5IVYA

Linked kdm5a jmj domain bound to the inhibitor n16 [3-(2-(4-chlorophenyl)acetamido)isonicotinic acid]
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
317
structure length
300
Chain Sequence
EFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEVKSFRFTPRVQRLNELEAMTQAVREYTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGSGFPVKDGRRKILPEEEEYALSGWNLNNMPVLEQSVLAHINKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIMNPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 5A
publication title Structural Basis for KDM5A Histone Lysine Demethylase Inhibition by Diverse Compounds.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 91
structure length 300
sequence length 317
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5ivyA00
5FPLA 3AVSA 3PU3A 4AAPA 4QWNA 3PDQA 4XDPA 5FZDA 3LD8A 2YU1A 5A3NA 2GP5A 2XUEA 2VD7A 2XDVA 4IGOA 4BISA 5FYHA 5FYTA 3N9QA 4AI9A 3PUSA 2W2IA 3N9LA 5FPAA 3NJYA 5F3IA 5A7PA 2Q8DA 4E4HA 3PUQA 3AL5A 5A1LA 5FZOB 5FY0A 4Y4RA 4EYUA 5A7OA 5A7SA 5F3GA 5FZCA 5A7QA 5A7WA 4CCMA 4CCNA 5FXWA 5IVCA 5FP8A 5F5AA 4DO0A 2OQ6A 5K4LA 2XMLA 4EZHA 5FWEA 5IVFA 4BXFA 3AVRA 3OPTA 5FY5A 4GD4A 4TN7A 5A7WB 3KV9A 2Q8CA 2Q8EA 3U4SA 5IVVA 3K2OA 5FP4A 5FZ6A 5FZ4A 2OX0A 5F3CA 5FV3A 5FXXA 4BU2A 5FPUA 5IVJA 2YBSA 5FY1A 4ASKA 4CUGA 5FJKA 3PURA 4HONA 5CEHA 5FZOA 5FYBA 4URAA 4LXLA 5FYMA 2GP3A 4LIVA 4V2VA 3KV6A 4CCOA 4D6RA 5FP3A 5FZKA 5F2WA 5F37A 4DIQA 5FZMA 5FZHA 4C8DA 5F5CA 5FYUA 5ANQA 3N9MA 5FZBA 5A3PA 3K3NA 3PUAA 5FUPA 5F5IA 5E6HA 5FZ7A 4CCJA 4UF0B 5ISLA 5FZEA 3KVAA 5A1FA 5IW0A 4NUBA 4CSWA 2WWUA 1VRBA 3LDBA 4V2WA 5FYVA 5F3EA 3N9NA 3U78A 5KR7A 5FJHA 3DXTA 4D6SA 3AL6A 4IGPA 5LY1A 5LWBA 5FZ3A 5FZ1A 5FZ9A 4QU1A 2OS2A 2YBPA 4EZ4A 3N9OA 5FUNA 5IVYA 4GAZA 2YPDA 4QX8A 5FZ0A 4LITA 5FZGA 5IVBA 5F2SA 5FYSA 5FZ8A 4XDOA 4UF0A 5FXVA 5IVEA 3K3OA 3KV4A 4GJYA 2P5BA 5FZIA 5A80A 4D6QA 5IWFA 4QXHA 4Y3OA 3PU8A 5FYYA 5LW9A 2YU2A 5FYIA 3DXUA 5FPBA 5LY2A 5FZLA 5FYCA 3UYJA 3RVHA 5FZFA 5FY7A 4CCKA 3ZLIA 5FWJA 2OT7A 5FYZA 2PXJA 5FY8A 4IGQA 5A3WA 2XXZA 4HOOA 3ZPOA 4CCLA 5FZAA 2WWJA 5FPVA 5FY4A 5FY9A 3KV5A 4GJZA 2OQ7A 3OPWA 5F32A 5F39A 5FP7A 4QX7A 4QXBA 2YBKA 5FP9A 5A7NA 4Y33A 5A3TA 3KVBA 3PTRB 4LIUA 3N9PA 5FBJA 5FXZA 4QXCA
chains in the Genus database with same CATH superfamily
4MH0E 5T5LA 2WQZC 1YQ8A 3A0NA 1SFYA 1DF0A 3T09A 1JMUB 2V5YA 1O3QA 4FFFA 1BXHA 4XF4A 1U5XA 2JIGA 4DUWA 3O0VA 2MEV1 3FX3A 2ZKNA 3FLPA 2WL1A 4IGOA 5M0TA 3SITA 4B29A 5LA0A 2V5DA 5FRAA 2ZACA 4NIAA 5GJ6A 2DURA 3EBRA 3ZYGA 1FNYA 4CDXC 5A1LA 3VKOA 5AC92 2A6XA 5C5TA 5BNPC 1OKQA 4UYBA 5FY0A 2R063 2D5HA 1XNDA 4PBPA 3VBHB 3VGIA 3JQWA 1J1LA 1R1ZA 4FOYA 1CN1A 2Q1FA 3AXEA 5FKCA 3CLPA 1ZBE3 3VL8A 4QQHA 2WBKA 2UWBA 4CDUC 2MEV2 4IUGA 3R4DB 3KSCA 1AF9A 1QEXA 1W2NA 3ABZA 5FPUA 1JOPA 1DZQA 1H9WA 4KWUA 3ZKYA 5FY1A 4ASKA 5C8CC 3VD3A 4AVBA 1YI9A 3WDUA 2D97A 1QJX1 1SLBA 1S0EA 2WWSA 2DFBA 3ZXGA 3CHXA 3AZXA 1EPWA 4R9BA 3SNMA 4V2VA 4DINB 1CPNA 4I09A 4PQQA 4MG2A 1OKOA 2WLQA 4OZXA 5GLVA 1NQDA 4AHZA 4QGLA 3THTA 1KS4A 2NMNA 2V4AA 1LODA 2WIIB 2Y33A 2WJSA 4YVWA 1FAYA 3PUAA 4PIZA 2A5ZA 4ZY9A 5L7OB 3DN7A 3B01A 5LRRA 1X50A 1PK6C 5LA2A 4FPYA 2HWF3 1HDKA 4MYEA 3POYA 4QQ2A 4CEYB 1YRZA 1RUE3 1SLCA 1QJX2 1VRBA 3CZJA 3KCXA 4FOVA 4R8HA 5FREA 3TN91 4CYDA 1O4YA 4R4XA 2PYTA 3PMEA 2TUNA 1DIWA 2VMIA 4LBQD 1PMHX 5FR3A 5CG8A 5FZ1A 5JZGC 1LHWA 1W2TA 1S0GA 2FCUA 2HWB1 3ALQA 1JH5A 4LO4B 5EFUA 1IQAA 1TMF3 1W90A 2CWSA 2VOXA 4YW6A 3SH3A 1RMU1 2P3JA 3EJKA 3ITQA 2H0VA 1B35A 5FMCA 4K1ZA 3AKSA 5FYSA 1OFNA 1GZWA 1Q8SA 1ZNPA 4IE6A 3ZX7A 4CZSA 4S2DA 1UYXA 2WRAA 4XF1A 1DQ6A 3WHUA 1F35A 1I1EA 4BLIA 3RZHA 3ILRA 3I2JA 5FYCA 3LA2A 2OZ6A 1Q8VA 4FP2A 4GH4C 3GCWA 4RA0A 1GOHA 1BYHA 1WKYA 2HWB2 2XXZA 4AEMA 1SMVA 1RMU2 2XH6A 4XQWA 4Y24A 5D2AA 1WA6X 1JZ3A 1S0FA 2DTWA 1VLNA 1Q8QA 5DXDA 3HOBA 1LESA 1O5UA 5I0SA 4NAOA 1GQPA 2FMDA 5FXZA 3ZFGC 4CU6A 2PLV3 1I5ZA 2CV6A 4LOTA 4CDQC 3U07A 2RE9A 4QX1A 5I8YA 4AAPA 4YZ3A 2GN3A 3I3MA 2WNUC 4MGZE 4B1LA 2VTXJ 2XUEA 4XVHA 3T2TA 4XETA 1GMMA 4NHYA 2FDKA 4EWAA 1SFNA 1DGLA 5T5OA 2PHUA 1MS9A 2OPKA 5BNNC 1HLCA 2P2KA 4HG6B 4H7MA 5IVFA 1ZRDA 2P1BA 4QB2A 1RJ7A 3VD9A 3FLTA 3GALA 3A0KA 4A3ZA 1E5SA 1O91A 3MUY1 1IS3A 2YPJA 1LHNA 1SDWA 2OYZA 1XBFA 1C3HA 3ZXDA 5JR2A 4XUTA 5CVRA 4FPFA 3H1WA 2B5HA 5ACA1 2ZX2A 1YIFA 3MHZA 2A6WA 4WZFA 4XZUG 4D8MA 3H3ZA 2TEPA 1YO8A 4JKMA 4XC9A 2G9GA 1JZ2A 1JZ8A 3DKQA 1NCRA 3NAPB 4BU2A 3GM8A 4ARXA 5K0UB 1W6NA 4B4PA 2O8OA 4MUVA 1N3QA 1CX4A 3MICA 4URAA 4WZCA 1CIWA 3H1MA 2EAKA 3HBKA 4IE5A 5FLJA 4DB5A 2E6VA 5JI9A 2D6PA 3WVJA 3IBMA 1VB2A 3W21A 5IFTA 4AEDB 1MQTB 1O3SA 5C70A 3WQBA 4C8DA 4IV3A 1XNAA 3POWA 2UURA 4HSJA 4KGGA 3WF4A 3KF5A 4PCRA 4MOAA 4YG0A 1W0PA 4KH9A 2F17A 2EIDA 4FBFA 5ISLA 3AZWA 4HMZA 4FT8A 1PO21 2JKBA 4EQVA 4CSWA 3OGGA 4AQ2A 4YZ5A 4WVMA 1J84A 4UOJA 3SHRA 1NY71 2VBPA 2VQ0A 1T6GC 1MZ5A 1OQEA 2X5IC 3OY8B 4QPYA 3U78A 4ET7A 3TEZA 1OF3A 4FPOB 3PLQA 4OUMA 3LCPA 3PIGA 5FZ3A 3J9SA 2Y0OA 4XOGA 5FDBA 3GZTB 3Q9OA 4W65A 4LK7A 3WW4A 5FZ8A 3NNJA 5JUVA 1LOFA 3E6DA 5EJZB 4COVA 3JCIA 2A75A 3OTFA 2JB4A 1PO22 4JDMA 3O5SA 2W39A 2X09A 1NY72 1W8TA 4LHSA 3VHNA 2ZAAA 3M7AA 3RMYA 5FZFA 4DFSA 2I07B 1K5JA 1FPN1 1ND3B 3ZN6A 3C3VA 1PZ9A 3PUHA 2DVFA 1SCSA 2XL9A 3Q8AA 1BHGA 4GJZA 1DDLA 1ULCA 3LGRA 4LBLA 5EJ1B 4MHUA 3M2MA 4LR4A 1D4M1 4N43B 1W9WA 2E7TA 3PIJA 4C0BA 4AI8A 5I8TA 2BUKA 4UFKA 4EV0A 2A6YA 2QTWB 4XCBA 3R0RA 3B7MA 5DUUA 1XSQA 4R4ZA 2RS51 1AL23 5C8CA 5L36A 4Y5Z0 3RZZA 2GC2A 4XZPA 1BLZA 1FX5A 2ZGMA 4I0WB 4XAEA 3VD5A 2IVIB 5FPXA 2Q8DA 5A33B 1D4M2 2VGDA 3KLSA 2DCYA 1SDDB 3HJRA 2VUJA 3RZMA 4NWVA 1HJGA 2VZPA 4YGCA 3H1YA 4GWNA 1POV0 1N1SA 3I59A 4XMAA 3ST7A 2HKXA 2A3WA 1ONAA 3WF0A 5A7WB 2OA2A 2AC1A 2R042 1PK6A 4NHXA 4XUNA 4YW1A 2RS52 4CP1A 3IIAA 4K8FA 5E89A 3U4SA 4RL7A 1G9AA 2LTNA 5FZ6A 4JQRA 4Y1ZA 1JZ5A 5FV3A 2KXLA 2D5FA 2WO3A 3F2ZA 3H7YA 4XBLA 4LBOA 4MGSA 4X8NA 1KS5A 1G86A 1ND2B 4B7EA 4GKYA 1QDCA 4CCCA 3QLQA 2XBO1 2GP3A 5CKQA 1YXWA 1Q3EA 5JZGA 1C5HA 2IC1A 4AGGA 4C0HA 1IPJA 3FE5A 3S0MA 4IV1C 3H8XA 5KXCA 3APBA 3R05A 5FZHA 1WBLA 3M3IA 4A45A 4E27A 4UT5A 4HANA 5A3PA 1JYWA 3GDBA 1YFYA 4LTAA 1WLDA 2JENA 5JSOA 4M3CA 1HB3A 2F4PA 1WCSA 5K9YA 2VW1A 3VBFB 2R062 2ZGTA 2JX9A 2Y6HA 4G4FA 3A23A 2D3RA 1N3OA 5E88A 4D7SA 4BIOA 3KZ4C 4RR3A 1OOPB 2VVDA 5A3UA 2XBO2 4GH4A 3NV2A 1R081 1OHFA 2BYVE 1ENXA 2JDKA 3ZSJA 2JG8C 5FMOS 2QCSB 1W6QA 4MO3M 4XFHA 5KHHA 2QQPA 3HAGA 2CY6A 4XACA 3DYOA 2PHWA 4CXWA 3KHCA 4LBNA 4W6WA 2FZ1A 1NYWA 4Q4W1 3T0DA 1HB1A 5DDJ3 5DPNA 1VR3A 3I2OA 2E31A 3WDYA 1VBB1 3NNFA 1FT9A 2CWMA 3KS7A 3ZFGA 5CFCC 2JIJA 2QQJA 4CDQA 1CAXB 4P9WA 1GNHA 1K42A 3IAQA 4LPLA 2KM2A 1Q43A 3UYJA 4IEVA 1R082 3AKQA 2WNUA 1XXNA 1J58A 2B45X 4GULA 1WUVA 4RGAA 5BY5A 5GALA 4HOOA 2DVDA 5BNNA 3ES4A 3WEZA 5FZAA 2KD7A 5FY9A 5JIUA 3JQXA 1D2QA 4QX7A 3VL9A 1VBB2 2VNVA 1OQDA 2WZ8A 1U5IA 1ZA4A 1CONA 2XG3A 4E2QA 1JYIA 1RITA 5EXOA 4JZRA 1X8EA 2RG4A 4PHZA 5IK5A 3VDDB 4XABA 1LGCA 5FPLA 3BTYA 4BA6A 3VZKA 1WW7A 4A2UA 2HYXA 5AC93 3U4XA 1H1AA 4IEOA 5DAQA 5DN2A 2VD7A 2FDFA 2R1BA 4LKSA 4PI2A 4ZXEA 3VBSB 1KD7A 4Y1VA 4XUQA 5HXVA 2XJTA 3S5QA 1UX7A 5ABJB 1DQ0A 4A44A 3FN9A 2BJSA 5FPAA 4HBNA 1A78A 4K1YA 3RMXA 1AYN1 5I0TA 4IW3A 2R1DA 4X6QB 1APNA 1UZYA 1WCKA 3UGGA 2MEV3 2CU5A 5D8AB 5F3GA 4ZKTB 5HV0A 5A6YA 4YVSA 4A3XA 3QCWA 5K4LA 4WM7B 5CU1A 2TNFA 4BQWA 2A1XA 1W8NA 3HD8B 4YZ2A 1QWRA 1W9FA 3MEPA 2Y6FA 3Q8EA 3AYAA 4MGIE 5A6QA 5B2GB 2ZMLA 3J7NA 4CE8A 3K2OA 5FP4A 5F3CA 5KXEA 4K21A 4AQSA 2QZ3A 5CEHA 2X5IA 1YFXA 4CDWC 2O14A 1AYN2 2EXIA 4QPIB 5GKAC 4EJRA 1C5IA 1H2MA 3A21A 1YC61 4HXCA 4EN8B 2PTMA 3CDZB 2EIBA 2GC0A 5APAA 4WVVA 2DFCA 2W91A 3IDAA 4XEZA 5LBBA 5GLZA 4UBHA 1IS4A 1O59A 1XE8A 2VTXA 1F2NA 1WLTA 3WLUA 4XIOA 2DUOA 2PAMA 3N9MA 1QJX3 4PIXA 2YMZA 3WG1A 5C33A 4LQRA 5I0RA 3ZOIA 3DL3A 1W39A 5FZ7A 2E53A 1ULOA 2DUQA 2V09A 3USUB 1VRH1 4R52A 3VZMA 5KXBA 3BGAA 1TE1B 1MS0A 3VD4A 1C8NA 2O1QA 1OURA 1F4AA 5KR7A 2E51A 4GMP1 2UY9A 2VBBA 2FHRA 1MS4A 1UOGA 1NCQC 2OXBA 3KQRA 4EWEA 2VZQA 4PDWA 1JHNA 4RQPA 4BPZA 1ZRCA 3UV9A 3A22A 4KG8A 5BNOB 3N9OA 5J7MA 2WZEA 5FUNA 4NHLA 3H7JA 3TN93 2VBDA 4H2AA 1V9U1 5FZ0A 1SLTA 5FZGA 4Q4X1 4BZ4A 5LK7B 3NV3A 1RXGA 4JVAA 4N9HA 3SCGA 3O1VA 5FXVA 3FHIB 3VKFC 4P9JA 1W9YA 4AVVA 5HV4A 4PI0A 2BW8A 1VRH2 1EY2A 4FXKB 4GJYA 4KBZA 4Q0VA 2HWB3 4BQ2A 2AEZA 4HT1T 2DCKA 2RMU1 1US3A 4QQPA 3T0BA 2V4VA 4Y3OA 1RTVA 3ZSEA 1UU5A 2YFUA 1RMU3 3C7EA 2FDHA 3RRDA 5FZLA 2IVJA 1E57A 1GR3A 3B5LB 1MS5A 1UU4A 4XIKA 1SFPA 2JDUA 3H0OA 5GZCA 4BE3A 4FSJA 4BQ3A 4CP9B 2VCCA 3I4IA 3UETA 2RVAA 1KQRA 1S0IA 2OQ7A 3DKWA 3NKTA 1LOGA 3AP9A 4BQ4A 1RUC1 3LQCA 3RGBA 2RMU2 4NRMA 1EAH1 2FMYA 1LULA 4O9GA 1XNBA 2R7EB 4R9DA 1MZEA 3HIFA 3ZFFB 3AVSA 2ORZA 2PA7A 4Y20A 3IMMA 2WLPA 2DWRA 1CD3G 1UXZA 4Q0UA 3ZR5A 2L9LA 3T30A 3AMNA 4ZS2A 3DPRC 1UCXA 4FPGA 4I3PA 3LKJA 4BISA 2QQUA 4XXPA 3SH5A 1PMJX 1IKQA 4NIDA 3SLIA 4HVQA 4L0PA 1JOJA 1YQ2A 4IXLA 5HCAA 1UAIA 3N3HA 2BEOA 5JI7A 2OZJA 5A7PA 1LR5A 2YROA 1RUC2 4YFWA 2ZX3A 5J37A 1JHJA 3N7KA 1EAH2 1OPMA 4EYUA 2VH9A 1W6MB 1KITA 2Y6GA 3EHKA 1A8DA 4JDNA 4CCMA 2HWC3 4GIQA 4YZ1A 3M3OA 4QGNA 5T50A 2GH8A 1W9TA 2XMLA 5LA1A 3JUUA 2A70A 3UJOA 1T2XA 1D7PM 2VZOA 4NRQA 5JOYA 2W1SA 1UYZA 3V64A 1IG3A 1QJEA 4EN9B 4ZZ8A 2A3YA 2VECA 2VZSA 2XVKA 2CTVA 2W9XA 3ZSKA 2R071 1GOFA 5ACA3 4EN6B 2PFWA 3D4KA 3VBOB 4Z2AA 2ZGPA 2QBXA 3FC0A 2JG8A 2A3XA 3KV6A 3RJ2X 1HRV1 1RUJ1 1CAWB 1DGRN 4UAPA 1JYNA 3AMQA 3TB0A 3ZKUA 3TBDA 1SHWB 2DCTA 2UYBA 3J7MA 1QQP3 3OD0A 4ORFA 4Q26A 3ZPYA 5CFCA 2W94A 5CISA 4LBQA 1BVVA 2ZX4A 3EB7A 1CX1A 3HMYA 1MACA 2R072 5GZGA 1E5HA 4NMIA 5BV6A 3RDIA 1GYKA 1PM7A 1POQA 1K12A 2NP0A 3PHMA 1L7LA 2A73B 4NR1A 1FI2A 3T08A 3AMMA 5HCHA 3BOPA 5FQ0A 1HRV2 1RUJ2 5EYYA 4L8QA 4QD2A 3E6BA 3DGTA 3WP5A 1I6XA 2A7AA 5FZ9A 1AR91 2GMMA 4F3JA 1PO23 4F7ZA 2YBPA 3CJIB 2NM1A 5IATA 1GNYA 1XB9A 1X8MA 3TNPB 5F5QA 5T5PA 2JD4A 4I3GA 1H6XA 4AFCA 1D0HA 2J1RA 4Q4Y1 4CP0A 1Z78A 4TXWA 1MS1A 4KMQA 4QXHA 3ZVXA 4Z92B 5CKMA 3K51A 2VOWA 4Q0PA 3EO6A 1STMA 4B3NA 5KC6A 3BTXA 4UFIA 2ETEA 3PVEA 2JE7A 4IEQA 4WVZA 3PVOA 1REEA 2PXJA 2AEYA 4YLZA 4INDA 4N9IA 3EYPA 1AR71 4TZDA 1J3QA 5FY4A 2RJKA 4DXTA 2P3YA 1O3RA 1XU2A 3TOJA 1ZZCA 4Q4Y2 1FPN3 1F5FA 1WCQA 1SLAA 2PHFA 4XFBA 4M0NA 3GJBA 2J1AA 1O8PA 5FKBA 1QY4A 1UF2C 3I2GA 3UJQA 4XFFA 2PQQA 4XDPA 1PZ7A 1D4M3 3IT8A 3LD8A 3S7IA 1PVXA 4Z8BA 4QX5A 4FTEA 5DDJ2 1OQ1A 4E8CA 1CJDA 3HNBM 1WZXA 1NX9A 2IZWA 2FBEA 3J26N 1VBC1 4HN1A 1GUIA 1VMHA 4AHWA 2VNOA 3U0ZA 3M3EA 2E7AA 4E4HA 3AL5A 4RSUA 3T0AA 4A7ZA 3IIIA 4CU7A 2Y38A 2BGOA 3NV1A 3O14A 2RS53 4JAAA 3KCYA 4JGZC 4QGMA 2C6SA 4YGDA 1Z0HA 3B00A 3ZYBA 1OA3A 5C3OA 2Y8KA 2NLRA 5AFBA 1GQHA 3AMPA 3PNAA 4GD4A 5GLWA 3CBNA 4JHTA 4YVWB 2ZHMA 1DZRA 1XYNA 1FV2A 5EWSA 4CPBD 2B46X 2OX0A 2DU1A 5C4WC 3HNYM 2VG9A 4CUGA 1O7FA 2YDEA 3ACHA 4MADA 3POIA 1YIPA 5I8SA 3W9AA 4XMIA 2ZGKA 4G3YC 5GM0A 3UKVA 4QAWA 1NCQA 4QPGA 4YM0A 4Q1RA 2HWD1 1PO11 3AB0A 4NJ4A 3SCHA 5L9VA 5FO8B 3RZGA 1CIYA 4NIGA 1XYPA 2ZGUA 4XF3A 1JU4A 3WP4A 2BGPA 3WCSA 2FZ2A 3NAPC 1JYCA 1DLLA 1UU6A 2AUYA 2XBO3 1W8HA 1JBCA 5FMBA 3EQEA 2E32A 3OOXA 1J3RA 3S5AA 1NA1C 3WXPA 4GWJA 3WUCA 1MPXA 4IQPA 2CAVA 1EV11 1RUG1 2V73A 1Y4WA 3POGA 4LE3A 4O7XA 4CEWB 1OLMA 1LTEA 4LBJA 2HWD2 2RDRA 1G6NA 1PO12 1GWKA 1BK0A 5DAPA 1MVQA 1F15A 2WO7A 3EXUA 3H3LA 1GBGA 3WOGA 5CA6A 4IEXA 2DBNA 2W52A 2WKKA 3T2QA 2ZBJA 2EVXA 1R1A1 4C90A 3OGRA 4QX3A 5SV5A 3HVDA 3IAPA 1DCSA 3ACFA 1R083 4LT5A 3NO8A 1DGRA 4YM1A 1MZ6A 2P5BA 2VU9A 1KGYA 4JDOA 4D69A 5F9TA 5EPAA 3TEWA 1EV12 1RUG2 2E7QA 2GNBA 5IWFA 1HX6A 3MIBA 2H0BA 5DAVA 5FYYA 1OI6A 3URFA 1IGOA 3WNXA 3FUQA 3WP3A 3ZFEC 4QKDA 3ZYFA 1HV0A 1OPOA 5LY2A 1UW8A 4Q4W3 3T1MA 5KHIA 1MZFA 2IFRA 4KWKA 4DY3A 3DPRA 3K4AA 1VBB3 4C91A 4I01A 1N1VA 5IK7A 4AXOA 5A3WA 1S0JA 2XVGA 1R1A2 2CGPA 1FMD1 5C7GA 4WM8B 2FCTA 5E16A 4QXBA 3CEWA 3VKLA 4Y33A 1OA4A 2R30A 3W5MA 3PTRB 5FBJA 3N9PA 2R0HA 2EIEA 3WDTA 3AFGA 1F9KA 4V1PA 4B1MA 3U10A 4OZOA 4E2GA 2W47A 3LFMA 3KMHA 4JX0A 1QJU1 3TN92 1LRHA 4XQDA 3JBG1 2WQ4A 2C9AA 2XQRA 2XR4A 2NPIA 2Y6KA 3S30A 1GP5A 1FMD2 3MF6A 1NCRB 2N7GA 3MV01 4DNYA 4BQ5A 3NJZA 4IE0A 1W6NB 3N9LA 2SLIA 3L2YA 3NJYA 5F3IA 4QPWA 1LEMA 5CG9A 2ZOEB 2WNOA 2XUMA 4L99A 3UKTA 3AZVA 4DXRA 1C1FA 5EHDA 2PMWB 4DO0A 3VBUC 5JCTA 3VZNA 4N7UA 3HPNA 4Q27A 1PGW1 3AVRA 1UZ0A 1QJU2 3OPTA 5GLTA 1AYN3 2WAAA 1UOJA 4M00A 3KV9A 2Q8CA 2VZRA 5JMCA 4Y1XA 5JOXA 2GC1A 3MIGA 1S2KA 2Y6JA 1ULGA 1S0BA 3K4ZA 3INAA 4HKWA 1J59A 2HWC1 1JUHA 2VNGA 1PX4A 2O0OA 4WVMB 3ZXLA 4LIVA 4FPHA 4AHYA 1H1MA 3MYXA 5HCBA 5FZKA 2WS91 3U11A 5G04L 2BNMA 2WA4A 1PGW2 2ARAA 3ETPA 5HXMA 1WLWA 5L9RA 4XBNA 2VQAA 5IT6A 3BU0A 2CYFA 1UY4A 4HK9A 3ZYPA 4BK4A 3TAYA 2BVBA 3SEPA 4IEPA 2Y26A 4JC1A 1CZTA 4OLLA 3GHNA 2BWCA 3DYPA 4BH9A 3MIDA 1O6UA 1V0AA 1RUD1 1W0NA 5GLUA 4AZZA 2H6BA 2WWUA 4AWDA 2HWC2 3N35A 2VZTA 5CZKA 3ZYRA 3IPVA 1RINA 5T5JA 5JOZA 5G05L 1W06A 2WS92 5LY1A 1W2AX 1QQP1 1VRH3 4M0HA 3HQRA 2BERA 5JDBA 4LA2A 3MLJA 3E5XA 4AI3A 2WO2A 4LE4A 4KU7A 3RYPA 3VBFC 3CMGA 2DV9A 4GMP3 4N53C 5ACA2 1DFQA 2VZVA 2QJVA 1OOPC 2JXAA 1RUD2 3H50A 4NOTA 3O1RA 2Q4SA 1EP0A 5LW9A 1V9U3 1ZBA1 1TNFA 5FYIA 4Q4X3 2GALA 2JEMA 3MLLA 4PQ9A 5JXIA 5FY7A 1KEXA 3I2DA 3H8RA 1VBD1 4JHZA 5FWJA 3OJBA 1QQP2 3GJAA 2AREA 4PF1A 4QHBA 5FY8A 3VBRC 2RMU3 1AX1A 3WW3A 4QDQA 3V0BA 1XE7A 3A7QA 3X29B 2D7FA 5C8CB 1QXRA 1HB4A 2C24A 4AEJA 1H0BA 2AENA 4FCAA 1VAKA 1K5MB 2W1UA 4JGZA 4AVSA 3N7MA 1ENQA 3WY6A 4CU9A 4M3CF 3I2IA 1U12A 3NMBA 5CBLA 1ZBA2 1JYXA 2WT0A 2Q1ZB 5DQ0A 2NN8A 1VBA1 3PU3A 5L9BA 1OA2A 2JDPA 1QU0A 1S1AA 3MFAA 2CL2A 2EALA 4OVEA 1VBD2 2IUWA 3I59B 2RJLA 4FI9A 1Q56A 1RUC3 4YW7A 4AW7A 2YU1A 4HSLA 4DUVA 4NE9A 4Y1UA 1EAH3 2VXJA 2ZEWA 1ZRRA 1SLLA 1PK6B 3KHBA 5C4WA 4HN0A 4XF9A 4LA3A 1HQWA 3PUSA 4XCAA 2Y64A 3GHMA 2FD8A 4GWIA 3WNLA 1QDOA 4DUXA 1RB8G 1POV1 1QF3A 2CDOA 3KGZA 3PUQA 4P08A 4QXKA 3VDDC 4NPMA 4CDXA 4FPCA 5FBZA 1LECA 2ZJCA 3FWEA 4JGYC 4PLMA 1PIV1 5BNPA 4QMAA 3UKNA 1Y9GA 2VZUA 5FP8A 1V6LA 1VBA2 4H55A 4MGYE 5JZGB 4KBBA 5K8SA 1URXA 2OQ6A 3GBWA 3NAPA 2QQIA 4X6RB 2WN2A 2B7YA 3VBSC 1NA1A 1QJFA 3M4FA 4XXAA 2Q8EA 3OUJA 2VCBA 1DQ1A 2Z5WA 4CDUA 5HPOA 1FPN2 1OSGA 4IE4A 1UMHA 1XSRA 5D8AC 1W2UA 3AYEA 3UGFA 1W04A 1LHOA 2DVBA 2HBTA 1LAJA 4RR3B 1PIV2 1VE0A 2DU0A 4LO6B 4OMCA 1NZIA 2R073 1W6QB 3MDPA 1VJ2A 2PHDA 1DQ2A 1H8TC 3VD7A 2DF7A 5I0UA 5FMDA 5C9AC 2UWCA 1RUI3 1SPPA 1HRV3 1RUJ3 2G1MA 3OY8A 4QPIC 4JRLA 2YC0A 3BI3A 3RQ0A 2YC2A 3ZFEA 1BBT3 5CNAA 1UN1A 4YWAA 4PJYA 2JDYA 4QM8A 1GANA 4ZU5A 3UESA 1WMXA 4LUMA 5CB7A 3DXTA 1ODNA 2G4IA 4D6SA 2RDQA 2WNUB 1AXKA 4Z1VA 5JVVA 1IKPA 2GC3A 3H3UA 4OHYA 1DQ5A 3FBYA 4XW3A 4DY5A 3OPZA 4LITA 5BNNB 3ZYIB 5B4XA 3BTAA 4XTMA 5E8AA 1DYOA 1MS3A 3KV4A 2UYAA 1JS9A 1AR93 3ENRA 4FPKA 1LCLA 2MNGA 2EXJA 3QOPA 1U5YA 4LHLA 2Q8OA 3R6SA 3UGHA 3GZEA 3GCXA 3UL2A 4TYSA 3PMSA 3GXUA 1SBFA 1UYPA 4WV8A 4QM9A 2IXLA 4KG0A 1LKNA 3WW1A 4RS5B 4KGQA 4UFHA 4BCUA 5BNOC 4JTOA 4Q4Y3 5EP9A 2I2SA 1GLHA 1DBNA 2R32A 1ZYBA 4GA9A 3ZPOA 1VP6A 1ZZ8A 4A6OA 2WWJA 1CAUA 1LOCA 3KV5A 1GZCA 5FP7A 5A1AA 3KF3A 4ZHNA 5A7NA 3M8LA 4FFGA 4YFZA 3O1UA 3MI8A 2F4LA 1KFUL 3TYJA 3S57A 1MS8A 2WZR1 2VAUA 3VBUA 3POFA 2HEYF 1NLRA 1AR73 4A4AA 3WG2A 3WCRA 2X10A 3V65A 2DVGA 3O12A 4YNIA 4YVSB 2RDNA 4JKKA 1WD4A 2B9UA 2OPWA 1QJZA 1UPSA 2D43A 3IKWA 3PDQA 4OCTA 1AJKA 3C2UA 4YGEA 3T1LA 3LEMA 2GP5A 2HEWF 5A3NA 1HXS1 2ILMA 3BPSA 5LEJA 4RGGA 1JODA 2C26A 4TWTA 1GQGA 1FV3A 3N9QA 2JKXA 3LDRA 2W92A 2ZGOA 3W20A 1RXFA 2PHLA 2MPFA 3VLBB 4Q2FA 3WG4A 1PM4A 2ERFA 1V6NA 2X5IB 5IUQA 4RD7A 4K3UA 4Y4RA 4OQ9A 3ZFFC 4Q4W2 2WZR2 2D6NA 3ATGA 5FZCA 3ACIA 1JW6A 5A7WA 5J48A 1XOYA 3OUIA 1HRI3 1YUDA 1JU3A 5DZFA 1VBC3 1G9CA 3WP6A 4BQ1A 5IYYA 4XJ8A 3NNMA 1O5LA 4TN7A 1LJ7A 5SV8A 1CWPA 3OGJA 1DG6A 1HXS2 4ZXKA 1CESA 2JE8A 1AXYA 4P9IA 4XJUA 1F8VA 2DTYA 4OI1A 1IOAA 1FOD1 3H8UA 3LIHA 1DQ4A 2BZDA 1V6KA 4LMFA 4DRRA 3LOBA 5FZOA 1Y7BA 4AFAA 4LXLA 1OD3A 3RG0A 2HBUA 1YQ6A 3T2PA 4D7YA 4LHKA 1GU3A 1SEFA 2IXCA 4MVTA 2ZX0A 4XJZA 3VDCA 1UMIA 1EPZA 1UY0A 5DZEA 3K4DA 3U75A 5F37A 5FZMA 5FO7B 3DECA 4PDWB 2VPVA 4RQPB 5ANQA 3J7LA 4N53A 5JR7B 2JG9C 3I3BA 3VBFA 4ES9A 4RFRB 2XJQA 3BIWE 2ARXA 2HWD3 2GSYA 4RN5A 2EIGA 1PO13 1OOPA 1OT5A 5IJRA 1F5JA 3AYDA 1LOBA 4OMDA 2ADDA 1YWKA 1L7RA 2XJPA 1ZREA 2GNTA 1S0CA 4XPVA 2A71A 5FYVA 1DHKB 4Q8LA 3IB3A 4N8MA 3WZ1A 5K7PA 4NIHA 3NVCA 3RZJA 3UK9A 3I7DA 3VBRA 2WO1A 4A41A 1K3IA 1OVPA 2YGMA 4JRAA 4QQLA 3LSEA 1BQPA 2HLEA 1EV13 1RUG3 3B9IA 3BVCA 3KT1A 4FFIA 4MXVA 1TEIA 1ENSA 2VMDA 1ZZ6A 5CYYA 5A32A 3PVBB 4ITCA 4CCEA 1CAXA 1BJQA 3CL1A 1FYUA 2HWE1 4NROA 4YW4A 5FUIA 3ECQA 3S6PA 2FCVA 4CU8A 3NSTA 2WA3A 1JYVA 1YQCA 2AR6A 3RWKX 1R1A3 3FBMA 3RPQA 3EMRA 3ES1A 1PVC1 3FFZA 4CTEA 4PT6A 1Q8PA 2G19A 5LBCA 3T2OA 3WF2A 4HPKA 5H9RA 3M3QA 4Y20B 1UWWA 1UY2A 2P6HA 2UWAA 1BKZA 4PBOA 3HQUA 1HV1A 2WUHA 1F31A 3PVNA 5T3NA 2YUEA 5L73A 4JV4A 4LORA 5CFDB 3POJA 2HWE2 1S0DA 4LKEA 3VZOA 2VZ3A 2VE1A 3ZYJB 4AYUA 4JGYA 2BOIA 3B9CA 3KVBA 3NW4A 2ZGRA 1W03A 2XJRA 2QDNA 1PVC2 3HEIA 1V70A 1FMD3 3B02A 4QXCA 5BPXA 1UL9A 3ZXEA 5DMYA 2D44A 2XJUA 4IEZA 5C3SA 3VBSA 5GZDA 1ASJ1 5BUVA 1H9PA 2C4XA 2XKOA 3RZLA 3M3CA 1MVEA 3CIHA 3LZZA 2X05A 1IS6A 3CU7A 4IESA 4J1WA 5HCFA 4RHV1 5D8AA 1MEC3 3C7GA 2VVFA 1CGPA 5J98B 1QJU3 3AP7A 1UOBA 1V9U2 2UU8A 2X53S 2ZXQA 3JBG3 4Q4X2 4Y22A 4AG4A 4CPBA 4O9EA 3BTZA 5A6ZA 2JG8B 2D40A 3VUOA 4FVVA 4YRDA 1X9PA 2ZABA 1RJ8A 1ASJ2 1H8TA 1W6OA 1J3PA 2QQNA 2C1FA 3POSA 5DUVA 5C9AA 4E4DX 3ZMNA 4UW6A 5CIRA 5CFCB 5IVVA 2BGCA 2VC9A 3PJQA 4LBQB 1Z7S1 2BFUS 4RHV2 2WNVC 1W8WA 3D0SA 3ILNA 4QU2A 3LWCA 4AK3A 2YBSA 1L3JA 4MGKE 5FJKA 3GYDA 5DG2A 5JXGA 3PTYA 3SCFA 2Y0IA 4YW5A 1REFA 1BCXA 5DABA 2P3IA 2IXJA 4FQ4A 4XHXA 1QOOA 1V6MA 2Z69A 3HT2A 4CCOA 3FHQA 2Y6LA 3DEMA 3MPBA 1H6YA 4AVAA 2RS31 2MHFA 1NLQA 3POEA 4DIQA 3SXWA 1JN2P 2JDZA 4IV1A 1CZSA 3VV1A 3ILFA 4AVCA 5F5IA 2ZCWA 1Z7S2 3RI8A 1XPWA 2FDJA 2WS93 3P5BA 2KA3A 3QD6A 4XF0A 2E63A 1L7QA 2GMPA 3BKZA 1K45A 2QNKA 4V2WA 1HQLA 1NOVA 5F3EA 3FJSA 3N9NA 5JPMB 1RUOA 4Q0QA 2J42A 3VHRA 3E6CC 3DYMA 5KHGA 2WYFA 4Q4V1 4HETA 1XE0A 2RS32 3AFKA 4IGPA 3T3YA 1OXCA 2OIIA 4OHXA 3VBHC 1ULDA 3FHAA 1RUD3 5JOWA 5IVYA 1QMJA 3ELNA 1NAEA 1RUI1 1LGNA 2Q30A 2QDRA 3RFRA 1V6JA 5F2SA 1WW6A 1TME1 2VXRA 3PL0A 1BBT1 5IVEA 4TSVA 1D2SA 4UXAA 4CEWC 3ZXFA 3V0AB 4MSVA 5LRSA 5JSRA 3ZR6A 1AL0G 4OULA 5C3PA 4Q4V2 4YW3A 3RVHA 3HN1A 1OH3A 3MBWA 5EQUA 3ZLIA 2CDPA 2EICA 2Y60A 5DZGA 3U1XA 2YV8A 4QQOA 3KWVA 4UI9L 1NZCA 3IMNA 4Q29A 4CVUA 1RUI2 4SBVA 2W1WA 1NKGA 1ZBA3 4YARA 1TME2 4AVTA 1RUH1 4J1XA 1BBT2 5L7OC 1VBD3 5FP9A 3ZFFA 2JE9A 2D3PA 2G9FA 1UY1A 5IK8A 5LATA 4CEYC 5IFPA 4AAXA 4XTPA 4E9KA 1NLSA 2KR2A 5IAXA 1NG0A 2D3SA 3IDEA 3KB5A 2EXHA 1W2OA 4R9CA 3MF9A 2ZHKA 1VAVA 3JD71 5FLHA 4DRVA 1UIJA 2K0GA 4UFMA 2FDGA 1O4ZA 2Q1MA 4IEYA 2ZX1A 3D8CA 3NJXA 3SC7X 5J96B 4WM8C 3OUHA 2EXKA 1VBA3 1AR92 4ZONA 1RUH2 2W2IA 1XQNA 4OYUA 1HN1A 1N1YA 1NXD1 1QOTA 3THCA 4BM8A 4S2GA 2DCZA 4LOSA 3LEIA 5J09A 2YY1A 1AR61 4CCNA 2ZGNA 4LO8A 1NCQB 3KGLA 4QPGB 5FXWA 3WG3A 3MO4A 3JD72 5L19A 2JG9A 3OEAA 2FDIA 1TVGA 5FWEA 1POV3 3IN9A 3I3EA 4WBBA 1J1TA 5JXJA 3OCPA 4GKXA 3GF6A 1NXMA 2PHXA 1VALA 1AVBA 4LUKA 1PIV3 3RWNA 3WT3A 5LCWL 2P37A 2W08A 3TEXA 5BNQA 3GZAA 5FPZA 3QH7A 1LU2A 2VCMA 2YZ4A 3OYWA 2WSVA 2CNAA 2LW8A 3KQ4B 4K40A 4LLFA 4NVPA 4HK8A 1CAWA 4FPJA 5KC5A 4ZU7A 5FOBB 1AR72 1OMIA 1HRI1 4LHNA 3AKTA 1COV1 1DGWX 4CDWA 4AI1A 2LROA 1AR62 4LKDA 4CXYA 4K20A 3H8OA 1H2LA 5F2WA 2K9ZA 2W46A 3O7OA 5F7UA 3LDKA 2K46A 4R9AA 3RYKA 2VOKA 2VM9A 2XJSA 2QFEA 3FUOA 2Y34A 1RVF1 2E26A 1SCRA 1H30A 3BCWA 2JD9A 4NHKA 5E6HA 4C1XA 1W6PA 3WINE 4EWDA 5A3LA 5CKNA 3WDWA 3HT1A 4PLOA 5A1FA 5I93A 3LDBA 3MW3A 1HRI2 2LALA 3ACLA 1UPIA 1COV2 1OBNA 1VBC2 3P3NA 4CP2A 2VOVA 3ZM8A 2WAOA 2NQYA 3USSA 1V00A 4WVWA 4Y1YA 1C1LA 1KFXL 2ZMKA 4JCKA 4OHVA 2GAUA 2PAKA 3H42B 4QU1A 4XILA 1IS5A 1QH7A 1UKGA 1YYNA 2BU9A 4P9LA 1VBE1 5IVBA 1RVF2 2PAEA 2VL4A 1C8M1 4AR2A 1ZX5A 1WMDA 4LO7A 4UF0A 2QQWA 1KDMA 3LB9A 4AF9A 1XJAA 2P17A 5K0UC 2I45A 1OD5A 2W68A 5C6CA 4QKFA 1B35B 1GWMA 1YQ5A 5DUWA 4OQ8A 4DEVA 4DOUA 1GZWB 3CNAA 3DCQA 3FL7A 1CVNA 3OBAA 3A4UA 4AEDC 2EF6A 4MV2A 1MQTC 2QUOA 2VMGA 3AYCA 3LF7A 3J8F1 3KCCA 3LA3A 1CJPA 4HKOA 4Q0SA 1US2A 1RUF1 1VBE2 2AGSA 2LS6A 5FPVA 1C8M2 4C1WA 5F32A 1IQDC 4MHRA 4DEQA 1T6BX 5J3UA 5JPNB 2BPA2 2BBVA 1W0OA 3K48A 2B4KA 3MZHA 3OBZA 4XFCA 4MXWA 3OGVA 2RR11 4ZPIA 5LB6A 3DV8A 4IE7A 2W87A 3NQHA 2CSGA 2VOTA 2X29A 3BODA 4Y5TA 3NL1A 3HQXA 4QDSA 2GMEA 2ZPXA 4YGBA 4BDVB 5A3MA 1CAVA 2WNVA 2WZR3 2XDVA 1A8MA 2ATFA 3J8F2 4BQXA 1RUF2 1ENRA 5EZWA 1K5MC 4AI9A 5C3QA 2JDMA 4A7KA 3D3AA 1PHMA 4H7LA 1I3HA 1ULFA 3GGLA 1KJLA 4HLTA 1FXZA 2VR4A 3O1PA 3CQOA 2RR12 1HXS3 3K77A 5FLIA 4IEWA 3O1OA 1XC6A 2K2SA 4Y26A 1ZA7A 4B7KA 4BMEA 2R0FA 5J36A 1Q5OA 4ASLA 4XUPA 1N3PA 4NHMA 3SISA 3D82A 3FMGA 5LBFA 2YFZA 1EUTA 2ZZJA 3PJYA 5CADA 1MEC1 4AFMA 1ND3C 3KM5A 4K6BA 2VQTA 5FO9B 2XJVA 3NWKA 4K9SA 1R091 2RJ2A 3RNSA 4HONA 2P4EA 2XWJB 1IHMA 4QX2A 5D1IA 3CO2A 4N43C 4ZZ5A 4KWJA 4W6XA 5FYMA 1I9RA 5TSWA 3LSDA 3IPVB 1W8UA 3VBHA 1JTZX 3WQ1A 2PHRA 4D6RA 1FOD3 3I49A 4AEKA 3NV4A 2ZGSA 5F5CA 3LOIA 3LEKA 1C57A 4BXSV 4AFDA 4J6GA 3SQOA 1GWLA 1MEC2 4M3CE 3ROUA 1SLIA 4CEWA 5JIAA 1S55A 2RS11 1G7YA 1R092 3J7HA 1RIRA 3QBQA 3JBG2 4IV3B 4PLNA 4XDQA 5FK8A 1PZ8A 3OEBA 4QKBA 3AC0A 2XGXA 1UXXX 4NUBA 4RR3C 3NKGA 3LIGA 4MZUA 4LJHA 1QGLA 1VIWB 3VN4A 2BQPA 2YGLA 3KT4A 3N7JA 3B69A 3ME2A 3MIHA 4ATEA 4CCDA 2XVLA 3ZSLA 4UFLA 2OS2A 3RS6A 1HQNA 4HL0A 2DVAA 3RI9A 3N4MA 4GAZA 4D6QA 4HVRA 1HKDA 1AUYA 5L7OA 4ISRA 1W8OA 3V0BB 1LENA 4FAHA 5GZFA 2RS12 4NAMA 4ISQA 4XFAA 4XURA 3K3OA 5A3OA 3VZLA 1NUKA 4CEYA 1QXJA 1H4HA 1S4CA 4GQ7A 2XONA 2A6VA 2GH2A 4JGZB 2CGNA 4XFGA 5FZIA 2FQPA 1TNRA 1PNGA 2JJ6A 1CR7A 3IWZA 4ZS3A 3WW2A 1ND2C 2YU2A 2C5DA 2AYHA 5FPBA 3UT0A 4COUA 2ENRA 2HWE3 3MLKA 5AVAA 2D6KA 4Q8KA 1OUXA 3OBRA 4A7YA 4WM8A 4E4SA 1HN0A 4FFHA 3O1TA 1IZ3A 4N90A 1LHUA 1UX6A 1LB2A 1PVC3 3QH6A 4S2HA 5C4WB 4B4RA 1UD1A 4JKLA 3ACGA 2GNDA 2WZPP 3OPWA 3I2KA 4DQAA 1NE6A 3ZN6B 3MPPG 4GXLA 4BB3A 4HFSA 1UYYA 4COYA 2YXSA 5AVPA 1O4TA 3LFIA 4LBMA 2CGOA 1UZVA 4M4PA 4CDXB 1QOSA 4RS5C 5BNPB 2PQSA 3I97A 1BK1A 1VMFA 4O61A 4XYXA 4QHOA 4QWNA 3W59A 4QT6A 2D6MA 2XL7A 4AL9A 1DP0A 2J1TA 4M4RA 1IG0A 5FZDA 3FLRA 2RM21 4AQTA 2VY0A 1FATA 1KRIA 3ZIWA 4MGQA 1NA1B 1YJLA 4XQ4A 3OF1A 5FYHA 2PELA 1XNKA 1YHFA 1C4RA 1LOEA 2J1UA 4CDUB 4GB31 4FPEA 4AQ6A 1ASJ3 4S2FA 2GZWA 1W28A 3AZYA 1UKRA 2BTVC 1GP6A 2WNEA 3HBZA 5A7QA 4YVSC 2J7MA 3PUIA 3SH4A 3U14A 3U37A 4RHV3 5F5AA 1RL3A 2XHKA 1OLQA 1H2KA 1RYYA 3JZVA 3THPA 1DZTA 2RM22 2BV4A 4P02B 5JMOA 2D6OX 5T52A 4COWA 4XHBA 3I3DA 4JQTA 3O1SA 2DDUA 4KL1A 1BZWA 4AHXA 2OUHA 3MIEA 1UO9A 4PF5A 1X7NA 1SPPB 2OW4A 4GB32 3WF3A 5FYBA 5I0DA 3P1IA 3ZFEB 1XNCA 2V72A 3WNNA 3AP6A 1I5PA 4L92A 1WMFA 3AMHA 1SG3A 5E1RA 1RHI3 1OF4A 5BXXA 5T55A 3TNQA 5JSPA 3KT7A 3M1HA 1Z7S3 2ET7A 5LEKA 3J4UH 2XQXA 4GWMA 3WUDA 2JDAA 3LEGA 2A6ZA 5FYUA 5JAXA 4AGVA 1ULPA 2RV9A 2UY8A 3K3NA 1N47A 2J1VA 4AI2A 3AJYA 1QNWA 1BEV3 2W95A 3BU7A 5F6KA 5K0UA 5EIYB 3WR0A 2RS33 5ABJC 3WX5A 1O3TA 1DYKA 3B94A 3IZOA 5IW0A 3R4SA 4M3CB 1LOAA 2VW0A 2XOMA 1RGSA 2WFF1 4AEDA 4DPNA 4OI4A 1MQTA 4Q5OA 4PDWC 4RQPC 1ZZ7A 4YG6A 3WQ0A 4WM7C 1X36A 3P3PA 4GH4B 1WA4A 4P5YA 3VB9A 1WCUA 2YPDA 3E5QA 3MV11 4YW2A 3VKNA 4NPLA 1GZ9A 4Q4V3 1CAUB 4P00B 5ANNA 4ATFA 2VMCA 1AYM3 2EAAA 1Y3TA 1QJY1 2DYCA 2LM3A 4BYYA 1V6OA 1GICA 4GZ9A 3D5OA 1JXNA 5LK5A 3VBUB 1VPHA 2WFF2 3VKMA 3ZFGB 1U0AA 1TME3 2R041 1Y43B 3W5NA 4H14A 3BIEA 4KNCA 5FK7A 4CDQB 1HJFA 4JTNA 4FO9A 4L11A 4IGQA 1SBDA 1K5MA 3NRUA 4Q1PA 2BDRA 1OUSA 1WMEA 3WNMA 4CCLA 4AGRA 4L9BA 3B3QE 4P9GA 2W5FA 2WC2A 2YBKA 5FTTC 4IDZA 2B8MA 1QJY2 3AKPA 2HYKA 3MGUA 2BP6A 5EV7A 4UFJA 3WQ7A 2R49A 1WD3A 2GU9A 3ZXKA 4LNVA 4Y4YA 1RUH3 1JYTA 4QB1A 4OI0A 1YFUA 5C3RA 1XNTA 4D0QA 1ND3A 3TEYA 3MW4A 1W05A 2WINB 3I3QA 3NNGA 3Q8FA 2R061 2TBVA 4CUAA 5CFDC 2QQMA 4KWLA 2G9ZA 3K46A 1OVSA 2XLGA 3BALA 3L2HA 4LULA 4E8DA 2WQ8A 1QIQA 3JD73 2D98A 4N43A 2XLFA 3C7OA 2I74A 4BJ0A 5FZOB 1ZBE1 3WDXA 3Q8BA 4RYDA 3G6JB 4LK6A 5IVCA 3CKHA 4TTGA 5D21A 4FP3A 2ID4A 1H4GA 4OI2A 4DMIA 5GZEA 2VQUA 3BYWA 4CUBA 5JXHA 4ASMB 3T4VA 4N53B 2BWAA 3L9JT 1AR63 4FOQA 1CZVA 1AR83 5FZ4A 5IVJA 3ETQA 1IPKA 1Y9MA 4NN0A 1AX2A 4CXXA 5LZ6A 1F4HA 5H9PA 1ULEA 5A33A 3PURA 3ZMOA 4AI0A 1D4VB 1ZBE2 1A34A 2GDFA 3ZO0B 1E5RA 2SBAA 1GOGA 1SACA 3LPFA 4FOWA 1FNZA 4QKNA 3D6EA 4FQZA 1SQ4A 2HWF1 3VBRB 4ES8A 1TZOA 1UY3A 2QVSB 1PGSA 4GALA 5JLVA 1RUE1 1O8SA 4NPRA 5FZBA 5A32B 1COV3 4FXGB 3GBGA 1AX0A 3ON7A 4IERA 3ZN5A 2DCJA 1W99A 2PN5A 2ZHLA 1DU3D 1MR5A 2WFPA 4CCJA 3RYRA 3KVAA 4I0BA 5AFEA 1ND2A 1UZWA 4PIYA 4BOWA 1TMF1 5IHRA 3SKVA 2HJIA 3LA7A 3H9AA 1X82A 4META 1OH4A 4AFBA 4AE2A 2ZAHA 1S2EA 3N36A 1RVF3 2ZEZA 3HNMA 3HR9A 4IEUA 4M01A 4NO4A 4HPKB 3ZSMA 2QQKA 1H1IA 4QDRA 4RFT0 2HWF2 1QXPA 3IM0A 2GNMA 2D6LX 1RUE2 1UNBA 4L2NA 2YYOA 4B8EA 2B42B 4OUEA 4BMBA 3W58A 1WW4A 2X8KA 4MLOA 1YEWA 3SMHA 1PGL1 1X33A 1CPMA 3RZKA 2WYSA 4P9XA 4RGKA 3E1F1 4KU8A 4RS5A 4JGYB 4NIIA 1TMF2 3ZXAC 2JB8A 3PU8A 3WV6A 1W9SA 1FOD2 1XRUA 2WN3A 3DF0A 1R64A 1VBE3 1UIKA 3MFCA 4J25A 4QHZA 1C8M3 4U36A 3VBOC 4I2OA 3ZN4A 4CCKA 3NNLA 2OT7A 1Y9QA 2ADEA 5FYZA 2QQOA 5KBFA 2LUWA 2Q0AA 2ZZQA 4W4ZA 3ZDVA 4D3WA 5FMOL 2PLV1 2NYYA 1YLLA 5EJ3A 4EN0A 2XKPA 2J1EA 4MX3A 4QX0A 3WF1A 2HEVF 4FTBA 3OSDA 4O65A 1PGL2 2P3KA 2VUAA 1PX3A 4FAGA 1YJKA 1YFWA 3ZXJA 4U2AA 3MUZ1 5FOJB 4Y22B 1PNFA 2BNNA 3E97A 3J8F3 1RUF3 2E9QA 1JOBA 1UOFA 3CF6E 1ZZBA 1H2NA 1HB2A 2JWPA 2J22A 2ZEYA 2ARCA 3M70A 4EROA 5FAXA 4UBGA 3RSJA 1GFF2 1H8TB 1OLRA 1W6OB 2P34A 1P8JA 2WT1A 4P9YA 2RR13 3T4HB 3VDAA 5C9AB 2J1SA 5FFOC 5KWRA 2PLV2 3CJIC 2VJXA 4W50A 1YNAA 5LASA 4COZA 3CZUA 3ZDSA 5KHKA 1G9BA 2QKDA 4TLFA 2XWBB 4XUOA 4F8AA 2O8QA 3AK0A 4XAAA 3WNKA 2RDSA 1W3XA 2IXKA 5A7OA 1X9TA 5A7SA 3VDDA 3VDBA 3I54A 3WHTA 3BOWA 5F6LB 1EUUA 1JI6A 5IK4A 2VCAA 2XLAA 2YC4A 4Z2WA 1W3VA 2VW2A 3K75B 4XFIA 4EZHA 2R6QA 5DUXA 4LO5B 3O1MA 4FPLA 3N7LA 4IV1B 4D94A 2BRTA 1VMJA 4XBQA 5EYXA 2Z79A 2VMHA 2H6CA 4YG3A 5ABJA 1G8WA 2E33A 4LBKA 5FXXA 1YI7A 1WGPA 2XHNA 5JWPA 4OHWA 1A6CA 2BVVA 2NMOA 3ASIA 3SEEA 4TLGA 4UW3A 2Z42A 1HIXA 2ZMNA 3VZJA 2C0ZA 5B4NA 1GSLA 4QPGC 4Z07A 5F1RA 1M06G 1ZRIA 1SBEA 2BNOA 4P14A 5FIXA 1TQ5A 2DUPA 3G7DA 1R093 5FP3A 4WM7A 2XPJA 1LHVA 1V6IA 1LGBA 1ACCA 3MIFA 1UMZA 1WBFA 1S2BA 2VTFA 1ZRFA 2B39A 2BBAA 5F8PA 2RHPA 4B4QA 3AP5A 3MW2A 1WLCA 1A3KA 5FUPA 1JZ4A 5KHJA 2HH9A 1J83A 5FZEA 4QPIA 1IPSA 1ODMA 1RHI1 3AKRA 3JU9A 4YSFA 1CQ9A 1OLME 4XJAA 1LNSA 2OKXA 5BYNA 5FJHA 3GNEA 2VNRA 3R4UA 2RS13 3O0WA 3JXSA 2EA7A 1UQXA 3WNOA 3QACA 1AJOA 5IAVA 1BEV1 3GBFA 3OG2A 2OVUA 5CAZA 1JUIA 4QX8A 1LEDA 3C7FA 3OD4A 4GMP0 2W3JA 2WR9A 4KI5M 5FQ0B 1JZ6A 1KJRA 1PMIA 4YVWC 1QKQA 3FZ3A 2Z4FA 1C28A 3FFQA 3USUA 1SZBA 1QNYA 3UNPA 2XB6C 1QH6A 1AXZA 3E5UA 1RHI2 2JICA 2LRPA 2IWGB 4HKLA 3JB4C 1GP4A 1WWYA 4I0AA 1ALYA 1XYOA 4DZGA 3DXUA 4I02A 3D0JA 3WNPA 4DXSA 3NJVA 3ORJA 2ZS6B 1JZ7A 4W6YA 5A70A 1XU1A 1NE4A 4X8PA 4N7IA 5HBAA 4IL7A 5CFDA 4CA9A 4QB6A 3VHOA 5BNOA 4A6SA 1BEV2 1LU1A 2ZA9A 1G9DA 1AYM1 4CUCA 2WDBA 4YPJA 3AXDA 1WW5A 4Z82A 3HN3A 5F39A 4YZ4A 1B35C 4UW5A 5T54A 4E2SA 2JDHA 3WD5A 3JB8A 1VAMA 1GNZA 2VMFA 2WABA 3LAGA 5A3TA 2P6CA 4LIUA 2W1QA 2ZHNA 3S7EA 1AL21 2ZKLA 1ZM1A 1REDA 1HW5A 2QZ2A 3O0XA 3BUCA 2AACA 4ARYA 2C9KA 2JG9B 1U5ZA 2ET1A 2VO5A 1EYBA 1DLCA 1GKBA 3OBTA 2QQLA 4URTA 4CP9A 2IFWA 3IDCB 4G9SB 4OUSA 1DGWA 2AH2A 1AYM2 1GV9A 3BB6A 5FYTA 3VHPA 4XE9A 4OHZA 5KXDA 3WSOA 3OYWB 4LLOA 3V56A 5C5UA 3DUIA 2RM23 3AX4A 2VMEA 4KQ7A 2NZ9A 1AL22 4BQYA 2ES3A 1BVP1 4CDWB 4F83A 2ARBA 1KXGA 3AZZA 4LKFA 1E5IA 4GB33 2YG0A 4P5HA 4Y5SA 4OFGA 5H9SA 4BXFA 2DBIA 5FY5A 4DXZA 3TWIA 1NQJA 4L97A 4BHPA 4IETA 4D7TA 2BFUL 3SKJE 3THDA 4FTSA 4XJ9A 2R16A 3IDBB 3BN6A 2VUCA 3GZUC 2YHJA 4BIFA 1G9FA 1W6PB 3B93A 1TG7A 3Q8CA 2Z2SB 1NT0A 3F95A 5J1XA 2GN7A 5HI0A 1W6MA 1W8ZA 3ZIXA 4DS0A 1BMV1 4SLIA 3LPGA 4K7JA 2JECA 2VZ1A 5H9QA 2Q5TA 2VULA 4ONUA 3I2FA 4A42A 1W8FA 3OB8A 2ZGLA 2QE3A 1AR81 3CJXA 2IXHA 1WCDJ 2ZEXA 3AM2A 5DG1A 4LEJA 4BWOA 2CAUA 2WT2A 5DAXA 5DAWA 3HWJA 4I30A 1RUNA 4UF0B 3BPZA 1NCRC 3TRSB 2ZTNA 4HZFA 1YCIA 2VVEA 5LA9A 3VBOA 1B09A 2QQVA 3I8TA 1H8VA 1D0GA 2YB7A 1BMV2 3LE0A 3OGSA 2IXIA 4XJWA 2JDNA 4YYOA 5DDJ1 5FCCA 4MGTA 4CRQA 1GZTA 3AL6A 1UZZA 5LWBA 3I2HA 4BLJA 2VUDA 1RC6A 4EZ4A 1OFSA 1AR82 5C8WA 5C71A 4UW4A 3KD4A 2ZGQA 4IV3C 2WFF3 2F6BA 3V0AA 1ZVFA 4XDOA 4YM3A 3AJZA 1ZZ9A 4HVOA 5A80A 2ORXA 1N1TA 3AP4A 2BOJA 4MXWB 4H3WA 4BK5A 1AZDA 1M4WA 1KDKA 2AZ5A 1QJY3 3CJIA 4NRPA 3C7HA 3P6BA 1CAVB 1OC1A 4K8RB 5A6XA 1ST8A 2WNVB 2WSUA 4AOCA 2OUJA 4YM2A 1VB4A 3POBA 3DPRB 2W0XA 4W8JA 1QHDA 5ERLA 3WDVA 2R043 5LBEA 1Q8OA 2D93A 1DYPA 2CHHA 4NWWA 5AC91 4ZU4A 1LOFC 1AHSA 3C8XA 4EN7B 4UWDA 4E4ZA 3RJRA 2PHTA 5I91A 2B9VA 3ZYHA 4EE2A
chains in the Genus database with same CATH topology
5FPLA 3AVSA 3PU3A 4AAPA 4QWNA 3PDQA 4XDPA 5FZDA 3LD8A 2YU1A 5A3NA 2GP5A 2XUEA 2VD7A 2XDVA 4IGOA 4BISA 5FYHA 5FYTA 3N9QA 4AI9A 3PUSA 2W2IA 3N9LA 5FPAA 3NJYA 5F3IA 5A7PA 2Q8DA 4E4HA 3PUQA 3AL5A 5A1LA 5FZOB 5FY0A 4Y4RA 4EYUA 5A7OA 5A7SA 5F3GA 5FZCA 5A7QA 5A7WA 4CCMA 4CCNA 5FXWA 5IVCA 5FP8A 5F5AA 4DO0A 2OQ6A 5K4LA 2XMLA 4EZHA 5FWEA 5IVFA 4BXFA 3AVRA 3OPTA 5FY5A 4GD4A 4TN7A 5A7WB 3KV9A 2Q8CA 2Q8EA 3U4SA 5IVVA 3K2OA 5FP4A 5FZ6A 5FZ4A 2OX0A 5F3CA 5FV3A 5FXXA 4BU2A 5FPUA 5IVJA 2YBSA 5FY1A 4ASKA 4CUGA 5FJKA 3PURA 4HONA 5CEHA 5FZOA 5FYBA 4URAA 4LXLA 5FYMA 2GP3A 4LIVA 4V2VA 3KV6A 4CCOA 4D6RA 5FP3A 5FZKA 5F2WA 5F37A 4DIQA 5FZMA 5FZHA 4C8DA 5F5CA 5FYUA 5ANQA 3N9MA 5FZBA 5A3PA 3K3NA 3PUAA 5FUPA 5F5IA 5E6HA 5FZ7A 4CCJA 4UF0B 5ISLA 5FZEA 3KVAA 5A1FA 5IW0A 4NUBA 4CSWA 2WWUA 1VRBA 3LDBA 4V2WA 5FYVA 5F3EA 3N9NA 3U78A 5KR7A 5FJHA 3DXTA 4D6SA 3AL6A 4IGPA 5LY1A 5LWBA 5FZ3A 5FZ1A 5FZ9A 4QU1A 2OS2A 2YBPA 4EZ4A 3N9OA 5FUNA 5IVYA 4GAZA 2YPDA 4QX8A 5FZ0A 4LITA 5FZGA 5IVBA 5F2SA 5FYSA 5FZ8A 4XDOA 4UF0A 5FXVA 5IVEA 3K3OA 3KV4A 4GJYA 2P5BA 5FZIA 5A80A 4D6QA 5IWFA 4QXHA 4Y3OA 3PU8A 5FYYA 5LW9A 2YU2A 5FYIA 3DXUA 5FPBA 5LY2A 5FZLA 5FYCA 3UYJA 3RVHA 5FZFA 5FY7A 4CCKA 3ZLIA 5FWJA 2OT7A 5FYZA 2PXJA 5FY8A 4IGQA 5A3WA 2XXZA 4HOOA 3ZPOA 4CCLA 5FZAA 2WWJA 5FPVA 5FY4A 5FY9A 3KV5A 4GJZA 2OQ7A 3OPWA 5F32A 5F39A 5FP7A 4QX7A 4QXBA 2YBKA 5FP9A 5A7NA 4Y33A 5A3TA 3KVBA 3PTRB 4LIUA 3N9PA 5FBJA 5FXZA 4QXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FPL A;  3AVS A;  3PU3 A;  4AAP A;  4QWN A;  3PDQ A;  4XDP A;  5FZD A;  3LD8 A;  2YU1 A;  5A3N A;  2GP5 A;  2XUE A;  2VD7 A;  2XDV A;  4IGO A;  4BIS A;  5FYH A;  5FYT A;  3N9Q A;  4AI9 A;  3PUS A;  2W2I A;  3N9L A;  5FPA A;  3NJY A;  5F3I A;  5A7P A;  2Q8D A;  4E4H A;  3PUQ A;  3AL5 A;  5A1L A;  5FZO B;  5FY0 A;  4Y4R A;  4EYU A;  5A7O A;  5A7S A;  5F3G A;  5FZC A;  5A7Q A;  5A7W A;  4CCM A;  4CCN A;  5FXW A;  5IVC A;  5FP8 A;  5F5A A;  4DO0 A;  2OQ6 A;  5K4L A;  2XML A;  4EZH A;  5FWE A;  5IVF A;  4BXF A;  3AVR A;  3OPT A;  5FY5 A;  4GD4 A;  4TN7 A;  5A7W B;  3KV9 A;  2Q8C A;  2Q8E A;  3U4S A;  5IVV A;  3K2O A;  5FP4 A;  5FZ6 A;  5FZ4 A;  2OX0 A;  5F3C A;  5FV3 A;  5FXX A;  4BU2 A;  5FPU A;  5IVJ A;  2YBS A;  5FY1 A;  4ASK A;  4CUG A;  5FJK A;  3PUR A;  4HON A;  5CEH A;  5FZO A;  5FYB A;  4URA A;  4LXL A;  5FYM A;  2GP3 A;  4LIV A;  4V2V A;  3KV6 A;  4CCO A;  4D6R A;  5FP3 A;  5FZK A;  5F2W A;  5F37 A;  4DIQ A;  5FZM A;  5FZH A;  4C8D A;  5F5C A;  5FYU A;  5ANQ A;  3N9M A;  5FZB A;  5A3P A;  3K3N A;  3PUA A;  5FUP A;  5F5I A;  5E6H A;  5FZ7 A;  4CCJ A;  4UF0 B;  5ISL A;  5FZE A;  3KVA A;  5A1F A;  5IW0 A;  4NUB A;  4CSW A;  2WWU A;  1VRB A;  3LDB A;  4V2W A;  5FYV A;  5F3E A;  3N9N A;  3U78 A;  5KR7 A;  5FJH A;  3DXT A;  4D6S A;  3AL6 A;  4IGP A;  5LY1 A;  5LWB A;  5FZ3 A;  5FZ1 A;  5FZ9 A;  4QU1 A;  2OS2 A;  2YBP A;  4EZ4 A;  3N9O A;  5FUN A;  5IVY A;  4GAZ A;  2YPD A;  4QX8 A;  5FZ0 A;  4LIT A;  5FZG A;  5IVB A;  5F2S A;  5FYS A;  5FZ8 A;  4XDO A;  4UF0 A;  5FXV A;  5IVE A;  3K3O A;  3KV4 A;  4GJY A;  2P5B A;  5FZI A;  5A80 A;  4D6Q A;  5IWF A;  4QXH A;  4Y3O A;  3PU8 A;  5FYY A;  5LW9 A;  2YU2 A;  5FYI A;  3DXU A;  5FPB A;  5LY2 A;  5FZL A;  5FYC A;  3UYJ A;  3RVH A;  5FZF A;  5FY7 A;  4CCK A;  3ZLI A;  5FWJ A;  2OT7 A;  5FYZ A;  2PXJ A;  5FY8 A;  4IGQ A;  5A3W A;  2XXZ A;  4HOO A;  3ZPO A;  4CCL A;  5FZA A;  2WWJ A;  5FPV A;  5FY4 A;  5FY9 A;  3KV5 A;  4GJZ A;  2OQ7 A;  3OPW A;  5F32 A;  5F39 A;  5FP7 A;  4QX7 A;  4QXB A;  2YBK A;  5FP9 A;  5A7N A;  4Y33 A;  5A3T A;  3KVB A;  3PTR B;  4LIU A;  3N9P A;  5FBJ A;  5FXZ A;  4QXC A; 
#chains in the Genus database with same CATH topology
 4MH0 E;  5T5L A;  2WQZ C;  1YQ8 A;  3A0N A;  1SFY A;  1DF0 A;  3T09 A;  1JMU B;  2V5Y A;  1O3Q A;  4FFF A;  1BXH A;  4XF4 A;  1U5X A;  2JIG A;  4DUW A;  3O0V A;  2MEV 1;  3FX3 A;  2ZKN A;  3FLP A;  2WL1 A;  4IGO A;  5M0T A;  3SIT A;  4B29 A;  5LA0 A;  2V5D A;  5FRA A;  2ZAC A;  4NIA A;  5GJ6 A;  2DUR A;  3EBR A;  3ZYG A;  1FNY A;  4CDX C;  5A1L A;  3VKO A;  5AC9 2;  2A6X A;  5C5T A;  5BNP C;  1OKQ A;  4UYB A;  5FY0 A;  2R06 3;  2D5H A;  1XND A;  4PBP A;  3VBH B;  3VGI A;  3JQW A;  1J1L A;  1R1Z A;  4FOY A;  1CN1 A;  2Q1F A;  3AXE A;  5FKC A;  3CLP A;  1ZBE 3;  3VL8 A;  4QQH A;  2WBK A;  2UWB A;  4CDU C;  2MEV 2;  4IUG A;  3R4D B;  3KSC A;  1AF9 A;  1QEX A;  1W2N A;  3ABZ A;  5FPU A;  1JOP A;  1DZQ A;  1H9W A;  4KWU A;  3ZKY A;  5FY1 A;  4ASK A;  5C8C C;  3VD3 A;  4AVB A;  1YI9 A;  3WDU A;  2D97 A;  1QJX 1;  1SLB A;  1S0E A;  2WWS A;  2DFB A;  3ZXG A;  3CHX A;  3AZX A;  1EPW A;  4R9B A;  3SNM A;  4V2V A;  4DIN B;  1CPN A;  4I09 A;  4PQQ A;  4MG2 A;  1OKO A;  2WLQ A;  4OZX A;  5GLV A;  1NQD A;  4AHZ A;  4QGL A;  3THT A;  1KS4 A;  2NMN A;  2V4A A;  1LOD A;  2WII B;  2Y33 A;  2WJS A;  4YVW A;  1FAY A;  3PUA A;  4PIZ A;  2A5Z A;  4ZY9 A;  5L7O B;  3DN7 A;  3B01 A;  5LRR A;  1X50 A;  1PK6 C;  5LA2 A;  4FPY A;  2HWF 3;  1HDK A;  4MYE A;  3POY A;  4QQ2 A;  4CEY B;  1YRZ A;  1RUE 3;  1SLC A;  1QJX 2;  1VRB A;  3CZJ A;  3KCX A;  4FOV A;  4R8H A;  5FRE A;  3TN9 1;  4CYD A;  1O4Y A;  4R4X A;  2PYT A;  3PME A;  2TUN A;  1DIW A;  2VMI A;  4LBQ D;  1PMH X;  5FR3 A;  5CG8 A;  5FZ1 A;  5JZG C;  1LHW A;  1W2T A;  1S0G A;  2FCU A;  2HWB 1;  3ALQ A;  1JH5 A;  4LO4 B;  5EFU A;  1IQA A;  1TMF 3;  1W90 A;  2CWS A;  2VOX A;  4YW6 A;  3SH3 A;  1RMU 1;  2P3J A;  3EJK A;  3ITQ A;  2H0V A;  1B35 A;  5FMC A;  4K1Z A;  3AKS A;  5FYS A;  1OFN A;  1GZW A;  1Q8S A;  1ZNP A;  4IE6 A;  3ZX7 A;  4CZS A;  4S2D A;  1UYX A;  2WRA A;  4XF1 A;  1DQ6 A;  3WHU A;  1F35 A;  1I1E A;  4BLI A;  3RZH A;  3ILR A;  3I2J A;  5FYC A;  3LA2 A;  2OZ6 A;  1Q8V A;  4FP2 A;  4GH4 C;  3GCW A;  4RA0 A;  1GOH A;  1BYH A;  1WKY A;  2HWB 2;  2XXZ A;  4AEM A;  1SMV A;  1RMU 2;  2XH6 A;  4XQW A;  4Y24 A;  5D2A A;  1WA6 X;  1JZ3 A;  1S0F A;  2DTW A;  1VLN A;  1Q8Q A;  5DXD A;  3HOB A;  1LES A;  1O5U A;  5I0S A;  4NAO A;  1GQP A;  2FMD A;  5FXZ A;  3ZFG C;  4CU6 A;  2PLV 3;  1I5Z A;  2CV6 A;  4LOT A;  4CDQ C;  3U07 A;  2RE9 A;  4QX1 A;  5I8Y A;  4AAP A;  4YZ3 A;  2GN3 A;  3I3M A;  2WNU C;  4MGZ E;  4B1L A;  2VTX J;  2XUE A;  4XVH A;  3T2T A;  4XET A;  1GMM A;  4NHY A;  2FDK A;  4EWA A;  1SFN A;  1DGL A;  5T5O A;  2PHU A;  1MS9 A;  2OPK A;  5BNN C;  1HLC A;  2P2K A;  4HG6 B;  4H7M A;  5IVF A;  1ZRD A;  2P1B A;  4QB2 A;  1RJ7 A;  3VD9 A;  3FLT A;  3GAL A;  3A0K A;  4A3Z A;  1E5S A;  1O91 A;  3MUY 1;  1IS3 A;  2YPJ A;  1LHN A;  1SDW A;  2OYZ A;  1XBF A;  1C3H A;  3ZXD A;  5JR2 A;  4XUT A;  5CVR A;  4FPF A;  3H1W A;  2B5H A;  5ACA 1;  2ZX2 A;  1YIF A;  3MHZ A;  2A6W A;  4WZF A;  4XZU G;  4D8M A;  3H3Z A;  2TEP A;  1YO8 A;  4JKM A;  4XC9 A;  2G9G A;  1JZ2 A;  1JZ8 A;  3DKQ A;  1NCR A;  3NAP B;  4BU2 A;  3GM8 A;  4ARX A;  5K0U B;  1W6N A;  4B4P A;  2O8O A;  4MUV A;  1N3Q A;  1CX4 A;  3MIC A;  4URA A;  4WZC A;  1CIW A;  3H1M A;  2EAK A;  3HBK A;  4IE5 A;  5FLJ A;  4DB5 A;  2E6V A;  5JI9 A;  2D6P A;  3WVJ A;  3IBM A;  1VB2 A;  3W21 A;  5IFT A;  4AED B;  1MQT B;  1O3S A;  5C70 A;  3WQB A;  4C8D A;  4IV3 A;  1XNA A;  3POW A;  2UUR A;  4HSJ A;  4KGG A;  3WF4 A;  3KF5 A;  4PCR A;  4MOA A;  4YG0 A;  1W0P A;  4KH9 A;  2F17 A;  2EID A;  4FBF A;  5ISL A;  3AZW A;  4HMZ A;  4FT8 A;  1PO2 1;  2JKB A;  4EQV A;  4CSW A;  3OGG A;  4AQ2 A;  4YZ5 A;  4WVM A;  1J84 A;  4UOJ A;  3SHR A;  1NY7 1;  2VBP A;  2VQ0 A;  1T6G C;  1MZ5 A;  1OQE A;  2X5I C;  3OY8 B;  4QPY A;  3U78 A;  4ET7 A;  3TEZ A;  1OF3 A;  4FPO B;  3PLQ A;  4OUM A;  3LCP A;  3PIG A;  5FZ3 A;  3J9S A;  2Y0O A;  4XOG A;  5FDB A;  3GZT B;  3Q9O A;  4W65 A;  4LK7 A;  3WW4 A;  5FZ8 A;  3NNJ A;  5JUV A;  1LOF A;  3E6D A;  5EJZ B;  4COV A;  3JCI A;  2A75 A;  3OTF A;  2JB4 A;  1PO2 2;  4JDM A;  3O5S A;  2W39 A;  2X09 A;  1NY7 2;  1W8T A;  4LHS A;  3VHN A;  2ZAA A;  3M7A A;  3RMY A;  5FZF A;  4DFS A;  2I07 B;  1K5J A;  1FPN 1;  1ND3 B;  3ZN6 A;  3C3V A;  1PZ9 A;  3PUH A;  2DVF A;  1SCS A;  2XL9 A;  3Q8A A;  1BHG A;  4GJZ A;  1DDL A;  1ULC A;  3LGR A;  4LBL A;  5EJ1 B;  4MHU A;  3M2M A;  4LR4 A;  1D4M 1;  4N43 B;  1W9W A;  2E7T A;  3PIJ A;  4C0B A;  4AI8 A;  5I8T A;  2BUK A;  4UFK A;  4EV0 A;  2A6Y A;  2QTW B;  4XCB A;  3R0R A;  3B7M A;  5DUU A;  1XSQ A;  4R4Z A;  2RS5 1;  1AL2 3;  5C8C A;  5L36 A;  4Y5Z 0;  3RZZ A;  2GC2 A;  4XZP A;  1BLZ A;  1FX5 A;  2ZGM A;  4I0W B;  4XAE A;  3VD5 A;  2IVI B;  5FPX A;  2Q8D A;  5A33 B;  1D4M 2;  2VGD A;  3KLS A;  2DCY A;  1SDD B;  3HJR A;  2VUJ A;  3RZM A;  4NWV A;  1HJG A;  2VZP A;  4YGC A;  3H1Y A;  4GWN A;  1POV 0;  1N1S A;  3I59 A;  4XMA A;  3ST7 A;  2HKX A;  2A3W A;  1ONA A;  3WF0 A;  5A7W B;  2OA2 A;  2AC1 A;  2R04 2;  1PK6 A;  4NHX A;  4XUN A;  4YW1 A;  2RS5 2;  4CP1 A;  3IIA A;  4K8F A;  5E89 A;  3U4S A;  4RL7 A;  1G9A A;  2LTN A;  5FZ6 A;  4JQR A;  4Y1Z A;  1JZ5 A;  5FV3 A;  2KXL A;  2D5F A;  2WO3 A;  3F2Z A;  3H7Y A;  4XBL A;  4LBO A;  4MGS A;  4X8N A;  1KS5 A;  1G86 A;  1ND2 B;  4B7E A;  4GKY A;  1QDC A;  4CCC A;  3QLQ A;  2XBO 1;  2GP3 A;  5CKQ A;  1YXW A;  1Q3E A;  5JZG A;  1C5H A;  2IC1 A;  4AGG A;  4C0H A;  1IPJ A;  3FE5 A;  3S0M A;  4IV1 C;  3H8X A;  5KXC A;  3APB A;  3R05 A;  5FZH A;  1WBL A;  3M3I A;  4A45 A;  4E27 A;  4UT5 A;  4HAN A;  5A3P A;  1JYW A;  3GDB A;  1YFY A;  4LTA A;  1WLD A;  2JEN A;  5JSO A;  4M3C A;  1HB3 A;  2F4P A;  1WCS A;  5K9Y A;  2VW1 A;  3VBF B;  2R06 2;  2ZGT A;  2JX9 A;  2Y6H A;  4G4F A;  3A23 A;  2D3R A;  1N3O A;  5E88 A;  4D7S A;  4BIO A;  3KZ4 C;  4RR3 A;  1OOP B;  2VVD A;  5A3U A;  2XBO 2;  4GH4 A;  3NV2 A;  1R08 1;  1OHF A;  2BYV E;  1ENX A;  2JDK A;  3ZSJ A;  2JG8 C;  5FMO S;  2QCS B;  1W6Q A;  4MO3 M;  4XFH A;  5KHH A;  2QQP A;  3HAG A;  2CY6 A;  4XAC A;  3DYO A;  2PHW A;  4CXW A;  3KHC A;  4LBN A;  4W6W A;  2FZ1 A;  1NYW A;  4Q4W 1;  3T0D A;  1HB1 A;  5DDJ 3;  5DPN A;  1VR3 A;  3I2O A;  2E31 A;  3WDY A;  1VBB 1;  3NNF A;  1FT9 A;  2CWM A;  3KS7 A;  3ZFG A;  5CFC C;  2JIJ A;  2QQJ A;  4CDQ A;  1CAX B;  4P9W A;  1GNH A;  1K42 A;  3IAQ A;  4LPL A;  2KM2 A;  1Q43 A;  3UYJ A;  4IEV A;  1R08 2;  3AKQ A;  2WNU A;  1XXN A;  1J58 A;  2B45 X;  4GUL A;  1WUV A;  4RGA A;  5BY5 A;  5GAL A;  4HOO A;  2DVD A;  5BNN A;  3ES4 A;  3WEZ A;  5FZA A;  2KD7 A;  5FY9 A;  5JIU A;  3JQX A;  1D2Q A;  4QX7 A;  3VL9 A;  1VBB 2;  2VNV A;  1OQD A;  2WZ8 A;  1U5I A;  1ZA4 A;  1CON A;  2XG3 A;  4E2Q A;  1JYI A;  1RIT A;  5EXO A;  4JZR A;  1X8E A;  2RG4 A;  4PHZ A;  5IK5 A;  3VDD B;  4XAB A;  1LGC A;  5FPL A;  3BTY A;  4BA6 A;  3VZK A;  1WW7 A;  4A2U A;  2HYX A;  5AC9 3;  3U4X A;  1H1A A;  4IEO A;  5DAQ A;  5DN2 A;  2VD7 A;  2FDF A;  2R1B A;  4LKS A;  4PI2 A;  4ZXE A;  3VBS B;  1KD7 A;  4Y1V A;  4XUQ A;  5HXV A;  2XJT A;  3S5Q A;  1UX7 A;  5ABJ B;  1DQ0 A;  4A44 A;  3FN9 A;  2BJS A;  5FPA A;  4HBN A;  1A78 A;  4K1Y A;  3RMX A;  1AYN 1;  5I0T A;  4IW3 A;  2R1D A;  4X6Q B;  1APN A;  1UZY A;  1WCK A;  3UGG A;  2MEV 3;  2CU5 A;  5D8A B;  5F3G A;  4ZKT B;  5HV0 A;  5A6Y A;  4YVS A;  4A3X A;  3QCW A;  5K4L A;  4WM7 B;  5CU1 A;  2TNF A;  4BQW A;  2A1X A;  1W8N A;  3HD8 B;  4YZ2 A;  1QWR A;  1W9F A;  3MEP A;  2Y6F A;  3Q8E A;  3AYA A;  4MGI E;  5A6Q A;  5B2G B;  2ZML A;  3J7N A;  4CE8 A;  3K2O A;  5FP4 A;  5F3C A;  5KXE A;  4K21 A;  4AQS A;  2QZ3 A;  5CEH A;  2X5I A;  1YFX A;  4CDW C;  2O14 A;  1AYN 2;  2EXI A;  4QPI B;  5GKA C;  4EJR A;  1C5I A;  1H2M A;  3A21 A;  1YC6 1;  4HXC A;  4EN8 B;  2PTM A;  3CDZ B;  2EIB A;  2GC0 A;  5APA A;  4WVV A;  2DFC A;  2W91 A;  3IDA A;  4XEZ A;  5LBB A;  5GLZ A;  4UBH A;  1IS4 A;  1O59 A;  1XE8 A;  2VTX A;  1F2N A;  1WLT A;  3WLU A;  4XIO A;  2DUO A;  2PAM A;  3N9M A;  1QJX 3;  4PIX A;  2YMZ A;  3WG1 A;  5C33 A;  4LQR A;  5I0R A;  3ZOI A;  3DL3 A;  1W39 A;  5FZ7 A;  2E53 A;  1ULO A;  2DUQ A;  2V09 A;  3USU B;  1VRH 1;  4R52 A;  3VZM A;  5KXB A;  3BGA A;  1TE1 B;  1MS0 A;  3VD4 A;  1C8N A;  2O1Q A;  1OUR A;  1F4A A;  5KR7 A;  2E51 A;  4GMP 1;  2UY9 A;  2VBB A;  2FHR A;  1MS4 A;  1UOG A;  1NCQ C;  2OXB A;  3KQR A;  4EWE A;  2VZQ A;  4PDW A;  1JHN A;  4RQP A;  4BPZ A;  1ZRC A;  3UV9 A;  3A22 A;  4KG8 A;  5BNO B;  3N9O A;  5J7M A;  2WZE A;  5FUN A;  4NHL A;  3H7J A;  3TN9 3;  2VBD A;  4H2A A;  1V9U 1;  5FZ0 A;  1SLT A;  5FZG A;  4Q4X 1;  4BZ4 A;  5LK7 B;  3NV3 A;  1RXG A;  4JVA A;  4N9H A;  3SCG A;  3O1V A;  5FXV A;  3FHI B;  3VKF C;  4P9J A;  1W9Y A;  4AVV A;  5HV4 A;  4PI0 A;  2BW8 A;  1VRH 2;  1EY2 A;  4FXK B;  4GJY A;  4KBZ A;  4Q0V A;  2HWB 3;  4BQ2 A;  2AEZ A;  4HT1 T;  2DCK A;  2RMU 1;  1US3 A;  4QQP A;  3T0B A;  2V4V A;  4Y3O A;  1RTV A;  3ZSE A;  1UU5 A;  2YFU A;  1RMU 3;  3C7E A;  2FDH A;  3RRD A;  5FZL A;  2IVJ A;  1E57 A;  1GR3 A;  3B5L B;  1MS5 A;  1UU4 A;  4XIK A;  1SFP A;  2JDU A;  3H0O A;  5GZC A;  4BE3 A;  4FSJ A;  4BQ3 A;  4CP9 B;  2VCC A;  3I4I A;  3UET A;  2RVA A;  1KQR A;  1S0I A;  2OQ7 A;  3DKW A;  3NKT A;  1LOG A;  3AP9 A;  4BQ4 A;  1RUC 1;  3LQC A;  3RGB A;  2RMU 2;  4NRM A;  1EAH 1;  2FMY A;  1LUL A;  4O9G A;  1XNB A;  2R7E B;  4R9D A;  1MZE A;  3HIF A;  3ZFF B;  3AVS A;  2ORZ A;  2PA7 A;  4Y20 A;  3IMM A;  2WLP A;  2DWR A;  1CD3 G;  1UXZ A;  4Q0U A;  3ZR5 A;  2L9L A;  3T30 A;  3AMN A;  4ZS2 A;  3DPR C;  1UCX A;  4FPG A;  4I3P A;  3LKJ A;  4BIS A;  2QQU A;  4XXP A;  3SH5 A;  1PMJ X;  1IKQ A;  4NID A;  3SLI A;  4HVQ A;  4L0P A;  1JOJ A;  1YQ2 A;  4IXL A;  5HCA A;  1UAI A;  3N3H A;  2BEO A;  5JI7 A;  2OZJ A;  5A7P A;  1LR5 A;  2YRO A;  1RUC 2;  4YFW A;  2ZX3 A;  5J37 A;  1JHJ A;  3N7K A;  1EAH 2;  1OPM A;  4EYU A;  2VH9 A;  1W6M B;  1KIT A;  2Y6G A;  3EHK A;  1A8D A;  4JDN A;  4CCM A;  2HWC 3;  4GIQ A;  4YZ1 A;  3M3O A;  4QGN A;  5T50 A;  2GH8 A;  1W9T A;  2XML A;  5LA1 A;  3JUU A;  2A70 A;  3UJO A;  1T2X A;  1D7P M;  2VZO A;  4NRQ A;  5JOY A;  2W1S A;  1UYZ A;  3V64 A;  1IG3 A;  1QJE A;  4EN9 B;  4ZZ8 A;  2A3Y A;  2VEC A;  2VZS A;  2XVK A;  2CTV A;  2W9X A;  3ZSK A;  2R07 1;  1GOF A;  5ACA 3;  4EN6 B;  2PFW A;  3D4K A;  3VBO B;  4Z2A A;  2ZGP A;  2QBX A;  3FC0 A;  2JG8 A;  2A3X A;  3KV6 A;  3RJ2 X;  1HRV 1;  1RUJ 1;  1CAW B;  1DGR N;  4UAP A;  1JYN A;  3AMQ A;  3TB0 A;  3ZKU A;  3TBD A;  1SHW B;  2DCT A;  2UYB A;  3J7M A;  1QQP 3;  3OD0 A;  4ORF A;  4Q26 A;  3ZPY A;  5CFC A;  2W94 A;  5CIS A;  4LBQ A;  1BVV A;  2ZX4 A;  3EB7 A;  1CX1 A;  3HMY A;  1MAC A;  2R07 2;  5GZG A;  1E5H A;  4NMI A;  5BV6 A;  3RDI A;  1GYK A;  1PM7 A;  1POQ A;  1K12 A;  2NP0 A;  3PHM A;  1L7L A;  2A73 B;  4NR1 A;  1FI2 A;  3T08 A;  3AMM A;  5HCH A;  3BOP A;  5FQ0 A;  1HRV 2;  1RUJ 2;  5EYY A;  4L8Q A;  4QD2 A;  3E6B A;  3DGT A;  3WP5 A;  1I6X A;  2A7A A;  5FZ9 A;  1AR9 1;  2GMM A;  4F3J A;  1PO2 3;  4F7Z A;  2YBP A;  3CJI B;  2NM1 A;  5IAT A;  1GNY A;  1XB9 A;  1X8M A;  3TNP B;  5F5Q A;  5T5P A;  2JD4 A;  4I3G A;  1H6X A;  4AFC A;  1D0H A;  2J1R A;  4Q4Y 1;  4CP0 A;  1Z78 A;  4TXW A;  1MS1 A;  4KMQ A;  4QXH A;  3ZVX A;  4Z92 B;  5CKM A;  3K51 A;  2VOW A;  4Q0P A;  3EO6 A;  1STM A;  4B3N A;  5KC6 A;  3BTX A;  4UFI A;  2ETE A;  3PVE A;  2JE7 A;  4IEQ A;  4WVZ A;  3PVO A;  1REE A;  2PXJ A;  2AEY A;  4YLZ A;  4IND A;  4N9I A;  3EYP A;  1AR7 1;  4TZD A;  1J3Q A;  5FY4 A;  2RJK A;  4DXT A;  2P3Y A;  1O3R A;  1XU2 A;  3TOJ A;  1ZZC A;  4Q4Y 2;  1FPN 3;  1F5F A;  1WCQ A;  1SLA A;  2PHF A;  4XFB A;  4M0N A;  3GJB A;  2J1A A;  1O8P A;  5FKB A;  1QY4 A;  1UF2 C;  3I2G A;  3UJQ A;  4XFF A;  2PQQ A;  4XDP A;  1PZ7 A;  1D4M 3;  3IT8 A;  3LD8 A;  3S7I A;  1PVX A;  4Z8B A;  4QX5 A;  4FTE A;  5DDJ 2;  1OQ1 A;  4E8C A;  1CJD A;  3HNB M;  1WZX A;  1NX9 A;  2IZW A;  2FBE A;  3J26 N;  1VBC 1;  4HN1 A;  1GUI A;  1VMH A;  4AHW A;  2VNO A;  3U0Z A;  3M3E A;  2E7A A;  4E4H A;  3AL5 A;  4RSU A;  3T0A A;  4A7Z A;  3III A;  4CU7 A;  2Y38 A;  2BGO A;  3NV1 A;  3O14 A;  2RS5 3;  4JAA A;  3KCY A;  4JGZ C;  4QGM A;  2C6S A;  4YGD A;  1Z0H A;  3B00 A;  3ZYB A;  1OA3 A;  5C3O A;  2Y8K A;  2NLR A;  5AFB A;  1GQH A;  3AMP A;  3PNA A;  4GD4 A;  5GLW A;  3CBN A;  4JHT A;  4YVW B;  2ZHM A;  1DZR A;  1XYN A;  1FV2 A;  5EWS A;  4CPB D;  2B46 X;  2OX0 A;  2DU1 A;  5C4W C;  3HNY M;  2VG9 A;  4CUG A;  1O7F A;  2YDE A;  3ACH A;  4MAD A;  3POI A;  1YIP A;  5I8S A;  3W9A A;  4XMI A;  2ZGK A;  4G3Y C;  5GM0 A;  3UKV A;  4QAW A;  1NCQ A;  4QPG A;  4YM0 A;  4Q1R A;  2HWD 1;  1PO1 1;  3AB0 A;  4NJ4 A;  3SCH A;  5L9V A;  5FO8 B;  3RZG A;  1CIY A;  4NIG A;  1XYP A;  2ZGU A;  4XF3 A;  1JU4 A;  3WP4 A;  2BGP A;  3WCS A;  2FZ2 A;  3NAP C;  1JYC A;  1DLL A;  1UU6 A;  2AUY A;  2XBO 3;  1W8H A;  1JBC A;  5FMB A;  3EQE A;  2E32 A;  3OOX A;  1J3R A;  3S5A A;  1NA1 C;  3WXP A;  4GWJ A;  3WUC A;  1MPX A;  4IQP A;  2CAV A;  1EV1 1;  1RUG 1;  2V73 A;  1Y4W A;  3POG A;  4LE3 A;  4O7X A;  4CEW B;  1OLM A;  1LTE A;  4LBJ A;  2HWD 2;  2RDR A;  1G6N A;  1PO1 2;  1GWK A;  1BK0 A;  5DAP A;  1MVQ A;  1F15 A;  2WO7 A;  3EXU A;  3H3L A;  1GBG A;  3WOG A;  5CA6 A;  4IEX A;  2DBN A;  2W52 A;  2WKK A;  3T2Q A;  2ZBJ A;  2EVX A;  1R1A 1;  4C90 A;  3OGR A;  4QX3 A;  5SV5 A;  3HVD A;  3IAP A;  1DCS A;  3ACF A;  1R08 3;  4LT5 A;  3NO8 A;  1DGR A;  4YM1 A;  1MZ6 A;  2P5B A;  2VU9 A;  1KGY A;  4JDO A;  4D69 A;  5F9T A;  5EPA A;  3TEW A;  1EV1 2;  1RUG 2;  2E7Q A;  2GNB A;  5IWF A;  1HX6 A;  3MIB A;  2H0B A;  5DAV A;  5FYY A;  1OI6 A;  3URF A;  1IGO A;  3WNX A;  3FUQ A;  3WP3 A;  3ZFE C;  4QKD A;  3ZYF A;  1HV0 A;  1OPO A;  5LY2 A;  1UW8 A;  4Q4W 3;  3T1M A;  5KHI A;  1MZF A;  2IFR A;  4KWK A;  4DY3 A;  3DPR A;  3K4A A;  1VBB 3;  4C91 A;  4I01 A;  1N1V A;  5IK7 A;  4AXO A;  5A3W A;  1S0J A;  2XVG A;  1R1A 2;  2CGP A;  1FMD 1;  5C7G A;  4WM8 B;  2FCT A;  5E16 A;  4QXB A;  3CEW A;  3VKL A;  4Y33 A;  1OA4 A;  2R30 A;  3W5M A;  3PTR B;  5FBJ A;  3N9P A;  2R0H A;  2EIE A;  3WDT A;  3AFG A;  1F9K A;  4V1P A;  4B1M A;  3U10 A;  4OZO A;  4E2G A;  2W47 A;  3LFM A;  3KMH A;  4JX0 A;  1QJU 1;  3TN9 2;  1LRH A;  4XQD A;  3JBG 1;  2WQ4 A;  2C9A A;  2XQR A;  2XR4 A;  2NPI A;  2Y6K A;  3S30 A;  1GP5 A;  1FMD 2;  3MF6 A;  1NCR B;  2N7G A;  3MV0 1;  4DNY A;  4BQ5 A;  3NJZ A;  4IE0 A;  1W6N B;  3N9L A;  2SLI A;  3L2Y A;  3NJY A;  5F3I A;  4QPW A;  1LEM A;  5CG9 A;  2ZOE B;  2WNO A;  2XUM A;  4L99 A;  3UKT A;  3AZV A;  4DXR A;  1C1F A;  5EHD A;  2PMW B;  4DO0 A;  3VBU C;  5JCT A;  3VZN A;  4N7U A;  3HPN A;  4Q27 A;  1PGW 1;  3AVR A;  1UZ0 A;  1QJU 2;  3OPT A;  5GLT A;  1AYN 3;  2WAA A;  1UOJ A;  4M00 A;  3KV9 A;  2Q8C A;  2VZR A;  5JMC A;  4Y1X A;  5JOX A;  2GC1 A;  3MIG A;  1S2K A;  2Y6J A;  1ULG A;  1S0B A;  3K4Z A;  3INA A;  4HKW A;  1J59 A;  2HWC 1;  1JUH A;  2VNG A;  1PX4 A;  2O0O A;  4WVM B;  3ZXL A;  4LIV A;  4FPH A;  4AHY A;  1H1M A;  3MYX A;  5HCB A;  5FZK A;  2WS9 1;  3U11 A;  5G04 L;  2BNM A;  2WA4 A;  1PGW 2;  2ARA A;  3ETP A;  5HXM A;  1WLW A;  5L9R A;  4XBN A;  2VQA A;  5IT6 A;  3BU0 A;  2CYF A;  1UY4 A;  4HK9 A;  3ZYP A;  4BK4 A;  3TAY A;  2BVB A;  3SEP A;  4IEP A;  2Y26 A;  4JC1 A;  1CZT A;  4OLL A;  3GHN A;  2BWC A;  3DYP A;  4BH9 A;  3MID A;  1O6U A;  1V0A A;  1RUD 1;  1W0N A;  5GLU A;  4AZZ A;  2H6B A;  2WWU A;  4AWD A;  2HWC 2;  3N35 A;  2VZT A;  5CZK A;  3ZYR A;  3IPV A;  1RIN A;  5T5J A;  5JOZ A;  5G05 L;  1W06 A;  2WS9 2;  5LY1 A;  1W2A X;  1QQP 1;  1VRH 3;  4M0H A;  3HQR A;  2BER A;  5JDB A;  4LA2 A;  3MLJ A;  3E5X A;  4AI3 A;  2WO2 A;  4LE4 A;  4KU7 A;  3RYP A;  3VBF C;  3CMG A;  2DV9 A;  4GMP 3;  4N53 C;  5ACA 2;  1DFQ A;  2VZV A;  2QJV A;  1OOP C;  2JXA A;  1RUD 2;  3H50 A;  4NOT A;  3O1R A;  2Q4S A;  1EP0 A;  5LW9 A;  1V9U 3;  1ZBA 1;  1TNF A;  5FYI A;  4Q4X 3;  2GAL A;  2JEM A;  3MLL A;  4PQ9 A;  5JXI A;  5FY7 A;  1KEX A;  3I2D A;  3H8R A;  1VBD 1;  4JHZ A;  5FWJ A;  3OJB A;  1QQP 2;  3GJA A;  2ARE A;  4PF1 A;  4QHB A;  5FY8 A;  3VBR C;  2RMU 3;  1AX1 A;  3WW3 A;  4QDQ A;  3V0B A;  1XE7 A;  3A7Q A;  3X29 B;  2D7F A;  5C8C B;  1QXR A;  1HB4 A;  2C24 A;  4AEJ A;  1H0B A;  2AEN A;  4FCA A;  1VAK A;  1K5M B;  2W1U A;  4JGZ A;  4AVS A;  3N7M A;  1ENQ A;  3WY6 A;  4CU9 A;  4M3C F;  3I2I A;  1U12 A;  3NMB A;  5CBL A;  1ZBA 2;  1JYX A;  2WT0 A;  2Q1Z B;  5DQ0 A;  2NN8 A;  1VBA 1;  3PU3 A;  5L9B A;  1OA2 A;  2JDP A;  1QU0 A;  1S1A A;  3MFA A;  2CL2 A;  2EAL A;  4OVE A;  1VBD 2;  2IUW A;  3I59 B;  2RJL A;  4FI9 A;  1Q56 A;  1RUC 3;  4YW7 A;  4AW7 A;  2YU1 A;  4HSL A;  4DUV A;  4NE9 A;  4Y1U A;  1EAH 3;  2VXJ A;  2ZEW A;  1ZRR A;  1SLL A;  1PK6 B;  3KHB A;  5C4W A;  4HN0 A;  4XF9 A;  4LA3 A;  1HQW A;  3PUS A;  4XCA A;  2Y64 A;  3GHM A;  2FD8 A;  4GWI A;  3WNL A;  1QDO A;  4DUX A;  1RB8 G;  1POV 1;  1QF3 A;  2CDO A;  3KGZ A;  3PUQ A;  4P08 A;  4QXK A;  3VDD C;  4NPM A;  4CDX A;  4FPC A;  5FBZ A;  1LEC A;  2ZJC A;  3FWE A;  4JGY C;  4PLM A;  1PIV 1;  5BNP A;  4QMA A;  3UKN A;  1Y9G A;  2VZU A;  5FP8 A;  1V6L A;  1VBA 2;  4H55 A;  4MGY E;  5JZG B;  4KBB A;  5K8S A;  1URX A;  2OQ6 A;  3GBW A;  3NAP A;  2QQI A;  4X6R B;  2WN2 A;  2B7Y A;  3VBS C;  1NA1 A;  1QJF A;  3M4F A;  4XXA A;  2Q8E A;  3OUJ A;  2VCB A;  1DQ1 A;  2Z5W A;  4CDU A;  5HPO A;  1FPN 2;  1OSG A;  4IE4 A;  1UMH A;  1XSR A;  5D8A C;  1W2U A;  3AYE A;  3UGF A;  1W04 A;  1LHO A;  2DVB A;  2HBT A;  1LAJ A;  4RR3 B;  1PIV 2;  1VE0 A;  2DU0 A;  4LO6 B;  4OMC A;  1NZI A;  2R07 3;  1W6Q B;  3MDP A;  1VJ2 A;  2PHD A;  1DQ2 A;  1H8T C;  3VD7 A;  2DF7 A;  5I0U A;  5FMD A;  5C9A C;  2UWC A;  1RUI 3;  1SPP A;  1HRV 3;  1RUJ 3;  2G1M A;  3OY8 A;  4QPI C;  4JRL A;  2YC0 A;  3BI3 A;  3RQ0 A;  2YC2 A;  3ZFE A;  1BBT 3;  5CNA A;  1UN1 A;  4YWA A;  4PJY A;  2JDY A;  4QM8 A;  1GAN A;  4ZU5 A;  3UES A;  1WMX A;  4LUM A;  5CB7 A;  3DXT A;  1ODN A;  2G4I A;  4D6S A;  2RDQ A;  2WNU B;  1AXK A;  4Z1V A;  5JVV A;  1IKP A;  2GC3 A;  3H3U A;  4OHY A;  1DQ5 A;  3FBY A;  4XW3 A;  4DY5 A;  3OPZ A;  4LIT A;  5BNN B;  3ZYI B;  5B4X A;  3BTA A;  4XTM A;  5E8A A;  1DYO A;  1MS3 A;  3KV4 A;  2UYA A;  1JS9 A;  1AR9 3;  3ENR A;  4FPK A;  1LCL A;  2MNG A;  2EXJ A;  3QOP A;  1U5Y A;  4LHL A;  2Q8O A;  3R6S A;  3UGH A;  3GZE A;  3GCX A;  3UL2 A;  4TYS A;  3PMS A;  3GXU A;  1SBF A;  1UYP A;  4WV8 A;  4QM9 A;  2IXL A;  4KG0 A;  1LKN A;  3WW1 A;  4RS5 B;  4KGQ A;  4UFH A;  4BCU A;  5BNO C;  4JTO A;  4Q4Y 3;  5EP9 A;  2I2S A;  1GLH A;  1DBN A;  2R32 A;  1ZYB A;  4GA9 A;  3ZPO A;  1VP6 A;  1ZZ8 A;  4A6O A;  2WWJ A;  1CAU A;  1LOC A;  3KV5 A;  1GZC A;  5FP7 A;  5A1A A;  3KF3 A;  4ZHN A;  5A7N A;  3M8L A;  4FFG A;  4YFZ A;  3O1U A;  3MI8 A;  2F4L A;  1KFU L;  3TYJ A;  3S57 A;  1MS8 A;  2WZR 1;  2VAU A;  3VBU A;  3POF A;  2HEY F;  1NLR A;  1AR7 3;  4A4A A;  3WG2 A;  3WCR A;  2X10 A;  3V65 A;  2DVG A;  3O12 A;  4YNI A;  4YVS B;  2RDN A;  4JKK A;  1WD4 A;  2B9U A;  2OPW A;  1QJZ A;  1UPS A;  2D43 A;  3IKW A;  3PDQ A;  4OCT A;  1AJK A;  3C2U A;  4YGE A;  3T1L A;  3LEM A;  2GP5 A;  2HEW F;  5A3N A;  1HXS 1;  2ILM A;  3BPS A;  5LEJ A;  4RGG A;  1JOD A;  2C26 A;  4TWT A;  1GQG A;  1FV3 A;  3N9Q A;  2JKX A;  3LDR A;  2W92 A;  2ZGO A;  3W20 A;  1RXF A;  2PHL A;  2MPF A;  3VLB B;  4Q2F A;  3WG4 A;  1PM4 A;  2ERF A;  1V6N A;  2X5I B;  5IUQ A;  4RD7 A;  4K3U A;  4Y4R A;  4OQ9 A;  3ZFF C;  4Q4W 2;  2WZR 2;  2D6N A;  3ATG A;  5FZC A;  3ACI A;  1JW6 A;  5A7W A;  5J48 A;  1XOY A;  3OUI A;  1HRI 3;  1YUD A;  1JU3 A;  5DZF A;  1VBC 3;  1G9C A;  3WP6 A;  4BQ1 A;  5IYY A;  4XJ8 A;  3NNM A;  1O5L A;  4TN7 A;  1LJ7 A;  5SV8 A;  1CWP A;  3OGJ A;  1DG6 A;  1HXS 2;  4ZXK A;  1CES A;  2JE8 A;  1AXY A;  4P9I A;  4XJU A;  1F8V A;  2DTY A;  4OI1 A;  1IOA A;  1FOD 1;  3H8U A;  3LIH A;  1DQ4 A;  2BZD A;  1V6K A;  4LMF A;  4DRR A;  3LOB A;  5FZO A;  1Y7B A;  4AFA A;  4LXL A;  1OD3 A;  3RG0 A;  2HBU A;  1YQ6 A;  3T2P A;  4D7Y A;  4LHK A;  1GU3 A;  1SEF A;  2IXC A;  4MVT A;  2ZX0 A;  4XJZ A;  3VDC A;  1UMI A;  1EPZ A;  1UY0 A;  5DZE A;  3K4D A;  3U75 A;  5F37 A;  5FZM A;  5FO7 B;  3DEC A;  4PDW B;  2VPV A;  4RQP B;  5ANQ A;  3J7L A;  4N53 A;  5JR7 B;  2JG9 C;  3I3B A;  3VBF A;  4ES9 A;  4RFR B;  2XJQ A;  3BIW E;  2ARX A;  2HWD 3;  2GSY A;  4RN5 A;  2EIG A;  1PO1 3;  1OOP A;  1OT5 A;  5IJR A;  1F5J A;  3AYD A;  1LOB A;  4OMD A;  2ADD A;  1YWK A;  1L7R A;  2XJP A;  1ZRE A;  2GNT A;  1S0C A;  4XPV A;  2A71 A;  5FYV A;  1DHK B;  4Q8L A;  3IB3 A;  4N8M A;  3WZ1 A;  5K7P A;  4NIH A;  3NVC A;  3RZJ A;  3UK9 A;  3I7D A;  3VBR A;  2WO1 A;  4A41 A;  1K3I A;  1OVP A;  2YGM A;  4JRA A;  4QQL A;  3LSE A;  1BQP A;  2HLE A;  1EV1 3;  1RUG 3;  3B9I A;  3BVC A;  3KT1 A;  4FFI A;  4MXV A;  1TEI A;  1ENS A;  2VMD A;  1ZZ6 A;  5CYY A;  5A32 A;  3PVB B;  4ITC A;  4CCE A;  1CAX A;  1BJQ A;  3CL1 A;  1FYU A;  2HWE 1;  4NRO A;  4YW4 A;  5FUI A;  3ECQ A;  3S6P A;  2FCV A;  4CU8 A;  3NST A;  2WA3 A;  1JYV A;  1YQC A;  2AR6 A;  3RWK X;  1R1A 3;  3FBM A;  3RPQ A;  3EMR A;  3ES1 A;  1PVC 1;  3FFZ A;  4CTE A;  4PT6 A;  1Q8P A;  2G19 A;  5LBC A;  3T2O A;  3WF2 A;  4HPK A;  5H9R A;  3M3Q A;  4Y20 B;  1UWW A;  1UY2 A;  2P6H A;  2UWA A;  1BKZ A;  4PBO A;  3HQU A;  1HV1 A;  2WUH A;  1F31 A;  3PVN A;  5T3N A;  2YUE A;  5L73 A;  4JV4 A;  4LOR A;  5CFD B;  3POJ A;  2HWE 2;  1S0D A;  4LKE A;  3VZO A;  2VZ3 A;  2VE1 A;  3ZYJ B;  4AYU A;  4JGY A;  2BOI A;  3B9C A;  3KVB A;  3NW4 A;  2ZGR A;  1W03 A;  2XJR A;  2QDN A;  1PVC 2;  3HEI A;  1V70 A;  1FMD 3;  3B02 A;  4QXC A;  5BPX A;  1UL9 A;  3ZXE A;  5DMY A;  2D44 A;  2XJU A;  4IEZ A;  5C3S A;  3VBS A;  5GZD A;  1ASJ 1;  5BUV A;  1H9P A;  2C4X A;  2XKO A;  3RZL A;  3M3C A;  1MVE A;  3CIH A;  3LZZ A;  2X05 A;  1IS6 A;  3CU7 A;  4IES A;  4J1W A;  5HCF A;  4RHV 1;  5D8A A;  1MEC 3;  3C7G A;  2VVF A;  1CGP A;  5J98 B;  1QJU 3;  3AP7 A;  1UOB A;  1V9U 2;  2UU8 A;  2X53 S;  2ZXQ A;  3JBG 3;  4Q4X 2;  4Y22 A;  4AG4 A;  4CPB A;  4O9E A;  3BTZ A;  5A6Z A;  2JG8 B;  2D40 A;  3VUO A;  4FVV A;  4YRD A;  1X9P A;  2ZAB A;  1RJ8 A;  1ASJ 2;  1H8T A;  1W6O A;  1J3P A;  2QQN A;  2C1F A;  3POS A;  5DUV A;  5C9A A;  4E4D X;  3ZMN A;  4UW6 A;  5CIR A;  5CFC B;  5IVV A;  2BGC A;  2VC9 A;  3PJQ A;  4LBQ B;  1Z7S 1;  2BFU S;  4RHV 2;  2WNV C;  1W8W A;  3D0S A;  3ILN A;  4QU2 A;  3LWC A;  4AK3 A;  2YBS A;  1L3J A;  4MGK E;  5FJK A;  3GYD A;  5DG2 A;  5JXG A;  3PTY A;  3SCF A;  2Y0I A;  4YW5 A;  1REF A;  1BCX A;  5DAB A;  2P3I A;  2IXJ A;  4FQ4 A;  4XHX A;  1QOO A;  1V6M A;  2Z69 A;  3HT2 A;  4CCO A;  3FHQ A;  2Y6L A;  3DEM A;  3MPB A;  1H6Y A;  4AVA A;  2RS3 1;  2MHF A;  1NLQ A;  3POE A;  4DIQ A;  3SXW A;  1JN2 P;  2JDZ A;  4IV1 A;  1CZS A;  3VV1 A;  3ILF A;  4AVC A;  5F5I A;  2ZCW A;  1Z7S 2;  3RI8 A;  1XPW A;  2FDJ A;  2WS9 3;  3P5B A;  2KA3 A;  3QD6 A;  4XF0 A;  2E63 A;  1L7Q A;  2GMP A;  3BKZ A;  1K45 A;  2QNK A;  4V2W A;  1HQL A;  1NOV A;  5F3E A;  3FJS A;  3N9N A;  5JPM B;  1RUO A;  4Q0Q A;  2J42 A;  3VHR A;  3E6C C;  3DYM A;  5KHG A;  2WYF A;  4Q4V 1;  4HET A;  1XE0 A;  2RS3 2;  3AFK A;  4IGP A;  3T3Y A;  1OXC A;  2OII A;  4OHX A;  3VBH C;  1ULD A;  3FHA A;  1RUD 3;  5JOW A;  5IVY A;  1QMJ A;  3ELN A;  1NAE A;  1RUI 1;  1LGN A;  2Q30 A;  2QDR A;  3RFR A;  1V6J A;  5F2S A;  1WW6 A;  1TME 1;  2VXR A;  3PL0 A;  1BBT 1;  5IVE A;  4TSV A;  1D2S A;  4UXA A;  4CEW C;  3ZXF A;  3V0A B;  4MSV A;  5LRS A;  5JSR A;  3ZR6 A;  1AL0 G;  4OUL A;  5C3P A;  4Q4V 2;  4YW3 A;  3RVH A;  3HN1 A;  1OH3 A;  3MBW A;  5EQU A;  3ZLI A;  2CDP A;  2EIC A;  2Y60 A;  5DZG A;  3U1X A;  2YV8 A;  4QQO A;  3KWV A;  4UI9 L;  1NZC A;  3IMN A;  4Q29 A;  4CVU A;  1RUI 2;  4SBV A;  2W1W A;  1NKG A;  1ZBA 3;  4YAR A;  1TME 2;  4AVT A;  1RUH 1;  4J1X A;  1BBT 2;  5L7O C;  1VBD 3;  5FP9 A;  3ZFF A;  2JE9 A;  2D3P A;  2G9F A;  1UY1 A;  5IK8 A;  5LAT A;  4CEY C;  5IFP A;  4AAX A;  4XTP A;  4E9K A;  1NLS A;  2KR2 A;  5IAX A;  1NG0 A;  2D3S A;  3IDE A;  3KB5 A;  2EXH A;  1W2O A;  4R9C A;  3MF9 A;  2ZHK A;  1VAV A;  3JD7 1;  5FLH A;  4DRV A;  1UIJ A;  2K0G A;  4UFM A;  2FDG A;  1O4Z A;  2Q1M A;  4IEY A;  2ZX1 A;  3D8C A;  3NJX A;  3SC7 X;  5J96 B;  4WM8 C;  3OUH A;  2EXK A;  1VBA 3;  1AR9 2;  4ZON A;  1RUH 2;  2W2I A;  1XQN A;  4OYU A;  1HN1 A;  1N1Y A;  1NXD 1;  1QOT A;  3THC A;  4BM8 A;  4S2G A;  2DCZ A;  4LOS A;  3LEI A;  5J09 A;  2YY1 A;  1AR6 1;  4CCN A;  2ZGN A;  4LO8 A;  1NCQ B;  3KGL A;  4QPG B;  5FXW A;  3WG3 A;  3MO4 A;  3JD7 2;  5L19 A;  2JG9 A;  3OEA A;  2FDI A;  1TVG A;  5FWE A;  1POV 3;  3IN9 A;  3I3E A;  4WBB A;  1J1T A;  5JXJ A;  3OCP A;  4GKX A;  3GF6 A;  1NXM A;  2PHX A;  1VAL A;  1AVB A;  4LUK A;  1PIV 3;  3RWN A;  3WT3 A;  5LCW L;  2P37 A;  2W08 A;  3TEX A;  5BNQ A;  3GZA A;  5FPZ A;  3QH7 A;  1LU2 A;  2VCM A;  2YZ4 A;  3OYW A;  2WSV A;  2CNA A;  2LW8 A;  3KQ4 B;  4K40 A;  4LLF A;  4NVP A;  4HK8 A;  1CAW A;  4FPJ A;  5KC5 A;  4ZU7 A;  5FOB B;  1AR7 2;  1OMI A;  1HRI 1;  4LHN A;  3AKT A;  1COV 1;  1DGW X;  4CDW A;  4AI1 A;  2LRO A;  1AR6 2;  4LKD A;  4CXY A;  4K20 A;  3H8O A;  1H2L A;  5F2W A;  2K9Z A;  2W46 A;  3O7O A;  5F7U A;  3LDK A;  2K46 A;  4R9A A;  3RYK A;  2VOK A;  2VM9 A;  2XJS A;  2QFE A;  3FUO A;  2Y34 A;  1RVF 1;  2E26 A;  1SCR A;  1H30 A;  3BCW A;  2JD9 A;  4NHK A;  5E6H A;  4C1X A;  1W6P A;  3WIN E;  4EWD A;  5A3L A;  5CKN A;  3WDW A;  3HT1 A;  4PLO A;  5A1F A;  5I93 A;  3LDB A;  3MW3 A;  1HRI 2;  2LAL A;  3ACL A;  1UPI A;  1COV 2;  1OBN A;  1VBC 2;  3P3N A;  4CP2 A;  2VOV A;  3ZM8 A;  2WAO A;  2NQY A;  3USS A;  1V00 A;  4WVW A;  4Y1Y A;  1C1L A;  1KFX L;  2ZMK A;  4JCK A;  4OHV A;  2GAU A;  2PAK A;  3H42 B;  4QU1 A;  4XIL A;  1IS5 A;  1QH7 A;  1UKG A;  1YYN A;  2BU9 A;  4P9L A;  1VBE 1;  5IVB A;  1RVF 2;  2PAE A;  2VL4 A;  1C8M 1;  4AR2 A;  1ZX5 A;  1WMD A;  4LO7 A;  4UF0 A;  2QQW A;  1KDM A;  3LB9 A;  4AF9 A;  1XJA A;  2P17 A;  5K0U C;  2I45 A;  1OD5 A;  2W68 A;  5C6C A;  4QKF A;  1B35 B;  1GWM A;  1YQ5 A;  5DUW A;  4OQ8 A;  4DEV A;  4DOU A;  1GZW B;  3CNA A;  3DCQ A;  3FL7 A;  1CVN A;  3OBA A;  3A4U A;  4AED C;  2EF6 A;  4MV2 A;  1MQT C;  2QUO A;  2VMG A;  3AYC A;  3LF7 A;  3J8F 1;  3KCC A;  3LA3 A;  1CJP A;  4HKO A;  4Q0S A;  1US2 A;  1RUF 1;  1VBE 2;  2AGS A;  2LS6 A;  5FPV A;  1C8M 2;  4C1W A;  5F32 A;  1IQD C;  4MHR A;  4DEQ A;  1T6B X;  5J3U A;  5JPN B;  2BPA 2;  2BBV A;  1W0O A;  3K48 A;  2B4K A;  3MZH A;  3OBZ A;  4XFC A;  4MXW A;  3OGV A;  2RR1 1;  4ZPI A;  5LB6 A;  3DV8 A;  4IE7 A;  2W87 A;  3NQH A;  2CSG A;  2VOT A;  2X29 A;  3BOD A;  4Y5T A;  3NL1 A;  3HQX A;  4QDS A;  2GME A;  2ZPX A;  4YGB A;  4BDV B;  5A3M A;  1CAV A;  2WNV A;  2WZR 3;  2XDV A;  1A8M A;  2ATF A;  3J8F 2;  4BQX A;  1RUF 2;  1ENR A;  5EZW A;  1K5M C;  4AI9 A;  5C3Q A;  2JDM A;  4A7K A;  3D3A A;  1PHM A;  4H7L A;  1I3H A;  1ULF A;  3GGL A;  1KJL A;  4HLT A;  1FXZ A;  2VR4 A;  3O1P A;  3CQO A;  2RR1 2;  1HXS 3;  3K77 A;  5FLI A;  4IEW A;  3O1O A;  1XC6 A;  2K2S A;  4Y26 A;  1ZA7 A;  4B7K A;  4BME A;  2R0F A;  5J36 A;  1Q5O A;  4ASL A;  4XUP A;  1N3P A;  4NHM A;  3SIS A;  3D82 A;  3FMG A;  5LBF A;  2YFZ A;  1EUT A;  2ZZJ A;  3PJY A;  5CAD A;  1MEC 1;  4AFM A;  1ND3 C;  3KM5 A;  4K6B A;  2VQT A;  5FO9 B;  2XJV A;  3NWK A;  4K9S A;  1R09 1;  2RJ2 A;  3RNS A;  4HON A;  2P4E A;  2XWJ B;  1IHM A;  4QX2 A;  5D1I A;  3CO2 A;  4N43 C;  4ZZ5 A;  4KWJ A;  4W6X A;  5FYM A;  1I9R A;  5TSW A;  3LSD A;  3IPV B;  1W8U A;  3VBH A;  1JTZ X;  3WQ1 A;  2PHR A;  4D6R A;  1FOD 3;  3I49 A;  4AEK A;  3NV4 A;  2ZGS A;  5F5C A;  3LOI A;  3LEK A;  1C57 A;  4BXS V;  4AFD A;  4J6G A;  3SQO A;  1GWL A;  1MEC 2;  4M3C E;  3ROU A;  1SLI A;  4CEW A;  5JIA A;  1S55 A;  2RS1 1;  1G7Y A;  1R09 2;  3J7H A;  1RIR A;  3QBQ A;  3JBG 2;  4IV3 B;  4PLN A;  4XDQ A;  5FK8 A;  1PZ8 A;  3OEB A;  4QKB A;  3AC0 A;  2XGX A;  1UXX X;  4NUB A;  4RR3 C;  3NKG A;  3LIG A;  4MZU A;  4LJH A;  1QGL A;  1VIW B;  3VN4 A;  2BQP A;  2YGL A;  3KT4 A;  3N7J A;  3B69 A;  3ME2 A;  3MIH A;  4ATE A;  4CCD A;  2XVL A;  3ZSL A;  4UFL A;  2OS2 A;  3RS6 A;  1HQN A;  4HL0 A;  2DVA A;  3RI9 A;  3N4M A;  4GAZ A;  4D6Q A;  4HVR A;  1HKD A;  1AUY A;  5L7O A;  4ISR A;  1W8O A;  3V0B B;  1LEN A;  4FAH A;  5GZF A;  2RS1 2;  4NAM A;  4ISQ A;  4XFA A;  4XUR A;  3K3O A;  5A3O A;  3VZL A;  1NUK A;  4CEY A;  1QXJ A;  1H4H A;  1S4C A;  4GQ7 A;  2XON A;  2A6V A;  2GH2 A;  4JGZ B;  2CGN A;  4XFG A;  5FZI A;  2FQP A;  1TNR A;  1PNG A;  2JJ6 A;  1CR7 A;  3IWZ A;  4ZS3 A;  3WW2 A;  1ND2 C;  2YU2 A;  2C5D A;  2AYH A;  5FPB A;  3UT0 A;  4COU A;  2ENR A;  2HWE 3;  3MLK A;  5AVA A;  2D6K A;  4Q8K A;  1OUX A;  3OBR A;  4A7Y A;  4WM8 A;  4E4S A;  1HN0 A;  4FFH A;  3O1T A;  1IZ3 A;  4N90 A;  1LHU A;  1UX6 A;  1LB2 A;  1PVC 3;  3QH6 A;  4S2H A;  5C4W B;  4B4R A;  1UD1 A;  4JKL A;  3ACG A;  2GND A;  2WZP P;  3OPW A;  3I2K A;  4DQA A;  1NE6 A;  3ZN6 B;  3MPP G;  4GXL A;  4BB3 A;  4HFS A;  1UYY A;  4COY A;  2YXS A;  5AVP A;  1O4T A;  3LFI A;  4LBM A;  2CGO A;  1UZV A;  4M4P A;  4CDX B;  1QOS A;  4RS5 C;  5BNP B;  2PQS A;  3I97 A;  1BK1 A;  1VMF A;  4O61 A;  4XYX A;  4QHO A;  4QWN A;  3W59 A;  4QT6 A;  2D6M A;  2XL7 A;  4AL9 A;  1DP0 A;  2J1T A;  4M4R A;  1IG0 A;  5FZD A;  3FLR A;  2RM2 1;  4AQT A;  2VY0 A;  1FAT A;  1KRI A;  3ZIW A;  4MGQ A;  1NA1 B;  1YJL A;  4XQ4 A;  3OF1 A;  5FYH A;  2PEL A;  1XNK A;  1YHF A;  1C4R A;  1LOE A;  2J1U A;  4CDU B;  4GB3 1;  4FPE A;  4AQ6 A;  1ASJ 3;  4S2F A;  2GZW A;  1W28 A;  3AZY A;  1UKR A;  2BTV C;  1GP6 A;  2WNE A;  3HBZ A;  5A7Q A;  4YVS C;  2J7M A;  3PUI A;  3SH4 A;  3U14 A;  3U37 A;  4RHV 3;  5F5A A;  1RL3 A;  2XHK A;  1OLQ A;  1H2K A;  1RYY A;  3JZV A;  3THP A;  1DZT A;  2RM2 2;  2BV4 A;  4P02 B;  5JMO A;  2D6O X;  5T52 A;  4COW A;  4XHB A;  3I3D A;  4JQT A;  3O1S A;  2DDU A;  4KL1 A;  1BZW A;  4AHX A;  2OUH A;  3MIE A;  1UO9 A;  4PF5 A;  1X7N A;  1SPP B;  2OW4 A;  4GB3 2;  3WF3 A;  5FYB A;  5I0D A;  3P1I A;  3ZFE B;  1XNC A;  2V72 A;  3WNN A;  3AP6 A;  1I5P A;  4L92 A;  1WMF A;  3AMH A;  1SG3 A;  5E1R A;  1RHI 3;  1OF4 A;  5BXX A;  5T55 A;  3TNQ A;  5JSP A;  3KT7 A;  3M1H A;  1Z7S 3;  2ET7 A;  5LEK A;  3J4U H;  2XQX A;  4GWM A;  3WUD A;  2JDA A;  3LEG A;  2A6Z A;  5FYU A;  5JAX A;  4AGV A;  1ULP A;  2RV9 A;  2UY8 A;  3K3N A;  1N47 A;  2J1V A;  4AI2 A;  3AJY A;  1QNW A;  1BEV 3;  2W95 A;  3BU7 A;  5F6K A;  5K0U A;  5EIY B;  3WR0 A;  2RS3 3;  5ABJ C;  3WX5 A;  1O3T A;  1DYK A;  3B94 A;  3IZO A;  5IW0 A;  3R4S A;  4M3C B;  1LOA A;  2VW0 A;  2XOM A;  1RGS A;  2WFF 1;  4AED A;  4DPN A;  4OI4 A;  1MQT A;  4Q5O A;  4PDW C;  4RQP C;  1ZZ7 A;  4YG6 A;  3WQ0 A;  4WM7 C;  1X36 A;  3P3P A;  4GH4 B;  1WA4 A;  4P5Y A;  3VB9 A;  1WCU A;  2YPD A;  3E5Q A;  3MV1 1;  4YW2 A;  3VKN A;  4NPL A;  1GZ9 A;  4Q4V 3;  1CAU B;  4P00 B;  5ANN A;  4ATF A;  2VMC A;  1AYM 3;  2EAA A;  1Y3T A;  1QJY 1;  2DYC A;  2LM3 A;  4BYY A;  1V6O A;  1GIC A;  4GZ9 A;  3D5O A;  1JXN A;  5LK5 A;  3VBU B;  1VPH A;  2WFF 2;  3VKM A;  3ZFG B;  1U0A A;  1TME 3;  2R04 1;  1Y43 B;  3W5N A;  4H14 A;  3BIE A;  4KNC A;  5FK7 A;  4CDQ B;  1HJF A;  4JTN A;  4FO9 A;  4L11 A;  4IGQ A;  1SBD A;  1K5M A;  3NRU A;  4Q1P A;  2BDR A;  1OUS A;  1WME A;  3WNM A;  4CCL A;  4AGR A;  4L9B A;  3B3Q E;  4P9G A;  2W5F A;  2WC2 A;  2YBK A;  5FTT C;  4IDZ A;  2B8M A;  1QJY 2;  3AKP A;  2HYK A;  3MGU A;  2BP6 A;  5EV7 A;  4UFJ A;  3WQ7 A;  2R49 A;  1WD3 A;  2GU9 A;  3ZXK A;  4LNV A;  4Y4Y A;  1RUH 3;  1JYT A;  4QB1 A;  4OI0 A;  1YFU A;  5C3R A;  1XNT A;  4D0Q A;  1ND3 A;  3TEY A;  3MW4 A;  1W05 A;  2WIN B;  3I3Q A;  3NNG A;  3Q8F A;  2R06 1;  2TBV A;  4CUA A;  5CFD C;  2QQM A;  4KWL A;  2G9Z A;  3K46 A;  1OVS A;  2XLG A;  3BAL A;  3L2H A;  4LUL A;  4E8D A;  2WQ8 A;  1QIQ A;  3JD7 3;  2D98 A;  4N43 A;  2XLF A;  3C7O A;  2I74 A;  4BJ0 A;  5FZO B;  1ZBE 1;  3WDX A;  3Q8B A;  4RYD A;  3G6J B;  4LK6 A;  5IVC A;  3CKH A;  4TTG A;  5D21 A;  4FP3 A;  2ID4 A;  1H4G A;  4OI2 A;  4DMI A;  5GZE A;  2VQU A;  3BYW A;  4CUB A;  5JXH A;  4ASM B;  3T4V A;  4N53 B;  2BWA A;  3L9J T;  1AR6 3;  4FOQ A;  1CZV A;  1AR8 3;  5FZ4 A;  5IVJ A;  3ETQ A;  1IPK A;  1Y9M A;  4NN0 A;  1AX2 A;  4CXX A;  5LZ6 A;  1F4H A;  5H9P A;  1ULE A;  5A33 A;  3PUR A;  3ZMO A;  4AI0 A;  1D4V B;  1ZBE 2;  1A34 A;  2GDF A;  3ZO0 B;  1E5R A;  2SBA A;  1GOG A;  1SAC A;  3LPF A;  4FOW A;  1FNZ A;  4QKN A;  3D6E A;  4FQZ A;  1SQ4 A;  2HWF 1;  3VBR B;  4ES8 A;  1TZO A;  1UY3 A;  2QVS B;  1PGS A;  4GAL A;  5JLV A;  1RUE 1;  1O8S A;  4NPR A;  5FZB A;  5A32 B;  1COV 3;  4FXG B;  3GBG A;  1AX0 A;  3ON7 A;  4IER A;  3ZN5 A;  2DCJ A;  1W99 A;  2PN5 A;  2ZHL A;  1DU3 D;  1MR5 A;  2WFP A;  4CCJ A;  3RYR A;  3KVA A;  4I0B A;  5AFE A;  1ND2 A;  1UZW A;  4PIY A;  4BOW A;  1TMF 1;  5IHR A;  3SKV A;  2HJI A;  3LA7 A;  3H9A A;  1X82 A;  4MET A;  1OH4 A;  4AFB A;  4AE2 A;  2ZAH A;  1S2E A;  3N36 A;  1RVF 3;  2ZEZ A;  3HNM A;  3HR9 A;  4IEU A;  4M01 A;  4NO4 A;  4HPK B;  3ZSM A;  2QQK A;  1H1I A;  4QDR A;  4RFT 0;  2HWF 2;  1QXP A;  3IM0 A;  2GNM A;  2D6L X;  1RUE 2;  1UNB A;  4L2N A;  2YYO A;  4B8E A;  2B42 B;  4OUE A;  4BMB A;  3W58 A;  1WW4 A;  2X8K A;  4MLO A;  1YEW A;  3SMH A;  1PGL 1;  1X33 A;  1CPM A;  3RZK A;  2WYS A;  4P9X A;  4RGK A;  3E1F 1;  4KU8 A;  4RS5 A;  4JGY B;  4NII A;  1TMF 2;  3ZXA C;  2JB8 A;  3PU8 A;  3WV6 A;  1W9S A;  1FOD 2;  1XRU A;  2WN3 A;  3DF0 A;  1R64 A;  1VBE 3;  1UIK A;  3MFC A;  4J25 A;  4QHZ A;  1C8M 3;  4U36 A;  3VBO C;  4I2O A;  3ZN4 A;  4CCK A;  3NNL A;  2OT7 A;  1Y9Q A;  2ADE A;  5FYZ A;  2QQO A;  5KBF A;  2LUW A;  2Q0A A;  2ZZQ A;  4W4Z A;  3ZDV A;  4D3W A;  5FMO L;  2PLV 1;  2NYY A;  1YLL A;  5EJ3 A;  4EN0 A;  2XKP A;  2J1E A;  4MX3 A;  4QX0 A;  3WF1 A;  2HEV F;  4FTB A;  3OSD A;  4O65 A;  1PGL 2;  2P3K A;  2VUA A;  1PX3 A;  4FAG A;  1YJK A;  1YFW A;  3ZXJ A;  4U2A A;  3MUZ 1;  5FOJ B;  4Y22 B;  1PNF A;  2BNN A;  3E97 A;  3J8F 3;  1RUF 3;  2E9Q A;  1JOB A;  1UOF A;  3CF6 E;  1ZZB A;  1H2N A;  1HB2 A;  2JWP A;  2J22 A;  2ZEY A;  2ARC A;  3M70 A;  4ERO A;  5FAX A;  4UBG A;  3RSJ A;  1GFF 2;  1H8T B;  1OLR A;  1W6O B;  2P34 A;  1P8J A;  2WT1 A;  4P9Y A;  2RR1 3;  3T4H B;  3VDA A;  5C9A B;  2J1S A;  5FFO C;  5KWR A;  2PLV 2;  3CJI C;  2VJX A;  4W50 A;  1YNA A;  5LAS A;  4COZ A;  3CZU A;  3ZDS A;  5KHK A;  1G9B A;  2QKD A;  4TLF A;  2XWB B;  4XUO A;  4F8A A;  2O8Q A;  3AK0 A;  4XAA A;  3WNK A;  2RDS A;  1W3X A;  2IXK A;  5A7O A;  1X9T A;  5A7S A;  3VDD A;  3VDB A;  3I54 A;  3WHT A;  3BOW A;  5F6L B;  1EUU A;  1JI6 A;  5IK4 A;  2VCA A;  2XLA A;  2YC4 A;  4Z2W A;  1W3V A;  2VW2 A;  3K75 B;  4XFI A;  4EZH A;  2R6Q A;  5DUX A;  4LO5 B;  3O1M A;  4FPL A;  3N7L A;  4IV1 B;  4D94 A;  2BRT A;  1VMJ A;  4XBQ A;  5EYX A;  2Z79 A;  2VMH A;  2H6C A;  4YG3 A;  5ABJ A;  1G8W A;  2E33 A;  4LBK A;  5FXX A;  1YI7 A;  1WGP A;  2XHN A;  5JWP A;  4OHW A;  1A6C A;  2BVV A;  2NMO A;  3ASI A;  3SEE A;  4TLG A;  4UW3 A;  2Z42 A;  1HIX A;  2ZMN A;  3VZJ A;  2C0Z A;  5B4N A;  1GSL A;  4QPG C;  4Z07 A;  5F1R A;  1M06 G;  1ZRI A;  1SBE A;  2BNO A;  4P14 A;  5FIX A;  1TQ5 A;  2DUP A;  3G7D A;  1R09 3;  5FP3 A;  4WM7 A;  2XPJ A;  1LHV A;  1V6I A;  1LGB A;  1ACC A;  3MIF A;  1UMZ A;  1WBF A;  1S2B A;  2VTF A;  1ZRF A;  2B39 A;  2BBA A;  5F8P A;  2RHP A;  4B4Q A;  3AP5 A;  3MW2 A;  1WLC A;  1A3K A;  5FUP A;  1JZ4 A;  5KHJ A;  2HH9 A;  1J83 A;  5FZE A;  4QPI A;  1IPS A;  1ODM A;  1RHI 1;  3AKR A;  3JU9 A;  4YSF A;  1CQ9 A;  1OLM E;  4XJA A;  1LNS A;  2OKX A;  5BYN A;  5FJH A;  3GNE A;  2VNR A;  3R4U A;  2RS1 3;  3O0W A;  3JXS A;  2EA7 A;  1UQX A;  3WNO A;  3QAC A;  1AJO A;  5IAV A;  1BEV 1;  3GBF A;  3OG2 A;  2OVU A;  5CAZ A;  1JUI A;  4QX8 A;  1LED A;  3C7F A;  3OD4 A;  4GMP 0;  2W3J A;  2WR9 A;  4KI5 M;  5FQ0 B;  1JZ6 A;  1KJR A;  1PMI A;  4YVW C;  1QKQ A;  3FZ3 A;  2Z4F A;  1C28 A;  3FFQ A;  3USU A;  1SZB A;  1QNY A;  3UNP A;  2XB6 C;  1QH6 A;  1AXZ A;  3E5U A;  1RHI 2;  2JIC A;  2LRP A;  2IWG B;  4HKL A;  3JB4 C;  1GP4 A;  1WWY A;  4I0A A;  1ALY A;  1XYO A;  4DZG A;  3DXU A;  4I02 A;  3D0J A;  3WNP A;  4DXS A;  3NJV A;  3ORJ A;  2ZS6 B;  1JZ7 A;  4W6Y A;  5A70 A;  1XU1 A;  1NE4 A;  4X8P A;  4N7I A;  5HBA A;  4IL7 A;  5CFD A;  4CA9 A;  4QB6 A;  3VHO A;  5BNO A;  4A6S A;  1BEV 2;  1LU1 A;  2ZA9 A;  1G9D A;  1AYM 1;  4CUC A;  2WDB A;  4YPJ A;  3AXD A;  1WW5 A;  4Z82 A;  3HN3 A;  5F39 A;  4YZ4 A;  1B35 C;  4UW5 A;  5T54 A;  4E2S A;  2JDH A;  3WD5 A;  3JB8 A;  1VAM A;  1GNZ A;  2VMF A;  2WAB A;  3LAG A;  5A3T A;  2P6C A;  4LIU A;  2W1Q A;  2ZHN A;  3S7E A;  1AL2 1;  2ZKL A;  1ZM1 A;  1RED A;  1HW5 A;  2QZ2 A;  3O0X A;  3BUC A;  2AAC A;  4ARY A;  2C9K A;  2JG9 B;  1U5Z A;  2ET1 A;  2VO5 A;  1EYB A;  1DLC A;  1GKB A;  3OBT A;  2QQL A;  4URT A;  4CP9 A;  2IFW A;  3IDC B;  4G9S B;  4OUS A;  1DGW A;  2AH2 A;  1AYM 2;  1GV9 A;  3BB6 A;  5FYT A;  3VHP A;  4XE9 A;  4OHZ A;  5KXD A;  3WSO A;  3OYW B;  4LLO A;  3V56 A;  5C5U A;  3DUI A;  2RM2 3;  3AX4 A;  2VME A;  4KQ7 A;  2NZ9 A;  1AL2 2;  4BQY A;  2ES3 A;  1BVP 1;  4CDW B;  4F83 A;  2ARB A;  1KXG A;  3AZZ A;  4LKF A;  1E5I A;  4GB3 3;  2YG0 A;  4P5H A;  4Y5S A;  4OFG A;  5H9S A;  4BXF A;  2DBI A;  5FY5 A;  4DXZ A;  3TWI A;  1NQJ A;  4L97 A;  4BHP A;  4IET A;  4D7T A;  2BFU L;  3SKJ E;  3THD A;  4FTS A;  4XJ9 A;  2R16 A;  3IDB B;  3BN6 A;  2VUC A;  3GZU C;  2YHJ A;  4BIF A;  1G9F A;  1W6P B;  3B93 A;  1TG7 A;  3Q8C A;  2Z2S B;  1NT0 A;  3F95 A;  5J1X A;  2GN7 A;  5HI0 A;  1W6M A;  1W8Z A;  3ZIX A;  4DS0 A;  1BMV 1;  4SLI A;  3LPG A;  4K7J A;  2JEC A;  2VZ1 A;  5H9Q A;  2Q5T A;  2VUL A;  4ONU A;  3I2F A;  4A42 A;  1W8F A;  3OB8 A;  2ZGL A;  2QE3 A;  1AR8 1;  3CJX A;  2IXH A;  1WCD J;  2ZEX A;  3AM2 A;  5DG1 A;  4LEJ A;  4BWO A;  2CAU A;  2WT2 A;  5DAX A;  5DAW A;  3HWJ A;  4I30 A;  1RUN A;  4UF0 B;  3BPZ A;  1NCR C;  3TRS B;  2ZTN A;  4HZF A;  1YCI A;  2VVE A;  5LA9 A;  3VBO A;  1B09 A;  2QQV A;  3I8T A;  1H8V A;  1D0G A;  2YB7 A;  1BMV 2;  3LE0 A;  3OGS A;  2IXI A;  4XJW A;  2JDN A;  4YYO A;  5DDJ 1;  5FCC A;  4MGT A;  4CRQ A;  1GZT A;  3AL6 A;  1UZZ A;  5LWB A;  3I2H A;  4BLJ A;  2VUD A;  1RC6 A;  4EZ4 A;  1OFS A;  1AR8 2;  5C8W A;  5C71 A;  4UW4 A;  3KD4 A;  2ZGQ A;  4IV3 C;  2WFF 3;  2F6B A;  3V0A A;  1ZVF A;  4XDO A;  4YM3 A;  3AJZ A;  1ZZ9 A;  4HVO A;  5A80 A;  2ORX A;  1N1T A;  3AP4 A;  2BOJ A;  4MXW B;  4H3W A;  4BK5 A;  1AZD A;  1M4W A;  1KDK A;  2AZ5 A;  1QJY 3;  3CJI A;  4NRP A;  3C7H A;  3P6B A;  1CAV B;  1OC1 A;  4K8R B;  5A6X A;  1ST8 A;  2WNV B;  2WSU A;  4AOC A;  2OUJ A;  4YM2 A;  1VB4 A;  3POB A;  3DPR B;  2W0X A;  4W8J A;  1QHD A;  5ERL A;  3WDV A;  2R04 3;  5LBE A;  1Q8O A;  2D93 A;  1DYP A;  2CHH A;  4NWW A;  5AC9 1;  4ZU4 A;  1LOF C;  1AHS A;  3C8X A;  4EN7 B;  4UWD A;  4E4Z A;  3RJR A;  2PHT A;  5I91 A;  2B9V A;  3ZYH A;  4EE2 A; 
#chains in the Genus database with same CATH homology
 5FPL A;  3AVS A;  3PU3 A;  4AAP A;  4QWN A;  3PDQ A;  4XDP A;  5FZD A;  3LD8 A;  2YU1 A;  5A3N A;  2GP5 A;  2XUE A;  2VD7 A;  2XDV A;  4IGO A;  4BIS A;  5FYH A;  5FYT A;  3N9Q A;  4AI9 A;  3PUS A;  2W2I A;  3N9L A;  5FPA A;  3NJY A;  5F3I A;  5A7P A;  2Q8D A;  4E4H A;  3PUQ A;  3AL5 A;  5A1L A;  5FZO B;  5FY0 A;  4Y4R A;  4EYU A;  5A7O A;  5A7S A;  5F3G A;  5FZC A;  5A7Q A;  5A7W A;  4CCM A;  4CCN A;  5FXW A;  5IVC A;  5FP8 A;  5F5A A;  4DO0 A;  2OQ6 A;  5K4L A;  2XML A;  4EZH A;  5FWE A;  5IVF A;  4BXF A;  3AVR A;  3OPT A;  5FY5 A;  4GD4 A;  4TN7 A;  5A7W B;  3KV9 A;  2Q8C A;  2Q8E A;  3U4S A;  5IVV A;  3K2O A;  5FP4 A;  5FZ6 A;  5FZ4 A;  2OX0 A;  5F3C A;  5FV3 A;  5FXX A;  4BU2 A;  5FPU A;  5IVJ A;  2YBS A;  5FY1 A;  4ASK A;  4CUG A;  5FJK A;  3PUR A;  4HON A;  5CEH A;  5FZO A;  5FYB A;  4URA A;  4LXL A;  5FYM A;  2GP3 A;  4LIV A;  4V2V A;  3KV6 A;  4CCO A;  4D6R A;  5FP3 A;  5FZK A;  5F2W A;  5F37 A;  4DIQ A;  5FZM A;  5FZH A;  4C8D A;  5F5C A;  5FYU A;  5ANQ A;  3N9M A;  5FZB A;  5A3P A;  3K3N A;  3PUA A;  5FUP A;  5F5I A;  5E6H A;  5FZ7 A;  4CCJ A;  4UF0 B;  5ISL A;  5FZE A;  3KVA A;  5A1F A;  5IW0 A;  4NUB A;  4CSW A;  2WWU A;  1VRB A;  3LDB A;  4V2W A;  5FYV A;  5F3E A;  3N9N A;  3U78 A;  5KR7 A;  5FJH A;  3DXT A;  4D6S A;  3AL6 A;  4IGP A;  5LY1 A;  5LWB A;  5FZ3 A;  5FZ1 A;  5FZ9 A;  4QU1 A;  2OS2 A;  2YBP A;  4EZ4 A;  3N9O A;  5FUN A;  5IVY A;  4GAZ A;  2YPD A;  4QX8 A;  5FZ0 A;  4LIT A;  5FZG A;  5IVB A;  5F2S A;  5FYS A;  5FZ8 A;  4XDO A;  4UF0 A;  5FXV A;  5IVE A;  3K3O A;  3KV4 A;  4GJY A;  2P5B A;  5FZI A;  5A80 A;  4D6Q A;  5IWF A;  4QXH A;  4Y3O A;  3PU8 A;  5FYY A;  5LW9 A;  2YU2 A;  5FYI A;  3DXU A;  5FPB A;  5LY2 A;  5FZL A;  5FYC A;  3UYJ A;  3RVH A;  5FZF A;  5FY7 A;  4CCK A;  3ZLI A;  5FWJ A;  2OT7 A;  5FYZ A;  2PXJ A;  5FY8 A;  4IGQ A;  5A3W A;  2XXZ A;  4HOO A;  3ZPO A;  4CCL A;  5FZA A;  2WWJ A;  5FPV A;  5FY4 A;  5FY9 A;  3KV5 A;  4GJZ A;  2OQ7 A;  3OPW A;  5F32 A;  5F39 A;  5FP7 A;  4QX7 A;  4QXB A;  2YBK A;  5FP9 A;  5A7N A;  4Y33 A;  5A3T A;  3KVB A;  3PTR B;  4LIU A;  3N9P A;  5FBJ A;  5FXZ A;  4QXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...