5IW1A

Crystal structure of b4.2.3 t-cell receptor
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
189
structure length
189
Chain Sequence
QQVRQSPQSLTVWEGETAILNCSYENSAFDYFPWYQQFPGEGPALLISILSVSNKKEDGRFTIFFNKREKKLSLHIADSQPGDSATYFCAASASFGDNSKLIWGLGTSLVVNPNIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKCVLDMKAMDSKSNGAIAWSNQTSFTCQDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An allosteric site in the T-cell receptor C beta domain plays a critical signalling role.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords T-CELL RECEPTOR ALPHA CHAIN
total genus 33
structure length 189
sequence length 189
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2016-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iw1A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iw1A02
2D4DA 2NY2C 3MUJA 3DUSA 4PP1D 5IESH 3EO0A 1BREA 1KJ2H 3VFMA 2WSKA 3TBVB 3TIEB 5K59F 1KACB 1OSZA 1M05B 2CIKB 3RU8L 4L3EB 2AI0L 2OP4L 5EOQL 3VFNA 4NO0D 4ZAKD 5C07E 4OD2A 5IJKC 2BOCA 3FFCE 2NXZB 3TVMC 1D5XB 4WTXA 2BNQB 4DGIL 4HIXH 1ZA6B 3F7RA 5F9JA 3ULVH 2AI0H 2OP4H 5EOQH 2HT3C 3GSNB 4PGZA 4EI6B 2DL9A 5L2JB 2V2TB 4F7TB 4YK4C 1UJ3A 4H1LB 5D93C 3RZCA 5HGBA 1GAFL 1A22B 2DIAA 4K8RH 2BP3A 2PR4H 2FX8H 1LHZA 3HTLX 1MFDH 2X40A 5IBUB 4XB7A 3FFDB 3WSQL 5IVXB 3VG9C 5GS0H 2BOBB 4ZUUA 1UWGH 4JLRB 5FV2A 4JO1L 1N7ML 4C83B 2VL4A 4JGUA 2IPKB 3VFNB 1X6NA 1SBBA 4PJ5E 3SGDH 2J2ZA 3GNML 3QWRA 3CH8A 3ULSB 1K8DA 3IGAA 2AK4B 5I1AA 1CDBA 1YEGL 3LKPB 2ZUXA 4P3DA 5E2UL 3RUGA 5JOEA 5DVMA 1V05A 5AWNL 3W0WE 5C9KA 2FLRT 1EUTA 5D7JB 1LVEA 1W0VB 2HH0H 4Y2OA 2L4OA 3OPZL 1WUNT 4XCFL 5CZXD 1CLZH 4JY5L 3FT3B 3UYRH 1EFQA 2WK2A 3WJLA 4QRUA 4D9LL 4HPYH 4JY4A 3FQRA 3V5DA 3RJDA 4ZDHB 3U36B 4FQ2L 5KVFH 5SWZD 2F58L 5C0EA 3HUJF 4HXAH 4MLIA 1KXQE 4NN7C 3QXAA 1F45A 5IUSA 4LCIL 3RNKB 2A9MH 3GMPB 4ZS6D 3KPLA 4LASH 1ORQB 5D7LB 4ZXBA 4ETQB 5KSAC 1NUFA 3R0MA 1L4IA 5EA0H 2VC2H 4NZRL 3VH8B 5IMOA 3R06B 2RFXB 4EN3B 3LKQA 1U3ZA 4Z0BL 4CVZB 2XY1A 3I3EA 4FTVD 4QXGL 4U1LB 1OQXA 5C0BA 1JGUH 1HHIA 4EIGB 1KENL 1U91B 2BSED 4YHLL 1PYWA 3IU3A 1OTTC 3V6FA 4CMMB 3R06A 2YS4A 2F58H 4MD4B 3FMGH 4HK0B 1U95A 3WJJA 2YPVH 3H3PL 2WUCH 5HYSG 2VUOA 1CT8A 4PJ5A 4YHNA 4MQ7A 4IOFD 5CEZH 3QQ9D 3ARRA 5D7LA 4HIEB 4ZXBB 4G42A 2W9DH 5CJ8A 2J8UF 1YNTA 2QV2A 3U9UB 5L88H 3B4NA 5C6TL 1C16A 1X4YA 4DGYH 5I71C 1FG9C 3MROB 3QA3A 3V6OC 4OGYL 3U9PL 4U1GB 2JB5H 1S9KC 2DBLH 4TPRL 4LDLB 1T22B 4UBDC 1YZZA 3GBMH 5C9JB 5L8KB 1FGNL 3F7PC 2D4FA 5GZOD 5KAQF 1HDMB 4JFQA 4X7SH 3U0TB 5HI4C 4IMLA 4WI9A 3L6FA 3TP4A 1XCQA 5F6HI 3WXWH 4M1GH 3KAAA 1ULVA 1SJEA 3CCHA 4QHNB 4NKIH 5BJTB 3ARFD 5FUZH 2BY2A 5E8EB 1P7HL 3GEWB 4JM2C 4FQJL 1FNSL 1MFAL 5GS1B 2PETA 3B5HA 2WBJC 4M00A 5DTFA 1P7KA 4NN6C 4MJ6A 4XCNB 3ZE1F 1IL1A 2NY5C 4IRSD 2J8UE 5H8DA 3QA3B 3R8BB 1OT2A 5CD3B 4NRXA 3ZKMC 3PHSA 2E7LC 4X98B 2WBKA 4GMTL 1T22A 5JXEA 5HYSB 4R3SA 4HGMA 5HYFA 3IFLH 5JIKA 4OKVA 1OW0A 5FECA 1YEEH 4NCC2 2YD5A 1IILE 4WWKB 3GIVB 1BBDL 3PP4L 2ADGA 5D1ZC 4M8QB 5GRVL 1FJ1A 3C6LA 3S37X 1U58B 3QNYA 4PJ7F 2GW5A 5EBLA 1JPGB 1SJEB 3CCHB 5J1AB 3CC5B 2YPKB 4MA3A 4NJ9H 1JF5A 1ZGLB 4B41A 2LABA 2Q6WA 1HWHB 1OGAB 3AY4A 2R0WL 1I1RA 4KPHL 1QLFB 5GJSL 5DUBB 2BOBA 3MRQB 2JF1A 3W11D 4A2LA 3CFJA 1P7QA 5GHWH 3D39D 3H2WA 1CBVL 1HXYA 1T0PB 1AD9A 2ERJB 4GLRI 3LZFL 4NJ9L 1MCKA 2X4UA 1UWGL 4Y4FC 2Y06H 5D70H 1CK0H 1F97A 2AJYH 4L8BB 1ZWIA 5GS0C 2AJVH 3VRIB 3U0WL 1KIPB 2DL2A 4ODXB 1CL7I 3TPUB 1XGQA 3OJVC 4JFYA 1QSEB 2Y72A 1U8HA 2HFFA 4MJIA 5ERWA 3ZE0F 3GSWA 4G7VL 4G9FB 5E9DA 1EHLL 1Y0LA 3H9SA 4YO0B 4BQ9A 4PBVC 4R96A 3O6FB 1KJMB 3ULUL 2FGZA 3GM8A 5FKPB 3KJ4C 1T1WB 3RWJA 3SGKA 1SY6A 3OTTA 4I0PD 1A5FH 5ANMA 1KC5L 1I7TA 5DD6A 4P46B 3UO1H 5DMKB 4MJ4A 3KLHD 3L3KA 5DEGA 5T5FL 3BT2L 3NH7L 3PABB 1WFOA 4GKZB 2H32B 1WWCA 5T1KA 3T1WA 4LLMB 4YXHH 2A6JB 5C09A 4C83A 1CICD 4M6MH 4NKDA 1MRDH 2RBLA 3RY6A 4KFZC 5I18H 2UUDH 3V2AR 5FFLA 2D3VA 5D5ME 1KIQB 4UOJA 4JLRA 4MA7H 3H9SD 3KPRA 4G7YH 2VITB 1LWRA 1Q72L 3SKOB 2DWDB 1ADQL 4B5EA 5ESAA 3RRQA 1CT8B 1E6JH 2CUIA 3MLTA 4KGJA 4N90E 4OD1H 3BSZH 3GSQB 4PJBB 5E4IA 2QSCL 1FNEB 2YOCA 3CFEA 1ZLSL 4I0KA 3TFKD 4M6ML 4Z7UF 5DO2C 4PRPE 35C8H 3O8XA 1NGXB 4WRLA 4I77L 1ZEAL 1OP9A 1RIHL 3KLAA 4X0KB 5B4MC 3GKWH 2VQ1B 3MRGB 3GSVB 4UTAL 1F90L 3O3DB 3BEVA 3ZT5A 5IB3A 3HN3A 1L9NA 3VFMB 2XTJD 1MJUL 3TJHC 1RK1B 3RI5K 1G6VK 1J1OL 4L4TB 4HX1B 2NY1B 3UEZA 1KGCD 1JWUB 1GGIH 2IPTH 2QHRL 1T5WB 1NEZB 1MCLA 3WIHA 4G8IB 5E94A 3MV8A 2VR4A 1DBBH 1M1SA 5IFJA 3GSQA 3FO2B 4JRXA 1GHFL 2WUBH 3T0AA 5AYUH 2K3TA 3ISWA 4P23D 3VXOB 4WWKC 1IT9H 3RWDB 3SHSA 1P9MA 3K8KA 1A7QH 3MPCA 4OIIL 3LN5B 4XCEB 5LGKA 2ORBH 3BUYB 1L0QA 1XIWD 1NEUA 4KZDL 1U8NA 1KG0B 2VQ1A 4G8FB 4RRPA 3JXAA 4K71C 1N5AB 1SVZA 1ETZB 5I1CH 5IQ9A 3BIAX 4Z7VA 3KS0H 2ZOKB 4GAYB 3H7BB 5CJBA 4JFQB 2ZCHH 1GOFA 5AZ2H 4DOHB 4YK4B 4PR5B 4JRWA 2QSTA 3AU1A 4OTXL 4PGCB 1EJ6A 1CLYL 3S88H 2AXFA 4M43H 4NO0A 4GAYA 4ZAKA 2APXA 3FO0H 3GI8L 5CJ5A 2DKUA 1CGYA 2DI9A 3V4UH 4AEHL 4N9GA 4OLXL 4LCYA 1U3HC 3I2CH 4JVWA 4K2UL 5IFHL 2P8PA 4WO4C 3BO8A 3U83A 4NO0B 4ZAKB 1S7XB 1KB9J 4LAQH 3G6JF 2DYPB 2PYEE 2EC9U 2DQJH 4PP2A 4G6KL 5AYQA 3BUTA 3K8MA 5DEZA 4YPGA 2FX9H 2CLZB 4JO4H 1WEJH 1D5ZB 1I9EA 3IS1X 3WNKA 1S7RA 5I0DA 2DBJA 3H3BC 1WC7A 2E5EA 5BMFL 3T0EC 4KQ3L 5FM8A 4PJEE 3AXLB 1MIEL 4P5TC 1IAOB 5I8CB 1R3KA 5DVKA 4HXAL 3UJIL 4UV4H 4JPKH 5F9OL 3ULVL 4FRWA 1YQVH 4L5FH 3NIFF 5DUML 4PRNB 3MFFA 1V5JA 3DGCR 3QWRD 1ZHKA 1F4AA 2CLVA 1CFTB 3D0VB 4WUKH 5KG9B 5GRUL 3RA7L 2BSSB 1G7IA 1YEJL 1YEFL 4LRNH 3QO0B 3RVUC 1H8NA 1XH3B 1FFPB 2ZUVA 4JFEB 4PJXB 4QT5A 4UOW1 5BS0D 5C7XH 5IBTL 3MYJB 1BAFL 3ESUF 5I8EB 32C2A 1MNUH 3FONB 4O5LH 3OGCA 1X5HA 2ZG2A 4LBEA 1EEQA 1Z0MA 3G5VB 4JY4B 1QRNA 3HNTL 2WINA 4MDIB 1Q9LB 1IGCH 3BEWB 3AROA 4KTDL 2YD9A 3MUY1 4L9LA 4MLSA 4CW1A 3O3BA 3UTPE 4P3CL 2VMFA 2DQTH 3HZYB 4ZOBA 2O5YL 4NQEA 5DK2A 3LRSB 1MCNA 4ZSOE 5I18L 4DOHE 5ID0A 3UZVB 4MJ2A 3PWJA 4S2SB 2EDWA 1IGCL 1CXHA 3GMLA 3QB7C 4XPAH 4ERSH 1P4LA 4PJ8C 2OR9L 2BNQD 1U8JB 1YEDA 4UQ2B 3B2VH 1NLBL 4O2FA 4TPRH 1BZ9B 5EU6D 5F7YC 2N56A 4QXTB 4MJIB 3PWJB 1PG7L 4K55A 4Q0XH 1F4XL 4X6CA 1HOCB 3CFIC 3RFZC 3O3BB 3UDWC 3OKOA 2OCFD 3MOAL 3QR2A 5IBUG 3ZHDA 4U7MA 2BVYA 4X4MA 4ELKB 4POZC 2QJDA 4O51B 1LP9E 2XTLA 2Q8AH 3C9NB 3WUWB 3U7YL 1E4XH 3L9RB 3FONA 3L5HA 1JZ8A 3MODH 5EORH 4Q9QH 2ADIB 4HCRA 2LU4A 1OCWH 3MV9E 1IQWH 5C0BE 3W0WD 1K5NB 3VWJC 4V1DB 3GSRB 3NTCL 4YUEL 4YQXL 5D1QD 4P9HL 1RV6X 5BVJA 1MCBA 3KNBA 5HHQA 4NQCB 4PYHA 1SYSB 2HFGL 4JHAL 4C54A 5MENE 3REVB 5E6IA 4L3EA 4X99A 1SJHA 1JGVL 1A3LL 3BGFB 4XP6H 1FFRA 2HLAB 1YY9D 4N8VG 1QACA 1MEXH 1OTUC 1DQML 4GAFB 4ODWB 3REVA 4YWGH 1FL6A 1I8MB 2BY3A 5FA3A 3ES6B 4GXUM 4JPIA 4Q9QL 3CDGA 2VDML 4RFOH 4X4ZA 5DRNB 4S0SD 2VZ3A 5ITFB 4YZFF 3L1OL 5DJDB 4ZYKB 4NZUL 4NT6B 2D0HA 1DCLA 4WUUD 4S1QH 4JPWH 3UZQA 2FZ3A 3BVNB 3I6KA 3IJSA 5DD1L 1OP3H 1MWAB 3P2TA 4PJHA 1G0XA 4LQFH 4GRLD 2OL3A 4EUPA 5E5UB 3X17A 3F5WA 1KCKA 3BPCB 4KXZH 4WV1B 4P2OC 1HQ4A 3LQAC 3FT3A 3BFOA 1D9KB 4TVPE 2IFFL 3GK8L 1UWXH 5IEKB 3EJYD 4BQCA 1UACH 2JJSC 3RAJL 3QDGE 4NQUA 4RGNE 5C09E 4DKFL 5BW7C 2JIXB 4OJFL 3T77A 4FXGA 1UYWL 4QRQA 4TSCH 4X5WB 1JNNH 4ODHH 1G9NC 1RK0A 3CSGA 3O3EA 4WHTB 2BCKA 4HJ0D 1MIMH 3BP6A 1SEQL 4OFKA 5CWSA 3HMXL 4XPFL 1BQHB 2A9NH 4XNZC 2MFNA 2APVA 1C1EL 4QTHB 2DM4A 1T2QH 4IIQC 3W2DL 4FG6C 3WLBB 5FYLD 2BHYA 4Z7UA 1FN4B 2F53B 5DD3L 4YAQA 3N0PB 2BJML 4QCIA 3U4EA 2IQ9L 3F8UB 5IFHH 1EHAA 2I07A 5E1AA 5HYJB 2H9GB 4JFOA 1OAYL 3MA9H 1MSPA 2HKFL 4I9WD 5DSCB 3RIAF 5JIHA 3VW3L 5JIPA 2AABL 1L6XA 3E2HC 2C3VB 2E7BA 1ONQA 3F12B 2FJFB 4JFYB 5DUMH 3CJJA 2AK4E 4NZTH 1XH3A 5D2LB 1TZIA 1DSFH 3AGVA 1VGKB 5E2VL 4L3ED 1KJMA 5DJ0B 5BMFH 3FQNB 1TJGH 2C3WA 1T4KA 2C4FU 3T2NH 3SQOL 1RK1A 5HI3C 3IT8D 4R8WH 3OAZK 3RPIA 3SN6N 1CFQB 3HS0B 4X80L 2VDOL 3PDOB 5JMOC 3N50A 2FBJH 1BX2B 2BC4A 1B9ZA 1T83C 1EGJL 3UTSE 4NO3A 4PJ5B 3VXRA 2W38A 4LSUL 2X1WL 4QTHA 3WDIA 3TBSA 4W6XB 1OB1A 4NBYB 4LHJB 5C08D 4RX4A 3HRZB 2N1KA 4XVUC 3OBAA 2PYEB 4DTGL 3RWGA 4RZCB 5C2UB 1OP5K 1PFCA 4C56D 1PSKL 1W0VA 4WO4B 2W0FA 3VFGL 1I9JL 5GGRY 3O2DH 5DK0A 3GJFH 4OF7A 1G6RA 4RMUA 2NLJB 5CEXB 1F4XH 2VH5H 4F2MB 5J13C 1QEWA 1J0ZA 1PSKH 2R56L 1FYTE 1R3LB 3LS5L 4IRSA 3QQ3B 1PX3A 4PJ8D 4BFEA 5C0GB 2PYFB 3QXUA 3WN5A 3ARSA 3FTGB 2DWEA 3RPIB 4ETQA 4PD4K 4NO5A 3TYFA 4FFVD 4LFHD 2EC9T 2IAMD 3S37H 2APBA 3T2QA 1J88A 1CWVA 1TJIH 5LCVL 3RIFK 4OUUB 5KSAB 3CFDA 4OD1L 2IADA 3O9WA 1ZLWH 1ZMYA 3L7EA 3IU4H 3LIZL 5IK3B 4TNWK 1EEYB 2KUTA 4XZUA 3RVUD 4ONGH 3QUKA 1N8ZB 4GXVL 3SDDC 3TN0B 1RZGA 1T0NA 1KPVB 3MV8D 4G5ZH 4AQ1B 2D9CA 3SKMB 5H37G 4OV5A 4NT6A 4PJ9D 4L8BA 5F44A 1I7UA 5IJVA 3VW3H 2J6EA 1WBYB 1CTOA 5C08A 2IANE 2CDEB 5INDA 4PJEF 1AFVH 2X1QA 4NN5C 1JGEA 4WW1B 4TUKL 2Y5EA 4K9EC 3LN4B 2PCPA 2HKHH 2XXMB 1DSFL 3C8KB 2HTLD 2R2HB 3MFGB 3T8XB 1HXYB 1LO2H 1UEYA 4HS3A 4Y16D 4AYFA 1NFDA 2VZSA 1F3JA 3G6JE 4JO4L 2Z0BA 3SGEH 1PW3A 3I84A 2ZOLB 4PB9L 2LVCA 1KJ2L 3J7HA 2X9YA 1YNLL 1I85A 2KPNA 2G9HB 3CFDB 4TSCL 5F89A 1GGBH 3DVGB 4WO4D 1JGVH 1HYSC 3TBYA 4Z76B 3D18B 2PCPB 1J1PH 3KXFD 4P2RD 2X4OB 1KPRA 4LF3B 4R3SB 4BH8A 1L7IL 3VXSD 3NZ8A 4M5YH 2EYSB 4S10A 5C08B 1CFSA 1NJ9A 2BHZA 2N4IA 4XAWH 4D9RD 3FO0L 1YN7B 2R1WB 3EYVA 2IALA 2R4RH 3QNXB 3WMSA 4L4VD 3MV9A 4GAJH 4NKMB 3IFLL 5I1KH 1FYTA 4Y4HB 4Z78B 1A9EA 1ZS8B 1S3KH 1MI5B 3S4SB 4AM0A 4XNZB 2ZOLA 1TCMA 4X4ME 1UB5A 4KJQC 2DQUH 4S2SA 2Z35A 4LMQE 3KPOA 1BLNB 2FEEI 3KJ6H 2YD2A 4U05A 3ULUE 1ZHNB 2GT9B 1TNMA 3STLA 4P2CG 3NACL 4TUOA 1MWAH 4LSRL 1DUZA 2ED7A 1QYGL 5JW4N 4FMKA 2HLFC 3ARTA 4GKSB 5HHXL 1LGVA 4EQ3A 5JHDE 2ADIA 1ZAGA 4X8JB 2VLRA 3DX9B 3WBDA 2DQHH 4JFXB 2GJ6E 2ED9A 5MENA 1V7MH 1HKFA 4I5BA 4P5MA 3RZCB 5K9KA 4P9MH 2NX5D 1Q9OA 4PG2C 1CFSB 1DDHB 2V2WA 4KRPB 4GG6F 1ITBB 1WQVT 4IJ3C 4OCLC 2DS4A 5K9KB 3FFCA 5EIVA 4D9LH 4FZEL 4LSSL 1MWAL 4LSRH 5IG7A 1HK6A 4PLKC 1MCDA 4F37F 1V3MA 1QP1A 1W72B 3HUJB 5F7KC 5F70A 3OPZH 4XCFH 4LRIA 5GGTA 2OSLA 1INQB 4KHXL 3QIBA 1TCRB 2FBJL 2QLVB 1N59B 3ELAT 3MX0A 4Q58C 5DQJB 1J1XL 4RBPH 1RU9L 5BRZD 5JNYA 3VFUB 1R5IB 1AQDA 3GMQA 3SCMB 1T5WA 4HCRL 1JV5B 3GO1H 1J12A 2PO6D 4GS7C 5C0RH 4RCAA 1MCRA 4MNGE 5EULV 1P84K 4CNIA 2HRPH 3JV0A 5EIQA 3FQXA 2Q8BH 3O4OC 4EXKA 5E4EB 5D5MF 3IXAB 5DA4A 3UAJD 4KMTL 4KI1A 3QI9B 4BZYA 2VABB 4JDVA 4PJEA 4PJIE 4DVRL 1SY6H 3QDME 5BXFA 4YFLI 2WUCL 4TUJB 1X5JA 4ALAH 4LLYA 2AJUL 2Y5TA 3DI3B 1KB5H 1CGUA 2A6KA 2JCCE 5IM7B 2W0FB 4I2XE 3O2DA 1EIBA 4QOKA 1LEKA 5ID1B 2BRRL 2H45A 4QXGH 1CXKA 1IKFL 3BESR 2VN7A 3BZFB 5LCVH 3G5YB 3LDBB 3WFCL 5F7DA 2ZOKA 1ACYH 1QFUL 3ZSTA 2ITDA 3RUGB 3VMOA 1FN4A 3EIFA 1B4JL 5ISZB 4YJZL 2BNRB 3QCUL 3VFOA 4QXUL 2G2RB 1DBJH 4EXPX 3FTGA 3GSOA 1OP5H 4OZIE 4DKFH 2YXFA 4JZJA 5H94A 2EE2A 1CI5A 4GQ9L 4KDTC 5HYQB 1AXIB 2X4SA 1T0MA 1J86A 4OZFH 1X6LA 5CKAA 4OD3H 1WITA 4V2CB 3I75A 2MCPL 4LHUA 3QAZB 4Y4FD 1MFBH 2AKRB 2B20A 4KKAD 2HH0L 5TGBB 4D0BA 1VFAA 4JZJC 1V7ML 3TV3L 2PW1A 1MAML 4U3HA 4PJDF 3EGSA 1JK8A 4QYOB 1FLRL 4M61A 3W11C 2Y23A 4JZOB 4OLWH 4AMKL 2YPVL 2FX8L 1KCRH 2VTFA 1R5WA 2BC4B 4XPTH 1HILB 3LVEA 2X4PB 2P7TB 1RZFL 1QHOA 3VFOB 1AKJA 3B8SA 3MV8E 3BWAB 4MZ3A 5D71H 3BPOC 2PO6A 5JHDB 1C8PA 4NKMA 2MCPH 4KHXH 5DJZA 3E2HB 3C08H 3S7GA 3O2VL 3LQMA 5TDNA 3N06B 3OKMA 3PV6B 4CMHB 1EK3A 3SDYH 5I15L 3AAZB 1EPFA 2ZKHH 4EQ2A 5HHVL 4XC1L 5BOPA 1RJCA 2MHAA 4LPVA 2DAVA 4OM0L 4P5KA 2ARWA 3QDHA 4OF8A 3RWFA 1AQKL 1FAKT 1DBMH 3QUZD 1KCUH 3LKPA 1RZIB 2YUVA 4NRZA 1UVQA 2YA2A 3WUZA 1FO0L 5DK0B 3FB7A 3E3QE 4JRYB 4JHWL 5EU7C 5DHVB 5KSBF 2W65A 1JWMB 5F7UA 1CLYH 3S88L 1UZ8B 2A9NL 5HDLA 3WUWA 4IHOB 2EIDA 4OBRA 4GG6B 1HQRA 1N4XH 3W0WB 2DIJA 1I7RA 4FXKB 4MNGB 4MXVE 3VFWB 3QG6B 1S7QA 4LHUD 4K2UH 1DJSA 4LRIC 4HT1L 1SMAA 1AI1L 4XWGL 3DROB 3WKML 3H0TB 3W0WA 5T3ZE 3BP4A 4PY8I 5FOBA 3FQTA 3D3VA 3S36H 4N1CA 3C60A 4X7TA 3GI9L 3DYMA 4GS7B 1FGVH 4WW2A 5ICYA 1U8JA 1P1ZB 2I9TA 4ODBD 1P2CA 5HVHC 5BRZB 3GMOB 3UAJC 4X99B 3MJ8B 2Z8SA 3C5JB 2YC1A 4LCCB 1CFBA 3U2SB 4MJID 5D7SL 3P4OA 4QHUB 3Q5YA 4L5FL 5BQ7B 1PD6A 1TZGH 3JWDL 4GMSL 4NRYB 3GSUA 3EYFB 2FR4A 3MXWL 2ICEB 4UV4L 3CGTA 4WFGD 2B8OT 4JFDB 5ANME 2E6JA 4U1LA 4NNYB 4WW1A 4PJIA 4UI2A 1BF2A 5JW4R 1WZ1H 4W81A 3DTXA 1J7VR 1A7QL 5J3HD 5FYKE 1NCWL 1KIRA 1MVUA 2CGRL 3GO1L 4WTWA 2HVKB 4X9IA 2ZJSH 1H5BB 3W9EA 4P2RE 3PJSB 1I7RB 4FXKA 4MNGA 3DIFB 5D2NB 1QNZL 3MRQA 2Q3ZA 5C0GA 5DTFB 4NQCA 4NN7B 5HJ3B 1FNAA 4ZS6C 4PTTA 1NCWH 4M93C 1ADQA 4OF0A 4TTDD 4JKWA 2FIKA 3O4OB 4ZUTB 3TO4A 5DD0H 4LCIH 5D6CA 1YYLH 1FAIL 1JRHH 1S7VA 1AGDB 1LO4H 4IRZH 4R7DB 3K4AA 4LASL 4WJ5A 2P5WD 1KC5H 3SDAB 1AGFA 3PGDB 3U7AA 1J5OH 5B39A 1EXUA 2VDRL 1D5ZA 5A2KH 5AD0B 2CRYA 3MLTB 3X3GL 4GRLB 3UP1A 1CXLA 4OLZH 2H3NB 3I2CL 2X4SB 1ERNA 1WTLA 4PV9B 1DFBL 1BHGA 3VXSA 1U3HD 4WUUB 5KJRL 2R1YB 3FT2A 2VABA 4JDVB 4PJEB 4U6TA 2X4UB 4X7EC 1YEEL 3M17A 3EYOA 4LK4A 4PRHA 1H9VA 3DNKA 1T3FA 3MR9A 4LIQH 5F9AC 3CFJB 1FAIH 1A4KB 3UTZB 2FBOJ 1GGCH 4K3GA 2ZCLH 4HUXA 4LSTH 4JREC 4U6YB 3VD4A 4PJCF 5CINH 2X6MA 5HGGS 5ID1A 4M9OA 5FA3B 1UJ3B 1I8LA 1S7VB 4H1LA 4IRJC 2XN9B 3QIWB 4H20L 3P9LA 1G84A 1DBBL 5A3ID 1FJ1B 3GHBL 3A6BH 2DQEL 4ELMB 2R0WH 3P0GB 4G8IA 2VXQH 4X6EB 1WBXA 4PJFB 3CXDL 1DTUA 4NHCL 1QVOA 2OTUB 3JTTB 4WEUD 1L7TH 3WFHA 3UZEA 2NW3A 1I7ZB 4B50A 1BX2A 4X6FA 4L9LB 4PJHB 1CZ8L 2ZUSA 2F53D 1P5UA 5EBGA 5IBTH 2ZPKH 3QUMB 3GSNL 4Q9CA 4HIHB 3VWKC 3WNOA 4I5BB 4Y2DB 3T04D 4ENEC 1TZGL 2A83A 2R1XB 5CJXA 5E5RB 3T3MF 3U0WH 1JYXA 3RVXC 4NZJA 1IC7H 4HQQH 3S34H 1SBSL 1YPZB 1AGBB 5JNYB 4LNVA 3M1BB 4UNTA 4I8DA 4CMMA 4WCYL 2HJLA 2IH1B 2VIRB 2X89A 4DW2L 5I1HH 1JE6A 5KVGL 4M1DH 5GGQL 1N64H 3DYOA 5LGHH 3R0NA 4FQJH 1T04A 3NBNA 2Q20A 4IS6B 3B43A 4XPAL 4POYA 1ZT4A 3KS0J 2P8LB 3LEXA 3SDDD 1M7DB 2RCSL 3PWPB 6CGTA 1WWBX 1A3QA 5HVHB 4OKDA 1L6ZA 5B4MD 1YMMA 1UM5H 2NY0C 3UTOA 5BZWA 3H6JA 1JN6B 5CSBA 3G5ZB 4PJIF 4CDGC 2VKXA 2YA0A 3TFKC 3MUGB 5IHLB 5MEOB 3MRGA 1Q0XH 3GSXB 4WU7A 5L2KA 3GMMA 2P8PB 2IPKA 4G6KH 2K7QA 2WZPD 1HH9B 4QRPB 3BZ4A 1Z3GL 1WCBA 3I6GB 3U0PB 5FO9B 2DTML 4OLYL 5JW3H 3I3DA 5I16B 3MLWL 3BW9A 5HHOE 5IVOA 5MEND 2X4QA 4XPGL 1IM3B 2DJ4A 5HYIA 1RJLB 3FCTA 2VE6A 4DCQA 3BKCL 5L9DH 3DUHA 1FVEA 5E99L 1M7DA 4MXQC 4DKAA 3CFBA 2D7TL 4XWOD 5HGAA 3VXMA 3EAKA 2EEAA 3O2WL 1ZHLA 3HRPA 1FFOA 5JZ7D 2ZUYA 1MEXL 5C0DB 4P0DA 1RZJH 3VFPB 5CD5D 3QJHB 1MHHB 2AJVL 3MJ9A 3C8KA 3RNKA 5KSBB 1NFIA 1PKQA 1U8MA 3VGHA 2FATL 1AE6H 5EU5B 2F74A 3B9KA 4D0DA 4UDTB 3IJYA 1ZVYA 2NY5H 2O5YH 4OFDA 2J5LC 3ZKND 2P48B 4EI6A 2NLJA 4PJCA 4L8CA 1RUQH 4U6VL 1DN0A 2A74B 2FATH 3ULUF 2GAZB 3HZVA 3QUMH 5CMAB 3GI8H 1S7UB 3S5LB 1OAKL 5GS0D 3DVNA 1K4DA 1JTTA 1TZHA 4HSQA 4KUCF 3O2DL 3V79C 4O02L 2BSTB 2NW2A 5CEZD 3ARWA 1SEBB 1N0LA 2HRPL 3WIHL 1EGJA 4B7IA 4E5XB 4LNRA 3WHXA 5HYSA 5EFIA 2R4SH 1H5BA 1I8KB 2AEWA 3JWDC 3CXHK 3OQ3B 4KKNA 2JJSA 2F19L 2GK0B 4QKXB 1FP5A 4P2OA 1KJVB 2C26A 1ORSA 2AQ1A 3H9YA 1CFNB 1CIDA 2EEBA 4YQXH 5FB8B 4F58H 1U8NB 2CO7B 4C55A 2QADD 2FIKB 4I0CC 4N0CC 5EBMB 4RGOL 3HPLB 5ETUA 3H9HA 4KJPC 4PJGA 1F6AA 2CK2A 2EDRA 2GUOB 5I19H 3HE7A 5E24E 2FLBT 4XAKE 2GJ6D 1HNGA 4U6HB 3UYPA 1JGLH 4E0RB 5GGUA 4FXLA 3MLWH 4DQOH 3T8XA 2NY4C 3PWNB 5E6ZA 2WBJD 1ZWIB 1WWAX 3L3KB 5DEGB 3ROOA 5TH2B 3VXRD 4PBWD 1NCUA 1DQLL 4LARL 4XNMB 3BRGC 1R24B 2B2XL 4KXZI 4GRLC 4ORGA 5ACMA 3SE4A 1HSAB 2H2SD 4LHQB 1X5KA 4UDUB 5CGMA 5DYOB 2CUHA 2C1OA 3VXUA 1SBSH 4KQ3H 5GS2H 4BZ2L 3STZA 5EU4B 4GRWE 5I6XC 5IB1A 2DTSA 3SGJC 4TQEL 1KGCE 2EO1A 3DXAB 1UH3A 5EOCH 5L6YH 2HFEB 4J2XA 3TT1L 3CVIL 3DVFA 4ELMA 5DVOA 1R3IL 4ODTL 3HCVA 4UQ3B 4XC3H 3F62A 3TBYB 5IMKA 3RTQA 4OIIH 2W0PA 3F5WB 4RMQA 4KHTL 5JORA 1AD0A 2AV1A 4GFTB 4UT7H 3SDXF 1V3JA 5ESAB 5EOCL 5FGCB 3A6OA 2YEZA 4MXVF 2V2WB 3V0WL 5FO9A 4M7JL 5DC0A 2EH8L 1CQYA 4YHPA 1C5BH 5F96L 1XEDA 3WLWC 4LGSB 1Z9LA 1YEIL 5D1QC 1JF6A 4FHBD 4JFDE 3TZVB 1IM9D 3BEVB 3UTTE 5JDSA 4HJJH 2DF3A 1H8OA 5GGRB 3S3PA 5SWSE 1A6AA 3CSYB 2VZOA 1KFAH 5JPNA 1K2DA 2NTSP 4P3WA 5HVGB 3ZHKA 4P46D 5GGVL 1IAMA 3BZFA 4HBQA 3D85A 2E7MA 5F1IB 4RFEA 1BD2B 5KSAD 1HHGA 4ODSH 2FX9L 5CEYB 1MCEA 3RTQB 3OZ9L 4JKPH 5DD6B 3FB5B 2AS5M 1AGDA 4HFWB 1GC1C 5LKNA 1YN6A 1MCJA 1D5IH 1YEGH 5I1GL 4MNQE 4U1SB 3GZKA 2Q8AL 3PXJA 4KVNL 3RGVA 1T1XA 3L3HB 2CK0H 5JW4Q 3B9KB 4D0DB 5HYQA 2XTJB 4PRBB 4XPGH 4BZ1L 2Y6SC 5ILTH 4YBQD 2MQCA 3KHQA 3PIQA 1NGZA 1CD9B 2F5AL 4ISVA 3TF7C 4L8SB 3S96A 1G7JA 2XFXB 3JUYA 4P2YA 1U8LA 4R0LC 4FZ8L 3O3EB 2WLZA 4XNUH 1H3PL 3ES6A 2R0LL 1R5IA 3FO2A 3RHWK 1G7MB 4KAQL 4HFUH 5MERB 4WUUE 4WI7A 1BD2A 1VFBA 2EZ0D 1TCRA 3C5ZB 4RIRB 1P7QB 5J06A 3FQWB 3G6DL 4S11A 1E27A 3WFEH 4RFEB 2GY5A 3N1PC 4JJ5B 4GRWF 1MFEH 2FGWH 2OTWB 2VDQL 2YUZA 2I26N 1MHEB 4WV1A 4GLRH 4PGDB 1I8LC 4X9BA 2ICWA 3ZDXE 1J1XH 3ZE1E 1Q1JH 2CXGA 1NCDL 1XR9B 3DX7B 1YPZF 4YHNB 1NMAH 3NZHL 3OF6A 4AEIL 3ULVF 4N9GB 1IRAY 7CGTA 3ZLQC 3DMMA 4QNPE 2BCKB 5LXGL 1U3YA 2B1HH 1Q9KA 1KLUA 3C6SB 5CSZA 2V5RA 3D87B 1BMGA 3DRTB 1CD8A 3SBWA 3TVMD 2I5YL 2RJMA 4R26L 3H3KA 4P46A 3EJZC 4XP9H 3OB8A 1YYML 3BH8A 3NA9H 2EYRB 1NGYA 2IGFL 3D0LB 4FOMA 5HDBE 5C0IA 4ELMF 3IB4A 1TZIB 3W9DB 1SM3L 3QEQB 4W4NA 4PP1C 3UJTL 4XPHL 2NY2D 1QYGH 3FRUB 4CBPA 1C7TA 4Y1AE 2BNQE 5CJOL 3L3DA 1RZKH 3C87A 2VLRD 2ZNWA 2DQHL 3I6LE 4PRID 4M6NH 1IL1B 2FECI 2XNAA 3SPVA 3GHEL 4IHOA 3LKNB 4PJ7B 1J87A 5GS3A 1F5WA 4Z7UB 4QRRB 2FJHB 4L29A 3GSNH 4P23B 4Z7WF 2V7HB 3MTRA 3ARDD 3KR3L 3UBXG 4NRYA 1FFOB 3ARUA 4P9ML 1IC1A 3U30B 2G75A 1RUKL 1DQMH 3P4NB 4J6RL 4NHCH 3EDKA 4NDMA 3PGCB 3RZWA 3OF6D 1N2RB 2W1NA 3O8XC 5BRZA 3IAPA 2IG2L 4HBCH 1MFDL 1OY3B 3CUPB 4FQHA 4PRDA 1QR1A 5SWSA 2AJSL 4WI8A 2DLTA 4JO1H 4OCXH 2BZDA 1NAKL 5ALCL 4B53A 1X5XA 2H26B 4G43A 2Q87A 4YHML 3ULUH 4WW2C 2R39A 4XAWL 3B5TA 5KSBA 1LP9F 3O6LH 3BWUC 3PWNA 1FVDB 1W0YT 3F65A 4GO6B 3B9KD 2IAND 2EXWD 3AMKA 3VRLE 1RJYA 3MLUH 5I30L 4OZIF 4J3XA 4GAJL 5DQDH 3HPJA 1O0VA 3SE9H 4Y5VB 5E95B 4R7DA 1DP0A 5T1LD 3MSPA 1MCOH 3MOAH 4PRNA 1AO7B 1I8IA 4GQPH 2OYPA 4WI4A 4MNQB 2HN7A 2XWJA 1YEKL 2ZSWB 3V0VA 3B8YA 3QEQE 1S7UA 3S5LA 4PJFE 3HPJB 3NGBB 3PQYA 4M6AA 1LDPH 2Y36H 1JBJA 5I75C 1D5BB 5AUMB 3VD7A 4HUWB 2X10A 4XC3L 1NCTA 4W6YB 4CVWA 3HB3D 2CRMA 3ESVF 5JIIA 7FABH 1A14H 3U0TA 3EDDA 2J8UB 4KUCD 4Y5XA 5JW5A 1GVIA 1FBIL 4HK3N 1FNGA 4XP9L 1KJ3L 1CGSH 5DJ8A 2V7NB 2VQUA 3REWA 5SWSB 5I6XB 5JOFA 4Z76A 1B2WL 1N0XL 1BOGB 1T21B 3ULUC 1KEGH 4MNHB 1H3WM 1A14L 3BP7A 4P2QE 1FNLA 2O26U 1UKTA 4KKBD 4OF6A 1X7QB 4XHJD 1LE9B 2HAZA 2YUWA 2EH7L 4F9PA 5E6YA 2BVQB 5HHNB 2ATKB 2HT4D 3BO8B 4UTBL 4TNVF 2YWZA 4PY8J 1BBJA 5DFVC 1UFUA 3HPLA 2XT1B 4WTZG 1QO3A 1KIPA 5DJ2A 4MA8L 2ATKA 4PRAB 1QFHA 1T83A 2C5DC 3EYUL 3RL1B 1CTNA 1MHCB 2R0LH 4E42A 3K1DA 4M7KL 4HUVA 2DIBA 4ONFL 4X9HA 3RTQC 4XVSL 2VLJA 3WO4C 1MFCL 1A4KA 4N0UA 3UTZA 4EZMA 3G9VA 4GW1A 5DJ6A 4F7MB 2Z93B 1RAMA 5E8PA 1OGAE 3SOBH 2X9XA 3C08L 3LV3B 3OXSA 1HEZB 1OWWA 3EYSL 4BFIA 1A6UL 1AO7E 1YJDC 5JXEC 3SDCD 5AZEH 3WNLA 4GRLA 3SE4C 5EZOL 4OCMC 1IGYB 2CRIA 2QTEA 3EFDH 2C3HA 2NY4B 5HDQL 1M6OB 4CKVX 1NMAL 4HZLA 1MELA 1FO0B 3SKNB 1KCVH 4OGAD 3LB6D 1UM4H 4IDLA 5ICZA 1RFDH 5I74C 4XBEL 1JL8A 1F6AB 5D7KE 4CGTA 5DT1H 4S1SL 2MPAH 3MREA 1YNKL 4JO2L 4NO3B 4P49A 3HAEB 4LCWD 1K2DB 4OLEA 3PP4H 1LP9A 3TBVA 4C57C 1V7NH 2VL5B 5ICXA 2VERN 1YMMB 4FNLH 3HNVH 3ZKQD 1CFVL 2L7UA 1F13A 1WZMA 3ZKMD 1AGCA 1FHGA 5M95B 2NR6C 1AQDB 4ZUSB 4BM7A 3DHMA 3A6CL 1TJHL 3RTQD 3TCXA 1RUKH 2VDPL 2VZVA 2V2TA 1PEWA 1INQA 3NCMA 4HV8B 3HMXH 3T0DA 4AM0B 4ZFFA 4KVCH 3P0VH 1WFTA 3QWOB 3TWCH 1C16B 3QIBC 4OAWB 2BDNL 4YR6B 1G7JB 2XFXA 4ZUVB 2DQCL 5DFVD 3O6MH 2YK1H 1FVDA 1RHHA 1F58H 4XWOC 1S9WB 2YD7A 5CKGA 5DRZA 4TRPL 4XHJC 3IRZA 3OKDB 5SWQB 2X4NA 5EBWB 3SGEI 2A6JA 5C09B 4P99A 1PGRB 5EG6C 5GISL 4XCCL 4CAGA 1F58L 2YPLD 1BZ7B 3K7UA 2O5XL 5TJWK 3LQZA 1U8KA 1EBPA 1P7QD 2VKWA 3SDCA 4RBPK 4EI5A 3RWDA 1FG2B 4G6FD 2FEEL 3BHBB 3L6FB 3LPGA 3MCG1 1OD9A 4IOFC 2ITCB 5I1DB 3OWEA 1JGUL 2CKBA 2PYFA 4Y4KD 1U92A 1MIEH 3QEGL 4AL8L 2NY0D 4JQIH 4Z7NF 3NCFB 4PV8B 4EBQL 4NP4L 1JGDB 3O6FC 4XMPL 1FDLH 4PJXF 1B0RB 5F1NA 1H3VA 1KCVL 1NFDF 1RHHB 1XR8B 3VFWA 4PV8A 4DVRH 4JANA 5JR1H 4G8GB 4KVNH 4DFIA 1A1OB 5I1IH 5D2LE 3JV6A 4HC1L 1HSBB 4R97B 5EFIB 5I8OH 4EVNB 3RWGB 3LOWA 2ESVE 3VDAA 3TN0C 4WFED 1J18A 2XWJB 3V0VB 1TIUA 1WIOA 3GRWH 5B22A 2P5WB 1U58A 3QNYB 5HHXH 4YHKH 3T4AB 3WEXA 3LQZB 5C09D 3DVIA 4U2ZA 4Y89A 5H37H 5E08H 1I85C 4XBPA 4N0UB 2ZUQC 5JQHC 4Y4FB 4LCUA 5D71L 5IEHB 4L4VE 4HDIB 1BM3H 5E99H 4D0CA 3I6LD 3EYUH 4OKVB 1IAIL 4YHZL 3ARBA 2WWMC 1NL0L 2HFGH 3KHOA 4JHAH 4PPTA 3AREA 1L9MA 3GM0A 3MXVH 1YJDH 2VXQL 5HXMA 1CLOH 4PJIB 1MJ7H 3VXSE 2DLFH 5D1XD 3DLQR 3T2OA 4Z7VF 1AJ7H 2DM7A 1VFOA 1K4DB 3ZDYE 1OVZA 1IGIH 2HFEA 3V6OE 2F5BH 1OAZL 5DJAA 3WYRA 2QKIA 5KSUB 5JMRA 1OGAA 4WFGE 2CMRH 3MV7B 1RUPL 4L3CB 1AXSA 3MXVL 1GGTA 4JHBA 5CLTA 5D1XC 5F3BA 5AYUL 3LKOB 4QTIL 4RGNC 5B3NA 1JJUA 6FABL 5DURD 1QLRB 3SDDA 3HI1B 4O2EB 4JO3H 4PTTB 1WJ3A 3ALPA 1CLZL 1LO4L 4IRZL 4JY5H 4KQ4H 5GIRB 5F8RC 3F7YA 3PP3K 1QA9B 3DURA 1U8QB 3P11L 1QRND 4NOBA 5FGBA 1H15B 4OT1L 3NIGE 3P73B 5IW1A 1XMWA 1S7QB 4IRJA 2P7TA 4U3XA 5INCA 4OSUH 1T7XA 5L7XH 1HHHA 1B88A 1TMCB 3QT2A 1Z0NA 4ZAKC 4HUNB 5K9OB 1FFNA 1OGAD 1Z6JT 1KTDB 2GSIA 2YRZA 1UM6L 4HK0A 3GSUB 2PN5A 2VSCA 4HV8A 3ILPA 5KS9E 1UH2A 4JKLA 1QD0A 4KTEH 3RVVC 4GAGL 1F8TH 2BNRE 1WEJL 3MGAA 1NCAL 4LLQA 3BDYL 3SE3C 5JORB 4J8RA 2J6EH 4P5KB 3VXMD 4CU6A 3UPAA 1NFDE 1MPAH 2LFGA 4QXTA 4XP5H 3V52L 5D5MA 3CVHH 5CIPH 2GTZB 3I02B 5MENB 3IDNB 5C0FA 1BGXL 3JV5A 3IDJA 5DEFA 5DJXA 1N4XL 4R2GD 1EO7A 4IEFB 2D7OA 5C0ND 4LVOC 2XKNA 3UTPD 5I1KL 1QR4A 5TQ0L 3MRCA 3QFJE 5KSVA 3TO4C 1TQBB 2YRLA 1AY1H 3VH8G 4APQD 1A6TA 5BO1L 5T3XD 3K8LA 4K23L 3P77A 5H35B 1X4ZA 2B2XH 1QFWH 3DGGB 1RULL 4BSWB 4K3EH 3SJVA 3EBAA 4MDIA 2ZG1A 2D7QA 1LEKB 1IC7L 1X5LA 1KIRB 1LEGA 5C6TH 3MRKB 4TN9A 1GIGL 1GSMA 3BJLA 4O2CB 5F7DB 5TPWL 5J89A 1FQ9C 1DQQA 4HKZA 4H20H 5BV7B 4HLZH 3STLB 3MRKA 3HZKB 1CLOL 1V3LA 2AJYL 4G7VH 4ZPVA 1G7MA 3K0WA 5FUZL 1T80A 2RB8A 3QFJB 4EIZC 4EUPB 4ONHA 1WAAE 2EDOA 3P77B 5BVJB 3TWCL 5SWZA 1G0DA 4N68A 2ZWLT 4P3DB 3NH7H 3E6HB 2A6IB 1W8NA 1PDKA 2ZKHL 2DOCA 5DJDA 3ARGD 4YHOH 4RMWA 5CBAB 3HFMH 3OKDA 5BZWB 4PRHB 2KL6A 3QQ4A 2A77L 2VAAA 4B0MM 2PUQT 4GKNA 2CUMA 1WT5C 4Y8AA 1QPXA 3V8CA 2OTPA 4HC1H 4F8QA 2IEPA 3RX7A 1IGYA 3RY5A 3M8OH 4YLQT 1QSFD 2NTFA 3UYRL 3VXQB 5T3XH 3KPLB 3Q5TA 4P9HH 3OAUH 2RIKA 5BW7A 1S9YB 3D9AL 2B5IB 2ENYA 1T0MB 2NMSA 3LH2L 2NXYB 1U8OB 2QSCH 1CBVH 1U93B 5KAQG 3OKEB 1KYOJ 3HKFA 3QAZC 1NQBA 1RJZB 4UTAH 1XR8A 1FVCB 3VFSA 1WIUA 1FZJB 5FO8A 4DUXA 1IQDA 5DZOA 1I7ZA 4C4KO 2C9AA 5KW9L 1JGDA 2XA3A 3UX9B 1GGCL 5JXED 3ARDA 1NFIB 3MOQA 1GXEA 3HI1A 1N6QL 2I25N 3MV8B 1NUNB 1ZLUK 4GMSH 1I9RL 3GJEB 3KYNA 1B4JH 1SMOA 2NY3B 4XNUL 3F12A 4WFHE 1F90H 4KJYA 1TTFA 2FH6A 5HHMD 3WFEL 1QKZL 1D6EA 2AEPH 4BZ2H 4P23A 3O9WB 3ARGA 1T66C 5HI5C 5IR1B 1U8OA 4ODVH 1ES0B 3JUZA 4NM8H 4M4PA 2M2DA 4KJPD 1GIGH 4LSQH 3FRPG 3B2VL 4E41B 2LQRA 2W60B 4UAOB 4WY7L 1XGRB 3BW9B 1T1YA 1IQDB 2FSEA 3G5VA 4H26A 5E8OB 1AIFB 2AQ2A 5T5NG 4M3JA 4BQBA 1A7OL 4NHUB 1WBZA 5GXBB 2VB5A 2YZ1A 2PTTA 3G5XB 1KN4L 5CAYB 1A3RL 4JHWH 1UYWH 3GSXA 5FYKU 4HIIB 3MGTA 4XMLL 1BQLL 2QQLL 2IH3B 1KTKE 3QULB 2OXHA 3BDYH 3AFLA 1OW0C 2EYRA 4AENA 4U1JA 1UADC 2B1HL 1NCNA 5GGQH 3JBG7 3TBSB 1CGTA 4RMVA 4DCQB 1MF2L 1X5ZA 1IARB 2X9WA 4RAVB 2ICWJ 2YSSA 3VDCA 5GGTL 3DHJA 2P5WE 5GISH 2J6EL 4FQCL 1VA9A 4OZFA 3LSOB 2E7HA 3LPFA 4Y1AB 43CAB 1X44A 4OIAA 2FIRT 4P4RA 1CD1A 1II4E 2WBJA 3FB6B 4HWUA 4ZTPH 1CK0L 4M4RA 4CW1B 4U31A 4XX1G 1EDQA 5D7JC 1BZQK 4NN6B 43CAA 3NZ8B 1C08A 1R3IH 1YEHL 3VFVB 1BFVH 1SEBA 2E8YA 3FOMA 4M7LT 1BP3B 5HHME 2ZSWA 1MHHA 2P8MB 3T0BA 3HAEH 1NCCL 3G08B 3A6BL 4U1JB 3ZT7A 1HWGB 2GTWB 5FO7A 2C1OB 2CLVB 4PJAB 5FYJL 3IFPA 1P6FA 2ILLA 4M5ZL 5JUEH 3BP5B 3P4MA 4HKJA 4RZCA 2JELL 3QO1B 2PW2A 3DO7A 3GIVA 2APFA 3AM8A 2D2OA 1IT9L 3VFVA 3MLVL 2IFFH 5I1JH 3O8XD 3VXNB 5I76A 3PWVB 4GOSA 5D5MB 3LKRA 1G1YA 1DBKH 4YXLL 3RZCD 3HG1B 2R1YA 2OXGA 2YUXA 1QLFA 3L3OA 3OZ9H 5B39G 4ORZC 1O7SA 3D2UD 4N5UA 1XGTB 1PAMA 1VKXB 5SX5H 1RULH 3KPRD 5K9JH 2YC1B 3Q1SL 3MNVA 4YE4L 4TQEH 3N1QC 3C2AL 3RWIA 5DHXB 1AGFB 3MRJA 3NCCB 4R4FH 4M5YL 1YEDB 2EDDA 1YPZE 1TVHB 4N0YL 4JCMA 5AD0A 2GKIA 2EDBA 3DO7B 3E6FB 5ELIA 3M45A 5I8OL 2UWEA 2VLKE 3QXDB 4AG4H 5ADPH 3IFPB 4CN1A 2P5WA 1EFXA 4Q97A 4ZQKA 3ABZA 4I2XB 1I3RA 1LNUA 1D6VL 4I18C 1QNZH 1Z3GH 2NY6C 2QQQA 4F7EB 5ICXB 3MLSL 1T2JA 5KANG 3PJSA 4QRRA 2MWCA 3LQAL 4DKDC 4XP6L 4ELME 5DZNA 3D25A 3EJZD 3OG4B 5C0CA 5C0JA 4WW2F 2HTKD 2VXUH 4JRYD 1XF4A 3KNBB 1EJOL 3S5LG 5IQ7H 2MMXA 1ZT4B 3LH2H 4QRQB 3NN8A 3I9GH 4HUMB 2FX7L 3OR7B 4YHYB 1E4KA 5CHNA 3IAGC 4XVJH 2ZPKL 4LIQE 5FF6B 4ZMAT 5KS9F 3IXTA 5IBLD 5IP4A 4R4BA 1YPZA 1NDGB 2XZCH 4G43B 1CGXA 3QDGB 4EDWH 3ULVE 5D8JH 3BAEL 1G9ML 1YMHB 5E9DB 5LBSL 2OZ4A 4HX1A 3K4ZA 5K9QI 3GMNA 5DRWB 2PXYA 5FKAB 4YAQB 2P5EA 4BK4A 4MCZB 1G7HA 5T3ZL 2BRRH 1I3RB 1A1NA 2C7UA 4UUJA 1LMKA 1MHEA 2J5LB 4PJ5D 4OCXL 4X5XB 4JO2H 4DN3H 5CJQL 1Q9OB 3X14A 4S1DD 1U8IB 2GQHA 4K7PX 3IFOB 3QUML 3O6KH 3DX9A 1VCAA 3QIBB 2DQEH 5IEKA 1D9KA 2H41A 3K4DA 4P59H 4MQSB 5F9JB 5IFAL 5BV7H 3QIWA 4NWUH 1EHXA 2WANA 3DX8A 4JPVH 2BNQA 3NA4A 1ZOXA 4Z0XA 4Y4KA 4PGBB 1A0QH 4YBQC 5EU7E 3MCLL 5J9PA 5KZCB 4OD3L 3GMMB 4N90D 1BF8A 1MH5B 4Z7VE 3B9EA 2C7UB 4Y16A 2J8HA 4JGMA 4V1DE 3C5SA 3O9WC 5F7EL 1PG7H 2PXYB 2VZTA 5FKAA 1H0DA 1EV2E 2BVPB 4S1SH 5GGVY 3HI5L 4ESKA 2AGJL 4OB5L 3MRFA 3RVTC 3AUVA 1QFUH 5DJZB 2ARJB 5IMLA 2IBZX 2RAMA 1RIUH 1EUUA 3SDAA 2GEEA 3CPLA 3QIWD 4PLOB 5DFWH 3RU8H 5KZCD 3BGMA 2HKFH 3CFBB 1CXEA 1A7PL 4J6RH 5J3HC 2EE3A 5HHMB 2COQA 5FUCE 5F88A 2IQ9H 1YYMH 3F6IA 4ZPTA 1OAQH 3VCLB 4BUHA 3DMMB 4XP5L 4R4ND 5CMAA 4WI6A 4LSUH 3V4UL 1WK0A 4X4YB 4HIIA 3TEUA 4OFYD 4L8CB 5C6PB 1Q9WA 3QUXA 4GW1B 4Y4HD 5CEYA 1OSZB 2VLJD 4YDIL 1XIWA 3ROLA 5ALBL 4L4VB 1BAFH 1NGWB 2X4RA 2HMID 1YNLH 3BKYH 3CXHJ 5L0QB 5GRUH 5SX5K 3AS3A 4HG4K 3WD5L 1W2KT 5DJCB 1X5IA 2BSRA 1DVFA 2XN9A 1ROWA 1VESA 5L9DL 2R0ZH 3RDTC 1LE5A 4AJ0A 2HG5A 5D8JL 5DRXB 5FA4A 3H8NA 3GSOB 4JPKL 5IT2H 1P4IH 4JJHA 3IDYB 1ZLVH 2B5IC 1J11A 4RFNB 1FVEB 4LCYB 1IGJB 1W72L 4L4TE 2ADFH 5DRXA 5FA4B 4QWWC 3MRRB 1VFAB 1TPXB 1JZ3A 3GMOA 1U6AL 5FGSA 3B6SB 2XRAL 3P4LA 3BMWA 5F88B 1RPQA 4KK5D 3PV7A 3DPBA 3GI9H 2OI9B 1J8HA 3S37L 4FFWC 4ONGL 2OL3L 5IHZA 1HHHB 3RBGA 1FE8H 4QHMA 3FFCD 4W6WB 4LKXB 2BVOB 5D1XB 3AAZA 4JG0L 5HYJE 1PZUB 1NJ9B 3TYFB 4YNYA 4U6XB 4YGAB 3TA3C 1G7IB 3QZWB 3EJYC 4JDZA 1F11A 3JWOH 2E7LA 2DQIH 1AGEB 4X8XA 2R8SL 1FNGB 3HUJE 4RAVA 4KKCC 3NAAH 3OSKA 5IW3A 3T65B 1KLGB 4YUEH 1FYTB 4Y4HA 4UIKL 3TH3T 1WICA 4ZO8A 1JYNA 5EIIB 2IH3A 1N3NB 3IDNA 1OL0A 1QSVA 5I9QC 4JM2A 1U36A 1DE4B 5CUSL 3G9AB 1QTYT 3NFPA 2G60H 4YNYB 5KVDL 4NWTH 2BFVL 5FHAH 5I2IA 3QWQB 1YN7A 3W39A 1E28A 5TE6L 4M48H 4Y2DD 1EAPA 4FFYH 4V2BA 4MX7B 4H0HB 5SWQA 1QBMH 1DDHA 5F8QC 4QHLB 2R8SH 3CSYA 1FZMA 3WO3B 4HWEH 5JDJA 4LPCA 3P9WB 1I1FB 2FR4B 1UA6H 1CR9H 3LDBC 3KDMA 3GHBH 3SJVD 3LRGA 4WNQB 1HOCA 3AVEA 4HMCA 4P57B 3T2NL 3V6OA 1MCCA 4NQCE 4ZYKA 3DX8B 5DQ9A 5GGSY 4Y5YC 4D94A 2B4CL 3CDYA 4KK8D 5D4QA 3PL6A 4OLVH 1A64A 3VWJD 3DSNA 2H8PB 3G04A 3TV3H 1EGJH 4I3GA 3NZHH 4AEIH 4M48L 2H6PA 3FQTB 3NABL 4RISL 4CMHC 5LAXA 4G6FB 1JF1A 1JZ4A 1A9BB 1OLZA 1ZA6A 5IIEA 3ARFA 5E4EC 3OR7A 5EU5A 1HXMA 5I71B 2XZCL 4QTIH 1KFAL 1AQKH 5JZ7C 2P5EB 3CMOH 5IV2A 5CEZE 1KNOA 4MXQD 4MAYA 1CDHA 4Q9RH 1FO0H 2HVKA 1HSAA 1U2HA 3CX5J 3U4AA 4DFHA 3QFJA 2HT2D 5DS8A 5E2TL 1S7SA 3FN0L 5K59E 3QIUA 1UH4A 1OAYH 3BN3B 3MA9L 1KNOB 3UJTH 4E42B 1AXTL 1Y0LB 5HGBB 3RNQB 4A6YA 5HVWA 1KJ2A 2V5YA 4NP4H 4WGWB 2NCMA 3BP6B 4XH2A 3VXUE 1MF2H 1RZ8A 4LP4A 2H9GA 1I7TB 1TQCB 2RQ8A 4JFOB 1GGUA 3PL6B 4WU5B 3TBTB 4QLRA 3V0WH 2JJUA 3CDCA 3FMGL 5IHBA 3UC0L 3VGEA 4AEEA 1X5YA 3SQOH 2GK0A 2F15A 3WNNA 3BH9A 3FJTA 1GAFH 3ARQA 2BX5A 1VFMA 4JREB 4BFGA 4WCYH 1I1YA 3QDJE 1VADA 3UPRA 1N64L 4WUUA 1AP2B 1YEFH 4YEFA 1KLUB 2N7BA 4F7CB 5C07B 3EO0B 4OBSA 3W82A 2OTWA 4KUZL 4XVTH 4GKZA 4N9OB 4TRPH 3TBTA 4HUVB 4HCRH 5TGBA 1MRCL 4ZPVB 2AW2A 4LVHB 3IJHA 2MQ0A 4U1KB 3L5XL 4F7TA 3B6SA 3DSFH 5DQJA 1HIML 4HKZB 4R9HA 3KPSA 3MBXH 4XP1L 3RNQA 4A6YB 4NYLB 4QRTA 1OAKH 4HPYL 3SY0B 3KXFE 4ENED 2NY3D 1QFWI 3SDYL 2Q86B 3T3PF 2VITA 3ZKXC 1UWEL 1NAKH 5ALCH 3SDCB 4EBQH 2R23A 3GMRA 3RGHA 5FM5O 4X9GA 5A16A 4OLVL 3QEGH 4AL8H 3OKMB 2YD3A 1LK2A 1HHKB 1ZA3A 5EO9B 4HMDA 4X4XB 4D9RE 1KB5B 4OI7A 5JHDA 1T6VN 1QVOB 2OTUA 1XCTA 2EDLA 4KI5D 3KYMB 3FQRB 1Z9SA 4P5TA 1ES0A 3MV01 5ADOL 2KBGA 1IMHC 4BELD 2Y4SA 2AJUH 1I4FA 4FQ2H 5C0RL 1FL3A 2Y9RT 4KI5C 3X3GH 4OAWA 4I9WE 4LLWB 2VLLB 4XBEH 1NBZA 4K7FB 3RP1A 2X5PA 2YD4A 4TTGA 4OUUA 5ITBL 2B0SL 4F7PA 1B90A 4XP4H 2AEQH 4OLZL 3HRZA 3V7AE 4WFFE 4F33A 3QHFH 5DD5H 2GCYB 1IM3A 2YK1L 1GPOL 5BV7L 1REIA 4FQQB 4GG8B 4XNXH 5CP3A 5D7IB 1DEDA 4JFFA 5CSGA 1T20B 1FVCA 5IB5B 4U33A 3S8WA 4RGMC 1MPAL 1MY5A 4FABL 4H5SA 3CH1A 2UYLA 3MLRL 4YGVB 4QRPA 1UZ6E 3OMZA 3Q6FA 3B3IA 5INDB 5JPMA 2ZNXA 4H25A 5FK9B 3SKJH 1YNTB 3U9UA 4N5EC 5EB9A 5EO0B 5KVMC 5I1DA 5HDBF 5FHBL 3RBSA 5I0ZA 1FYTD 4D8PA 4G6ML 2F19H 5J6GB 3EGSB 4QYOA 4GBXA 4N0UE 4I0PB 5TQ2H 2QKIB 5KSUA 1RIVH 3SKJL 3KPRE 1GZPB 5IMMA 1MRFL 1MFCH 3TT3H 3Q6FB 1NDMA 3RY4A 3Q48A 5I66B 2Y7QB 2IANA 4OSUL 4D9QE 4M62L 5IB5A 4QRRE 4U49A 5AEAA 5GIRA 3WDJA 1UC6A 5E8DH 3KJ4B 3EYSH 2PW2B 4O58H 1Q0YL 2VXVH 1UM4L 5C3TA 1R3JA 2P24A 1U8QA 2EICA 3HMWL 1KPVA 4HWBA 4KGLA 4FFVC 1J0IA 3VFPA 2UWEE 3MRRA 5TH2A 1KN4H 5IVXE 4RQQB 3PQYB 1I1AC 1RZIA 1Z5LA 1JMZA 1HDMA 3QDMA 5I74B 4MXWH 2NY7H 1NC2A 3FQUA 3E8UL 3RWEB 1XCQB 5C9JA 3GSWB 4HXBH 4RMTA 1HSBA 2YA1A 1RURH 5DJ2B 4QXWA 4JZNA 5FYJH 5HD8D 4PJAF 3FL7A 4XBGB 1G6RH 5KTEL 3EOBB 4P4RB 4NC1E 4P4KA 4AEHH 3E3QC 4LNRB 2EH7H 2OQJB 3M8OL 3OKLB 5T1MA 3TCLA 4XVUD 5HYEA 4YBLB 3DVGA 3NACH 4WEBL 2IQAB 32C2B 3D3VB 1MJ8L 4I48A 3QUZC 3OG6B 1BVKB 3EFFB 2VLRB 3EYOB 3MJGX 1NC2B 4LCUB 3K1KC 3T0XA 3BKJH 1DBKL 4YXLH 1DVFC 2DD8H 4GKSA 3N9GH 4A6YL 2JCCB 2NY2B 3IETB 4XVTL 4I18B 4MVBD 3QP3A 3LD8B 1S9XA 4UMGA 4NC0B 3JV6B 1QA9A 3BXNB 1WGOA 1OGTA 5EBLB 5F7FA 4JFZH 2J1KA 3QEUA 1J10A 1KJ2B 3DECA 1K4CA 3NFNB 3VD9A 2IAMB 1S9VA 4MAUH 4O2EA 3WIFA 4ZD3L 1SQ2N 4Z78A 3QUXC 1BGXH 4ZS7L 2P49B 4X4XA 3VWKB 1TXKA 5CZVL 2UVFA 4Y2DC 2WQ8A 1TQCC 2EKSB 2QQKL 3I3BA 4Y2DA 4PB0H 1K6QL 5D7IE 4B7LA 4LVNB 1BWWA 3WXVL 2XV6B 3AC0A 2A83B 1AP2A 3NFSH 4XGZA 1U8HB 5HHOA 2APWA 1NL0H 4CU7A 3NCBB 4R2GB 4O5LL 1JYWA 4XNMA 1YQ2A 4MSWA 3VRJB 4PJDE 3ZSSA 3GMQB 3WL9B 5HPOA 4X7SL 2EECA 3LS4L 2EDNA 1HNFA 1J0KA 5D72L 4TUOB 1I75A 3IDXH 3BZEA 1SJHB 2X4TA 4Q7DA 2EIBA 5DMGC 3Q3GB 5DD0L 3E6FA 4WIQA 4KY1H 5ACLA 1H3UA 4GKOA 4HKXB 4HS6A 4GW4B 5T5FH 5IB1B 3LMJL 3NIFE 4NQEB 4XVJL 2XN9E 1JYVA 4KI5F 3V6BR 4KC3B 4HH9B 1MHPH 2Z8RA 3M17B 4KK5C 5FYLL 4Y5YA 4G3YH 1CDIA 3GBLA 4Z7QF 5C0EB 4R97C 3WUWG 1RZKC 4MB4A 4LVHC 3C6LC 3MLXL 2JB6B 4HGKC 4WDIA 5D6DA 3VXTA 5D1ZA 1NMBL 2XKUA 15C8H 1I1AA 5GZOC 4IBLT 4FTVA 2D7PA 3D85D 1CF8H 4HUWA 3BMVA 5M94B 2AXJA 2Z92B 3D5OF 5JW4M 3PGFL 4JKMA 4HWNA 2G5RA 1EHNA 5A40E 2XXCB 5DI8A 2PXYC 1NDGA 3QUXD 4G8FA 1OTUD 3UTQB 4I77H 5FYKD 4LLDA 5KN5A 4KWUA 4U0RB 4XP4L 4JY6A 1OT1A 3DIFA 1MREH 2WP3T 5MHSD 3QUMA 4Y4HC 4K3JH 1DANT 1RZFH 5C0DA 5MI0C 4DZ8B 4V1DA 5F9DC 5KN5B 1QSZA 4KZDH 1DN2A 1KSRA 4TUJA 1EH9A 3GSVA 4YHMH 2I60L 1VHPA 3WFZA 5EUOF 1EHLH 4Y19B 2DQFB 5E8NA 1RD6A 5D7IA 3RGVB 2CJUH 4NYLA 1CGWA 4WEMB 4HWZA 2IG2H 5A1AA 3CXDH 2JIXD 3ZE2E 2Z92A 3FQXB 2XQYG 3NCJL 4KVCL 4WHYH 5EU6B 1IAIM 5D6DC 4PB0L 2ITCA 5BRZE 1AC0A 3MUHL 1AH1A 4PTUA 1U2CA 3NCEB 4POZD 1ZHLB 4BSWA 3WNPA 3C09B 2LE9A 4KDWA 3DV6A 1RVFL 2MKLC 5GRJL 3P11H 4P59L 4EN3D 1NFKA 4NQVB 3DJ9A 4JZJB 2DQUL 4GW5B 3HG1D 3OJMB 5E7FA 1MAKA 3WJJC 1YMMD 5GSRB 1R5VB 2VR5A 1QBAA 4PJ9A 3BH9B 1T2XA 4G9DB 4GW5A 1PG7X 1WBYA 4F57H 3L95A 4OM1H 3QCVL 1WCBB 3I6GA 3OKEA 3U0PA 1BFVL 1XF2B 5DD3H 3ZYIA 5KANI 4YXKH 1R5VA 2QSQA 3FO1B 5BS0B 5EN2A 1H3XA 5HHVH 3FB7B 3VG0L 3PDGA 4QHKI 5E08L 1GGYA 4R4BB 4PTUB 2GUOA 4NQCD 3HC0A 3UTTA 2J3SA 4BKLB 1IGMH 4HT1H 4Z7UE 3DV6B 5GS2D 4OCWL 1ZANL 4J3SA 2WP3O 1HZHL 1T7VA 4HAGA 2XNAB 1MNUL 3ARDB 2X70B 2E27H 4CJ0A 3RIFF 3D6GA 5TDPA 1EJOH 4Q6YA 2C4FT 4LRNL 4PY7B 3QHZL 2JJVA 2V17H 2BSRB 4BZ1H 1R3HA 5TE4L 2QQKH 2XRAH 4PD4J 4KTDH 3SE8H 2XZZA 3MLVH 3WIIL 2X1PA 2BNUB 3SDAC 1TJGL 2F74B 1GGIL 3FT4B 5EPMB 3WXWL 5DJYB 1YQVL 4K3EL 4Q2ZA 4N5ED 1S8DB 2EE9A 4WVRA 4P5TD 3BGFC 3PXHA 4IRSB 5I1LB 5DA0B 1K3IA 2AXGB 3D3VE 3T0ED 4L8DA 4LAJH 4FQLH 4HQQL 4HUUA 1MY7A 4J3UA 5GS1C 2EDHA 4Y16C 2EH8H 3VE0B 5ESVB 3QUZA 2ERJC 3N9GL 3WD5H 5K9JL 2HFFB 5IK3A 3DTXB 3MGTB 3TIDA 2HTLC 4OZFB 4F9LC 4FMFA 4HJJL 3TM6A 3V5KA 2NQCA 3HC0B 1CLCA 3MODL 5EORL 3I50L 1JNHB 1F2XK 2EYTA 1Y6NR 4KRLB 2NY6D 2VDKH 4APQB 3QRGL 4U1HB 3O3AA 4I3RH 1UJ3C 2VC2L 4GXVH 4NZRH 3OV6A 4D0CB 5EC2A 2BVPA 4NFDA 2CDEA 5T1KD 3ARXA 4LLUB 4P48A 3Q6GL 4XCYB 1EERB 5F3HA 2F5BL 4K94C 4KROD 1SVCP 4OF5A 2NPLX 4LLMA 2XKNB 4FQQA 4GG8A 3TNMB 1F00I 3CU7A 1NLBH 1A7OH 2EKSA 3QHFL 5DD5L 3FT2B 1P4LB 3GIZL 4Q2ZB 3BIKB 3FN9A 5EA0L 5IJKA 2AGJH 4OB5H 1EO5A 1NCCH 4KMQA 5MI0B 2H3NA 2EDJA 4RQQA 4NNXA 2IAMC 1OAUH 4IIQB 2A6DA 2KQNA 1QSEE 1S5HA 1BOYA 4F58L 1TNNA 2W07A 2H32H 3LEVH 1HHGB 4E0RA 1A6VH 4HF5H 1P69B 2WM0A 3VFRA 2AAVA 4WWKD 1B0RA 5TE7H 4FP8L 4P23C 5K33A 3TH4T 2BFVH 1AO7A 1I8IB 5TDOA 1PQZB 3INUH 3CX5K 3O45A 3C09C 4YHYC 3LEVL 4Y5VC 1A1MB 1I9IH 2VDLH 2VLKD 1F6FB 1RIVL 3OKLA 5T1MB 5J12C 3FHAA 3GMNB 5DRWA 2VXUL 1BQSA 1OAXL 1I8MA 2FCBA 3PE9A 3WFHB 5F9OH 3TO2B 4F15C 1GOGA 1FLRH 4ZSOB 3VGAC 4WJ5B 4Z95H 3OJ2C 4I18A 4DVBB 3HCVB 1JNLH 2CKNA 1V7NL 4PB9H 5F96H 5JQ6H 5I73C 3IFOA 5D7JD 3HMWH 3CD4A 3ZYJA 2RCSH 5J1SC 4YDJA 1B6UA 3INUL 1CVRA 1RQ5A 3LV3A 3H9SB 5DO2D 4KMLB 2VXTL 4G9FA 1QQDA 1C5CL 5E03A 3AS1A 4PRIA 2ADGB 2R9HC 5GZND 3BAEH 4WY7H 1XR9A 3DX7A 2VWEE 4NN5B 4FQLL 3U4EB 2W9EH 1EAJA 1E6OL 2KKQA 4LDOB 4DAGL 4DUWA 4X6DF 5DC4B 4JFEE 4GKNB 5DRNA 5IKCB 5L6YL 1NKRA 1PQZA 2DTMH 4OLYH 2ZG3A 1IC5H 2VR9A 2ZSVB 3HZMA 1HINL 5E2JA 3EDFA 1NAML 2W9EL 3GB7A 4WHTA 3VMPA 1Y6KR 3PWPA 5J13B 2HT2C 3EDJA 3CLEH 3JWOL 2NY6B 3MO1A 4ZSOA 3OJDA 4BQ6A 4YXKL 3ZDXF 2VN4A 1CICC 3O6ML 3H7BA 4X7DC 1MOEA 1DEEB 4YZFE 3NIGF 4N0YH 2OR8A 4F7PB 1AO7D 4UILL 4G9FD 3AM8C 5F7WC 1SYVB 2FO4A 3IETA 1CD0A 4MDJA 5IB2B 4FG6D 5FF6A 1QRNE 1MIML 4YDVA 5F71A 7FABL 1HHKA 3QHZH 5BZDB 5DJYA 4ZFOB 2LTQB 1ZHBB 1F4YH 4JQXA 1N0XH 1XGPA 3GUTA 1ONQB 1MI5E 3ARYA 2O5XH 4JFHE 4NC2B 5FCUH 2AJZB 4NIKB 2UYLB 3OJDB 1PEZA 4P5TB 4JN2A 5CEXA 3CLEL 2YD1A 5EZJB 3FFDA 3DYPA 1MCQA 2O61B 2D7TH 1UQSB 4TOYL 2HVJA 3GB7B 2FYYB 2PF6A 3D39B 4LKCB 3ROLB 3NVQA 3UBXI 4KRMB 1PLGL 4P2OD 5D7JA 4YR6A 5TE7L 2R2EA 3RUGF 2XICA 2DN7A 5A2JH 4MQ7B 3LPWA 3C2SA 4N8VB 3Q0HA 4YWGL 2MJWA 5FDWB 1VPOH 1KELL 4PFEA 4I4WB 2YD8A 3B3IB 1BIIA 4RFOL 1J9CT 3P4NA 2DM2A 3MLUL 5I30H 1M71A 2AK4D 1OP3K 1CXIA 3IVKB 2X1OA 2G2RA 2H26A 2PYEA 1H3PH 4R6UA 4YX2L 5E8OA 4LCCC 1KELH 5CGYC 4JRXE 3WV0A 4L1HA 5AAWA 4ZNEA 5D1ZD 4KK9C 4HC1A 3K80A 4QOKD 1PY4A 1U92B 1G7HB 2F9BT 4ZUVA 2JJTA 3QEQD 1MLCA 3TA3D 3WS6C 3O0RH 1T0NB 3VGBA 4MA7L 4OGZA 4YH6A 2P8MA 3VFGH 3BIBX 4PJXE 3L5JA 3VFTB 4AEFA 4U3CA 1NCDH 4FFWD 3ARGC 3K2UL 4LSQL 4NJAH 2AKRA 4JM2D 3UPCA 1MJUH 1IGFH 4LSDA 3QDJD 3IXAA 3K46A 3CPLB 3PUCA 4H8WC 2VJXA 2NX5E 4GSDH 3ARFC 2IPUG 2D7NA 1U8MB 2XA8H 4X6BA 1UCBH 8FABA 4KV5E 3WHE0 4PRPD 3RGVD 4WHCA 2I24N 1RIHH 2J8UA 4Y19D 4NO5B 3ME0A 2ICCA 2OR7A 1JVKA 4OLUL 3B9AA 4HMEA 5TQ0H 4PS4L 1Y6MR 1WV7T 1HH6A 3UC0H 5BVPL 1FV1A 4NQDE 2NW2B 1UA6L 1R3LA 1J1PL 2BVUA 4C56E 1NBYA 1T7YA 3IS0X 4C56A 4PJBF 4JM4L 5HGHB 3CK0H 2OQJA 3R1GL 1A6WH 1G7QB 4ZFGH 5E2VH 3DVNB 5C08E 1WLHA 1T7ZA 3AREC 2YKLH 2ADFL 2I60H 1MLCB 4ODTH 4R90L 4P57A 2UWEB 1OSPH 2P42B 4APQC 1CDUA 4FTVE 4IMLB 1ORSB 4U0QB 3QQ9C 2DQDL 5BO1H 2DJUA 1QSFE 1WZKA 4IJ3B 3BQUA 3VU2A 1FGNH 3VWJB 5HY9A 2H8PA 3G04B 1I8KA 1OPGH 3OAYK 3MRJB 1OTTD 4NFCA 5AAMA 4F15B 5GPRA 1F3JB 5DD1H 3AB0B 4E9LA 1BOGA 3PHQA 3G6DH 1Q38A 1XGTA 1WT5A 3MYJA 1DUYB 4PJXA 3UJJL 43C9B 4U4BA 1O7VA 5D7LE 1IAKA 3TN0A 5EDXA 1S5IL 1LDPL 5TF1H 1CL7L 2LAGB 5I1LA 4MJ5B 3LN4A 1LNUB 1E4KC 4ZO6A 3DRQA 5BOZG 1GJIA 3LZFH 4XMPH 2HJKB 3HI6L 3TA3A 5DQDL 3IXTB 3RWHA 5J57B 1BQHG 5IR1A 1BD2D 3DARA 3MJ6A 4ZNCD 4JRYE 3LKOA 5JR1L 3BP5A 3MV9B 5MP6H 2R29H 1LEGB 4U1GC 4XPFH 5B38G 1GCFA 3CU1A 4K94L 4XH2B 1BFSA 3O6LL 4OZHE 5DJAB 4JN2B 4TVPD 4UILH 4KU1A 1JHLH 3FO9A 3O4LA 3DBXB 3MGOA 1IM9B 4UDUA 3D25B 4KROB 3BIKA 1UXSB 2OX5A 3O2WH 4O9HL 4PRPB 1IBGH 1BQHA 5ILTL 3HAEA 4QHLA 4PLNC 3MBEB 3LRHA 5C07D 3R4DA 5ITBH 1A9BA 4RGND 3H42L 2AK1L 1INDL 2F53E 3GGWA 1U8PA 5T5NF 3FB5A 3V5HA 3VDBA 4WHYG 2G5BA 3RWCA 1AI1H 2I9LB 4TSBH 3OR6B 5ESQA 3RDTA 4DGYL 1NBQA 3DSFL 4FQXD 4XI5D 3RL2B 1KT2B 1OM3H 3X3FL 3GBML 5ESQB 3WHE1 1G9NH 1WISA 5A43C 3IJHB 1A6AB 3VG9B 2FH8A 1XIWC 4Y5YB 3AMLA 5I1GH 5FXCH 1QFWL 4MSWB 3DO3A 4H88L 1SJXA 1S7WA 3GBNL 5AZEL 2LU7A 4J4PD 1AHWA 2P44B 1GHFH 2WUBL 3KPPA 4NM4L 3IDIA 4LP5A 5LXGH 4P2RA 4OQTA 4K7PH 5ITFA 4X9FA 2P5ED 1C12A 3HE6B 2OJZH 1ZA3B 2V6HA 1DQTA 4OM0H 1INEH 5FGBC 4PJBA 1QPPA 1IEBB 1MUJB 1OARH 4I4WA 5LBSH 2XACC 2BMKA 2ATPB 2XTJC 3ZTJH 4H8WH 1SM3H 2D03H 3ILPB 5ICZB 4Z8FL 3KWWB 3IDIB 5FM4A 3HZKA 3GSRA 3PQYD 4DWHA 2BXYA 5CILL 3QCTH 1QBLL 4FQCH 1I1CA 4Z7QE 2B0SH 1Q9KB 1RURL 4Z95L 1A7RL 4G9FE 1CG9B 4Y4KC 4RAUB 2AABH 1OTSD 3BE1H 5J0BA 3MRFB 2LU3A 2CDGA 3U7WH 1AR2A 4G6MH 2XY2A 3MRDA 1T6WA 2DLEA 3FN0H 2WBWB 4J3OC 3KPPB 2Z31B 4KV5F 4CN4A 1QO3B 1JNNL 4DN4L 1IGJA 1JPST 3QRFM 1Q94A 4JJ5A 5A2LH 5FKPA 1LK3H 5I1AB 1JCKA 4HJGB 1K8DB 3IGAB 4JQVC 3QH3B 2ITDB 3QQ4B 4DW2H 5I1HL 1NAMH 1BEYL 5JUEL 1KTRL 1CE1H 3RKDD 2UUDK 3U6RB 4XC1H 3O41A 2VNCA 1GOHA 4PJCE 3RIAK 3QIBD 1I3GL 2E6PA 1P5VA 5DJCA 1IKNA 3DX6A 4K8RL 4YFLF 5DJ0A 5GQBA 3WL9A 1KCUL 1OWRM 4ZXBD 1CCZA 1NDMB 2Z91B 3CUPA 4M7ZC 1QR1B 4IMKC 1FL5A 3FOLB 2BSSA 1N2RA 3IKKA 3QO0A 5I1EL 1JPTL 3D0LA 5C0IB 3HI6H 4NKQB 5GRXG 3VCLA 2XN9D 1QOKA 5KVEL 2VLRE 1A2YB 2OM5A 3HC3L 3EYQC 5FK9A 5T33L 5D96C 1ZVSA 3MC0A 1G7PB 5GJSH 4YGVA 1T03H 3MCKA 1JWSB 4M8VA 3ULVD 1D6VH 1RUML 3G6JA 2XWBB 4HZAA 5DT1L 1CS6A 3B2UC 4P4KD 2R2BB 1VPOL 4M43L 1T20A 1IBGL 4L9DA 3LB6C 4NQEE 5J8OA 5DLML 3JWDH 5CIPA 5JHLH 1ZV5A 3BSZL 3GKWL 4F33B 4LPWA 4GBXB 5EC2B 4QNPF 5E8EA 3EOAB 1JN6A 4BKLA 3OXRB 1KEMH 4NRZB 1NC4B 1INDH 1TFHA 1ACYL 2XZQL 5TQ2L 5FEBA 5IB4A 1ZGLM 1IKFH 4LOUC 2A1WL 3MMEB 4MXWL 2DQGH 2YMXH 3MLYL 4JDTH 2QADB 4HD9A 3LKNA 4JCLA 4HXBL 4I13B 4ZO7A 3W81A 15C8L 4OV6F 1F4YL 1ZHNA 2GT9A 3IKCA 4WW2B 3S35X 5ICYB 4X6CE 3JVGA 1HH9A 3O81A 4J7RA 4GRMA 1J1OH 3G6JB 4L8DB 3BP4B 1Z5LB 4DK6A 5C8JB 3BT2H 1UZ8A 4M7KH 4XWGH 4PRPA 3JWNC 3QRGH 4LPUA 1S8DA 4OFPA 5B8CA 2ZJSL 1BVLA 1E4XI 4MHHG 5J11B 4LFHG 4HIJA 3F58L 1F11B 1ZT1B 3FO9B 3O4LB 3OKKA 4BK5A 4MAYB 4U7SA 1EZVY 1IM9A 1FORL 3SQBA 2FRGP 5ISZD 1FG2A 1MFNA 1AXSB 1HE7A 4L3CA 3IKCB 2DJSA 4MD4A 2DBLL 4JFDD 4OUOA 1MCSA 4UIMB 1P7KB 2KDGA 4UBDD 3S4SG 1P6AB 3ULUD 1OARL 1KN2L 1ND0B 3D85B 1XF4B 1J8KA 3OKYA 3QDMB 1X4XA 3IJYB 3HR6A 4I3SH 1F8TL 1NEZG 4UIMA 1UZ6F 2ENSA 1LILA 1JPFB 4TUKH 1RVFH 3SO5A 2QHLA 2N7AA 4I0PA 4X83A 4Z5RB 4CJ1A 3BJ91 4X6CF 2FDBP 5LQBH 2VSDA 2DM3A 4WHDA 3PWLA 5DMIL 1A3RH 3QI9D 4HIJB 3PHQB 3RHWF 1U3HB 5DDHB 2R69H 4G8GE 1NMBH 3EOYG 3QXVA 3SBWC 3S3JA 3PDDA 3L9RA 3ILQD 3RL1A 3SE3A 1UCBL 4HJGA 3HE7D 4NZDA 1OD7A 2C4XA 4KQ4L 1K4CB 4MMXC 2EXWC 2HFTA 2X70A 2XWTA 3C5ZD 1B4RA 1MREL 3UJJH 4AK1A 2ESVD 3DMMD 5HDQH 1G7LA 4JM2F 3PGDA 5C0AB 2EDEA 2EKJA 4MWFB 5DC9B 3BQUD 5CJQH 4GMTH 1MI5A 3S4SA 4BFIB 2XA8L 2C1PB 3UPRB 1RZKL 4QCIB 1L7TL 4LBEB 4EKXA 4LHUG 3TIEA 5E8PB 2UY7A 4WEBH 4HF5L 1QHPA 5ISZA 1XCTB 2Z8VC 5C2BL 5FECB 1UB6B 1CGVA 5FYKH 1IAIH 4HKXA 5B39B 3T3PE 5LGJA 2H32A 3BDXA 2V5TA 3ARDC 2R0ZL 1MAJA 2Q1EA 1M6OA 3LN9A 5D72H 4LVNC 1C1EH 2EYTB 5C2BH 2JIXA 2BVEA 3T77B 1KB9K 2W0KA 4O2FB 3CFCL 1D6EB 1E0OB 3BKYL 4UB0L 5TPWH 1W72H 2WIMA 3VRJA 1NMCB 2F8XC 3MNVB 1HEZA 4NO2B 1S7TA 3EO1A 3U48A 1F3RB 4JRXD 5EU6A 4M61B 3ARBC 1U93A 5I73B 3OX8B 3TZVD 3U79A 5K9QG 1RMFH 1R0AH 1C7SA 1MCHA 1OF2B 1E6OH 4ODXA 5EOTB 1JV5A 4F7CA 3AS2A 4K3DH 4XT1C 1U8IA 1WBXB 2W60A 4CNIB 2IJ0C 3N85L 5JHLL 1QG3A 4TNWF 3QJHA 4DAGH 4QO1A 3HFML 5DR5L 2GY7B 1RMFL 1R0AL 2DB8A 4JFFB 3TJEH 2CKBB 2NZIA 4AENB 3QPQD 2AP2A 4ZFOL 1RUMH 2UZXB 3LEXB 4HFUL 1ED3A 2P8LA 5D1QA 4HS8H 2OMBA 4X0KA 5E6IB 1A02N 3LEYH 3QWOA 4NKOA 2A77H 4JG0H 3KPQB 2HG5B 3QG7L 2E27L 2VIRA 4G7YL 1MJ8H 3BOVA 5E6ID 4M9PA 1VFBB 5KVEH 5KS9A 1MVFA 4XRCA 3HZVB 5DFTA 3T09A 5FYLH 1T1YB 2A2QT 1GYAA 2B39A 1GC1L 4Y19A 3TZVC 4H5SB 3QIUB 5EOTA 4D3CH 5FGCE 3CLFL 3MNWA 3VI3F 3V5DB 3LCYA 4JFPB 3FHQA 1HQRB 3LIZH 4JFFE 3VFSB 2O61A 4XI5C 2F5AH 4U1IA 3OAUL 4DZ8A 2WBJB 3FB6A 3B83A 4PY7A 4HPOH 2CDGB 3F7VA 4OD2B 2E8ZA 4E5XA 3BPLB 4NCDA 3OKNA 4EI5C 4XTRC 3LS5H 2NYYD 5IWLA 3P30H 4JHZA 3QFDB 3MYZA 5DHYA 4TOYH 4Y7MA 4PJDA 3BPOB 3QEHB 4O02H 1DBJL 2ZUUA 3CZFB 1JNLL 3BRFA 3DRTA 3QFDA 4HAFA 1NANH 5EN2B 3ECBA 2BHUA 4O58L 2Y6SD 2V9RA 4RDQG 1FNSH 3NFSL 3WCYA 1UACL 5AG9A 1C5CH 3MNWB 4OZGA 4UDTA 3BZDA 4TULL 1RUQL 1QUNA 1CDYA 2DMKA 3VXPA 4ODHL 1DBML 3DX6B 4NUGL 2X4PA 3MQIA 1X5FA 3QUYD 3QDAA 3CZJA 2W9LA 4BSVA 4DKEH 2XZAH 3DMMC 2D0FA 3E8UH 3C5ZC 5F3HB 1WCQA 5IF0A 3D18A 3I85A 1U0QA 4EUPG 4GAGH 3GHEH 2Q86A 5KJRH 4JFED 1EEYA 3WEXB 2WIIA 1UM6H 3NFNA 4TVSa 4OZGB 5F7EH 4YHIB 3BQUB 3KJ6L 1G7PA 2FHCA 5CP3H 1H5BC 1K8IB 2BSTA 2DI7A 1OAUL 1E4WH 3EJJX 1RZJC 2WIIB 3CNKA 1NC2D 4XMKL 5EPMA 4J1UA 2JCCA 2OBGA 35C8L 2GJZB 2G75B 1BWMA 1CDJA 2X7LA 3VXUB 5ESVA 3K3QA 2CKBH 2GAZA 3OHXA 3V4PL 4QGYA 2CIIA 3NCYP 1JZ6A 1R3HB 1ODAA 3RX8A 1YA5A