5IVYA

Linked kdm5a jmj domain bound to the inhibitor n16 [3-(2-(4-chlorophenyl)acetamido)isonicotinic acid]
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
317
structure length
300
Chain Sequence
b'EFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEVKSFRFTPRVQRLNELEAMTQAVREYTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGSGFPVKDGRRKILPEEEEYALSGWNLNNMPVLEQSVLAHINKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIMNPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 5A
publication title Structural Basis for KDM5A Histone Lysine Demethylase Inhibition by Diverse Compounds.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 91
structure length 300
sequence length 317
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5ivyA00
5FZ3A 5FY8A 3U78A 1VRBA 3K2OA 3PTRB 5E6HA 2XDVA 5IWFA 3ZPOA 2OQ7A 3NJYA 4XDOA 5FZDA 2XUEA 5FXXA 3KV5A 4HOOA 3N9QA 5KR7A 5IVJA 5IVVA 4CCLA 2YU1A 5F2SA 5A3WA 4D6RA 4URAA 4Y4RA 5FZLA 4QX7A 2YBSA 5FYBA 4EZHA 2Q8EA 3PU8A 2WWJA 4Y33A 4IGPA 5FP9A 5FY5A 4CCNA 5FZKA 5FPVA 4CSWA 2YBKA 5FZFA 5IVEA 3ZLIA 5A7PA 3N9PA 3AL6A 4IGOA 5FZ4A 5FY9A 5FZ1A 3N9LA 5FWEA 3PUAA 5A3PA 5FZAA 2YPDA 4EYUA 2XMLA 5FZOB 4AAPA 5FZ9A 5F37A 5FWJA 3PUSA 3KV6A 5A7QA 4AI9A 4GAZA 5F2WA 5LW9A 4CCKA 2YU2A 3PU3A 4GJYA 5FYMA 3KVBA 4V2VA 5FUNA 5FPUA 5F39A 2OS2A 5A3NA 5FXWA 5F3EA 2PXJA 4Y3OA 5A1FA 5FZBA 3AVSA 5A1LA 4LITA 3DXTA 2OQ6A 3OPTA 5F32A 5FYZA 3RVHA 5ISLA 4LXLA 5FYIA 5FZMA 5LWBA 4UF0A 5FJHA 3N9NA 3PUQA 2Q8DA 2GP3A 3K3OA 4LIVA 5A80A 4QU1A 5FZ0A 2GP5A 4BISA 5FPLA 4E4HA 5LY2A 2OT7A 4HONA 3LD8A 4XDPA 5FYTA 5FXVA 4EZ4A 5A7SA 2YBPA 4TN7A 5FJKA 4QXCA 3KV9A 3KVAA 5F5CA 3AL5A 3PDQA 5FZCA 3PURA 5A7WB 4CCJA 4BXFA 5IVFA 4D6QA 5FPBA 5FZ7A 5IVCA 5FY7A 5FYUA 5FY1A 4V2WA 3DXUA 5FP3A 5FP8A 4GD4A 5FZHA 4DO0A 4CUGA 3K3NA 5IW0A 4LIUA 5CEHA 4QX8A 5IVYA 4NUBA 5FBJA 5FXZA 5F5AA 2Q8CA 5FYSA 5FYYA 3UYJA 4DIQA 4IGQA 3OPWA 4CCMA 2XXZA 2VD7A 3N9OA 5FZ6A 5FYHA 5FYVA 5FPAA 4BU2A 5FZIA 5FZ8A 5LY1A 3KV4A 4ASKA 5F5IA 5ANQA 5FZOA 5F3CA 5A7NA 3AVRA 5K4LA 5A7OA 2OX0A 5FZEA 5FP7A 4QXBA 3N9MA 4UF0B 5FUPA 3LDBA 5A7WA 5IVBA 3U4SA 4CCOA 4C8DA 4D6SA 5FZGA 2W2IA 5FY4A 2P5BA 5FP4A 4QWNA 5FYCA 2WWUA 5A3TA 5F3GA 4QXHA 4GJZA 5FV3A 5FY0A 5F3IA
chains in the Genus database with same CATH superfamily
3NAPA 4Z2AA 5BNNA 3J7NA 4XUNA 1OC1A 1LOAA 1ZRFA 2BYVE 1LGNA 1HRV3 1AR82 3CHXA 1NKGA 3H8RA 4IV1A 4KGQA 3BB6A 4FPYA 5JI7A 2B42B 4B29A 1BXHA 1V9U3 1HDKA 5FDBA 5FP9A 3WW2A 4ZHNA 1XXNA 3H42B 4UXAA 4HK9A 3I2GA 5BY5A 1RUNA 2XH6A 2QFEA 1ZA4A 4C1WA 2J1TA 1ZBA3 2WZR1 4CE8A 1MQTB 4K1YA 2IXCA 4UI9L 3VDDA 4CP1A 4Q27A 4DNYA 2WZPP 1XNAA 4JGZC 2R042 1ZZ8A 1RUE1 4META 4Q1PA 3LKJA 5A7QA 4QGLA 3C7FA 4QB1A 1IGOA 1I5PA 2VVFA 3ZYJB 4D0QA 3OBAA 2YG0A 2NP0A 4G4FA 1UO9A 2ZGPA 5KHKA 4MADA 1FPN1 5HV4A 3JCIA 4IEWA 2AUYA 4XHXA 1OVSA 1WKYA 2X53S 3IN9A 4FTBA 4UFKA 4IE5A 4ORFA 4MXWB 2NM1A 3A4UA 2NLRA 1QJX2 3KB5A 1NLSA 4LMFA 2BOIA 1DGLA 1VRH2 4DXZA 2GMMA 2Q8DA 2J1AA 4FOQA 4AXOA 4YVSB 3CJIA 5EJ3A 5FZ0A 3MW2A 3NNFA 3VBHA 1WMDA 2RR13 2VNRA 4Q4V3 2R073 4IEQA 3VD7A 1LNSA 2DBIA 2OUHA 2Y0IA 3KV9A 1XNTA 3RS6A 4Y5Z0 1CAUA 3B00A 3BALA 2B8MA 3B01A 1XSRA 2WRAA 2D6NA 4CCJA 3LFIA 1SHWB 4HVRA 1M4WA 1PZ9A 1I3HA 1RJ8A 5FPBA 2D93A 4AVCA 2JG9B 5A6XA 3E5XA 3LDKA 1WMFA 1O91A 3N35A 3O1OA 2GNTA 4LIUA 3WG1A 4ATFA 2XJUA 1W0PA 2JKXA 3MI8A 5FLHA 1W3XA 1W2UA 4H3WA 2ZGQA 3U37A 1GQPA 4C91A 2JG8C 4GH4B 2IXHA 4MXWA 1GZCA 3H3LA 2W95A 2AR6A 3PMSA 2P6HA 2JDUA 2WZR3 5FZ6A 5CZKA 1N47A 2VH9A 3POIA 1BYHA 1W8NA 5LATA 4FQZA 1CQ9A 4GKYA 3WG3A 3U75A 3WF1A 1MZ6A 2K2SA 5ANQA 1GMMA 3VL9A 4M4RA 1RUE3 1UF2C 1N3QA 1ZZCA 1KEXA 2WO3A 3KHBA 3LQCA 2XB6C 3NAPC 2AEZA 5J96B 5IAXA 5FUPA 3HQXA 1CONA 1UU4A 5SV8A 2QE3A 5C9AB 2G9GA 4BIOA 4EN7B 3KLSA 3OF1A 5CKNA 2JG9A 1RUH2 1FPN3 5DMYA 1C8M1 1PGL2 3O1RA 5JLVA 1HW5A 4IV1C 1RVF2 3I4IA 4TLFA 4BLJA 4HLTA 4IQPA 4XF0A 4Y1UA 4YZ4A 5EPAA 5JSOA 1YRZA 1C3HA 4OI0A 3IT8A 2EICA 1PZ7A 1MS3A 1W8TA 3CF6E 4NROA 3I49A 4GH4A 2P2KA 2UWBA 3FL7A 5T54A 4DO0A 1H8TB 3THPA 2O14A 4QX5A 3KV5A 2ZMKA 3DUIA 3M3IA 2WFPA 1PO22 1W28A 4N43B 1SBEA 3VDDC 3JD72 3LFMA 5HCBA 3TNPB 4UW6A 4DOUA 4QX3A 3H1WA 1AHSA 4F8AA 3EQEA 3O5SA 2DCZA 5CIRA 4CP0A 1LHWA 4RS5B 3GM8A 4YZ1A 1YUDA 1MZFA 1PM4A 1FI2A 1D2SA 2D6OX 4QPIB 4LA2A 3VZNA 2R062 4UW3A 5FTTC 1JUHA 1C5HA 4Q1RA 4YGBA 5LRRA 3ZN6B 4GB32 3VZOA 1ULCA 2Y6KA 4FOYA 1OMIA 1A8MA 4MXVA 2Q0AA 3IIIA 1GZ9A 1GWLA 1JZ3A 1JTZX 1QDCA 5LW9A 2Q1ZB 4OI2A 4QXKA 3WX5A 2DBNA 5FUNA 2BV4A 3GNEA 2UU8A 2VUJA 1DGWX 3CJIC 3ZSLA 2O0OA 3VBHC 4HN0A 1Q43A 2FDIA 1K5MB 1UOJA 5C3RA 4ASMB 5E8AA 5FZBA 4N43A 1X50A 3SH3A 3I7DA 4FTEA 1OUXA 2PQQA 4MSVA 4FOVA 2W08A 2KR2A 2YFZA 5A3LA 3ZFGC 2A6ZA 4IETA 3JQXA 3N9NA 3O0WA 3PVOA 4OYUA 4S2HA 4RS5A 1C8M3 1RJ7A 2F6BA 1XYOA 2P6CA 2W0XA 2Y6LA 4P9LA 4QPIA 3UGHA 3WNXA 1JYNA 1SQ4A 1YQ6A 2OT7A 1UY4A 3OJBA 3VKMA 3UK9A 3ZR5A 5BUVA 3ZKUA 2ZGMA 2VZ3A 2E31A 1IG0A 4K1ZA 3OBRA 2ILMA 4JV4A 3BI3A 4FPOB 1EY2A 3PURA 4M0HA 2FDGA 4AVAA 1RUJ2 4YW5A 3PL0A 2H6CA 2DTWA 2BGOA 2Y33A 2VUAA 5FMOS 3DXUA 3ZSMA 4Y20B 1GWKA 3DPRC 5FP8A 2QUOA 4QX8A 1W2AX 5FREA 3BUCA 3VBUB 1K5MA 1EV11 2D5HA 1BVVA 1QIQA 4P9WA 3HOBA 3IPVB 1BKZA 2W1QA 1X36A 3L9JT 4KMQA 1ZX5A 1O5UA 2DVBA 5HPOA 1W8UA 2JG9C 1LOGA 1AX1A 1VBD1 4WZCA 3A7QA 2OYZA 2IVJA 3AJZA 4Q4W2 5CVRA 2ES3A 5EJZB 5J48A 5DDJ2 2VNVA 4B4QA 1UMIA 1LECA 2HWD2 3PIJA 4I2OA 5FP4A 4PDWB 4Y20A 3F2ZA 1JZ6A 3RZKA 2WQ4A 2PAKA 2P1BA 2VBBA 4P9YA 3TB0A 3TN92 3VBUA 4GJZA 1QJEA 1VB2A 1FV3A 4HVOA 2R0FA 4LEJA 4CDUB 3RZGA 4NMIA 4AQ6A 2BVVA 1Q8OA 1W04A 3GBWA 5C3OA 3FLPA 4PI2A 3POSA 4CPBA 1AXZA 4AVSA 3RWKX 4Q29A 5DUVA 2A75A 2X10A 3K51A 4XAEA 2WT1A 2X8KA 2PHRA 4YW6A 3I54A 3VHNA 5EWSA 4CYDA 4BIFA 1U12A 5JXJA 2WDBA 5DUUA 5I8TA 1JXNA 3AZZA 4LHNA 2CGPA 2VVEA 5DN2A 4XIKA 4YFWA 5GLUA 2DURA 1HQWA 3QH7A 4FXGB 4H14A 3ZIXA 3V65A 1HQLA 2PLV1 3EJKA 5FPZA 5A7PA 1S2EA 2ZPXA 4QKNA 3P1IA 4LORA 1IQDC 2OW4A 4CU6A 4UT5A 3MZHA 1ZRCA 4BE3A 2JX9A 2YROA 1BHGA 1EV13 4PDWA 5I8SA 4YARA 2ZGSA 1AL0G 4N43C 4RHV1 4AAPA 3VDCA 4AFBA 5F2WA 3ACHA 3O7OA 4AAXA 1IS5A 5K0UB 2SBAA 2XJTA 3OEAA 3Q8FA 4ZZ5A 2FDKA 1DQ2A 2V09A 3BOWA 2EF6A 2G19A 4RS5C 1VBD3 4CDWB 2R1DA 5A3NA 4QPIC 3ATGA 2ERFA 4EWAA 4YM3A 2DYCA 3AP6A 2BU9A 5FOBB 1LHVA 2WYFA 4LHLA 2HYXA 1Y9QA 2QQMA 3KCXA 5EHDA 4Q8KA 1O3TA 4O9EA 5CB7A 5IK7A 2UY9A 1H9PA 2YC4A 1KGYA 1GZTA 1X7NA 3LAGA 4LE4A 2I45A 4IXLA 1NXD1 4Q8LA 2ENRA 2GP5A 4LBJA 3VLBB 1OPOA 1IKPA 1GNZA 2YC0A 4EZ4A 4K6BA 1K5MC 3BODA 1F5FA 2XQRA 3MIDA 2ZHKA 2DCYA 4XETA 4INDA 1HJGA 1R091 2QQNA 2KM2A 1OA2A 2CDOA 3WUCA 1TME1 3ZFEB 4C1XA 4D6QA 2W92A 2IUWA 5IK4A 1X8EA 1ZBE1 5K0UA 2XJPA 1FOD2 4M3CF 3PVEA 3NNJA 3VKNA 2BGCA 4Q4Y2 2QQWA 4CDWA 2W5FA 4NUBA 3E6DA 3UKNA 1GBGA 1TQ5A 3RRDA 3IKWA 4BQ2A 5T5LA 4CP9B 1IPJA 1PMIA 2PLV3 1JOJA 3TYJA 1VLNA 3QBQA 1VALA 4QDRA 2IXIA 4IEZA 5KHJA 1NE6A 3KD4A 2BNNA 4L2NA 1SLLA 4B3NA 4LT5A 1UIJA 5FPAA 3ZXLA 3VBRB 3MW3A 1XQNA 2VTXA 3PNAA 1UY0A 4NWVA 4RHV3 4XTMA 1HRV2 2PHUA 3H7JA 2W9XA 5J98B 4K7JA 3T2QA 1FYUA 2RV9A 3POBA 3O14A 2R32A 5FMBA 2XBO1 4QXBA 1W0OA 1MVQA 2FZ1A 1V9U2 3ZFEA 1OLRA 1JYTA 1S2BA 3I97A 1KXGA 3CIHA 5FY4A 2VULA 1YFXA 1FATA 1KD7A 2VOVA 3VKFC 1G9FA 1JYIA 1H2LA 2XL7A 3UGFA 4QXHA 2RE9A 2FHRA 1AXYA 1OPMA 3LOIA 3M3OA 2WNVA 3FHAA 1H1AA 1H2NA 3PVBB 3J7HA 5EP9A 5FK7A 4CP9A 4XYXA 4OQ8A 3I59B 4PIYA 1CJPA 1QJU1 3T0AA 2FCVA 3IMMA 2O1QA 2PMWB 5IVJA 2GU9A 5I91A 1XU1A 3RZHA 3VBRA 1VMFA 4PDWC 2TNFA 2YBSA 4FI9A 2Q8EA 4C90A 1R093 1UX6A 2WWJA 3ELNA 4YG3A 3SNMA 1TME3 3ILNA 4CSWA 3OEBA 4COVA 1ZBE3 3JXSA 5D2AA 3IAPA 2YGMA 1JODA 2WINB 4Q0QA 3SEEA 4EYUA 3ZXEA 3DKQA 1GU3A 1US3A 2J1EA 2SLIA 4YWAA 2VBPA 4AI9A 4CVUA 2BRTA 2R072 3N7LA 2Y6FA 4LO6B 3I59A 1ULFA 5JVVA 1LCLA 3KM5A 5FFOC 5I0RA 2PXJA 4D7SA 3OGSA 5A1FA 3N7MA 1FX5A 4XUTA 3ZPYA 2XVLA 4FP2A 1BK0A 4LITA 3WDWA 1PX3A 5FYZA 4ES9A 5BNOB 2XBO3 1LENA 3T2OA 5LZ6A 1UOBA 2WA3A 5K0UC 3L2YA 4XIOA 5A80A 2ZAHA 3PLQA 1JYWA 1JU4A 3OG2A 4JQRA 4CA9A 3CLPA 4CDWC 2W1UA 3LD8A 3NJXA 5FYTA 3SCHA 1A78A 1H8VA 5LBEA 2BTVC 2ET1A 3KMHA 3CNAA 4AGGA 1H1IA 2WQ8A 4MZUA 4Z1VA 3WG4A 3SQOA 5FZCA 1RUE2 1QJU3 1QGLA 4MOAA 5AFEA 2WS91 2PYTA 3RGBA 2B7YA 1JZ2A 3PTYA 2WYSA 2VCMA 2AACA 4RL7A 3J4UH 3UV9A 4C0HA 4AHYA 1Z7S1 2BFUS 1FPN2 1W2TA 2WKKA 3OGGA 2ZGUA 5DABA 2RS51 5BNOA 1JUIA 4NOTA 1G86A 5ACA1 5DQ0A 3NO8A 3VB9A 1ZM1A 4HBNA 3ZFEC 4XTPA 5ABJB 5G05L 2GSYA 3LGRA 4MO3M 3FWEA 4XBLA 1MS5A 4V1PA 1ND2C 1UKRA 4JDNA 3THCA 3TWIA 3USUB 4AEDB 3J26N 3K4ZA 5A7OA 4JGYB 1PGSA 2JE9A 2WNVC 2IC1A 4KGGA 4Y1YA 4Y24A 1UCXA 1KITA 1WBLA 5A33B 4Q0SA 4FQ4A 4UF0B 1ZRIA 4P02B 3DF0A 2JD9A 1ACCA 4IE4A 3S7IA 3ZO0B 1S2KA 3U4XA 1J83A 4FTSA 4M3CE 3WDVA 3QCWA 3OY8A 1X33A 2PAMA 2IVIB 2VQ0A 1XPWA 4GZ9A 4LPLA 4COZA 3VBRC 5A3TA 1CPMA 2VZUA 4M00A 3TNQA 4JDMA 1MEC2 1RYYA 3SEPA 4DXTA 4E8DA 1YIPA 4ZZ8A 2P34A 3DV8A 4XAAA 1X82A 2AGSA 3AP7A 1W2NA 1TG7A 5CFCB 4GQ7A 5JOXA 4N7IA 1JZ5A 3I2OA 2GAUA 3B69A 3QH6A 5JUVA 4XZPA 1YQ5A 2ARBA 3PUHA 1TEIA 5DPNA 3USUA 4AEDA 1UYZA 4LBKA 4JGYA 5DAXA 5FPVA 1UZZA 4BCUA 2WS93 4DFSA 5A33A 1B35B 3T4VA 1UXZA 2AYHA 4LOSA 4IGOA 5C6CA 5LK5A 3HN1A 1AYM1 1Z7S3 1UL9A 1VBB2 2WNUB 5FZ1A 5L73A 2OKXA 3UL2A 3ZSKA 2IFWA 1C8M2 4FPHA 1MVEA 2YPDA 1GYKA 1TE1B 1VAMA 2RS53 1OH3A 4GAZA 5ACA3 4LHSA 2VW2A 1NXMA 2IXLA 2ZXQA 5D1IA 4S2GA 5DUXA 4CXWA 3V0AB 4FPLA 3F95A 1ALYA 1ZA7A 1OURA 5F3EA 5CFCA 2XLFA 3WV6A 1VAKA 4FPCA 3H7YA 4P9XA 3WNPA 4Z82A 3C7EA 2PN5A 2NMNA 3H50A 5FLIA 1NY71 4A41A 5FYIA 1E5RA 3M2MA 2JE7A 3V0BB 1S0CA 3NV3A 1SMVA 1AJOA 2Z5WA 1PMJX 4FPKA 1IS6A 3KQ4B 4OHXA 5K8SA 4TWTA 3NNLA 1B35A 4QU1A 4R9AA 4ZU5A 4A3ZA 3FHIB 1F2NA 3WLUA 2ZCWA 2WNUA 1MR5A 2Q1FA 1WCSA 3QOPA 3B9CA 3SCFA 4AWDA 3KVAA 5F5CA 1I9RA 1MS1A 1U5IA 3K77A 3RZZA 4RN5A 1TVGA 5BNOC 2P37A 4IE0A 1Y7BA 4Q4X1 5H9SA 4BOWA 3OUJA 3KZ4C 5LCWL 1OFSA 5T55A 4ES8A 2EXJA 2ZZJA 4LHKA 2QQLA 3MLJA 4QX0A 4DUXA 2ORZA 2KD7A 2A3YA 1L7RA 3SITA 1UZWA 2VECA 5F5AA 2DVDA 4EQVA 2J1RA 1CGPA 2VOWA 1HRI1 1LRHA 2P3KA 1AYN2 3NSTA 3WDUA 3SC7X 3HT1A 4B7EA 3WHUA 1NT0A 1QEXA 4CCMA 1GOGA 4XVHA 1A8DA 3IDAA 3N9OA 3V0BA 3ZXAC 1AYM3 3WQ0A 1H2MA 1JYVA 2QZ2A 1Q56A 3POGA 1QMJA 5F5IA 1WGPA 2DUOA 4YM1A 4CUCA 3RZMA 2TUNA 2E7QA 4PHZA 1BBT2 4UFIA 5A7NA 1QHDA 1SPPB 3LF7A 3LWCA 2BQPA 2EXIA 2XHNA 2Y60A 4S2DA 2E7TA 3AYEA 1UZVA 2QQKA 5C3PA 1NG0A 4B1MA 2Z2SB 5SV5A 1FAYA 3T08A 4BWOA 5CBLA 5IFPA 1Y9MA 3BYWA 1H30A 1VJ2A 1GWMA 1IPSA 1APNA 1WBFA 2EIBA 4AK3A 2J1UA 2BUKA 3OBZA 4YZ5A 1PVC2 5FYCA 4XBQA 1RUI1 3ZYBA 1NCQB 4AZZA 4BHPA 1RINA 4R9DA 4NPLA 3X29B 4FPEA 5JOZA 2HKXA 4AEDC 3ALQA 1AXKA 1EV12 1ZRDA 4LKEA 4JGYC 5KC5A 4Y22B 3NJYA 4XDOA 5FZDA 2R30A 2RDQA 1KRIA 3T09A 1DLLA 1HQNA 2Y6JA 4BLIA 4W4ZA 3DL3A 5CISA 2MNGA 3WP4A 2DVAA 1W90A 2ZJCA 4LO4B 2C6SA 3POEA 1XSQA 4Y4RA 1OUSA 1VBD2 1KJLA 3HMYA 4MGSA 3UETA 2BBAA 2ZGLA 3WD5A 2GC3A 1PGW1 4CEYA 5JDBA 4C0BA 5A3UA 4Q4X3 2VZOA 3VKLA 2HWF2 2PHFA 2VVDA 1CAWB 1JS9A 5FY9A 2I2SA 2ZGKA 3CU7A 1ULGA 3RFRA 4TYSA 4FPJA 4BQWA 4EN6B 1IS4A 1HRI3 2W87A 4LBMA 1KS5A 1UOFA 4QPYA 3UNPA 4EN9B 4Y22A 2B45X 4BH9A 2D5FA 4MUVA 2ETEA 5A6ZA 4X8PA 4YNIA 4J6GA 2VUDA 1QJFA 1W6PA 2XJSA 3TEXA 2D6KA 1LOBA 2R6QA 4GWJA 2WNUC 3AFGA 3AVSA 4KI5M 2A1XA 2WLQA 1LJ7A 1UMZA 2ZBJA 4PLOA 5GLZA 3BTXA 2V4AA 3OPTA 2C1FA 2F4LA 1V00A 4M01A 4QX2A 5GZFA 1ZZ9A 2G1MA 1WW4A 3GZEA 3WW4A 3R05A 4DXRA 1G9DA 2LS6A 3HN3A 1Q8PA 1XYNA 4B4PA 5FPXA 4J1XA 2CWMA 4GKXA 2R7EB 2PLV2 5GLVA 4XOGA 1BEV1 1CAWA 5FPLA 1LKNA 1RUI3 4OUMA 5KXDA 4PCRA 2XLGA 2WJSA 2C9AA 4R52A 1CAVB 2E51A 5HXMA 2QQUA 1VP6A 3WF0A 3WP3A 4RHV2 3FFZA 3AP9A 3IM0A 1E5SA 1BJQA 4OZOA 3ZYPA 2XWJB 3B9IA 4JQTA 1COV1 1UD1A 4UFHA 1RL3A 2D44A 5CFDC 5CEHA 2ZEXA 1UZYA 1OH4A 2YUEA 3GALA 1BK1A 1RC6A 4MH0E 1HV0A 4RGAA 4PIZA 5JI9A 5HV0A 5B4XA 3WP6A 4QHBA 4I3GA 2JDPA 2XJQA 1CPNA 5C71A 4Z2WA 4YGDA 3WZ1A 2EA7A 1G8WA 1XNKA 4YGCA 1JHJA 3BGAA 1W9FA 4SBVA 3O1TA 3K4DA 2Y34A 1MQTA 2LRPA 3BTYA 3O1PA 3NKGA 3A23A 3LEIA 1ZZ7A 5GZCA 2FDHA 3AKRA 4HVQA 1CZTA 1HN0A 2JB8A 4OHVA 1ENQA 1R1A1 4HSJA 3MICA 3ZXJA 3CJXA 3VD5A 3MIFA 3H1MA 1OI6A 5C33A 1QNWA 5LA0A 3DECA 3GJAA 4R4ZA 1GLHA 2P5BA 1WW7A 1ZBE2 3E6BA 4LK6A 4YW3A 3SH5A 1NQDA 2TBVA 3O0XA 3E97A 1QQP1 2YGLA 3MEPA 5ANNA 2WWUA 3AP4A 2ZTNA 4R4XA 1FT9A 1WCDJ 3HR9A 1OQDA 2D97A 4XC9A 1XE8A 1LHNA 2JDKA 2Z4FA 2ZGRA 3ZVXA 4AG4A 4BMEA 4CEYC 5FY8A 4NIAA 1O4YA 5IWFA 4MG2A 5KXEA 3D3AA 3UJQA 3AZYA 2XUEA 4MGQA 2ZZQA 4EN8B 2PAEA 4YVSA 4YFZA 4QD2A 1BEV3 3S6PA 3SISA 1CN1A 3WP5A 5C3QA 3FHQA 4RD7A 2R49A 3HAGA 3KT1A 4EZHA 2XPJA 3S57A 3RYKA 3ZSEA 4Y33A 4CCNA 4XFIA 4UYBA 5FY5A 4K20A 2JKBA 4K8FA 4O7XA 5BNNC 5IVEA 1COV3 3JQWA 3KT7A 4XMAA 1WWYA 4YG6A 3RSJA 2XBO2 3AYDA 3EO6A 4URTA 5CG9A 3H8UA 1M06G 4PI0A 4LBNA 2HEWF 1ULPA 4K3UA 4OFGA 3VZKA 3FBYA 4UW5A 1LHUA 3P5BA 1SCRA 1EPZA 4BA6A 4BQ5A 1J1LA 5E89A 4A6SA 4DQAA 1YYNA 2VMCA 4EN0A 4DUVA 2KA3A 3D82A 3I2DA 4XFCA 4J1WA 3IWZA 4I09A 3NRUA 5BPXA 3Q8EA 2UURA 3ECQA 1DZTA 3KF3A 1QJU2 1G9BA 4NE9A 3BKZA 3BOPA 2MEV2 3HT2A 1LESA 4Y3OA 2C26A 2NYYA 1POV0 1YEWA 2XQXA 3R4DB 4J25A 4XBNA 2CL2A 2VQAA 5DAVA 5FO8B 1R1A3 3I2KA 5C8WA 4GALA 5F6KA 4K9SA 5L19A 1ULEA 3AP5A 3VBSB 1AR61 5C9AA 4D69A 5KHGA 3PUQA 3OB8A 4XFGA 3ILFA 5LASA 1YLLA 1QQP3 1RITA 2OIIA 3NVCA 3CZJA 3VN4A 5D21A 1UU6A 5FR3A 4GIQA 5H9PA 3SLIA 2GH8A 4QXCA 3VHPA 1NZCA 2ZMNA 3M3QA 2AC1A 3AYCA 3TEZA 3PDQA 2Q5TA 1W3VA 5A7WB 2XKPA 1O3SA 1H8TA 4XUPA 1NCRB 1OQ1A 2QQVA 3ZYFA 4PT6A 3H8OA 3NMBA 4V2WA 1N1YA 3WW1A 2CTVA 2MHFA 2ADEA 1MQTC 2BVBA 2O8OA 4XFBA 3LA7A 1MACA 4WVWA 5DUWA 2XGXA 5I0TA 5FYYA 4JHZA 2RG4A 3AM2A 4DIQA 1V70A 1O6UA 4E4SA 3VBSA 1D4VB 5I93A 1UNBA 4FP3A 3AKPA 5BNPB 4YW7A 3ZN6A 1YHFA 5T5JA 1C4RA 3B7MA 1V6JA 3ST7A 1FMD1 4LO5B 3TEYA 1VE0A 4NPMA 1RUF1 2WAOA 3J8F1 4LR4A 4BK4A 4XUOA 5A6YA 2VTFA 3AKSA 3ETPA 2CGOA 3BN6A 3GYDA 3H3ZA 3KCYA 4XQDA 3LSDA 5A7WA 4CCOA 5EFUA 1SZBA 1NCRA 4YVSC 5GLTA 4D6SA 2WO1A 2WS92 4N9HA 1AL22 4MGTA 3GZTB 5JIAA 2B9VA 5F3GA 1GOHA 5LEKA 1H1MA 1V6LA 5KWRA 1F35A 5F3IA 4ZXEA 4Z07A 3DYPA 3MLLA 1AR63 4U2AA 5FIXA 2JEMA 1VAVA 2OQ7A 1F31A 2RS52 3ACLA 4BQ1A 2BWCA 1QOOA 5ACA2 3CBNA 4XF9A 2JIJA 1KDMA 5IVVA 4AGVA 4H2AA 5BNPA 1QNYA 2B46X 2E33A 1UY2A 2VZSA 4W6XA 5J3UA 3ZYGA 1N1TA 2D3PA 2WBKA 2WR9A 4GH4C 3D8CA 3VV1A 2A70A 1CAXB 2B39A 2PELA 5IFTA 4O65A 2XHKA 4M4PA 2ARAA 5F6LB 4Z92B 3S5AA 4N9IA 3U14A 3W21A 5B2GB 1T2XA 1QDOA 3FE5A 2XMLA 2DWRA 2WN3A 1PNGA 2VUCA 2W91A 3NJVA 4KWLA 5FOJB 3IPVA 4NIIA 2C4XA 2QTWB 5FCCA 2VMIA 4GJYA 1JI6A 2J7MA 3R4SA 5FYMA 5C9AC 2HWC1 1POQA 2Y6HA 4UWDA 4BK5A 2FZ2A 4NHYA 2N7GA 1FMD3 4HFSA 2EALA 1RUF3 3J8F3 3LB9A 1V6OA 2YPJA 1WMXA 1O7FA 3AX4A 4UFJA 2W46A 1XYPA 2A6VA 3ZM8A 1VR3A 5AC91 1H8TC 1UN1A 1REDA 2ZX3A 4RFRB 4QQPA 1PIV1 2CGNA 4KU8A 1AR81 4Q0VA 5JXIA 3SCGA 5IAVA 5JCTA 5CYYA 1WD3A 1BMV1 4HONA 4Y26A 4XDPA 2ZS6B 1AYM2 5JSPA 2YBPA 3MBWA 4CDUA 3SH4A 3W5NA 2WNEA 1OLQA 4HT1T 1OD5A 1RHI1 1RIRA 1TNFA 5BXXA 4PF5A 3GF6A 1CVNA 3I3DA 2P17A 4FO9A 5DZFA 3UESA 3MO4A 1AX0A 1J3PA 5EYXA 4YG0A 5FY1A 2JDYA 3VBSC 4QQHA 4OULA 2XUMA 4YPJA 4NAMA 2JECA 5IW0A 5ERLA 2VE1A 3D0SA 4GWNA 3AKTA 4UFLA 4E9KA 3OYWB 4MGZE 4B1LA 2DUPA 1LEMA 4ZXKA 2E26A 2UYAA 1VBA1 4DRVA 3JB4C 4W6YA 1UPSA 5FYSA 5GKAC 2Q8CA 3UYJA 2ARXA 3LIHA 2K0GA 3MIEA 4A42A 3AMQA 4I01A 2J1VA 2DU1A 3PIGA 3H1YA 1NCRC 4XQ4A 4PQ9A 4DXSA 4W50A 1W8HA 5FYVA 3RMXA 1LAJA 2ZGNA 2WO2A 1WMEA 3FFQA 3ILRA 1PO12 3O1MA 3VZJA 2OUJA 1W8ZA 1W99A 1N1SA 1POV1 4FXKB 5AFBA 4RSUA 1K3IA 4ZS2A 2VAUA 1UMHA 1NE4A 1WW5A 1W39A 3ZSJA 2Q4SA 2A7AA 4CCCA 4OLLA 3DEMA 3LDBA 1YJKA 2HWC3 4JX0A 2D43A 4C8DA 5L7OB 5LRSA 5I8YA 4Q4X2 2ZGTA 1RXFA 3UKVA 3JB8A 4NIDA 3E5QA 5BNPC 1UY3A 4UAPA 3URFA 3OYWA 3BPSA 2BBVA 3ZDVA 5B4NA 2GDFA 3O0VA 1JZ7A 2QKDA 1S0FA 3OGVA 4AVBA 5AC93 4AOCA 3ENRA 1HRI2 1PIV3 1CIWA 2ZABA 1AR83 4YM2A 3VBFB 1ASJ1 1W8WA 3LDRA 1LGCA 1WLWA 1K5JA 1F8VA 4MX3A 2D6PA 4UOJA 4IUGA 3VBUC 1LU2A 2VOXA 3AJYA 4L11A 5G04L 3VUOA 2W68A 5EV7A 1RHI3 2UY8A 3J7LA 3DN7A 3NQHA 2ZX2A 5E88A 2QDRA 2YBKA 3C2UA 4L99A 4YW2A 5C4WB 4FFIA 5JMOA 1S4CA 1DQ6A 1GOFA 2A5ZA 2VC9A 1RMU1 1GP6A 5L7OA 3ZX7A 1ZBA2 3FBMA 5T3NA 5FZAA 1VBA3 1H2KA 3NV4A 4MYEA 3D6EA 1RUI2 1WCKA 2BERA 2ZHNA 3B02A 4IDZA 1G9AA 5C8CB 4CCKA 2AREA 3HPNA 2ID4A 2LW8A 2W39A 2ZX0A 2VXRA 2VZVA 5FPUA 4MLOA 2VXJA 3VBFA 4HG6B 3WR0A 3MIGA 1ZZ6A 1XJAA 1HX6A 2EVXA 3OGJA 4QHZA 1IG3A 4WVMB 1GZWB 2WT2A 3V56A 1POV3 3C8XA 1DZQA 2ZHLA 1H4HA 3UT0A 2XJVA 3I2JA 2OQ6A 4PLMA 4CDUC 3RVHA 1A3KA 1BLZA 2OZ6A 3OPZA 5L9BA 3BTAA 4X6RB 1W6OB 4MHUA 4NHLA 4OVEA 1PGW2 1EUTA 3FMGA 1NA1B 1Z0HA 2ZEYA 3K3OA 1O3RA 3IB3A 3MUZ1 4IV3B 4BISA 1W6MB 4IERA 1S1AA 2ADDA 2BJSA 3N4MA 3MW4A 5DZEA 3MYXA 1VMJA 3NL1A 2RR12 3NNGA 1JU3A 4Q4V2 2JE8A 4A44A 1H9WA 1W06A 3AL5A 2WZ8A 4P00B 1CX1A 3IIAA 3POYA 4LJHA 4KNCA 5C8CA 1K42A 2BNMA 1ASJ3 5IVCA 2VGDA 1S0GA 1Q3EA 2FMDA 3QACA 4NHMA 4GD4A 5LEJA 4AFDA 3RZJA 5LBBA 2W94A 3M4FA 3GDBA 3NV1A 4JRAA 5K9YA 3BCWA 3MFCA 1QXJA 1DZRA 3OTFA 1W8OA 1A34A 1X8MA 3U11A 4CEWB 2A6XA 1U5YA 1W6OA 1DGRA 4AFMA 1WA6X 1RMU3 4O9GA 1NA1A 4AGRA 2JJ6A 2GC1A 5CADA 1XNCA 2ET7A 3SMHA 1O8PA 1S0BA 2WZR2 2RJLA 1OSGA 4IV3A 4PJYA 4P9GA 1RUOA 1W6MA 1BEV2 1EUUA 2WL1A 4Y1VA 1JYCA 1BQPA 4EROA 5FZEA 1UU5A 2WIIB 2VMDA 4MGYE 3HNYM 2VNOA 1FNYA 2UWCA 4L92A 4QT6A 4FOWA 1D0HA 5AVAA 3C7HA 4QDQA 4WM7B 1COV2 1QY4A 3S5QA 1E57A 2JDZA 5CKQA 2RHPA 3ZXGA 1GP4A 4CU9A 2VQUA 3B3QE 3VHRA 4DY3A 2WO7A 4LLFA 1O5LA 2VBDA 2WT0A 1AZDA 2RS11 1XBFA 3MPBA 3GHMA 1OBNA 5D8AB 1PVXA 4AI0A 4P9IA 4QMAA 1VRBA 4K21A 2LUWA 5T5PA 4Q2FA 2D6LX 4I30A 3WNLA 1QU0A 5FXXA 4R8HA 3WF3A 1OD3A 4HOOA 5GZGA 5KR7A 2JB4A 5EQUA 1YFUA 5L7OC 1ZREA 1DG6A 2V5DA 4CUAA 1CWPA 3GCWA 3POWA 3MV11 2E7AA 1DQ1A 1WCQA 4QGNA 5FLJA 1R1A2 3ZLIA 1HB3A 3KS7A 1H6YA 1PHMA 1DBNA 1TNRA 1C28A 3A22A 2ZX1A 3N9PA 4N7UA 3VBFC 3FUOA 4WM7A 5IUQA 1FNZA 2RVAA 5IT6A 1OOPB 5JMCA 5EJ1B 4NRMA 5LA2A 4IEYA 4NO4A 2OPKA 4BDVB 2Q30A 4JAAA 2LTNA 2VPVA 3AFKA 1Y4WA 3CDZB 4XJAA 2MPFA 5ABJA 2TEPA 4N53B 2WABA 1SLAA 2PHXA 1D4M1 4Q0PA 4ZONA 5L36A 5KC6A 4Q0UA 3TN91 3ME2A 1REEA 4CCEA 2PHLA 3OD0A 4IL7A 5ISLA 1MZ5A 4QKFA 3ZFFB 1OA3A 1ZNPA 3N36A 4UF0A 4XILA 5C8CC 3T0BA 2OXBA 1XU2A 4OMCA 2I07B 2VW1A 3WT3A 3J7MA 1D7PM 3ZOIA 4XF1A 5A3MA 2ZKLA 3ZMNA 5LK7B 2RS13 4XF3A 4ZY9A 5CA6A 3GBGA 4NRPA 4MGIE 2DUQA 5KXCA 5DG2A 2QNKA 2WLPA 3J9SA 3LA3A 3LOBA 1Q8SA 3KWVA 3N3HA 4UFMA 3INAA 1NA1C 5FMOL 3WF2A 3WF4A 2AEYA 2DVGA 4XABA 4NVPA 2HYKA 4N53A 2FBEA 3CEWA 5IVYA 1URXA 1UKGA 2EXHA 3EMRA 2RS31 4L97A 1E5HA 4DB5A 5FXZA 5I0UA 5EXOA 2Q8OA 3RI8A 3DGTA 2AENA 1MS4A 4LUKA 4SLIA 4YVWB 2GH2A 5T5OA 2P3IA 2G9ZA 3WNMA 1AR62 1F5JA 1VBE1 3ZMOA 3AB0A 4AEJA 4HKLA 2PHDA 4KL1A 1TMF1 4TXWA 4XXAA 3ZYRA 2YYOA 4BB3A 2OX0A 4E2QA 4DRRA 2PHWA 4NR1A 2FDFA 2EIEA 4AW7A 1OLMA 5J1XA 2VOTA 2X29A 3DYMA 3O1UA 3V0AA 4L8QA 4O61A 1JW6A 2NZ9A 1D4M3 3BVCA 1R081 4XF4A 1IOAA 1YQCA 3TN93 3ON7A 2CY6A 4I02A 5FRAA 1F4HA 4WBBA 5FY0A 3CQOA 1REFA 4DEQA 2JIGA 2J42A 5E6HA 5HCFA 3PTRB 4OHZA 4OI1A 3ZPOA 5KHHA 3JZVA 1YO8A 2BDRA 4DY5A 1O3QA 3S7EA 2WWSA 2HH9A 3G7DA 3KCCA 4YVWA 1SLBA 1NX9A 1S0IA 4ONUA 2G9FA 2E63A 3R0RA 4WM7C 5I0SA 4GXLA 4D3WA 1AR91 3E5UA 1BZWA 4URAA 3Q8AA 4QX7A 4YW4A 1J84A 4HN1A 1FMD2 2IXJA 1QXRA 4LTAA 5GM0A 3ZYIB 3DCQA 3ZR6A 1RUF2 3J8F2 4AE2A 4ZKTB 2ARCA 1OVPA 2VR4A 4WM8B 4I0BA 1PZ8A 1UY1A 4H7MA 3MDPA 5ABJC 1UWWA 4YM0A 1MPXA 1DGRN 2A73B 3HEIA 4K8RB 4EWDA 2RS33 5CAZA 5FZOB 4YYOA 1OHFA 1DYKA 1XE7A 5FZ9A 5KHIA 2Z79A 2DCTA 4K40A 5F7UA 2YV8A 4Y5SA 2D3RA 1V6NA 1GQHA 1J3RA 1UPIA 2IFRA 2VMGA 3RDIA 1OQEA 3WDTA 2W1SA 1VBE3 1AF9A 3A21A 3T0DA 1E5IA 3EBRA 3USSA 1TMF3 2Y0OA 5APAA 4LQRA 1SPPA 2DFBA 4JC1A 4F7ZA 5F9TA 4KWJA 2NPIA 5FJHA 3BIEA 5IJRA 2YB7A 4WM8A 2DV9A 1O4ZA 2Y38A 3EXUA 1R083 2ZX4A 4FFHA 4QHOA 5CFCC 1W6NB 2V5YA 3ACFA 4EE2A 4GWIA 1NCQA 3IAQA 5FXVA 5FJKA 3RZLA 2YDEA 2RJKA 1EAH1 3AMMA 1RUC1 2FDJA 4U36A 5LBFA 3OCPA 3TEWA 3S30A 2DU0A 5FY7A 1YCIA 2RJ2A 1B35C 2XKOA 1UYPA 4LA3A 4QQLA 5HXVA 4NHKA 3K3NA 1AR93 2HWC2 3VDDB 1N1VA 2DF7A 4M3CB 4QPGB 4XW3A 1JZ8A 2VW0A 2G4IA 2I74A 1CZVA 4QB6A 5FBZA 4X6QB 2ZEWA 1ZYBA 3KSCA 4QM8A 1I5ZA 4AQ2A 2VD7A 5AC92 3TRSB 1HB2A 5AVPA 5FZ8A 1OA4A 1PIV2 3RI9A 1W6NA 4QM9A 3KHCA 2Y8KA 4A4AA 3K48A 2E9QA 3AC0A 1XB9A 4LLOA 1FXZA 1GNHA 3JBG1 4FFGA 3THDA 1BMV2 3FJSA 4OI4A 4D8MA 2HJIA 2HWE1 2QQPA 4CDXB 3VGIA 3C3VA 3WSOA 3NJZA 1RHI2 1RUG1 1Y3TA 3GHNA 1CZSA 1YFWA 4YVWC 5FZGA 3WINE 4AFCA 1DDLA 3CJIB 4H55A 3HNMA 3VBHB 2ZACA 4IEOA 2VZTA 2CAVA 3SXWA 4ITCA 1XE0A 4XHBA 3P6BA 1GV9A 2KXLA 5FV3A 1RGSA 2NN8A 3ZFGB 4M3CA 4QPGA 3BU7A 1CAUB 1DFQA 5FZ3A 5FMDA 1NUKA 1VBA2 3OOXA 3K2OA 2JDNA 4XFFA 5GALA 4FAHA 5I0DA 3JU9A 3OUIA 4LKDA 2HWB1 3N9QA 5C3SA 3VZMA 5JR7B 1L3JA 3RJRA 3T3YA 2EXKA 4ISQA 5DXDA 4QQ2A 4D6RA 1CAVA 1UYYA 2ZMLA 4ARYA 2JXAA 1EAH3 3GJBA 1D2QA 1RUC3 2P3YA 4OHWA 4A45A 2VO5A 4IGPA 2R0HA 2AH2A 2YFUA 1R092 5HI0A 1TME2 1OKOA 4CDXA 1GUIA 5GLWA 4F3JA 1W9TA 1ZZBA 4LOTA 3ES1A 1S0DA 1DIWA 3DPRB 2GN7A 4XQWA 4AHWA 1GSLA 2WZEA 2V73A 4YLZA 4FPFA 3VD3A 3K75B 4YRDA 1MS0A 1VMHA 4WVVA 4E4DX 4UW4A 5BYNA 1ULOA 3ZFGA 2FCTA 4Z8BA 1JZ4A 2A6YA 3VL8A 5L9VA 3KVBA 1SDDB 3ZN5A 4V2VA 4WM8C 3U10A 4ZU7A 3FLRA 5F39A 2OS2A 3AKQA 1ASJ2 3AK0A 3M1HA 2YY1A 1WLDA 2WA4A 4N8MA 4NWWA 5LA1A 1NCQC 3JBG3 4I0AA 3HQRA 1NZIA 5IK5A 5F8PA 1MEC1 2J1SA 2HWE3 5JPNB 2RDNA 2WNOA 5F1RA 4LK7A 3ETQA 1RUG3 3M8LA 1YIFA 3UGGA 2GP3A 1US2A 2YXSA 2ZA9A 4NAOA 4AQTA 4X8NA 4NHXA 3EB7A 3DPRA 1P8JA 1U5XA 2WFF1 1RMU2 2Z42A 3WEZA 1LTEA 1O8SA 4OUEA 4W8JA 4AHZA 1W2OA 4Y5TA 2VL4A 4LBQD 2D6MA 1K12A 4G3YC 3H3UA 3P3NA 4A7YA 2DCJA 1GP5A 1VBC1 2HWB3 4YW1A 5FYUA 2YHJA 3IDBB 3N7KA 3POFA 2FQPA 3CKHA 4QU2A 1VBB1 5LB6A 1CESA 4E27A 1J58A 3AMPA 3PJYA 2WUHA 1OKQA 1BVP1 2BFUL 2BWAA 2W1WA 3CL1A 4AFAA 2D40A 1W9WA 4FBFA 2PQSA 2B5HA 3ABZA 3AMHA 5A3OA 5IK8A 2XXZA 4CU8A 2ATFA 3W5MA 5GJ6A 3MPPG 1EP0A 3LE0A 1RUD1 3M7AA 4GULA 2QQIA 4BZ4A 1ENXA 4S2FA 4LO8A 4QPGC 3I3EA 2WQZC 2HEYF 3LEMA 1WA4A 1JN2P 4DS0A 3ES4A 3N9MA 1GFF2 5IVBA 2WN2A 2VU9A 3MUY1 1HXS1 4AYUA 4CDQB 3THTA 4LBLA 2W2IA 4NN0A 4KQ7A 5DAWA 4BM8A 1NYWA 1ODMA 1Q8QA 4TSVA 3R4UA 2F17A 2PA7A 1MEC3 2CAUA 2XWBB 4LNVA 2VZ1A 3MF9A 2XR4A 4XJWA 4AEKA 3V64A 2DFCA 4UBHA 3U78A 1ENRA 2GC0A 3AXDA 3D4KA 5CKMA 4JTNA 5KXBA 1AR71 4CDXC 1UIKA 1WD4A 1SFNA 3VBOB 2RM21 2QCSB 1L7QA 2WFF3 5H9QA 2X09A 3KF5A 4AVVA 3GXUA 4E8CA 1CR7A 3LEKA 4GMP1 2F4PA 4M0NA 1KFXL 5FYBA 4XCBA 1G7YA 1KFUL 1Y9GA 3HIFA 1AYN1 1C5IA 2XL9A 3RNSA 4CU7A 3IMNA 1V6KA 1O59A 1PK6B 1VBC3 5JPMB 4NRQA 5A70A 3VD4A 4XACA 3DKWA 1VBB3 4ARXA 1LODA 4CDQA 3VKOA 3KT4A 4IEXA 3MIHA 2C9KA 4R9CA 4R9BA 5FWEA 5GZDA 1GICA 1Z7S2 1BBT1 3LPFA 3UKTA 4NJ4A 5DAQA 5JOWA 2RS12 4QB2A 1MS9A 5CG8A 3AXEA 4PIXA 5FKBA 1R1ZA 4HKWA 1W9YA 1JYXA 2L9LA 3I2FA 3A0NA 1DHKB 4XPVA 4Y1ZA 4Y4YA 1DQ4A 3SHRA 2OPWA 5KBFA 1QXPA 4MV2A 4DMIA 1PVC1 5FXWA 2VZQA 3VBOA 4RR3B 3WNOA 1RUD3 1DQ5A 3WUDA 2WSVA 1DU3D 1LR5A 5F32A 4HANA 1W05A 2J22A 3HD8B 4LKSA 4RA0A 4CTEA 5JSRA 2C24A 3CMGA 4LO7A 4TTGA 1HXS3 1PK6A 1UX7A 3M70A 4GWMA 4IEUA 2JDAA 4OUSA 1PX4A 1LHOA 1SFPA 3FUQA 3ZXDA 4EJRA 2W3JA 4RQPB 2RMU1 5HBAA 4LULA 1GANA 2CNAA 4CP2A 4MVTA 1IS3A 4QGMA 2GC2A 2YC2A 5BNQA 4XZUG 4NIGA 1PM7A 4XE9A 1JOBA 2XG3A 1JMUB 3ZXFA 1AR73 1QJY1 3W58A 5LA9A 2HWF1 1IZ3A 1YC61 3M3EA 4H7LA 3Q9OA 2RM23 1SLCA 5FZHA 3GZUC 3ASIA 2VMHA 2DVFA 1GNYA 4RR3A 3LZZA 4GMP3 3U1XA 1XC6A 1D4M2 2GMPA 2E32A 1OF4A 2E6VA 2WSUA 1CD3G 4MHRA 5JZGB 4IEVA 1AYN3 5J09A 1JBCA 3RJ2X 3MHZA 1NQJA 4BJ0A 1CAXA 3OPWA 2CU5A 3PVNA 1VB4A 2XVGA 4WV8A 4W65A 5DAPA 2NQYA 4COUA 4E4ZA 2ZEZA 5T52A 4TLGA 4RGKA 3SKVA 1X9TA 3U0ZA 2CSGA 1BBT3 1HB4A 2H0VA 4QKDA 4Q26A 3PJQA 4RQPA 4ISRA 3ROUA 2CWSA 3AVRA 2UYBA 2IZWA 3RYRA 3BU0A 4E2GA 2A3XA 4A3XA 1CIYA 4QKBA 3OD4A 3TBDA 1ONAA 1PVC3 2JICA 4AI1A 4HSLA 2H0BA 5FK8A 2RDRA 1WW6A 2R041 3U07A 5IHRA 1UOGA 3H9AA 3KGLA 4DUWA 1SBDA 4COWA 5BV6A 2RS32 3HBKA 5JZGA 3T1MA 1NY72 1R64A 3CZUA 1ND3B 2FCUA 4OHYA 2JWPA 3EHKA 4I0WB 1OFNA 3W20A 2RMU3 4CDQC 2QQJA 2YU1A 3C7GA 4PQQA 2BP6A 4CCLA 1RXGA 1JOPA 1VBE2 1AVBA 3W59A 5FZLA 5K7PA 3VHOA 4JHTA 1J59A 2D98A 1QJX1 1X9PA 1I6XA 1TMF2 1S0JA 1VRH1 1LB2A 4BQXA 1QJY3 3ACIA 5CU1A 4KG0A 4D7TA 2HWF3 5FZFA 1SLTA 4OZXA 2YZ4A 2OZJA 3IBMA 2A3WA 4DEVA 1DGWA 2PTMA 5EYYA 4XUQA 3T4HB 3VBOC 2BNOA 4I3PA 4A7KA 5A3PA 5J7MA 1C8NA 1R082 4FFFA 1XOYA 1ODNA 2GN3A 3RMYA 3PUSA 3OGRA 3RYPA 2QJVA 4A2UA 4AI8A 2JDMA 1N3PA 3ZKYA 5DZGA 1YFYA 2P4EA 3HQUA 1HN1A 2ZGOA 5EIYB 1ND3A 1OT5A 1PK6C 2ZKNA 1J1TA 4IE7A 2DDUA 2ORXA 1DQ0A 2D3SA 2GALA 3I2HA 1JH5A 1ND2B 3Q8BA 1AX2A 1YJLA 2GNMA 4YSFA 3B94A 1AR92 1SCSA 4KWUA 2VZPA 2EAKA 2A71A 2WNVB 2YMZA 4JKMA 1ZRRA 1H0BA 1QWRA 4L9BA 5A1AA 4PF1A 4IE6A 2BGPA 3RPQA 1WZXA 4LIVA 2R043 4N90A 4HL0A 4HK8A 3T2TA 1KDKA 3NKTA 4B4RA 2BW8A 3A0KA 1AJKA 4RR3C 3IZOA 2BZDA 1LOEA 1W6QB 1LOCA 3FC0A 4L0PA 5FKCA 4BQYA 1OLME 4EV0A 4HETA 3EYPA 1MZEA 3GBFA 1I1EA 1RUH1 3NV2A 1PGL1 4QAWA 4XURA 3S0MA 4LBQB 3WHTA 1RVF1 3WOGA 1YQ2A 1HLCA 1S55A 2O8QA 4HMZA 4RQPC 1QJX3 1SDWA 1ND2A 1VRH3 1Z78A 2OVUA 2XLAA 3AZVA 4EWEA 1J3QA 4KBBA 1SACA 5C5TA 1LGBA 5C4WA 3H8XA 5FUIA 4AL9A 4QPWA 4XJUA 1PO21 3Q8CA 2ZOEB 3K46A 4YGEA 5FYHA 2GNBA 4KH9A 4RFT0 3JD71 2MEV1 2VCAA 1G9CA 1F15A 3ZIWA 2HEVF 4XJ9A 1DLCA 1ULDA 1W6QA 4JRLA 4COYA 5JZGC 4P5YA 1EAH2 4W6WA 2A6WA 2IWGB 1RUC2 3FLTA 3GGLA 4XFHA 4XJ8A 3U4SA 2JDHA 3WVJA 3WQ7A 3G6JB 2R061 2HLEA 4GB31 4LBQA 5JXHA 5C70A 1F9KA 4WVMA 1GZWA 2GZWA 2V72A 1G6NA 4JVAA 1SLIA 1ENSA 4ZU4A 5LBCA 2Y26A 2GMEA 2IXKA 1GR3A 1IKQA 2C5DA 3ZYHA 2V4VA 2RDSA 4OCTA 4RYDA 2XDVA 1AUYA 3K4AA 5JIUA 3VDAA 4QDSA 4XJZA 1ST8A 2FMYA 2WC2A 3PUIA 3ZXKA 3LIGA 1IHMA 2Y6GA 2R16A 4HPKB 5EZWA 5GZEA 1Y43B 5TSWA 2E53A 4NPRA 3QD6A 3NNMA 1TZOA 3PU8A 1UW8A 3JBG2 3OBTA 4XXPA 5FAXA 1RUH3 1XRUA 2GNDA 4XEZA 2HWE2 1RVF3 1ND3C 2CDPA 2K9ZA 4JCKA 1RUG2 2LALA 4UBGA 4F83A 3WNKA 1LU1A 4DINB 1KQRA 4PBPA 5F37A 3KV6A 3KQRA 1RUJ1 1SBFA 1XNDA 4CEWA 1UQXA 2EIDA 1Q5OA 3MV01 2YU2A 1PO23 4AI3A 1H4GA 1NLRA 1SEFA 2VCCA 2ZAAA 2VQTA 3JD73 2MEV3 1V6IA 1AL21 1U5ZA 1QOTA 3LSEA 5L9RA 1QH6A 2HWB2 3OY8B 5JXGA 3WW3A 4HPKA 1PMHX 1W0NA 1GQGA 3POJA 5A1LA 4KG8A 2B9UA 4LUMA 5FZMA 4DZGA 5LWBA 4XDQA 4ZPIA 1Q8VA 2R063 3HWJA 1K45A 3ACGA 3H0OA 1S0EA 2QZ3A 4GB33 5FO7B 2C0ZA 1JHNA 1YWKA 4Q4W1 3WDXA 1IPKA 4P08A 1QQP2 2HBTA 3M3CA 2PHTA 5DDJ1 2VZRA 3ITQA 5E16A 5E1RA 4TN7A 5A7SA 4CCDA 5D8AA 1KS4A 1YI9A 2HWD1 4IW3A 2W47A 4Q5OA 1YXWA 2VTXJ 1KJRA 1HKDA 2FD8A 2K46A 4E2SA 4BXFA 3LCPA 1T6BX 5C4WC 1SG3A 2X05A 1YNAA 2VY0A 3I3QA 4GA9A 4ASLA 1HIXA 4ATEA 3FN9A 5FP3A 2LROA 3MF6A 3WDYA 3CO2A 2X5IB 1V6MA 4AQSA 4XMIA 4NIHA 1UAIA 4G9SB 1C57A 4OQ9A 5FBJA 1QKQA 2DCKA 3VD9A 3ORJA 4FAGA 4IGQA 4Y1XA 3O1VA 2PFWA 3AMNA 3AZWA 5H9RA 3E6CC 4CZSA 4FVVA 4YZ2A 3L2HA 1LULA 4HXCA 5FZIA 2VJXA 1LOFA 1WCUA 3R6SA 3WCRA 4ASKA 4BU2A 5LY1A 3FX3A 4HZFA 1OOPA 3PHMA 3JUUA 4HKOA 5F5QA 5F3CA 4B8EA 2WFF2 1RUJ3 1BCXA 3NWKA 4QQOA 5K4LA 3PMEA 3P3PA 3LPGA 4BYYA 1WLTA 1F4AA 3I3BA 1OF3A 3UJOA 3DYOA 5JAXA 1C1LA 4KBZA 5JR2A 3WNNA 3WXPA 3BTZA 4B7KA 1AL23 5FMCA 4IV3C 1VBC2 1IQAA 1QJZA 1DYPA 1VIWB 1CJDA 3HBZA 3IDCB 4FPGA 2Y64A 2X5IA 4BQ3A 2AZ5A 2VM9A 1QF3A 3O12A 3ZFFA 1CX4A 5C5UA 3D5OA 4P9JA 3T30A 2CYFA 4JZRA 2UWAA 3HJRA 3WG2A 5J36A 4IEPA 2R1BA 3RWNA 3GZAA 4Q4W3 4BPZA 1UXXX 1N3OA 2BEOA 4A6OA 5DDJ3 5F2SA 3VZLA 4JGZB 4A7ZA 4QX1A 5A3WA 4AHXA 1NAEA 2HWD3 2XOMA 1RUD2 3LEGA 2H6BA 5FZKA 1OXCA 5JOYA 3HVDA 4CEWC 5CFDB 3KGZA 4JKKA 1C1FA 2QBXA 5FQ0B 3LA2A 3AL6A 5DG1A 5FZ4A 5C7GA 5A32B 4ET7A 1HXS2 1ZVFA 3D0JA 1PO11 3N9LA 2XONA 1A6CA 3PUAA 4LBOA 1DP0A 3WCSA 4AVTA 3O1SA 1W9SA 2VOKA 3GCXA 3OUHA 3W9AA 4D7YA 5FWJA 2EIGA 4TZDA 4JTOA 1FOD1 1FV2A 4KU7A 3PU3A 2VMEA 3NW4A 4Q4Y1 2DTYA 4CXYA 1DCSA 3QLQA 3HNBM 1AR72 1NOVA 2VNGA 3BIWE 3RQ0A 4AEMA 4D94A 4LKFA 1EPWA 2RM22 4JGZA 2ZHMA 3MFAA 3DXTA 5HCHA 5D8AC 4LXLA 2WAAA 1HV1A 2B4KA 3ZN4A 5J37A 1O4TA 4P5HA 1STMA 2VMFA 3MGUA 4XFAA 3T1LA 4AI2A 3WY6A 2QQOA 4YZ3A 4DPNA 4FT8A 2XVKA 1VPHA 3B93A 5CFDA 3WQ1A 3T2PA 4AF9A 2CV6A 4CUBA 1HB1A 5FQ0A 1V0AA 1HRV1 4FCAA 4OMDA 4E4HA 2D7FA 5LY2A 5A32A 1YQ8A 4BXSV 3VDBA 4FSJA 5T50A 2JG8B 2W52A 2NMOA 1QH7A 3I2IA 4JDOA 4CXXA 4ZS3A 1XNBA 2JD4A 3FZ3A 4CEYB 1V9U1 4BQ4A 3ZDSA 2VCBA 5IVFA 4JKLA 5FZ7A 3TAYA 1LEDA 2JENA 3MIBA 3RG0A 4CUGA 2Z69A 3B5LB 3BPZA 4CRQA 1U0AA 1ZBA1 5JWPA 1LOFC 2CHHA 4P14A 3TOJA 1DF0A 2XJRA 1OOPC 1RTVA 1W8FA 3I8TA 4CPBD 1D0GA 2Q1MA 3NAPB 2LM3A 1H6XA 5BNNB 1QOSA 1T6GC 1UYXA 1WLCA 5FO9B 1HJFA 5IYYA 1W03A 3C7OA 1EYBA 2QDNA 3OSDA 2HBUA 1DYOA 4MGKE 2QVSB 1NLQA 4AR2A 2VG9A 4WVZA 4PLNA 4IV1B 5CNAA 1PO13 4N53C 1PNFA 1YI7A 4RGGA 1W6PB 1WUVA 3KV4A 3MLKA 5HCAA 1UZ0A 5FZOA 3SKJE 2X5IC 4WZFA 1MS8A 2RMU2 3WQBA 2BPA2 3IDEA 1L7LA 5A6QA 2JG8A 3ZFFC 1FOD3 3I3MA 1RB8G 4PBOA 5FP7A 2EAAA 4Q4Y3 4KWKA 4XCAA 1QJY2 3E1F1 2BOJA 4IESA 1GKBA 3N7JA 4GMP0 4QWNA 3AZXA 3APBA 4LE3A 2P3JA 1SFYA 2RR11 4BMBA 5IATA 4Q4V1 2R071 5M0TA 1B09A 3AYAA 2OA2A
chains in the Genus database with same CATH topology
5FZ3A 5FY8A 3U78A 1VRBA 3K2OA 3PTRB 5E6HA 2XDVA 5IWFA 3ZPOA 2OQ7A 3NJYA 4XDOA 5FZDA 2XUEA 5FXXA 3KV5A 4HOOA 3N9QA 5KR7A 5IVJA 5IVVA 4CCLA 2YU1A 5F2SA 5A3WA 4D6RA 4URAA 4Y4RA 5FZLA 4QX7A 2YBSA 5FYBA 4EZHA 2Q8EA 3PU8A 2WWJA 4Y33A 4IGPA 5FP9A 5FY5A 4CCNA 5FZKA 5FPVA 4CSWA 2YBKA 5FZFA 5IVEA 3ZLIA 5A7PA 3N9PA 3AL6A 4IGOA 5FZ4A 5FY9A 5FZ1A 3N9LA 5FWEA 3PUAA 5A3PA 5FZAA 2YPDA 4EYUA 2XMLA 5FZOB 4AAPA 5FZ9A 5F37A 5FWJA 3PUSA 3KV6A 5A7QA 4AI9A 4GAZA 5F2WA 5LW9A 4CCKA 2YU2A 3PU3A 4GJYA 5FYMA 3KVBA 4V2VA 5FUNA 5FPUA 5F39A 2OS2A 5A3NA 5FXWA 5F3EA 2PXJA 4Y3OA 5A1FA 5FZBA 3AVSA 5A1LA 4LITA 3DXTA 2OQ6A 3OPTA 5F32A 5FYZA 3RVHA 5ISLA 4LXLA 5FYIA 5FZMA 5LWBA 4UF0A 5FJHA 3N9NA 3PUQA 2Q8DA 2GP3A 3K3OA 4LIVA 5A80A 4QU1A 5FZ0A 2GP5A 4BISA 5FPLA 4E4HA 5LY2A 2OT7A 4HONA 3LD8A 4XDPA 5FYTA 5FXVA 4EZ4A 5A7SA 2YBPA 4TN7A 5FJKA 4QXCA 3KV9A 3KVAA 5F5CA 3AL5A 3PDQA 5FZCA 3PURA 5A7WB 4CCJA 4BXFA 5IVFA 4D6QA 5FPBA 5FZ7A 5IVCA 5FY7A 5FYUA 5FY1A 4V2WA 3DXUA 5FP3A 5FP8A 4GD4A 5FZHA 4DO0A 4CUGA 3K3NA 5IW0A 4LIUA 5CEHA 4QX8A 5IVYA 4NUBA 5FBJA 5FXZA 5F5AA 2Q8CA 5FYSA 5FYYA 3UYJA 4DIQA 4IGQA 3OPWA 4CCMA 2XXZA 2VD7A 3N9OA 5FZ6A 5FYHA 5FYVA 5FPAA 4BU2A 5FZIA 5FZ8A 5LY1A 3KV4A 4ASKA 5F5IA 5ANQA 5FZOA 5F3CA 5A7NA 3AVRA 5K4LA 5A7OA 2OX0A 5FZEA 5FP7A 4QXBA 3N9MA 4UF0B 5FUPA 3LDBA 5A7WA 5IVBA 3U4SA 4CCOA 4C8DA 4D6SA 5FZGA 2W2IA 5FY4A 2P5BA 5FP4A 4QWNA 5FYCA 2WWUA 5A3TA 5F3GA 4QXHA 4GJZA 5FV3A 5FY0A 5F3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FZ3 A;  5FY8 A;  3U78 A;  1VRB A;  3K2O A;  3PTR B;  5E6H A;  2XDV A;  5IWF A;  3ZPO A;  2OQ7 A;  3NJY A;  4XDO A;  5FZD A;  2XUE A;  5FXX A;  3KV5 A;  4HOO A;  3N9Q A;  5KR7 A;  5IVJ A;  5IVV A;  4CCL A;  2YU1 A;  5F2S A;  5A3W A;  4D6R A;  4URA A;  4Y4R A;  5FZL A;  4QX7 A;  2YBS A;  5FYB A;  4EZH A;  2Q8E A;  3PU8 A;  2WWJ A;  4Y33 A;  4IGP A;  5FP9 A;  5FY5 A;  4CCN A;  5FZK A;  5FPV A;  4CSW A;  2YBK A;  5FZF A;  5IVE A;  3ZLI A;  5A7P A;  3N9P A;  3AL6 A;  4IGO A;  5FZ4 A;  5FY9 A;  5FZ1 A;  3N9L A;  5FWE A;  3PUA A;  5A3P A;  5FZA A;  2YPD A;  4EYU A;  2XML A;  5FZO B;  4AAP A;  5FZ9 A;  5F37 A;  5FWJ A;  3PUS A;  3KV6 A;  5A7Q A;  4AI9 A;  4GAZ A;  5F2W A;  5LW9 A;  4CCK A;  2YU2 A;  3PU3 A;  4GJY A;  5FYM A;  3KVB A;  4V2V A;  5FUN A;  5FPU A;  5F39 A;  2OS2 A;  5A3N A;  5FXW A;  5F3E A;  2PXJ A;  4Y3O A;  5A1F A;  5FZB A;  3AVS A;  5A1L A;  4LIT A;  3DXT A;  2OQ6 A;  3OPT A;  5F32 A;  5FYZ A;  3RVH A;  5ISL A;  4LXL A;  5FYI A;  5FZM A;  5LWB A;  4UF0 A;  5FJH A;  3N9N A;  3PUQ A;  2Q8D A;  2GP3 A;  3K3O A;  4LIV A;  5A80 A;  4QU1 A;  5FZ0 A;  2GP5 A;  4BIS A;  5FPL A;  4E4H A;  5LY2 A;  2OT7 A;  4HON A;  3LD8 A;  4XDP A;  5FYT A;  5FXV A;  4EZ4 A;  5A7S A;  2YBP A;  4TN7 A;  5FJK A;  4QXC A;  3KV9 A;  3KVA A;  5F5C A;  3AL5 A;  3PDQ A;  5FZC A;  3PUR A;  5A7W B;  4CCJ A;  4BXF A;  5IVF A;  4D6Q A;  5FPB A;  5FZ7 A;  5IVC A;  5FY7 A;  5FYU A;  5FY1 A;  4V2W A;  3DXU A;  5FP3 A;  5FP8 A;  4GD4 A;  5FZH A;  4DO0 A;  4CUG A;  3K3N A;  5IW0 A;  4LIU A;  5CEH A;  4QX8 A;  5IVY A;  4NUB A;  5FBJ A;  5FXZ A;  5F5A A;  2Q8C A;  5FYS A;  5FYY A;  3UYJ A;  4DIQ A;  4IGQ A;  3OPW A;  4CCM A;  2XXZ A;  2VD7 A;  3N9O A;  5FZ6 A;  5FYH A;  5FYV A;  5FPA A;  4BU2 A;  5FZI A;  5FZ8 A;  5LY1 A;  3KV4 A;  4ASK A;  5F5I A;  5ANQ A;  5FZO A;  5F3C A;  5A7N A;  3AVR A;  5K4L A;  5A7O A;  2OX0 A;  5FZE A;  5FP7 A;  4QXB A;  3N9M A;  4UF0 B;  5FUP A;  3LDB A;  5A7W A;  5IVB A;  3U4S A;  4CCO A;  4C8D A;  4D6S A;  5FZG A;  2W2I A;  5FY4 A;  2P5B A;  5FP4 A;  4QWN A;  5FYC A;  2WWU A;  5A3T A;  5F3G A;  4QXH A;  4GJZ A;  5FV3 A;  5FY0 A;  5F3I A; 
#chains in the Genus database with same CATH topology
 3NAP A;  4Z2A A;  5BNN A;  3J7N A;  4XUN A;  1OC1 A;  1LOA A;  1ZRF A;  2BYV E;  1LGN A;  1HRV 3;  1AR8 2;  3CHX A;  1NKG A;  3H8R A;  4IV1 A;  4KGQ A;  3BB6 A;  4FPY A;  5JI7 A;  2B42 B;  4B29 A;  1BXH A;  1V9U 3;  1HDK A;  5FDB A;  5FP9 A;  3WW2 A;  4ZHN A;  1XXN A;  3H42 B;  4UXA A;  4HK9 A;  3I2G A;  5BY5 A;  1RUN A;  2XH6 A;  2QFE A;  1ZA4 A;  4C1W A;  2J1T A;  1ZBA 3;  2WZR 1;  4CE8 A;  1MQT B;  4K1Y A;  2IXC A;  4UI9 L;  3VDD A;  4CP1 A;  4Q27 A;  4DNY A;  2WZP P;  1XNA A;  4JGZ C;  2R04 2;  1ZZ8 A;  1RUE 1;  4MET A;  4Q1P A;  3LKJ A;  5A7Q A;  4QGL A;  3C7F A;  4QB1 A;  1IGO A;  1I5P A;  2VVF A;  3ZYJ B;  4D0Q A;  3OBA A;  2YG0 A;  2NP0 A;  4G4F A;  1UO9 A;  2ZGP A;  5KHK A;  4MAD A;  1FPN 1;  5HV4 A;  3JCI A;  4IEW A;  2AUY A;  4XHX A;  1OVS A;  1WKY A;  2X53 S;  3IN9 A;  4FTB A;  4UFK A;  4IE5 A;  4ORF A;  4MXW B;  2NM1 A;  3A4U A;  2NLR A;  1QJX 2;  3KB5 A;  1NLS A;  4LMF A;  2BOI A;  1DGL A;  1VRH 2;  4DXZ A;  2GMM A;  2Q8D A;  2J1A A;  4FOQ A;  4AXO A;  4YVS B;  3CJI A;  5EJ3 A;  5FZ0 A;  3MW2 A;  3NNF A;  3VBH A;  1WMD A;  2RR1 3;  2VNR A;  4Q4V 3;  2R07 3;  4IEQ A;  3VD7 A;  1LNS A;  2DBI A;  2OUH A;  2Y0I A;  3KV9 A;  1XNT A;  3RS6 A;  4Y5Z 0;  1CAU A;  3B00 A;  3BAL A;  2B8M A;  3B01 A;  1XSR A;  2WRA A;  2D6N A;  4CCJ A;  3LFI A;  1SHW B;  4HVR A;  1M4W A;  1PZ9 A;  1I3H A;  1RJ8 A;  5FPB A;  2D93 A;  4AVC A;  2JG9 B;  5A6X A;  3E5X A;  3LDK A;  1WMF A;  1O91 A;  3N35 A;  3O1O A;  2GNT A;  4LIU A;  3WG1 A;  4ATF A;  2XJU A;  1W0P A;  2JKX A;  3MI8 A;  5FLH A;  1W3X A;  1W2U A;  4H3W A;  2ZGQ A;  3U37 A;  1GQP A;  4C91 A;  2JG8 C;  4GH4 B;  2IXH A;  4MXW A;  1GZC A;  3H3L A;  2W95 A;  2AR6 A;  3PMS A;  2P6H A;  2JDU A;  2WZR 3;  5FZ6 A;  5CZK A;  1N47 A;  2VH9 A;  3POI A;  1BYH A;  1W8N A;  5LAT A;  4FQZ A;  1CQ9 A;  4GKY A;  3WG3 A;  3U75 A;  3WF1 A;  1MZ6 A;  2K2S A;  5ANQ A;  1GMM A;  3VL9 A;  4M4R A;  1RUE 3;  1UF2 C;  1N3Q A;  1ZZC A;  1KEX A;  2WO3 A;  3KHB A;  3LQC A;  2XB6 C;  3NAP C;  2AEZ A;  5J96 B;  5IAX A;  5FUP A;  3HQX A;  1CON A;  1UU4 A;  5SV8 A;  2QE3 A;  5C9A B;  2G9G A;  4BIO A;  4EN7 B;  3KLS A;  3OF1 A;  5CKN A;  2JG9 A;  1RUH 2;  1FPN 3;  5DMY A;  1C8M 1;  1PGL 2;  3O1R A;  5JLV A;  1HW5 A;  4IV1 C;  1RVF 2;  3I4I A;  4TLF A;  4BLJ A;  4HLT A;  4IQP A;  4XF0 A;  4Y1U A;  4YZ4 A;  5EPA A;  5JSO A;  1YRZ A;  1C3H A;  4OI0 A;  3IT8 A;  2EIC A;  1PZ7 A;  1MS3 A;  1W8T A;  3CF6 E;  4NRO A;  3I49 A;  4GH4 A;  2P2K A;  2UWB A;  3FL7 A;  5T54 A;  4DO0 A;  1H8T B;  3THP A;  2O14 A;  4QX5 A;  3KV5 A;  2ZMK A;  3DUI A;  3M3I A;  2WFP A;  1PO2 2;  1W28 A;  4N43 B;  1SBE A;  3VDD C;  3JD7 2;  3LFM A;  5HCB A;  3TNP B;  4UW6 A;  4DOU A;  4QX3 A;  3H1W A;  1AHS A;  4F8A A;  3EQE A;  3O5S A;  2DCZ A;  5CIR A;  4CP0 A;  1LHW A;  4RS5 B;  3GM8 A;  4YZ1 A;  1YUD A;  1MZF A;  1PM4 A;  1FI2 A;  1D2S A;  2D6O X;  4QPI B;  4LA2 A;  3VZN A;  2R06 2;  4UW3 A;  5FTT C;  1JUH A;  1C5H A;  4Q1R A;  4YGB A;  5LRR A;  3ZN6 B;  4GB3 2;  3VZO A;  1ULC A;  2Y6K A;  4FOY A;  1OMI A;  1A8M A;  4MXV A;  2Q0A A;  3III A;  1GZ9 A;  1GWL A;  1JZ3 A;  1JTZ X;  1QDC A;  5LW9 A;  2Q1Z B;  4OI2 A;  4QXK A;  3WX5 A;  2DBN A;  5FUN A;  2BV4 A;  3GNE A;  2UU8 A;  2VUJ A;  1DGW X;  3CJI C;  3ZSL A;  2O0O A;  3VBH C;  4HN0 A;  1Q43 A;  2FDI A;  1K5M B;  1UOJ A;  5C3R A;  4ASM B;  5E8A A;  5FZB A;  4N43 A;  1X50 A;  3SH3 A;  3I7D A;  4FTE A;  1OUX A;  2PQQ A;  4MSV A;  4FOV A;  2W08 A;  2KR2 A;  2YFZ A;  5A3L A;  3ZFG C;  2A6Z A;  4IET A;  3JQX A;  3N9N A;  3O0W A;  3PVO A;  4OYU A;  4S2H A;  4RS5 A;  1C8M 3;  1RJ7 A;  2F6B A;  1XYO A;  2P6C A;  2W0X A;  2Y6L A;  4P9L A;  4QPI A;  3UGH A;  3WNX A;  1JYN A;  1SQ4 A;  1YQ6 A;  2OT7 A;  1UY4 A;  3OJB A;  3VKM A;  3UK9 A;  3ZR5 A;  5BUV A;  3ZKU A;  2ZGM A;  2VZ3 A;  2E31 A;  1IG0 A;  4K1Z A;  3OBR A;  2ILM A;  4JV4 A;  3BI3 A;  4FPO B;  1EY2 A;  3PUR A;  4M0H A;  2FDG A;  4AVA A;  1RUJ 2;  4YW5 A;  3PL0 A;  2H6C A;  2DTW A;  2BGO A;  2Y33 A;  2VUA A;  5FMO S;  3DXU A;  3ZSM A;  4Y20 B;  1GWK A;  3DPR C;  5FP8 A;  2QUO A;  4QX8 A;  1W2A X;  5FRE A;  3BUC A;  3VBU B;  1K5M A;  1EV1 1;  2D5H A;  1BVV A;  1QIQ A;  4P9W A;  3HOB A;  3IPV B;  1BKZ A;  2W1Q A;  1X36 A;  3L9J T;  4KMQ A;  1ZX5 A;  1O5U A;  2DVB A;  5HPO A;  1W8U A;  2JG9 C;  1LOG A;  1AX1 A;  1VBD 1;  4WZC A;  3A7Q A;  2OYZ A;  2IVJ A;  3AJZ A;  4Q4W 2;  5CVR A;  2ES3 A;  5EJZ B;  5J48 A;  5DDJ 2;  2VNV A;  4B4Q A;  1UMI A;  1LEC A;  2HWD 2;  3PIJ A;  4I2O A;  5FP4 A;  4PDW B;  4Y20 A;  3F2Z A;  1JZ6 A;  3RZK A;  2WQ4 A;  2PAK A;  2P1B A;  2VBB A;  4P9Y A;  3TB0 A;  3TN9 2;  3VBU A;  4GJZ A;  1QJE A;  1VB2 A;  1FV3 A;  4HVO A;  2R0F A;  4LEJ A;  4CDU B;  3RZG A;  4NMI A;  4AQ6 A;  2BVV A;  1Q8O A;  1W04 A;  3GBW A;  5C3O A;  3FLP A;  4PI2 A;  3POS A;  4CPB A;  1AXZ A;  4AVS A;  3RWK X;  4Q29 A;  5DUV A;  2A75 A;  2X10 A;  3K51 A;  4XAE A;  2WT1 A;  2X8K A;  2PHR A;  4YW6 A;  3I54 A;  3VHN A;  5EWS A;  4CYD A;  4BIF A;  1U12 A;  5JXJ A;  2WDB A;  5DUU A;  5I8T A;  1JXN A;  3AZZ A;  4LHN A;  2CGP A;  2VVE A;  5DN2 A;  4XIK A;  4YFW A;  5GLU A;  2DUR A;  1HQW A;  3QH7 A;  4FXG B;  4H14 A;  3ZIX A;  3V65 A;  1HQL A;  2PLV 1;  3EJK A;  5FPZ A;  5A7P A;  1S2E A;  2ZPX A;  4QKN A;  3P1I A;  4LOR A;  1IQD C;  2OW4 A;  4CU6 A;  4UT5 A;  3MZH A;  1ZRC A;  4BE3 A;  2JX9 A;  2YRO A;  1BHG A;  1EV1 3;  4PDW A;  5I8S A;  4YAR A;  2ZGS A;  1AL0 G;  4N43 C;  4RHV 1;  4AAP A;  3VDC A;  4AFB A;  5F2W A;  3ACH A;  3O7O A;  4AAX A;  1IS5 A;  5K0U B;  2SBA A;  2XJT A;  3OEA A;  3Q8F A;  4ZZ5 A;  2FDK A;  1DQ2 A;  2V09 A;  3BOW A;  2EF6 A;  2G19 A;  4RS5 C;  1VBD 3;  4CDW B;  2R1D A;  5A3N A;  4QPI C;  3ATG A;  2ERF A;  4EWA A;  4YM3 A;  2DYC A;  3AP6 A;  2BU9 A;  5FOB B;  1LHV A;  2WYF A;  4LHL A;  2HYX A;  1Y9Q A;  2QQM A;  3KCX A;  5EHD A;  4Q8K A;  1O3T A;  4O9E A;  5CB7 A;  5IK7 A;  2UY9 A;  1H9P A;  2YC4 A;  1KGY A;  1GZT A;  1X7N A;  3LAG A;  4LE4 A;  2I45 A;  4IXL A;  1NXD 1;  4Q8L A;  2ENR A;  2GP5 A;  4LBJ A;  3VLB B;  1OPO A;  1IKP A;  1GNZ A;  2YC0 A;  4EZ4 A;  4K6B A;  1K5M C;  3BOD A;  1F5F A;  2XQR A;  3MID A;  2ZHK A;  2DCY A;  4XET A;  4IND A;  1HJG A;  1R09 1;  2QQN A;  2KM2 A;  1OA2 A;  2CDO A;  3WUC A;  1TME 1;  3ZFE B;  4C1X A;  4D6Q A;  2W92 A;  2IUW A;  5IK4 A;  1X8E A;  1ZBE 1;  5K0U A;  2XJP A;  1FOD 2;  4M3C F;  3PVE A;  3NNJ A;  3VKN A;  2BGC A;  4Q4Y 2;  2QQW A;  4CDW A;  2W5F A;  4NUB A;  3E6D A;  3UKN A;  1GBG A;  1TQ5 A;  3RRD A;  3IKW A;  4BQ2 A;  5T5L A;  4CP9 B;  1IPJ A;  1PMI A;  2PLV 3;  1JOJ A;  3TYJ A;  1VLN A;  3QBQ A;  1VAL A;  4QDR A;  2IXI A;  4IEZ A;  5KHJ A;  1NE6 A;  3KD4 A;  2BNN A;  4L2N A;  1SLL A;  4B3N A;  4LT5 A;  1UIJ A;  5FPA A;  3ZXL A;  3VBR B;  3MW3 A;  1XQN A;  2VTX A;  3PNA A;  1UY0 A;  4NWV A;  4RHV 3;  4XTM A;  1HRV 2;  2PHU A;  3H7J A;  2W9X A;  5J98 B;  4K7J A;  3T2Q A;  1FYU A;  2RV9 A;  3POB A;  3O14 A;  2R32 A;  5FMB A;  2XBO 1;  4QXB A;  1W0O A;  1MVQ A;  2FZ1 A;  1V9U 2;  3ZFE A;  1OLR A;  1JYT A;  1S2B A;  3I97 A;  1KXG A;  3CIH A;  5FY4 A;  2VUL A;  1YFX A;  1FAT A;  1KD7 A;  2VOV A;  3VKF C;  1G9F A;  1JYI A;  1H2L A;  2XL7 A;  3UGF A;  4QXH A;  2RE9 A;  2FHR A;  1AXY A;  1OPM A;  3LOI A;  3M3O A;  2WNV A;  3FHA A;  1H1A A;  1H2N A;  3PVB B;  3J7H A;  5EP9 A;  5FK7 A;  4CP9 A;  4XYX A;  4OQ8 A;  3I59 B;  4PIY A;  1CJP A;  1QJU 1;  3T0A A;  2FCV A;  3IMM A;  2O1Q A;  2PMW B;  5IVJ A;  2GU9 A;  5I91 A;  1XU1 A;  3RZH A;  3VBR A;  1VMF A;  4PDW C;  2TNF A;  2YBS A;  4FI9 A;  2Q8E A;  4C90 A;  1R09 3;  1UX6 A;  2WWJ A;  3ELN A;  4YG3 A;  3SNM A;  1TME 3;  3ILN A;  4CSW A;  3OEB A;  4COV A;  1ZBE 3;  3JXS A;  5D2A A;  3IAP A;  2YGM A;  1JOD A;  2WIN B;  4Q0Q A;  3SEE A;  4EYU A;  3ZXE A;  3DKQ A;  1GU3 A;  1US3 A;  2J1E A;  2SLI A;  4YWA A;  2VBP A;  4AI9 A;  4CVU A;  2BRT A;  2R07 2;  3N7L A;  2Y6F A;  4LO6 B;  3I59 A;  1ULF A;  5JVV A;  1LCL A;  3KM5 A;  5FFO C;  5I0R A;  2PXJ A;  4D7S A;  3OGS A;  5A1F A;  3N7M A;  1FX5 A;  4XUT A;  3ZPY A;  2XVL A;  4FP2 A;  1BK0 A;  4LIT A;  3WDW A;  1PX3 A;  5FYZ A;  4ES9 A;  5BNO B;  2XBO 3;  1LEN A;  3T2O A;  5LZ6 A;  1UOB A;  2WA3 A;  5K0U C;  3L2Y A;  4XIO A;  5A80 A;  2ZAH A;  3PLQ A;  1JYW A;  1JU4 A;  3OG2 A;  4JQR A;  4CA9 A;  3CLP A;  4CDW C;  2W1U A;  3LD8 A;  3NJX A;  5FYT A;  3SCH A;  1A78 A;  1H8V A;  5LBE A;  2BTV C;  2ET1 A;  3KMH A;  3CNA A;  4AGG A;  1H1I A;  2WQ8 A;  4MZU A;  4Z1V A;  3WG4 A;  3SQO A;  5FZC A;  1RUE 2;  1QJU 3;  1QGL A;  4MOA A;  5AFE A;  2WS9 1;  2PYT A;  3RGB A;  2B7Y A;  1JZ2 A;  3PTY A;  2WYS A;  2VCM A;  2AAC A;  4RL7 A;  3J4U H;  3UV9 A;  4C0H A;  4AHY A;  1Z7S 1;  2BFU S;  1FPN 2;  1W2T A;  2WKK A;  3OGG A;  2ZGU A;  5DAB A;  2RS5 1;  5BNO A;  1JUI A;  4NOT A;  1G86 A;  5ACA 1;  5DQ0 A;  3NO8 A;  3VB9 A;  1ZM1 A;  4HBN A;  3ZFE C;  4XTP A;  5ABJ B;  5G05 L;  2GSY A;  3LGR A;  4MO3 M;  3FWE A;  4XBL A;  1MS5 A;  4V1P A;  1ND2 C;  1UKR A;  4JDN A;  3THC A;  3TWI A;  3USU B;  4AED B;  3J26 N;  3K4Z A;  5A7O A;  4JGY B;  1PGS A;  2JE9 A;  2WNV C;  2IC1 A;  4KGG A;  4Y1Y A;  4Y24 A;  1UCX A;  1KIT A;  1WBL A;  5A33 B;  4Q0S A;  4FQ4 A;  4UF0 B;  1ZRI A;  4P02 B;  3DF0 A;  2JD9 A;  1ACC A;  4IE4 A;  3S7I A;  3ZO0 B;  1S2K A;  3U4X A;  1J83 A;  4FTS A;  4M3C E;  3WDV A;  3QCW A;  3OY8 A;  1X33 A;  2PAM A;  2IVI B;  2VQ0 A;  1XPW A;  4GZ9 A;  4LPL A;  4COZ A;  3VBR C;  5A3T A;  1CPM A;  2VZU A;  4M00 A;  3TNQ A;  4JDM A;  1MEC 2;  1RYY A;  3SEP A;  4DXT A;  4E8D A;  1YIP A;  4ZZ8 A;  2P34 A;  3DV8 A;  4XAA A;  1X82 A;  2AGS A;  3AP7 A;  1W2N A;  1TG7 A;  5CFC B;  4GQ7 A;  5JOX A;  4N7I A;  1JZ5 A;  3I2O A;  2GAU A;  3B69 A;  3QH6 A;  5JUV A;  4XZP A;  1YQ5 A;  2ARB A;  3PUH A;  1TEI A;  5DPN A;  3USU A;  4AED A;  1UYZ A;  4LBK A;  4JGY A;  5DAX A;  5FPV A;  1UZZ A;  4BCU A;  2WS9 3;  4DFS A;  5A33 A;  1B35 B;  3T4V A;  1UXZ A;  2AYH A;  4LOS A;  4IGO A;  5C6C A;  5LK5 A;  3HN1 A;  1AYM 1;  1Z7S 3;  1UL9 A;  1VBB 2;  2WNU B;  5FZ1 A;  5L73 A;  2OKX A;  3UL2 A;  3ZSK A;  2IFW A;  1C8M 2;  4FPH A;  1MVE A;  2YPD A;  1GYK A;  1TE1 B;  1VAM A;  2RS5 3;  1OH3 A;  4GAZ A;  5ACA 3;  4LHS A;  2VW2 A;  1NXM A;  2IXL A;  2ZXQ A;  5D1I A;  4S2G A;  5DUX A;  4CXW A;  3V0A B;  4FPL A;  3F95 A;  1ALY A;  1ZA7 A;  1OUR A;  5F3E A;  5CFC A;  2XLF A;  3WV6 A;  1VAK A;  4FPC A;  3H7Y A;  4P9X A;  3WNP A;  4Z82 A;  3C7E A;  2PN5 A;  2NMN A;  3H50 A;  5FLI A;  1NY7 1;  4A41 A;  5FYI A;  1E5R A;  3M2M A;  2JE7 A;  3V0B B;  1S0C A;  3NV3 A;  1SMV A;  1AJO A;  2Z5W A;  1PMJ X;  4FPK A;  1IS6 A;  3KQ4 B;  4OHX A;  5K8S A;  4TWT A;  3NNL A;  1B35 A;  4QU1 A;  4R9A A;  4ZU5 A;  4A3Z A;  3FHI B;  1F2N A;  3WLU A;  2ZCW A;  2WNU A;  1MR5 A;  2Q1F A;  1WCS A;  3QOP A;  3B9C A;  3SCF A;  4AWD A;  3KVA A;  5F5C A;  1I9R A;  1MS1 A;  1U5I A;  3K77 A;  3RZZ A;  4RN5 A;  1TVG A;  5BNO C;  2P37 A;  4IE0 A;  1Y7B A;  4Q4X 1;  5H9S A;  4BOW A;  3OUJ A;  3KZ4 C;  5LCW L;  1OFS A;  5T55 A;  4ES8 A;  2EXJ A;  2ZZJ A;  4LHK A;  2QQL A;  3MLJ A;  4QX0 A;  4DUX A;  2ORZ A;  2KD7 A;  2A3Y A;  1L7R A;  3SIT A;  1UZW A;  2VEC A;  5F5A A;  2DVD A;  4EQV A;  2J1R A;  1CGP A;  2VOW A;  1HRI 1;  1LRH A;  2P3K A;  1AYN 2;  3NST A;  3WDU A;  3SC7 X;  3HT1 A;  4B7E A;  3WHU A;  1NT0 A;  1QEX A;  4CCM A;  1GOG A;  4XVH A;  1A8D A;  3IDA A;  3N9O A;  3V0B A;  3ZXA C;  1AYM 3;  3WQ0 A;  1H2M A;  1JYV A;  2QZ2 A;  1Q56 A;  3POG A;  1QMJ A;  5F5I A;  1WGP A;  2DUO A;  4YM1 A;  4CUC A;  3RZM A;  2TUN A;  2E7Q A;  4PHZ A;  1BBT 2;  4UFI A;  5A7N A;  1QHD A;  1SPP B;  3LF7 A;  3LWC A;  2BQP A;  2EXI A;  2XHN A;  2Y60 A;  4S2D A;  2E7T A;  3AYE A;  1UZV A;  2QQK A;  5C3P A;  1NG0 A;  4B1M A;  2Z2S B;  5SV5 A;  1FAY A;  3T08 A;  4BWO A;  5CBL A;  5IFP A;  1Y9M A;  3BYW A;  1H30 A;  1VJ2 A;  1GWM A;  1IPS A;  1APN A;  1WBF A;  2EIB A;  4AK3 A;  2J1U A;  2BUK A;  3OBZ A;  4YZ5 A;  1PVC 2;  5FYC A;  4XBQ A;  1RUI 1;  3ZYB A;  1NCQ B;  4AZZ A;  4BHP A;  1RIN A;  4R9D A;  4NPL A;  3X29 B;  4FPE A;  5JOZ A;  2HKX A;  4AED C;  3ALQ A;  1AXK A;  1EV1 2;  1ZRD A;  4LKE A;  4JGY C;  5KC5 A;  4Y22 B;  3NJY A;  4XDO A;  5FZD A;  2R30 A;  2RDQ A;  1KRI A;  3T09 A;  1DLL A;  1HQN A;  2Y6J A;  4BLI A;  4W4Z A;  3DL3 A;  5CIS A;  2MNG A;  3WP4 A;  2DVA A;  1W90 A;  2ZJC A;  4LO4 B;  2C6S A;  3POE A;  1XSQ A;  4Y4R A;  1OUS A;  1VBD 2;  1KJL A;  3HMY A;  4MGS A;  3UET A;  2BBA A;  2ZGL A;  3WD5 A;  2GC3 A;  1PGW 1;  4CEY A;  5JDB A;  4C0B A;  5A3U A;  4Q4X 3;  2VZO A;  3VKL A;  2HWF 2;  2PHF A;  2VVD A;  1CAW B;  1JS9 A;  5FY9 A;  2I2S A;  2ZGK A;  3CU7 A;  1ULG A;  3RFR A;  4TYS A;  4FPJ A;  4BQW A;  4EN6 B;  1IS4 A;  1HRI 3;  2W87 A;  4LBM A;  1KS5 A;  1UOF A;  4QPY A;  3UNP A;  4EN9 B;  4Y22 A;  2B45 X;  4BH9 A;  2D5F A;  4MUV A;  2ETE A;  5A6Z A;  4X8P A;  4YNI A;  4J6G A;  2VUD A;  1QJF A;  1W6P A;  2XJS A;  3TEX A;  2D6K A;  1LOB A;  2R6Q A;  4GWJ A;  2WNU C;  3AFG A;  3AVS A;  4KI5 M;  2A1X A;  2WLQ A;  1LJ7 A;  1UMZ A;  2ZBJ A;  4PLO A;  5GLZ A;  3BTX A;  2V4A A;  3OPT A;  2C1F A;  2F4L A;  1V00 A;  4M01 A;  4QX2 A;  5GZF A;  1ZZ9 A;  2G1M A;  1WW4 A;  3GZE A;  3WW4 A;  3R05 A;  4DXR A;  1G9D A;  2LS6 A;  3HN3 A;  1Q8P A;  1XYN A;  4B4P A;  5FPX A;  4J1X A;  2CWM A;  4GKX A;  2R7E B;  2PLV 2;  5GLV A;  4XOG A;  1BEV 1;  1CAW A;  5FPL A;  1LKN A;  1RUI 3;  4OUM A;  5KXD A;  4PCR A;  2XLG A;  2WJS A;  2C9A A;  4R52 A;  1CAV B;  2E51 A;  5HXM A;  2QQU A;  1VP6 A;  3WF0 A;  3WP3 A;  4RHV 2;  3FFZ A;  3AP9 A;  3IM0 A;  1E5S A;  1BJQ A;  4OZO A;  3ZYP A;  2XWJ B;  3B9I A;  4JQT A;  1COV 1;  1UD1 A;  4UFH A;  1RL3 A;  2D44 A;  5CFD C;  5CEH A;  2ZEX A;  1UZY A;  1OH4 A;  2YUE A;  3GAL A;  1BK1 A;  1RC6 A;  4MH0 E;  1HV0 A;  4RGA A;  4PIZ A;  5JI9 A;  5HV0 A;  5B4X A;  3WP6 A;  4QHB A;  4I3G A;  2JDP A;  2XJQ A;  1CPN A;  5C71 A;  4Z2W A;  4YGD A;  3WZ1 A;  2EA7 A;  1G8W A;  1XNK A;  4YGC A;  1JHJ A;  3BGA A;  1W9F A;  4SBV A;  3O1T A;  3K4D A;  2Y34 A;  1MQT A;  2LRP A;  3BTY A;  3O1P A;  3NKG A;  3A23 A;  3LEI A;  1ZZ7 A;  5GZC A;  2FDH A;  3AKR A;  4HVQ A;  1CZT A;  1HN0 A;  2JB8 A;  4OHV A;  1ENQ A;  1R1A 1;  4HSJ A;  3MIC A;  3ZXJ A;  3CJX A;  3VD5 A;  3MIF A;  3H1M A;  1OI6 A;  5C33 A;  1QNW A;  5LA0 A;  3DEC A;  3GJA A;  4R4Z A;  1GLH A;  2P5B A;  1WW7 A;  1ZBE 2;  3E6B A;  4LK6 A;  4YW3 A;  3SH5 A;  1NQD A;  2TBV A;  3O0X A;  3E97 A;  1QQP 1;  2YGL A;  3MEP A;  5ANN A;  2WWU A;  3AP4 A;  2ZTN A;  4R4X A;  1FT9 A;  1WCD J;  3HR9 A;  1OQD A;  2D97 A;  4XC9 A;  1XE8 A;  1LHN A;  2JDK A;  2Z4F A;  2ZGR A;  3ZVX A;  4AG4 A;  4BME A;  4CEY C;  5FY8 A;  4NIA A;  1O4Y A;  5IWF A;  4MG2 A;  5KXE A;  3D3A A;  3UJQ A;  3AZY A;  2XUE A;  4MGQ A;  2ZZQ A;  4EN8 B;  2PAE A;  4YVS A;  4YFZ A;  4QD2 A;  1BEV 3;  3S6P A;  3SIS A;  1CN1 A;  3WP5 A;  5C3Q A;  3FHQ A;  4RD7 A;  2R49 A;  3HAG A;  3KT1 A;  4EZH A;  2XPJ A;  3S57 A;  3RYK A;  3ZSE A;  4Y33 A;  4CCN A;  4XFI A;  4UYB A;  5FY5 A;  4K20 A;  2JKB A;  4K8F A;  4O7X A;  5BNN C;  5IVE A;  1COV 3;  3JQW A;  3KT7 A;  4XMA A;  1WWY A;  4YG6 A;  3RSJ A;  2XBO 2;  3AYD A;  3EO6 A;  4URT A;  5CG9 A;  3H8U A;  1M06 G;  4PI0 A;  4LBN A;  2HEW F;  1ULP A;  4K3U A;  4OFG A;  3VZK A;  3FBY A;  4UW5 A;  1LHU A;  3P5B A;  1SCR A;  1EPZ A;  4BA6 A;  4BQ5 A;  1J1L A;  5E89 A;  4A6S A;  4DQA A;  1YYN A;  2VMC A;  4EN0 A;  4DUV A;  2KA3 A;  3D82 A;  3I2D A;  4XFC A;  4J1W A;  3IWZ A;  4I09 A;  3NRU A;  5BPX A;  3Q8E A;  2UUR A;  3ECQ A;  1DZT A;  3KF3 A;  1QJU 2;  1G9B A;  4NE9 A;  3BKZ A;  3BOP A;  2MEV 2;  3HT2 A;  1LES A;  4Y3O A;  2C26 A;  2NYY A;  1POV 0;  1YEW A;  2XQX A;  3R4D B;  4J25 A;  4XBN A;  2CL2 A;  2VQA A;  5DAV A;  5FO8 B;  1R1A 3;  3I2K A;  5C8W A;  4GAL A;  5F6K A;  4K9S A;  5L19 A;  1ULE A;  3AP5 A;  3VBS B;  1AR6 1;  5C9A A;  4D69 A;  5KHG A;  3PUQ A;  3OB8 A;  4XFG A;  3ILF A;  5LAS A;  1YLL A;  1QQP 3;  1RIT A;  2OII A;  3NVC A;  3CZJ A;  3VN4 A;  5D21 A;  1UU6 A;  5FR3 A;  4GIQ A;  5H9P A;  3SLI A;  2GH8 A;  4QXC A;  3VHP A;  1NZC A;  2ZMN A;  3M3Q A;  2AC1 A;  3AYC A;  3TEZ A;  3PDQ A;  2Q5T A;  1W3V A;  5A7W B;  2XKP A;  1O3S A;  1H8T A;  4XUP A;  1NCR B;  1OQ1 A;  2QQV A;  3ZYF A;  4PT6 A;  3H8O A;  3NMB A;  4V2W A;  1N1Y A;  3WW1 A;  2CTV A;  2MHF A;  2ADE A;  1MQT C;  2BVB A;  2O8O A;  4XFB A;  3LA7 A;  1MAC A;  4WVW A;  5DUW A;  2XGX A;  5I0T A;  5FYY A;  4JHZ A;  2RG4 A;  3AM2 A;  4DIQ A;  1V70 A;  1O6U A;  4E4S A;  3VBS A;  1D4V B;  5I93 A;  1UNB A;  4FP3 A;  3AKP A;  5BNP B;  4YW7 A;  3ZN6 A;  1YHF A;  5T5J A;  1C4R A;  3B7M A;  1V6J A;  3ST7 A;  1FMD 1;  4LO5 B;  3TEY A;  1VE0 A;  4NPM A;  1RUF 1;  2WAO A;  3J8F 1;  4LR4 A;  4BK4 A;  4XUO A;  5A6Y A;  2VTF A;  3AKS A;  3ETP A;  2CGO A;  3BN6 A;  3GYD A;  3H3Z A;  3KCY A;  4XQD A;  3LSD A;  5A7W A;  4CCO A;  5EFU A;  1SZB A;  1NCR A;  4YVS C;  5GLT A;  4D6S A;  2WO1 A;  2WS9 2;  4N9H A;  1AL2 2;  4MGT A;  3GZT B;  5JIA A;  2B9V A;  5F3G A;  1GOH A;  5LEK A;  1H1M A;  1V6L A;  5KWR A;  1F35 A;  5F3I A;  4ZXE A;  4Z07 A;  3DYP A;  3MLL A;  1AR6 3;  4U2A A;  5FIX A;  2JEM A;  1VAV A;  2OQ7 A;  1F31 A;  2RS5 2;  3ACL A;  4BQ1 A;  2BWC A;  1QOO A;  5ACA 2;  3CBN A;  4XF9 A;  2JIJ A;  1KDM A;  5IVV A;  4AGV A;  4H2A A;  5BNP A;  1QNY A;  2B46 X;  2E33 A;  1UY2 A;  2VZS A;  4W6X A;  5J3U A;  3ZYG A;  1N1T A;  2D3P A;  2WBK A;  2WR9 A;  4GH4 C;  3D8C A;  3VV1 A;  2A70 A;  1CAX B;  2B39 A;  2PEL A;  5IFT A;  4O65 A;  2XHK A;  4M4P A;  2ARA A;  5F6L B;  4Z92 B;  3S5A A;  4N9I A;  3U14 A;  3W21 A;  5B2G B;  1T2X A;  1QDO A;  3FE5 A;  2XML A;  2DWR A;  2WN3 A;  1PNG A;  2VUC A;  2W91 A;  3NJV A;  4KWL A;  5FOJ B;  3IPV A;  4NII A;  2C4X A;  2QTW B;  5FCC A;  2VMI A;  4GJY A;  1JI6 A;  2J7M A;  3R4S A;  5FYM A;  5C9A C;  2HWC 1;  1POQ A;  2Y6H A;  4UWD A;  4BK5 A;  2FZ2 A;  4NHY A;  2N7G A;  1FMD 3;  4HFS A;  2EAL A;  1RUF 3;  3J8F 3;  3LB9 A;  1V6O A;  2YPJ A;  1WMX A;  1O7F A;  3AX4 A;  4UFJ A;  2W46 A;  1XYP A;  2A6V A;  3ZM8 A;  1VR3 A;  5AC9 1;  1H8T C;  1UN1 A;  1RED A;  2ZX3 A;  4RFR B;  4QQP A;  1PIV 1;  2CGN A;  4KU8 A;  1AR8 1;  4Q0V A;  5JXI A;  3SCG A;  5IAV A;  5JCT A;  5CYY A;  1WD3 A;  1BMV 1;  4HON A;  4Y26 A;  4XDP A;  2ZS6 B;  1AYM 2;  5JSP A;  2YBP A;  3MBW A;  4CDU A;  3SH4 A;  3W5N A;  2WNE A;  1OLQ A;  4HT1 T;  1OD5 A;  1RHI 1;  1RIR A;  1TNF A;  5BXX A;  4PF5 A;  3GF6 A;  1CVN A;  3I3D A;  2P17 A;  4FO9 A;  5DZF A;  3UES A;  3MO4 A;  1AX0 A;  1J3P A;  5EYX A;  4YG0 A;  5FY1 A;  2JDY A;  3VBS C;  4QQH A;  4OUL A;  2XUM A;  4YPJ A;  4NAM A;  2JEC A;  5IW0 A;  5ERL A;  2VE1 A;  3D0S A;  4GWN A;  3AKT A;  4UFL A;  4E9K A;  3OYW B;  4MGZ E;  4B1L A;  2DUP A;  1LEM A;  4ZXK A;  2E26 A;  2UYA A;  1VBA 1;  4DRV A;  3JB4 C;  4W6Y A;  1UPS A;  5FYS A;  5GKA C;  2Q8C A;  3UYJ A;  2ARX A;  3LIH A;  2K0G A;  3MIE A;  4A42 A;  3AMQ A;  4I01 A;  2J1V A;  2DU1 A;  3PIG A;  3H1Y A;  1NCR C;  4XQ4 A;  4PQ9 A;  4DXS A;  4W50 A;  1W8H A;  5FYV A;  3RMX A;  1LAJ A;  2ZGN A;  2WO2 A;  1WME A;  3FFQ A;  3ILR A;  1PO1 2;  3O1M A;  3VZJ A;  2OUJ A;  1W8Z A;  1W99 A;  1N1S A;  1POV 1;  4FXK B;  5AFB A;  4RSU A;  1K3I A;  4ZS2 A;  2VAU A;  1UMH A;  1NE4 A;  1WW5 A;  1W39 A;  3ZSJ A;  2Q4S A;  2A7A A;  4CCC A;  4OLL A;  3DEM A;  3LDB A;  1YJK A;  2HWC 3;  4JX0 A;  2D43 A;  4C8D A;  5L7O B;  5LRS A;  5I8Y A;  4Q4X 2;  2ZGT A;  1RXF A;  3UKV A;  3JB8 A;  4NID A;  3E5Q A;  5BNP C;  1UY3 A;  4UAP A;  3URF A;  3OYW A;  3BPS A;  2BBV A;  3ZDV A;  5B4N A;  2GDF A;  3O0V A;  1JZ7 A;  2QKD A;  1S0F A;  3OGV A;  4AVB A;  5AC9 3;  4AOC A;  3ENR A;  1HRI 2;  1PIV 3;  1CIW A;  2ZAB A;  1AR8 3;  4YM2 A;  3VBF B;  1ASJ 1;  1W8W A;  3LDR A;  1LGC A;  1WLW A;  1K5J A;  1F8V A;  4MX3 A;  2D6P A;  4UOJ A;  4IUG A;  3VBU C;  1LU2 A;  2VOX A;  3AJY A;  4L11 A;  5G04 L;  3VUO A;  2W68 A;  5EV7 A;  1RHI 3;  2UY8 A;  3J7L A;  3DN7 A;  3NQH A;  2ZX2 A;  5E88 A;  2QDR A;  2YBK A;  3C2U A;  4L99 A;  4YW2 A;  5C4W B;  4FFI A;  5JMO A;  1S4C A;  1DQ6 A;  1GOF A;  2A5Z A;  2VC9 A;  1RMU 1;  1GP6 A;  5L7O A;  3ZX7 A;  1ZBA 2;  3FBM A;  5T3N A;  5FZA A;  1VBA 3;  1H2K A;  3NV4 A;  4MYE A;  3D6E A;  1RUI 2;  1WCK A;  2BER A;  2ZHN A;  3B02 A;  4IDZ A;  1G9A A;  5C8C B;  4CCK A;  2ARE A;  3HPN A;  2ID4 A;  2LW8 A;  2W39 A;  2ZX0 A;  2VXR A;  2VZV A;  5FPU A;  4MLO A;  2VXJ A;  3VBF A;  4HG6 B;  3WR0 A;  3MIG A;  1ZZ6 A;  1XJA A;  1HX6 A;  2EVX A;  3OGJ A;  4QHZ A;  1IG3 A;  4WVM B;  1GZW B;  2WT2 A;  3V56 A;  1POV 3;  3C8X A;  1DZQ A;  2ZHL A;  1H4H A;  3UT0 A;  2XJV A;  3I2J A;  2OQ6 A;  4PLM A;  4CDU C;  3RVH A;  1A3K A;  1BLZ A;  2OZ6 A;  3OPZ A;  5L9B A;  3BTA A;  4X6R B;  1W6O B;  4MHU A;  4NHL A;  4OVE A;  1PGW 2;  1EUT A;  3FMG A;  1NA1 B;  1Z0H A;  2ZEY A;  3K3O A;  1O3R A;  3IB3 A;  3MUZ 1;  4IV3 B;  4BIS A;  1W6M B;  4IER A;  1S1A A;  2ADD A;  2BJS A;  3N4M A;  3MW4 A;  5DZE A;  3MYX A;  1VMJ A;  3NL1 A;  2RR1 2;  3NNG A;  1JU3 A;  4Q4V 2;  2JE8 A;  4A44 A;  1H9W A;  1W06 A;  3AL5 A;  2WZ8 A;  4P00 B;  1CX1 A;  3IIA A;  3POY A;  4LJH A;  4KNC A;  5C8C A;  1K42 A;  2BNM A;  1ASJ 3;  5IVC A;  2VGD A;  1S0G A;  1Q3E A;  2FMD A;  3QAC A;  4NHM A;  4GD4 A;  5LEJ A;  4AFD A;  3RZJ A;  5LBB A;  2W94 A;  3M4F A;  3GDB A;  3NV1 A;  4JRA A;  5K9Y A;  3BCW A;  3MFC A;  1QXJ A;  1DZR A;  3OTF A;  1W8O A;  1A34 A;  1X8M A;  3U11 A;  4CEW B;  2A6X A;  1U5Y A;  1W6O A;  1DGR A;  4AFM A;  1WA6 X;  1RMU 3;  4O9G A;  1NA1 A;  4AGR A;  2JJ6 A;  2GC1 A;  5CAD A;  1XNC A;  2ET7 A;  3SMH A;  1O8P A;  1S0B A;  2WZR 2;  2RJL A;  1OSG A;  4IV3 A;  4PJY A;  4P9G A;  1RUO A;  1W6M A;  1BEV 2;  1EUU A;  2WL1 A;  4Y1V A;  1JYC A;  1BQP A;  4ERO A;  5FZE A;  1UU5 A;  2WII B;  2VMD A;  4MGY E;  3HNY M;  2VNO A;  1FNY A;  2UWC A;  4L92 A;  4QT6 A;  4FOW A;  1D0H A;  5AVA A;  3C7H A;  4QDQ A;  4WM7 B;  1COV 2;  1QY4 A;  3S5Q A;  1E57 A;  2JDZ A;  5CKQ A;  2RHP A;  3ZXG A;  1GP4 A;  4CU9 A;  2VQU A;  3B3Q E;  3VHR A;  4DY3 A;  2WO7 A;  4LLF A;  1O5L A;  2VBD A;  2WT0 A;  1AZD A;  2RS1 1;  1XBF A;  3MPB A;  3GHM A;  1OBN A;  5D8A B;  1PVX A;  4AI0 A;  4P9I A;  4QMA A;  1VRB A;  4K21 A;  2LUW A;  5T5P A;  4Q2F A;  2D6L X;  4I30 A;  3WNL A;  1QU0 A;  5FXX A;  4R8H A;  3WF3 A;  1OD3 A;  4HOO A;  5GZG A;  5KR7 A;  2JB4 A;  5EQU A;  1YFU A;  5L7O C;  1ZRE A;  1DG6 A;  2V5D A;  4CUA A;  1CWP A;  3GCW A;  3POW A;  3MV1 1;  2E7A A;  1DQ1 A;  1WCQ A;  4QGN A;  5FLJ A;  1R1A 2;  3ZLI A;  1HB3 A;  3KS7 A;  1H6Y A;  1PHM A;  1DBN A;  1TNR A;  1C28 A;  3A22 A;  2ZX1 A;  3N9P A;  4N7U A;  3VBF C;  3FUO A;  4WM7 A;  5IUQ A;  1FNZ A;  2RVA A;  5IT6 A;  1OOP B;  5JMC A;  5EJ1 B;  4NRM A;  5LA2 A;  4IEY A;  4NO4 A;  2OPK A;  4BDV B;  2Q30 A;  4JAA A;  2LTN A;  2VPV A;  3AFK A;  1Y4W A;  3CDZ B;  4XJA A;  2MPF A;  5ABJ A;  2TEP A;  4N53 B;  2WAB A;  1SLA A;  2PHX A;  1D4M 1;  4Q0P A;  4ZON A;  5L36 A;  5KC6 A;  4Q0U A;  3TN9 1;  3ME2 A;  1REE A;  4CCE A;  2PHL A;  3OD0 A;  4IL7 A;  5ISL A;  1MZ5 A;  4QKF A;  3ZFF B;  1OA3 A;  1ZNP A;  3N36 A;  4UF0 A;  4XIL A;  5C8C C;  3T0B A;  2OXB A;  1XU2 A;  4OMC A;  2I07 B;  2VW1 A;  3WT3 A;  3J7M A;  1D7P M;  3ZOI A;  4XF1 A;  5A3M A;  2ZKL A;  3ZMN A;  5LK7 B;  2RS1 3;  4XF3 A;  4ZY9 A;  5CA6 A;  3GBG A;  4NRP A;  4MGI E;  2DUQ A;  5KXC A;  5DG2 A;  2QNK A;  2WLP A;  3J9S A;  3LA3 A;  3LOB A;  1Q8S A;  3KWV A;  3N3H A;  4UFM A;  3INA A;  1NA1 C;  5FMO L;  3WF2 A;  3WF4 A;  2AEY A;  2DVG A;  4XAB A;  4NVP A;  2HYK A;  4N53 A;  2FBE A;  3CEW A;  5IVY A;  1URX A;  1UKG A;  2EXH A;  3EMR A;  2RS3 1;  4L97 A;  1E5H A;  4DB5 A;  5FXZ A;  5I0U A;  5EXO A;  2Q8O A;  3RI8 A;  3DGT A;  2AEN A;  1MS4 A;  4LUK A;  4SLI A;  4YVW B;  2GH2 A;  5T5O A;  2P3I A;  2G9Z A;  3WNM A;  1AR6 2;  1F5J A;  1VBE 1;  3ZMO A;  3AB0 A;  4AEJ A;  4HKL A;  2PHD A;  4KL1 A;  1TMF 1;  4TXW A;  4XXA A;  3ZYR A;  2YYO A;  4BB3 A;  2OX0 A;  4E2Q A;  4DRR A;  2PHW A;  4NR1 A;  2FDF A;  2EIE A;  4AW7 A;  1OLM A;  5J1X A;  2VOT A;  2X29 A;  3DYM A;  3O1U A;  3V0A A;  4L8Q A;  4O61 A;  1JW6 A;  2NZ9 A;  1D4M 3;  3BVC A;  1R08 1;  4XF4 A;  1IOA A;  1YQC A;  3TN9 3;  3ON7 A;  2CY6 A;  4I02 A;  5FRA A;  1F4H A;  4WBB A;  5FY0 A;  3CQO A;  1REF A;  4DEQ A;  2JIG A;  2J42 A;  5E6H A;  5HCF A;  3PTR B;  4OHZ A;  4OI1 A;  3ZPO A;  5KHH A;  3JZV A;  1YO8 A;  2BDR A;  4DY5 A;  1O3Q A;  3S7E A;  2WWS A;  2HH9 A;  3G7D A;  3KCC A;  4YVW A;  1SLB A;  1NX9 A;  1S0I A;  4ONU A;  2G9F A;  2E63 A;  3R0R A;  4WM7 C;  5I0S A;  4GXL A;  4D3W A;  1AR9 1;  3E5U A;  1BZW A;  4URA A;  3Q8A A;  4QX7 A;  4YW4 A;  1J84 A;  4HN1 A;  1FMD 2;  2IXJ A;  1QXR A;  4LTA A;  5GM0 A;  3ZYI B;  3DCQ A;  3ZR6 A;  1RUF 2;  3J8F 2;  4AE2 A;  4ZKT B;  2ARC A;  1OVP A;  2VR4 A;  4WM8 B;  4I0B A;  1PZ8 A;  1UY1 A;  4H7M A;  3MDP A;  5ABJ C;  1UWW A;  4YM0 A;  1MPX A;  1DGR N;  2A73 B;  3HEI A;  4K8R B;  4EWD A;  2RS3 3;  5CAZ A;  5FZO B;  4YYO A;  1OHF A;  1DYK A;  1XE7 A;  5FZ9 A;  5KHI A;  2Z79 A;  2DCT A;  4K40 A;  5F7U A;  2YV8 A;  4Y5S A;  2D3R A;  1V6N A;  1GQH A;  1J3R A;  1UPI A;  2IFR A;  2VMG A;  3RDI A;  1OQE A;  3WDT A;  2W1S A;  1VBE 3;  1AF9 A;  3A21 A;  3T0D A;  1E5I A;  3EBR A;  3USS A;  1TMF 3;  2Y0O A;  5APA A;  4LQR A;  1SPP A;  2DFB A;  4JC1 A;  4F7Z A;  5F9T A;  4KWJ A;  2NPI A;  5FJH A;  3BIE A;  5IJR A;  2YB7 A;  4WM8 A;  2DV9 A;  1O4Z A;  2Y38 A;  3EXU A;  1R08 3;  2ZX4 A;  4FFH A;  4QHO A;  5CFC C;  1W6N B;  2V5Y A;  3ACF A;  4EE2 A;  4GWI A;  1NCQ A;  3IAQ A;  5FXV A;  5FJK A;  3RZL A;  2YDE A;  2RJK A;  1EAH 1;  3AMM A;  1RUC 1;  2FDJ A;  4U36 A;  5LBF A;  3OCP A;  3TEW A;  3S30 A;  2DU0 A;  5FY7 A;  1YCI A;  2RJ2 A;  1B35 C;  2XKO A;  1UYP A;  4LA3 A;  4QQL A;  5HXV A;  4NHK A;  3K3N A;  1AR9 3;  2HWC 2;  3VDD B;  1N1V A;  2DF7 A;  4M3C B;  4QPG B;  4XW3 A;  1JZ8 A;  2VW0 A;  2G4I A;  2I74 A;  1CZV A;  4QB6 A;  5FBZ A;  4X6Q B;  2ZEW A;  1ZYB A;  3KSC A;  4QM8 A;  1I5Z A;  4AQ2 A;  2VD7 A;  5AC9 2;  3TRS B;  1HB2 A;  5AVP A;  5FZ8 A;  1OA4 A;  1PIV 2;  3RI9 A;  1W6N A;  4QM9 A;  3KHC A;  2Y8K A;  4A4A A;  3K48 A;  2E9Q A;  3AC0 A;  1XB9 A;  4LLO A;  1FXZ A;  1GNH A;  3JBG 1;  4FFG A;  3THD A;  1BMV 2;  3FJS A;  4OI4 A;  4D8M A;  2HJI A;  2HWE 1;  2QQP A;  4CDX B;  3VGI A;  3C3V A;  3WSO A;  3NJZ A;  1RHI 2;  1RUG 1;  1Y3T A;  3GHN A;  1CZS A;  1YFW A;  4YVW C;  5FZG A;  3WIN E;  4AFC A;  1DDL A;  3CJI B;  4H55 A;  3HNM A;  3VBH B;  2ZAC A;  4IEO A;  2VZT A;  2CAV A;  3SXW A;  4ITC A;  1XE0 A;  4XHB A;  3P6B A;  1GV9 A;  2KXL A;  5FV3 A;  1RGS A;  2NN8 A;  3ZFG B;  4M3C A;  4QPG A;  3BU7 A;  1CAU B;  1DFQ A;  5FZ3 A;  5FMD A;  1NUK A;  1VBA 2;  3OOX A;  3K2O A;  2JDN A;  4XFF A;  5GAL A;  4FAH A;  5I0D A;  3JU9 A;  3OUI A;  4LKD A;  2HWB 1;  3N9Q A;  5C3S A;  3VZM A;  5JR7 B;  1L3J A;  3RJR A;  3T3Y A;  2EXK A;  4ISQ A;  5DXD A;  4QQ2 A;  4D6R A;  1CAV A;  1UYY A;  2ZML A;  4ARY A;  2JXA A;  1EAH 3;  3GJB A;  1D2Q A;  1RUC 3;  2P3Y A;  4OHW A;  4A45 A;  2VO5 A;  4IGP A;  2R0H A;  2AH2 A;  2YFU A;  1R09 2;  5HI0 A;  1TME 2;  1OKO A;  4CDX A;  1GUI A;  5GLW A;  4F3J A;  1W9T A;  1ZZB A;  4LOT A;  3ES1 A;  1S0D A;  1DIW A;  3DPR B;  2GN7 A;  4XQW A;  4AHW A;  1GSL A;  2WZE A;  2V73 A;  4YLZ A;  4FPF A;  3VD3 A;  3K75 B;  4YRD A;  1MS0 A;  1VMH A;  4WVV A;  4E4D X;  4UW4 A;  5BYN A;  1ULO A;  3ZFG A;  2FCT A;  4Z8B A;  1JZ4 A;  2A6Y A;  3VL8 A;  5L9V A;  3KVB A;  1SDD B;  3ZN5 A;  4V2V A;  4WM8 C;  3U10 A;  4ZU7 A;  3FLR A;  5F39 A;  2OS2 A;  3AKQ A;  1ASJ 2;  3AK0 A;  3M1H A;  2YY1 A;  1WLD A;  2WA4 A;  4N8M A;  4NWW A;  5LA1 A;  1NCQ C;  3JBG 3;  4I0A A;  3HQR A;  1NZI A;  5IK5 A;  5F8P A;  1MEC 1;  2J1S A;  2HWE 3;  5JPN B;  2RDN A;  2WNO A;  5F1R A;  4LK7 A;  3ETQ A;  1RUG 3;  3M8L A;  1YIF A;  3UGG A;  2GP3 A;  1US2 A;  2YXS A;  2ZA9 A;  4NAO A;  4AQT A;  4X8N A;  4NHX A;  3EB7 A;  3DPR A;  1P8J A;  1U5X A;  2WFF 1;  1RMU 2;  2Z42 A;  3WEZ A;  1LTE A;  1O8S A;  4OUE A;  4W8J A;  4AHZ A;  1W2O A;  4Y5T A;  2VL4 A;  4LBQ D;  2D6M A;  1K12 A;  4G3Y C;  3H3U A;  3P3N A;  4A7Y A;  2DCJ A;  1GP5 A;  1VBC 1;  2HWB 3;  4YW1 A;  5FYU A;  2YHJ A;  3IDB B;  3N7K A;  3POF A;  2FQP A;  3CKH A;  4QU2 A;  1VBB 1;  5LB6 A;  1CES A;  4E27 A;  1J58 A;  3AMP A;  3PJY A;  2WUH A;  1OKQ A;  1BVP 1;  2BFU L;  2BWA A;  2W1W A;  3CL1 A;  4AFA A;  2D40 A;  1W9W A;  4FBF A;  2PQS A;  2B5H A;  3ABZ A;  3AMH A;  5A3O A;  5IK8 A;  2XXZ A;  4CU8 A;  2ATF A;  3W5M A;  5GJ6 A;  3MPP G;  1EP0 A;  3LE0 A;  1RUD 1;  3M7A A;  4GUL A;  2QQI A;  4BZ4 A;  1ENX A;  4S2F A;  4LO8 A;  4QPG C;  3I3E A;  2WQZ C;  2HEY F;  3LEM A;  1WA4 A;  1JN2 P;  4DS0 A;  3ES4 A;  3N9M A;  1GFF 2;  5IVB A;  2WN2 A;  2VU9 A;  3MUY 1;  1HXS 1;  4AYU A;  4CDQ B;  3THT A;  4LBL A;  2W2I A;  4NN0 A;  4KQ7 A;  5DAW A;  4BM8 A;  1NYW A;  1ODM A;  1Q8Q A;  4TSV A;  3R4U A;  2F17 A;  2PA7 A;  1MEC 3;  2CAU A;  2XWB B;  4LNV A;  2VZ1 A;  3MF9 A;  2XR4 A;  4XJW A;  4AEK A;  3V64 A;  2DFC A;  4UBH A;  3U78 A;  1ENR A;  2GC0 A;  3AXD A;  3D4K A;  5CKM A;  4JTN A;  5KXB A;  1AR7 1;  4CDX C;  1UIK A;  1WD4 A;  1SFN A;  3VBO B;  2RM2 1;  2QCS B;  1L7Q A;  2WFF 3;  5H9Q A;  2X09 A;  3KF5 A;  4AVV A;  3GXU A;  4E8C A;  1CR7 A;  3LEK A;  4GMP 1;  2F4P A;  4M0N A;  1KFX L;  5FYB A;  4XCB A;  1G7Y A;  1KFU L;  1Y9G A;  3HIF A;  1AYN 1;  1C5I A;  2XL9 A;  3RNS A;  4CU7 A;  3IMN A;  1V6K A;  1O59 A;  1PK6 B;  1VBC 3;  5JPM B;  4NRQ A;  5A70 A;  3VD4 A;  4XAC A;  3DKW A;  1VBB 3;  4ARX A;  1LOD A;  4CDQ A;  3VKO A;  3KT4 A;  4IEX A;  3MIH A;  2C9K A;  4R9C A;  4R9B A;  5FWE A;  5GZD A;  1GIC A;  1Z7S 2;  1BBT 1;  3LPF A;  3UKT A;  4NJ4 A;  5DAQ A;  5JOW A;  2RS1 2;  4QB2 A;  1MS9 A;  5CG8 A;  3AXE A;  4PIX A;  5FKB A;  1R1Z A;  4HKW A;  1W9Y A;  1JYX A;  2L9L A;  3I2F A;  3A0N A;  1DHK B;  4XPV A;  4Y1Z A;  4Y4Y A;  1DQ4 A;  3SHR A;  2OPW A;  5KBF A;  1QXP A;  4MV2 A;  4DMI A;  1PVC 1;  5FXW A;  2VZQ A;  3VBO A;  4RR3 B;  3WNO A;  1RUD 3;  1DQ5 A;  3WUD A;  2WSV A;  1DU3 D;  1LR5 A;  5F32 A;  4HAN A;  1W05 A;  2J22 A;  3HD8 B;  4LKS A;  4RA0 A;  4CTE A;  5JSR A;  2C24 A;  3CMG A;  4LO7 A;  4TTG A;  1HXS 3;  1PK6 A;  1UX7 A;  3M70 A;  4GWM A;  4IEU A;  2JDA A;  4OUS A;  1PX4 A;  1LHO A;  1SFP A;  3FUQ A;  3ZXD A;  4EJR A;  2W3J A;  4RQP B;  2RMU 1;  5HBA A;  4LUL A;  1GAN A;  2CNA A;  4CP2 A;  4MVT A;  1IS3 A;  4QGM A;  2GC2 A;  2YC2 A;  5BNQ A;  4XZU G;  4NIG A;  1PM7 A;  4XE9 A;  1JOB A;  2XG3 A;  1JMU B;  3ZXF A;  1AR7 3;  1QJY 1;  3W58 A;  5LA9 A;  2HWF 1;  1IZ3 A;  1YC6 1;  3M3E A;  4H7L A;  3Q9O A;  2RM2 3;  1SLC A;  5FZH A;  3GZU C;  3ASI A;  2VMH A;  2DVF A;  1GNY A;  4RR3 A;  3LZZ A;  4GMP 3;  3U1X A;  1XC6 A;  1D4M 2;  2GMP A;  2E32 A;  1OF4 A;  2E6V A;  2WSU A;  1CD3 G;  4MHR A;  5JZG B;  4IEV A;  1AYN 3;  5J09 A;  1JBC A;  3RJ2 X;  3MHZ A;  1NQJ A;  4BJ0 A;  1CAX A;  3OPW A;  2CU5 A;  3PVN A;  1VB4 A;  2XVG A;  4WV8 A;  4W65 A;  5DAP A;  2NQY A;  4COU A;  4E4Z A;  2ZEZ A;  5T52 A;  4TLG A;  4RGK A;  3SKV A;  1X9T A;  3U0Z A;  2CSG A;  1BBT 3;  1HB4 A;  2H0V A;  4QKD A;  4Q26 A;  3PJQ A;  4RQP A;  4ISR A;  3ROU A;  2CWS A;  3AVR A;  2UYB A;  2IZW A;  3RYR A;  3BU0 A;  4E2G A;  2A3X A;  4A3X A;  1CIY A;  4QKB A;  3OD4 A;  3TBD A;  1ONA A;  1PVC 3;  2JIC A;  4AI1 A;  4HSL A;  2H0B A;  5FK8 A;  2RDR A;  1WW6 A;  2R04 1;  3U07 A;  5IHR A;  1UOG A;  3H9A A;  3KGL A;  4DUW A;  1SBD A;  4COW A;  5BV6 A;  2RS3 2;  3HBK A;  5JZG A;  3T1M A;  1NY7 2;  1R64 A;  3CZU A;  1ND3 B;  2FCU A;  4OHY A;  2JWP A;  3EHK A;  4I0W B;  1OFN A;  3W20 A;  2RMU 3;  4CDQ C;  2QQJ A;  2YU1 A;  3C7G A;  4PQQ A;  2BP6 A;  4CCL A;  1RXG A;  1JOP A;  1VBE 2;  1AVB A;  3W59 A;  5FZL A;  5K7P A;  3VHO A;  4JHT A;  1J59 A;  2D98 A;  1QJX 1;  1X9P A;  1I6X A;  1TMF 2;  1S0J A;  1VRH 1;  1LB2 A;  4BQX A;  1QJY 3;  3ACI A;  5CU1 A;  4KG0 A;  4D7T A;  2HWF 3;  5FZF A;  1SLT A;  4OZX A;  2YZ4 A;  2OZJ A;  3IBM A;  2A3W A;  4DEV A;  1DGW A;  2PTM A;  5EYY A;  4XUQ A;  3T4H B;  3VBO C;  2BNO A;  4I3P A;  4A7K A;  5A3P A;  5J7M A;  1C8N A;  1R08 2;  4FFF A;  1XOY A;  1ODN A;  2GN3 A;  3RMY A;  3PUS A;  3OGR A;  3RYP A;  2QJV A;  4A2U A;  4AI8 A;  2JDM A;  1N3P A;  3ZKY A;  5DZG A;  1YFY A;  2P4E A;  3HQU A;  1HN1 A;  2ZGO A;  5EIY B;  1ND3 A;  1OT5 A;  1PK6 C;  2ZKN A;  1J1T A;  4IE7 A;  2DDU A;  2ORX A;  1DQ0 A;  2D3S A;  2GAL A;  3I2H A;  1JH5 A;  1ND2 B;  3Q8B A;  1AX2 A;  1YJL A;  2GNM A;  4YSF A;  3B94 A;  1AR9 2;  1SCS A;  4KWU A;  2VZP A;  2EAK A;  2A71 A;  2WNV B;  2YMZ A;  4JKM A;  1ZRR A;  1H0B A;  1QWR A;  4L9B A;  5A1A A;  4PF1 A;  4IE6 A;  2BGP A;  3RPQ A;  1WZX A;  4LIV A;  2R04 3;  4N90 A;  4HL0 A;  4HK8 A;  3T2T A;  1KDK A;  3NKT A;  4B4R A;  2BW8 A;  3A0K A;  1AJK A;  4RR3 C;  3IZO A;  2BZD A;  1LOE A;  1W6Q B;  1LOC A;  3FC0 A;  4L0P A;  5FKC A;  4BQY A;  1OLM E;  4EV0 A;  4HET A;  3EYP A;  1MZE A;  3GBF A;  1I1E A;  1RUH 1;  3NV2 A;  1PGL 1;  4QAW A;  4XUR A;  3S0M A;  4LBQ B;  3WHT A;  1RVF 1;  3WOG A;  1YQ2 A;  1HLC A;  1S55 A;  2O8Q A;  4HMZ A;  4RQP C;  1QJX 3;  1SDW A;  1ND2 A;  1VRH 3;  1Z78 A;  2OVU A;  2XLA A;  3AZV A;  4EWE A;  1J3Q A;  4KBB A;  1SAC A;  5C5T A;  1LGB A;  5C4W A;  3H8X A;  5FUI A;  4AL9 A;  4QPW A;  4XJU A;  1PO2 1;  3Q8C A;  2ZOE B;  3K46 A;  4YGE A;  5FYH A;  2GNB A;  4KH9 A;  4RFT 0;  3JD7 1;  2MEV 1;  2VCA A;  1G9C A;  1F15 A;  3ZIW A;  2HEV F;  4XJ9 A;  1DLC A;  1ULD A;  1W6Q A;  4JRL A;  4COY A;  5JZG C;  4P5Y A;  1EAH 2;  4W6W A;  2A6W A;  2IWG B;  1RUC 2;  3FLT A;  3GGL A;  4XFH A;  4XJ8 A;  3U4S A;  2JDH A;  3WVJ A;  3WQ7 A;  3G6J B;  2R06 1;  2HLE A;  4GB3 1;  4LBQ A;  5JXH A;  5C70 A;  1F9K A;  4WVM A;  1GZW A;  2GZW A;  2V72 A;  1G6N A;  4JVA A;  1SLI A;  1ENS A;  4ZU4 A;  5LBC A;  2Y26 A;  2GME A;  2IXK A;  1GR3 A;  1IKQ A;  2C5D A;  3ZYH A;  2V4V A;  2RDS A;  4OCT A;  4RYD A;  2XDV A;  1AUY A;  3K4A A;  5JIU A;  3VDA A;  4QDS A;  4XJZ A;  1ST8 A;  2FMY A;  2WC2 A;  3PUI A;  3ZXK A;  3LIG A;  1IHM A;  2Y6G A;  2R16 A;  4HPK B;  5EZW A;  5GZE A;  1Y43 B;  5TSW A;  2E53 A;  4NPR A;  3QD6 A;  3NNM A;  1TZO A;  3PU8 A;  1UW8 A;  3JBG 2;  3OBT A;  4XXP A;  5FAX A;  1RUH 3;  1XRU A;  2GND A;  4XEZ A;  2HWE 2;  1RVF 3;  1ND3 C;  2CDP A;  2K9Z A;  4JCK A;  1RUG 2;  2LAL A;  4UBG A;  4F83 A;  3WNK A;  1LU1 A;  4DIN B;  1KQR A;  4PBP A;  5F37 A;  3KV6 A;  3KQR A;  1RUJ 1;  1SBF A;  1XND A;  4CEW A;  1UQX A;  2EID A;  1Q5O A;  3MV0 1;  2YU2 A;  1PO2 3;  4AI3 A;  1H4G A;  1NLR A;  1SEF A;  2VCC A;  2ZAA A;  2VQT A;  3JD7 3;  2MEV 3;  1V6I A;  1AL2 1;  1U5Z A;  1QOT A;  3LSE A;  5L9R A;  1QH6 A;  2HWB 2;  3OY8 B;  5JXG A;  3WW3 A;  4HPK A;  1PMH X;  1W0N A;  1GQG A;  3POJ A;  5A1L A;  4KG8 A;  2B9U A;  4LUM A;  5FZM A;  4DZG A;  5LWB A;  4XDQ A;  4ZPI A;  1Q8V A;  2R06 3;  3HWJ A;  1K45 A;  3ACG A;  3H0O A;  1S0E A;  2QZ3 A;  4GB3 3;  5FO7 B;  2C0Z A;  1JHN A;  1YWK A;  4Q4W 1;  3WDX A;  1IPK A;  4P08 A;  1QQP 2;  2HBT A;  3M3C A;  2PHT A;  5DDJ 1;  2VZR A;  3ITQ A;  5E16 A;  5E1R A;  4TN7 A;  5A7S A;  4CCD A;  5D8A A;  1KS4 A;  1YI9 A;  2HWD 1;  4IW3 A;  2W47 A;  4Q5O A;  1YXW A;  2VTX J;  1KJR A;  1HKD A;  2FD8 A;  2K46 A;  4E2S A;  4BXF A;  3LCP A;  1T6B X;  5C4W C;  1SG3 A;  2X05 A;  1YNA A;  2VY0 A;  3I3Q A;  4GA9 A;  4ASL A;  1HIX A;  4ATE A;  3FN9 A;  5FP3 A;  2LRO A;  3MF6 A;  3WDY A;  3CO2 A;  2X5I B;  1V6M A;  4AQS A;  4XMI A;  4NIH A;  1UAI A;  4G9S B;  1C57 A;  4OQ9 A;  5FBJ A;  1QKQ A;  2DCK A;  3VD9 A;  3ORJ A;  4FAG A;  4IGQ A;  4Y1X A;  3O1V A;  2PFW A;  3AMN A;  3AZW A;  5H9R A;  3E6C C;  4CZS A;  4FVV A;  4YZ2 A;  3L2H A;  1LUL A;  4HXC A;  5FZI A;  2VJX A;  1LOF A;  1WCU A;  3R6S A;  3WCR A;  4ASK A;  4BU2 A;  5LY1 A;  3FX3 A;  4HZF A;  1OOP A;  3PHM A;  3JUU A;  4HKO A;  5F5Q A;  5F3C A;  4B8E A;  2WFF 2;  1RUJ 3;  1BCX A;  3NWK A;  4QQO A;  5K4L A;  3PME A;  3P3P A;  3LPG A;  4BYY A;  1WLT A;  1F4A A;  3I3B A;  1OF3 A;  3UJO A;  3DYO A;  5JAX A;  1C1L A;  4KBZ A;  5JR2 A;  3WNN A;  3WXP A;  3BTZ A;  4B7K A;  1AL2 3;  5FMC A;  4IV3 C;  1VBC 2;  1IQA A;  1QJZ A;  1DYP A;  1VIW B;  1CJD A;  3HBZ A;  3IDC B;  4FPG A;  2Y64 A;  2X5I A;  4BQ3 A;  2AZ5 A;  2VM9 A;  1QF3 A;  3O12 A;  3ZFF A;  1CX4 A;  5C5U A;  3D5O A;  4P9J A;  3T30 A;  2CYF A;  4JZR A;  2UWA A;  3HJR A;  3WG2 A;  5J36 A;  4IEP A;  2R1B A;  3RWN A;  3GZA A;  4Q4W 3;  4BPZ A;  1UXX X;  1N3O A;  2BEO A;  4A6O A;  5DDJ 3;  5F2S A;  3VZL A;  4JGZ B;  4A7Z A;  4QX1 A;  5A3W A;  4AHX A;  1NAE A;  2HWD 3;  2XOM A;  1RUD 2;  3LEG A;  2H6B A;  5FZK A;  1OXC A;  5JOY A;  3HVD A;  4CEW C;  5CFD B;  3KGZ A;  4JKK A;  1C1F A;  2QBX A;  5FQ0 B;  3LA2 A;  3AL6 A;  5DG1 A;  5FZ4 A;  5C7G A;  5A32 B;  4ET7 A;  1HXS 2;  1ZVF A;  3D0J A;  1PO1 1;  3N9L A;  2XON A;  1A6C A;  3PUA A;  4LBO A;  1DP0 A;  3WCS A;  4AVT A;  3O1S A;  1W9S A;  2VOK A;  3GCX A;  3OUH A;  3W9A A;  4D7Y A;  5FWJ A;  2EIG A;  4TZD A;  4JTO A;  1FOD 1;  1FV2 A;  4KU7 A;  3PU3 A;  2VME A;  3NW4 A;  4Q4Y 1;  2DTY A;  4CXY A;  1DCS A;  3QLQ A;  3HNB M;  1AR7 2;  1NOV A;  2VNG A;  3BIW E;  3RQ0 A;  4AEM A;  4D94 A;  4LKF A;  1EPW A;  2RM2 2;  4JGZ A;  2ZHM A;  3MFA A;  3DXT A;  5HCH A;  5D8A C;  4LXL A;  2WAA A;  1HV1 A;  2B4K A;  3ZN4 A;  5J37 A;  1O4T A;  4P5H A;  1STM A;  2VMF A;  3MGU A;  4XFA A;  3T1L A;  4AI2 A;  3WY6 A;  2QQO A;  4YZ3 A;  4DPN A;  4FT8 A;  2XVK A;  1VPH A;  3B93 A;  5CFD A;  3WQ1 A;  3T2P A;  4AF9 A;  2CV6 A;  4CUB A;  1HB1 A;  5FQ0 A;  1V0A A;  1HRV 1;  4FCA A;  4OMD A;  4E4H A;  2D7F A;  5LY2 A;  5A32 A;  1YQ8 A;  4BXS V;  3VDB A;  4FSJ A;  5T50 A;  2JG8 B;  2W52 A;  2NMO A;  1QH7 A;  3I2I A;  4JDO A;  4CXX A;  4ZS3 A;  1XNB A;  2JD4 A;  3FZ3 A;  4CEY B;  1V9U 1;  4BQ4 A;  3ZDS A;  2VCB A;  5IVF A;  4JKL A;  5FZ7 A;  3TAY A;  1LED A;  2JEN A;  3MIB A;  3RG0 A;  4CUG A;  2Z69 A;  3B5L B;  3BPZ A;  4CRQ A;  1U0A A;  1ZBA 1;  5JWP A;  1LOF C;  2CHH A;  4P14 A;  3TOJ A;  1DF0 A;  2XJR A;  1OOP C;  1RTV A;  1W8F A;  3I8T A;  4CPB D;  1D0G A;  2Q1M A;  3NAP B;  2LM3 A;  1H6X A;  5BNN B;  1QOS A;  1T6G C;  1UYX A;  1WLC A;  5FO9 B;  1HJF A;  5IYY A;  1W03 A;  3C7O A;  1EYB A;  2QDN A;  3OSD A;  2HBU A;  1DYO A;  4MGK E;  2QVS B;  1NLQ A;  4AR2 A;  2VG9 A;  4WVZ A;  4PLN A;  4IV1 B;  5CNA A;  1PO1 3;  4N53 C;  1PNF A;  1YI7 A;  4RGG A;  1W6P B;  1WUV A;  3KV4 A;  3MLK A;  5HCA A;  1UZ0 A;  5FZO A;  3SKJ E;  2X5I C;  4WZF A;  1MS8 A;  2RMU 2;  3WQB A;  2BPA 2;  3IDE A;  1L7L A;  5A6Q A;  2JG8 A;  3ZFF C;  1FOD 3;  3I3M A;  1RB8 G;  4PBO A;  5FP7 A;  2EAA A;  4Q4Y 3;  4KWK A;  4XCA A;  1QJY 2;  3E1F 1;  2BOJ A;  4IES A;  1GKB A;  3N7J A;  4GMP 0;  4QWN A;  3AZX A;  3APB A;  4LE3 A;  2P3J A;  1SFY A;  2RR1 1;  4BMB A;  5IAT A;  4Q4V 1;  2R07 1;  5M0T A;  1B09 A;  3AYA A;  2OA2 A; 
#chains in the Genus database with same CATH homology
 5FZ3 A;  5FY8 A;  3U78 A;  1VRB A;  3K2O A;  3PTR B;  5E6H A;  2XDV A;  5IWF A;  3ZPO A;  2OQ7 A;  3NJY A;  4XDO A;  5FZD A;  2XUE A;  5FXX A;  3KV5 A;  4HOO A;  3N9Q A;  5KR7 A;  5IVJ A;  5IVV A;  4CCL A;  2YU1 A;  5F2S A;  5A3W A;  4D6R A;  4URA A;  4Y4R A;  5FZL A;  4QX7 A;  2YBS A;  5FYB A;  4EZH A;  2Q8E A;  3PU8 A;  2WWJ A;  4Y33 A;  4IGP A;  5FP9 A;  5FY5 A;  4CCN A;  5FZK A;  5FPV A;  4CSW A;  2YBK A;  5FZF A;  5IVE A;  3ZLI A;  5A7P A;  3N9P A;  3AL6 A;  4IGO A;  5FZ4 A;  5FY9 A;  5FZ1 A;  3N9L A;  5FWE A;  3PUA A;  5A3P A;  5FZA A;  2YPD A;  4EYU A;  2XML A;  5FZO B;  4AAP A;  5FZ9 A;  5F37 A;  5FWJ A;  3PUS A;  3KV6 A;  5A7Q A;  4AI9 A;  4GAZ A;  5F2W A;  5LW9 A;  4CCK A;  2YU2 A;  3PU3 A;  4GJY A;  5FYM A;  3KVB A;  4V2V A;  5FUN A;  5FPU A;  5F39 A;  2OS2 A;  5A3N A;  5FXW A;  5F3E A;  2PXJ A;  4Y3O A;  5A1F A;  5FZB A;  3AVS A;  5A1L A;  4LIT A;  3DXT A;  2OQ6 A;  3OPT A;  5F32 A;  5FYZ A;  3RVH A;  5ISL A;  4LXL A;  5FYI A;  5FZM A;  5LWB A;  4UF0 A;  5FJH A;  3N9N A;  3PUQ A;  2Q8D A;  2GP3 A;  3K3O A;  4LIV A;  5A80 A;  4QU1 A;  5FZ0 A;  2GP5 A;  4BIS A;  5FPL A;  4E4H A;  5LY2 A;  2OT7 A;  4HON A;  3LD8 A;  4XDP A;  5FYT A;  5FXV A;  4EZ4 A;  5A7S A;  2YBP A;  4TN7 A;  5FJK A;  4QXC A;  3KV9 A;  3KVA A;  5F5C A;  3AL5 A;  3PDQ A;  5FZC A;  3PUR A;  5A7W B;  4CCJ A;  4BXF A;  5IVF A;  4D6Q A;  5FPB A;  5FZ7 A;  5IVC A;  5FY7 A;  5FYU A;  5FY1 A;  4V2W A;  3DXU A;  5FP3 A;  5FP8 A;  4GD4 A;  5FZH A;  4DO0 A;  4CUG A;  3K3N A;  5IW0 A;  4LIU A;  5CEH A;  4QX8 A;  5IVY A;  4NUB A;  5FBJ A;  5FXZ A;  5F5A A;  2Q8C A;  5FYS A;  5FYY A;  3UYJ A;  4DIQ A;  4IGQ A;  3OPW A;  4CCM A;  2XXZ A;  2VD7 A;  3N9O A;  5FZ6 A;  5FYH A;  5FYV A;  5FPA A;  4BU2 A;  5FZI A;  5FZ8 A;  5LY1 A;  3KV4 A;  4ASK A;  5F5I A;  5ANQ A;  5FZO A;  5F3C A;  5A7N A;  3AVR A;  5K4L A;  5A7O A;  2OX0 A;  5FZE A;  5FP7 A;  4QXB A;  3N9M A;  4UF0 B;  5FUP A;  3LDB A;  5A7W A;  5IVB A;  3U4S A;  4CCO A;  4C8D A;  4D6S A;  5FZG A;  2W2I A;  5FY4 A;  2P5B A;  5FP4 A;  4QWN A;  5FYC A;  2WWU A;  5A3T A;  5F3G A;  4QXH A;  4GJZ A;  5FV3 A;  5FY0 A;  5F3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...