO A;  1HJF A;  3OBR A;  4XMI A;  5FZO A;  4G3Y C;  4BIF A;  2JX9 A;  2Y26 A;  2R06 1;  3ILF A;  4NWW A;  2FD8 A;  1VB2 A;  3VUO A;  1BXH A;  4BXF A;  1W6P B;  1PK6 B;  2AR6 A;  4LUM A;  3AC0 A;  5FAX A;  3L2H A;  4LLF A;  4RYD A;  5F7U A;  2JXA A;  4JHT A;  2VMC A;  4QPI A;  4OI0 A;  5FZM A;  3VHP A;  1RGS A;  1ULF A;  2ID4 A;  2PXJ A;  3MV1 1;  4FFI A;  3IT8 A;  4URT A;  5FLH A;  1OFS A;  3AX4 A;  4AFC A;  3ETQ A;  3T0A A;  5GZE A;  4BJ0 A;  1TE1 B;  2PAM A;  5GZF A;  1QH7 A;  5CBL A;  4IV3 A;  5GLW A;  4EN9 B;  3WDV A;  4FOY A;  1UPS A;  2XL7 A;  5DPN A;  3ZM8 A;  5C6C A;  3FE5 A;  4MOA A;  3GZU C;  3LZZ A;  2F17 A;  2R16 A;  2D6M A;  4AHW A;  3WQ0 A;  2C26 A;  2Z2S B;  5FKC A;  4CU6 A;  1WA4 A;  2O8Q A;  1PHM A;  2OVU A;  2ZAH A;  4UYB A;  3VGI A;  1UU6 A;  3NVC A;  3A0K A;  4M3C B;  4CU9 A;  2W2I A;  4TN7 A;  4DS0 A;  4XJU A;  1SCR A;  1IPJ A;  4NIH A;  4JGY B;  1AR8 2;  2XBO 2;  3C7E A;  2H0V A;  4K8F A;  4BIS A;  4CDW C;  1LGN A;  3W5N A;  1CVN A;  3ZYF A;  1OQE A;  2RMU 1;  1XJA A;  5FZ3 A;  2VY0 A;  4A41 A;  2WQZ C;  3W58 A;  2BW8 A;  5DZG A;  1XE8 A;  2WA3 A;  5C4W C;  1U5I A;  3WDT A;  1HB4 A;  1VLN A;  4P9J A;  4WBB A;  5K0U C;  3R4S A;  1MR5 A;  3RZH A;  3AYD A;  4WVV A;  4NID A;  4GWI A;  2VZ3 A;  1VBE 3;  3LA2 A;  4J6G A;  3GNE A;  3R4U A;  2E33 A;  3UKV A;  4B8E A;  3SEE A;  3BPS A;  1OOP A;  3MW4 A;  3JU9 A;  3P6B A;  4Y4Y A;  3K75 B;  3OGG A;  4OI4 A;  4NHM A;  1XQN A;  3FWE A;  1WBF A;  1NAE A;  4MZU A;  2WYS A;  2OW4 A;  4MXV A;  2ZGT A;  2EF6 A;  1A78 A;  3Q8E A;  4Q5O A;  4KWJ A;  3DYO A;  2JWP A;  3E6D A;  3PJY A;  4AFM A;  2Y6G A;  3AM2 A;  1TME 2;  2WFP A;  1CAX B;  4DEQ A;  1DHK B;  3GGL A;  3OEB A;  5A7W A;  3RJR A;  5C33 A;  2Z5W A;  3N7K A;  5CKQ A;  2E31 A;  4CXX A;  2HJI A;  3TYJ A;  2PHX A;  2GNT A;  1TMF 3;  4NWV A;  2GMM A;  5FBZ A;  2B5H A;  4BOW A;  4IEO A;  4KL1 A;  3VBO B;  3IM0 A;  2K46 A;  4F3J A;  2VMH A;  2LUW A;  4JGZ A;  4Q8L A;  3WDX A;  4MUV A;  2R07 2;  1N1T A;  2VE1 A;  5C9A C;  4ZZ5 A;  1D4M 2;  5FKB A;  1ZRE A;  2VJX A;  3PUH A;  4UW3 A;  5F5A A;  4NRQ A;  2VAU A;  4LKE A;  2WWJ A;  2XWJ B;  3CZU A;  5IAT A;  1HRI 3;  1JU4 A;  4QDQ A;  2R06 2;  4Y22 B;  2ZX1 A;  3B7M A;  2P3Y A;  4LK7 A;  1OLQ A;  3D8C A;  4XF0 A;  5IUQ A;  1JH5 A;  4R9A A;  1C4R A;  1D0H A;  5A7P A;  1QXR A;  4P02 B;  3M3I A;  4AVV A;  3KHB A;  2WS9 1;  1UOJ A;  3VZK A;  3FFZ A;  1WCS A;  1RUG 1;  4OLL A;  1I6X A;  1WD4 A;  2AAC A;  3DKW A;  3VBS B;  2YBS A;  1IS3 A;  3I3D A;  5J48 A;  1EYB A;  4HXC A;  2ZX2 A;  3CJI C;  3O1O A;  2E51 A;  2J1U A;  3BCW A;  2MNG A;  4V1P A;  4BQ2 A;  2YFU A;  3CNA A;  2OXB A;  4BQY A;  4YG3 A;  3BVC A;  2DCJ A;  1VBC 3;  4XF1 A;  2WSV A;  4CCN A;  1FPN 1;  3C7F A;  4I01 A;  3WP3 A;  2W5F A;  4Y33 A;  1JOP A;  4MO3 M;  4Q0V A;  5EYY A;  3RI9 A;  3RRD A;  1MS1 A;  1HX6 A;  2ZGS A;  4QQO A;  1OH4 A;  1OHF A;  3MLK A;  1HRV 1;  3G7D A;  1VMF A;  5FZ0 A;  5LB6 A;  4AEK A;  4C1W A;  4D3W A;  1DGR A;  2WT0 A;  5FZC A;  1R09 3;  4QWN A;  5A33 B;  3OY8 A;  3VBU A;  4IEQ A;  3WW4 A;  1QJE A;  4XFI A;  1QJX 3;  1ASJ 3;  4LKF A;  5FTT C;  3U4S A;  3W5M A;  1CJD A;  2RMU 2;  2WAO A;  4FSJ A;  4XIL A;  1POV 3; 
#chains in the Genus database with same CATH homology
 4UF0 A;  5FV3 A;  5FZ3 A;  5K4L A;  5FYI A;  5FZ8 A;  4D6R A;  5A3T A;  2XML A;  4QX7 A;  5FZH A;  3LDB A;  4NUB A;  5FZB A;  5FJH A;  3PDQ A;  4CCJ A;  5FPA A;  4BU2 A;  5IWF A;  5A7O A;  5FUP A;  5F3G A;  4LXL A;  5F5I A;  5FZ7 A;  5A3W A;  3PTR B;  2YU1 A;  5F2S A;  5F3E A;  5FZL A;  5FXX A;  5FYY A;  4E4H A;  4EZH A;  5FZ4 A;  3PUS A;  4Y4R A;  4V2W A;  5A7N A;  3PUR A;  4D6S A;  5FP4 A;  5F37 A;  4IGO A;  4QXC A;  4CCM A;  5FY0 A;  3AL6 A;  2GP5 A;  5FZG A;  4CCL A;  5FZE A;  3ZLI A;  4GJZ A;  4XDO A;  4CSW A;  5IVV A;  5FPU A;  2XUE A;  5A1L A;  2YBP A;  4UF0 B;  5FYB A;  5FYU A;  4LIU A;  5IW0 A;  3RVH A;  3PUA A;  5CEH A;  5IVF A;  3NJY A;  5FWJ A;  2XXZ A;  5FZ9 A;  4D6Q A;  3PU3 A;  5LY1 A;  3DXT A;  5FXW A;  5FPL A;  5A80 A;  5KR7 A;  5FXV A;  4QXH A;  2OQ6 A;  5FZD A;  5FJK A;  3PUQ A;  5FZ1 A;  5FP7 A;  3LD8 A;  5FP8 A;  5FYH A;  2Q8E A;  5F39 A;  4DO0 A;  3OPT A;  4IGQ A;  5A7W A;  4AI9 A;  4QU1 A;  3N9P A;  2XDV A;  5E6H A;  2YBK A;  5FZK A;  4EYU A;  3N9Q A;  4CCK A;  3K2O A;  3KVA A;  5FY8 A;  3PU8 A;  5LW9 A;  2P5B A;  5FUN A;  5FY9 A;  4GAZ A;  5FY5 A;  5A7S A;  5IVY A;  5F3C A;  3KV9 A;  4C8D A;  5FZA A;  4CCO A;  5FYT A;  5F5A A;  4GJY A;  2Q8D A;  5IVB A;  3N9M A;  2YPD A;  2WWJ A;  3N9N A;  4ASK A;  3DXU A;  5FZ6 A;  2YU2 A;  3KVB A;  5FZO A;  5FP3 A;  5FP9 A;  5FYZ A;  2OX0 A;  5A7P A;  3KV4 A;  3AVR A;  3K3O A;  5ISL A;  4QXB A;  5A3P A;  4BXF A;  4DIQ A;  5F3I A;  5FY7 A;  4URA A;  2WWU A;  2YBS A;  3UYJ A;  5A1F A;  3KV5 A;  5FZM A;  5FYM A;  5FZI A;  4HON A;  5FZF A;  2GP3 A;  3N9O A;  3ZPO A;  1VRB A;  2PXJ A;  5FWE A;  5IVJ A;  4LIT A;  4Y3O A;  4HOO A;  3N9L A;  5A3N A;  5F5C A;  3K3N A;  4CCN A;  5FBJ A;  5IVE A;  2Q8C A;  2OT7 A;  4EZ4 A;  2OQ7 A;  4Y33 A;  5FXZ A;  5FZO B;  4XDP A;  5FYV A;  4LIV A;  4CUG A;  5FYS A;  3AVS A;  5A7W B;  3KV6 A;  2OS2 A;  3AL5 A;  5FPB A;  4GD4 A;  5LWB A;  5FZ0 A;  4QX8 A;  3OPW A;  5F32 A;  2W2I A;  5FZC A;  4TN7 A;  4QWN A;  5FYC A;  5FY4 A;  3U78 A;  5IVC A;  5FPV A;  5F2W A;  5LY2 A;  4V2V A;  5FY1 A;  3U4S A;  4AAP A;  4BIS A;  2VD7 A;  5A7Q A;  4IGP A;  5ANQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...