5IW5A

Crystal structure of e. coli nudc in complex with nmn
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
257
structure length
254
Chain Sequence
MDRIIEKLDHGWWVVSHEQKLWLPKGELPYGEAANFDLVGQRALQIGEWQGEPVWLVQQQRRHDMGSVRQVIDLDVGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSHCRERYYPQIAPCIIVAIRRDDSILLAQHTNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVKNLRYVTSQPWPFPQSLMTAFMAEYDSGDIVIDPKELLEANWYRYDDLPLLPPPGTVARRLIEDTVAMCRAEYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the bacterial decapping enzyme NudC
pubmed doi rcsb
molecule keywords NADH pyrophosphatase
molecule tags Hydrolase
source organism Escherichia coli b354
total genus 60
structure length 254
sequence length 257
chains with identical sequence B
ec nomenclature ec 3.6.1.22: NAD(+) diphosphatase.
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
A PF09297 zf-NADH-PPase NADH pyrophosphatase zinc ribbon domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5iw5A02
3.90.79.20 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5iw5A01
3X0RA 4JZVA 3DKUA 3GZ8A 2A8RA 1XSBA 1MQEA 3SONA 1OW2A 3CNGA 1TUMA 1VIUA 3DUPA 4JZTA 2DUKA 3X0NA 2JVBA 3N9UA 5IW4A 5GHOA 1VK6A 3A6UA 5BS6A 2GT2A 3ACAA 5FSMA 1NQZA 1RYAA 3O52A 5ANTA 3EEUA 4YOQA 5ANWA 1V8TA 2I6KA 3RH7A 2FVVA 2O5FA 3O8SA 2J8QA 3MCFA 5GHQA 3HYQA 4N1TA 4V14A 5GHJA 4HVYA 3E57A 4S2YA 3P6YA 1V8VA 1KTGA 5DD4A 1NQYA 1Q33A 3O69A 2G73A 1I9AA 2B0VA 1XSCA 1K26A 2I8UA 3EF5A 3GRNA 1PUQA 3ID9A 1MP2A 1V8UA 2DSDA 1MK1A 3FCMA 3MGMA 1X51A 5DEQA 3Q1PA 5LPGA 1V8WA 4S2XA 3X0JA 3EXQA 1SOIA 1PUSA 2CL3A 1MR2A 3Q2TA 4S2WA 3MDGA 2B2KA 2ICJA 1F3YA 2I8TA 3L85A 2PQVA 3A6VA 3J7Ye 3FJYA 5DDGA 1V8RA 1NFSA 1PPWA 3X0OA 3X0SA 2KDWA 3FK9A 2VNPA 2YVNA 3F13A 2FKBA 4N1UA 5FSLA 4ICKA 2RRKA 2GB5A 5C7QA 5C8LA 3WHWA 3BAPA 3R03A 1NFZA 1SJYA 3SMDA 1VHGA 2O1CA 3G0QA 5DPKA 3GZ5A 5ISYA 1X84A 2QKMB 2W4EA 3X0LA 1U20A 4KTBA 3A6SA 4IJXA 3X0KA 4JZSA 1SZ3A 3QSJA 1VRLA 1R67A 1VIQA 3GG6A 5I8UA 4KYXA 3KVHA 1JRKA 5GHIA 5IW5A 1HZTA 5CFJA 3COUA 3P5TA 1GA7A 3A6TA 4KG4A 4HFQA 1G9QA 3U53A 1VC8A 1RRSA 1MUTA 1XSAA 4YPRA 1PPXA 1Q27A 3MDIA 3O61A 1G0SA 1MQWA 1X83A 2A8SA 1V8SA 2XSQA 4NFWA 3H95A 4KG3A 4MPOA 3F6AA 1V8LA 1V8IA 2R5WA 3X0PA 3FFUA 3OGAA 2Q9PA 3Q93A 1VCDA 4NFXA 4K6EA 5FSIA 2A6TA 2AZWA 3I9XA 2DHOA 2KDVA 1PUNA 2DSCA 2VNQA 2DSBA 3SHDA 2YVPA 3O6ZA 4ILQA 1QVJA 1VHZA 2O5WA 2YVMA 4C9WA 5GHNA 5BONA 2FMLA 3EESA 2YVOA 3Q4IA 3HHJA 5FSKA 5HZXA 3BM4A 3ZR1A 3X0MA 1V8YA 2A8TA 3GWYA 3FSPA 1JKNA 4DYWA 2A8PA 5C7TA 5GHMA 1KT9A 3X0QA 4C9XA 1KHZA 1K2EA 2G74A 5CFIA 2B06A 4JZUA 3Q91A 5ANUA 2YYHA 3I7UA 3X0IA 1HX3A 2QJTA 1V8MA 2GT4A 3N77A 4YPHA 3ZR0A 3GZ6A 1PVFA 5ANVA 4S2VA 5FSOA 1VC9A 1RRQA 3AC9A 1SU2A 5ANSA 2ICKA 1V8NA 5GHPA 4ZG0A 3BHOA 3Q2SA 2QJOA 1PPVA 1Q54A 1IRYA 2PNYA 5FSNA 3I7VA 2A8QA
chains in the Genus database with same CATH superfamily
3X0RA 4JZVA 3DKUA 3GZ8A 2A8RA 1XSBA 1MQEA 3SONA 1OW2A 3CNGA 1TUMA 4J7GA 1VIUA 3DUPA 4JZTA 2DUKA 3X0NA 2JVBA 3N9UA 5IW4A 5GHOA 1VK6A 3A6UA 5BS6A 2GT2A 4J7HA 3ACAA 5FSMA 1NQZA 1RYAA 3O52A 5ANTA 3EEUA 4YOQA 5ANWA 1V8TA 2I6KA 3RH7A 2FVVA 2O5FA 3O8SA 2J8QA 3MCFA 5GHQA 3HYQA 4N1TA 4V14A 5GHJA 4HVYA 3E57A 4S2YA 3P6YA 1V8VA 1KTGA 2CZRA 5DD4A 1NQYA 1Q33A 3O69A 2G73A 1I9AA 2B0VA 1XSCA 1K26A 2I8UA 3EF5A 3GRNA 1PUQA 3ID9A 1MP2A 1V8UA 2DSDA 1MK1A 3FCMA 3MGMA 1X51A 5DEQA 3Q1PA 5LPGA 1V8WA 4S2XA 3X0JA 3EXQA 1SOIA 1PUSA 2CL3A 1MR2A 3Q2TA 4S2WA 3MDGA 2B2KA 2ICJA 1F3YA 2I8TA 3L85A 2PQVA 3A6VA 3J7Ye 3FJYA 5DDGA 1V8RA 1NFSA 1PPWA 3X0OA 3X0SA 2KDWA 3FK9A 2VNPA 2YVNA 3F13A 2FKBA 4N1UA 5FSLA 4ICKA 2RRKA 2GB5A 5C7QA 5C8LA 3WHWA 3BAPA 3R03A 1NFZA 1SJYA 3SMDA 1VHGA 2O1CA 3G0QA 5DPKA 3GZ5A 5ISYA 1X84A 2QKMB 2W4EA 3X0LA 1U20A 4KTBA 3A6SA 4IJXA 3X0KA 4JZSA 1SZ3A 3QSJA 1VRLA 1R67A 1VIQA 3GG6A 5I8UA 4KYXA 3KVHA 1JRKA 5GHIA 5IW5A 1HZTA 5CFJA 3COUA 3P5TA 1GA7A 3A6TA 4KG4A 4HFQA 1G9QA 3U53A 1VC8A 1RRSA 1MUTA 1XSAA 4YPRA 1PPXA 1Q27A 3MDIA 3O61A 1G0SA 1MQWA 1X83A 2A8SA 1V8SA 2XSQA 4NFWA 3H95A 4KG3A 4MPOA 3F6AA 1V8LA 1V8IA 2R5WA 3X0PA 3FFUA 3OGAA 2Q9PA 3Q93A 1VCDA 4NFXA 4K6EA 5FSIA 2A6TA 2AZWA 3I9XA 2DHOA 2KDVA 1PUNA 2DSCA 2VNQA 2DSBA 3SHDA 2YVPA 3O6ZA 4ILQA 1QVJA 1VHZA 2O5WA 2YVMA 4C9WA 5GHNA 5BONA 2FMLA 3EESA 2YVOA 3Q4IA 3HHJA 5FSKA 5HZXA 3BM4A 3ZR1A 3X0MA 1V8YA 2A8TA 3GWYA 3FSPA 1JKNA 4DYWA 2A8PA 5C7TA 5GHMA 1KT9A 3X0QA 4C9XA 1KHZA 1K2EA 2G74A 5CFIA 2B06A 4JZUA 3Q91A 5ANUA 2YYHA 3I7UA 3X0IA 1HX3A 2QJTA 1V8MA 2GT4A 3N77A 4YPHA 3ZR0A 3GZ6A 1PVFA 5ANVA 4S2VA 5FSOA 1VC9A 1RRQA 3AC9A 1SU2A 5ANSA 2ICKA 1V8NA 5GHPA 4ZG0A 3BHOA 3Q2SA 2QJOA 1PPVA 1Q54A 1IRYA 2PNYA 5FSNA 3I7VA 2A8QA
chains in the Genus database with same CATH topology
3X0RA 4JZVA 3DKUA 3GZ8A 2A8RA 1XSBA 1MQEA 3SONA 1OW2A 3CNGA 1TUMA 4J7GA 1VIUA 3DUPA 4JZTA 2DUKA 3X0NA 2JVBA 3N9UA 5IW4A 5GHOA 1VK6A 3A6UA 5BS6A 2GT2A 4J7HA 3ACAA 5FSMA 1NQZA 1RYAA 3O52A 5ANTA 3EEUA 4YOQA 5ANWA 1V8TA 2I6KA 3RH7A 2FVVA 2O5FA 3O8SA 2J8QA 3MCFA 5GHQA 3HYQA 4N1TA 4V14A 5GHJA 4HVYA 3E57A 4S2YA 3P6YA 1V8VA 1KTGA 2CZRA 5DD4A 1NQYA 1Q33A 3O69A 2G73A 1I9AA 2B0VA 1XSCA 1K26A 2I8UA 3EF5A 3GRNA 1PUQA 3ID9A 1MP2A 1V8UA 2DSDA 1MK1A 3FCMA 3MGMA 1X51A 5DEQA 3Q1PA 5LPGA 1V8WA 4S2XA 3X0JA 3EXQA 1SOIA 1PUSA 2CL3A 1MR2A 3Q2TA 4S2WA 3MDGA 2B2KA 2ICJA 1F3YA 2I8TA 3L85A 2PQVA 3A6VA 3J7Ye 3FJYA 5DDGA 1V8RA 1NFSA 1PPWA 3X0OA 3X0SA 2KDWA 3FK9A 2VNPA 2YVNA 3F13A 2FKBA 4N1UA 5FSLA 4ICKA 2RRKA 2GB5A 5C7QA 5C8LA 3WHWA 3BAPA 3R03A 1NFZA 1SJYA 3SMDA 1VHGA 2O1CA 3G0QA 5DPKA 3GZ5A 5ISYA 1X84A 2QKMB 2W4EA 3X0LA 1U20A 4KTBA 3A6SA 4IJXA 3X0KA 4JZSA 1SZ3A 3QSJA 1VRLA 1R67A 1VIQA 3GG6A 5I8UA 4KYXA 3KVHA 1JRKA 5GHIA 5IW5A 1HZTA 5CFJA 3COUA 3P5TA 1GA7A 3A6TA 4KG4A 4HFQA 1G9QA 3U53A 1VC8A 1RRSA 1MUTA 1XSAA 4YPRA 1PPXA 1Q27A 3MDIA 3O61A 1G0SA 1MQWA 1X83A 2A8SA 1V8SA 2XSQA 4NFWA 3H95A 4KG3A 4MPOA 3F6AA 1V8LA 1V8IA 2R5WA 3X0PA 3FFUA 3OGAA 2Q9PA 3Q93A 1VCDA 4NFXA 4K6EA 5FSIA 2A6TA 2AZWA 3I9XA 2DHOA 2KDVA 1PUNA 2DSCA 2VNQA 2DSBA 3SHDA 2YVPA 3O6ZA 4ILQA 1QVJA 1VHZA 2O5WA 2YVMA 4C9WA 5GHNA 5BONA 2FMLA 3EESA 2YVOA 3Q4IA 3HHJA 5FSKA 5HZXA 3BM4A 3ZR1A 3X0MA 1V8YA 2A8TA 3GWYA 3FSPA 1JKNA 4DYWA 2A8PA 5C7TA 5GHMA 1KT9A 3X0QA 4C9XA 1KHZA 1K2EA 2G74A 5CFIA 2B06A 4JZUA 3Q91A 5ANUA 2YYHA 3I7UA 3X0IA 1HX3A 2QJTA 1V8MA 2GT4A 3N77A 4YPHA 3ZR0A 3GZ6A 1PVFA 5ANVA 4S2VA 5FSOA 1VC9A 1RRQA 3AC9A 1SU2A 5ANSA 2ICKA 1V8NA 5GHPA 4ZG0A 3BHOA 3Q2SA 2QJOA 1PPVA 1Q54A 1IRYA 2PNYA 5FSNA 3I7VA 2A8QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X0R A;  4JZV A;  3DKU A;  3GZ8 A;  2A8R A;  1XSB A;  1MQE A;  3SON A;  1OW2 A;  3CNG A;  1TUM A;  1VIU A;  3DUP A;  4JZT A;  2DUK A;  3X0N A;  2JVB A;  3N9U A;  5IW4 A;  5GHO A;  1VK6 A;  3A6U A;  5BS6 A;  2GT2 A;  3ACA A;  5FSM A;  1NQZ A;  1RYA A;  3O52 A;  5ANT A;  3EEU A;  4YOQ A;  5ANW A;  1V8T A;  2I6K A;  3RH7 A;  2FVV A;  2O5F A;  3O8S A;  2J8Q A;  3MCF A;  5GHQ A;  3HYQ A;  4N1T A;  4V14 A;  5GHJ A;  4HVY A;  3E57 A;  4S2Y A;  3P6Y A;  1V8V A;  1KTG A;  5DD4 A;  1NQY A;  1Q33 A;  3O69 A;  2G73 A;  1I9A A;  2B0V A;  1XSC A;  1K26 A;  2I8U A;  3EF5 A;  3GRN A;  1PUQ A;  3ID9 A;  1MP2 A;  1V8U A;  2DSD A;  1MK1 A;  3FCM A;  3MGM A;  1X51 A;  5DEQ A;  3Q1P A;  5LPG A;  1V8W A;  4S2X A;  3X0J A;  3EXQ A;  1SOI A;  1PUS A;  2CL3 A;  1MR2 A;  3Q2T A;  4S2W A;  3MDG A;  2B2K A;  2ICJ A;  1F3Y A;  2I8T A;  3L85 A;  2PQV A;  3A6V A;  3J7Y e;  3FJY A;  5DDG A;  1V8R A;  1NFS A;  1PPW A;  3X0O A;  3X0S A;  2KDW A;  3FK9 A;  2VNP A;  2YVN A;  3F13 A;  2FKB A;  4N1U A;  5FSL A;  4ICK A;  2RRK A;  2GB5 A;  5C7Q A;  5C8L A;  3WHW A;  3BAP A;  3R03 A;  1NFZ A;  1SJY A;  3SMD A;  1VHG A;  2O1C A;  3G0Q A;  5DPK A;  3GZ5 A;  5ISY A;  1X84 A;  2QKM B;  2W4E A;  3X0L A;  1U20 A;  4KTB A;  3A6S A;  4IJX A;  3X0K A;  4JZS A;  1SZ3 A;  3QSJ A;  1VRL A;  1R67 A;  1VIQ A;  3GG6 A;  5I8U A;  4KYX A;  3KVH A;  1JRK A;  5GHI A;  5IW5 A;  1HZT A;  5CFJ A;  3COU A;  3P5T A;  1GA7 A;  3A6T A;  4KG4 A;  4HFQ A;  1G9Q A;  3U53 A;  1VC8 A;  1RRS A;  1MUT A;  1XSA A;  4YPR A;  1PPX A;  1Q27 A;  3MDI A;  3O61 A;  1G0S A;  1MQW A;  1X83 A;  2A8S A;  1V8S A;  2XSQ A;  4NFW A;  3H95 A;  4KG3 A;  4MPO A;  3F6A A;  1V8L A;  1V8I A;  2R5W A;  3X0P A;  3FFU A;  3OGA A;  2Q9P A;  3Q93 A;  1VCD A;  4NFX A;  4K6E A;  5FSI A;  2A6T A;  2AZW A;  3I9X A;  2DHO A;  2KDV A;  1PUN A;  2DSC A;  2VNQ A;  2DSB A;  3SHD A;  2YVP A;  3O6Z A;  4ILQ A;  1QVJ A;  1VHZ A;  2O5W A;  2YVM A;  4C9W A;  5GHN A;  5BON A;  2FML A;  3EES A;  2YVO A;  3Q4I A;  3HHJ A;  5FSK A;  5HZX A;  3BM4 A;  3ZR1 A;  3X0M A;  1V8Y A;  2A8T A;  3GWY A;  3FSP A;  1JKN A;  4DYW A;  2A8P A;  5C7T A;  5GHM A;  1KT9 A;  3X0Q A;  4C9X A;  1KHZ A;  1K2E A;  2G74 A;  5CFI A;  2B06 A;  4JZU A;  3Q91 A;  5ANU A;  2YYH A;  3I7U A;  3X0I A;  1HX3 A;  2QJT A;  1V8M A;  2GT4 A;  3N77 A;  4YPH A;  3ZR0 A;  3GZ6 A;  1PVF A;  5ANV A;  4S2V A;  5FSO A;  1VC9 A;  1RRQ A;  3AC9 A;  1SU2 A;  5ANS A;  2ICK A;  1V8N A;  5GHP A;  4ZG0 A;  3BHO A;  3Q2S A;  2QJO A;  1PPV A;  1Q54 A;  1IRY A;  2PNY A;  5FSN A;  3I7V A;  2A8Q A; 
#chains in the Genus database with same CATH topology
 3X0R A;  4JZV A;  3DKU A;  3GZ8 A;  2A8R A;  1XSB A;  1MQE A;  3SON A;  1OW2 A;  3CNG A;  1TUM A;  4J7G A;  1VIU A;  3DUP A;  4JZT A;  2DUK A;  3X0N A;  2JVB A;  3N9U A;  5IW4 A;  5GHO A;  1VK6 A;  3A6U A;  5BS6 A;  2GT2 A;  4J7H A;  3ACA A;  5FSM A;  1NQZ A;  1RYA A;  3O52 A;  5ANT A;  3EEU A;  4YOQ A;  5ANW A;  1V8T A;  2I6K A;  3RH7 A;  2FVV A;  2O5F A;  3O8S A;  2J8Q A;  3MCF A;  5GHQ A;  3HYQ A;  4N1T A;  4V14 A;  5GHJ A;  4HVY A;  3E57 A;  4S2Y A;  3P6Y A;  1V8V A;  1KTG A;  2CZR A;  5DD4 A;  1NQY A;  1Q33 A;  3O69 A;  2G73 A;  1I9A A;  2B0V A;  1XSC A;  1K26 A;  2I8U A;  3EF5 A;  3GRN A;  1PUQ A;  3ID9 A;  1MP2 A;  1V8U A;  2DSD A;  1MK1 A;  3FCM A;  3MGM A;  1X51 A;  5DEQ A;  3Q1P A;  5LPG A;  1V8W A;  4S2X A;  3X0J A;  3EXQ A;  1SOI A;  1PUS A;  2CL3 A;  1MR2 A;  3Q2T A;  4S2W A;  3MDG A;  2B2K A;  2ICJ A;  1F3Y A;  2I8T A;  3L85 A;  2PQV A;  3A6V A;  3J7Y e;  3FJY A;  5DDG A;  1V8R A;  1NFS A;  1PPW A;  3X0O A;  3X0S A;  2KDW A;  3FK9 A;  2VNP A;  2YVN A;  3F13 A;  2FKB A;  4N1U A;  5FSL A;  4ICK A;  2RRK A;  2GB5 A;  5C7Q A;  5C8L A;  3WHW A;  3BAP A;  3R03 A;  1NFZ A;  1SJY A;  3SMD A;  1VHG A;  2O1C A;  3G0Q A;  5DPK A;  3GZ5 A;  5ISY A;  1X84 A;  2QKM B;  2W4E A;  3X0L A;  1U20 A;  4KTB A;  3A6S A;  4IJX A;  3X0K A;  4JZS A;  1SZ3 A;  3QSJ A;  1VRL A;  1R67 A;  1VIQ A;  3GG6 A;  5I8U A;  4KYX A;  3KVH A;  1JRK A;  5GHI A;  5IW5 A;  1HZT A;  5CFJ A;  3COU A;  3P5T A;  1GA7 A;  3A6T A;  4KG4 A;  4HFQ A;  1G9Q A;  3U53 A;  1VC8 A;  1RRS A;  1MUT A;  1XSA A;  4YPR A;  1PPX A;  1Q27 A;  3MDI A;  3O61 A;  1G0S A;  1MQW A;  1X83 A;  2A8S A;  1V8S A;  2XSQ A;  4NFW A;  3H95 A;  4KG3 A;  4MPO A;  3F6A A;  1V8L A;  1V8I A;  2R5W A;  3X0P A;  3FFU A;  3OGA A;  2Q9P A;  3Q93 A;  1VCD A;  4NFX A;  4K6E A;  5FSI A;  2A6T A;  2AZW A;  3I9X A;  2DHO A;  2KDV A;  1PUN A;  2DSC A;  2VNQ A;  2DSB A;  3SHD A;  2YVP A;  3O6Z A;  4ILQ A;  1QVJ A;  1VHZ A;  2O5W A;  2YVM A;  4C9W A;  5GHN A;  5BON A;  2FML A;  3EES A;  2YVO A;  3Q4I A;  3HHJ A;  5FSK A;  5HZX A;  3BM4 A;  3ZR1 A;  3X0M A;  1V8Y A;  2A8T A;  3GWY A;  3FSP A;  1JKN A;  4DYW A;  2A8P A;  5C7T A;  5GHM A;  1KT9 A;  3X0Q A;  4C9X A;  1KHZ A;  1K2E A;  2G74 A;  5CFI A;  2B06 A;  4JZU A;  3Q91 A;  5ANU A;  2YYH A;  3I7U A;  3X0I A;  1HX3 A;  2QJT A;  1V8M A;  2GT4 A;  3N77 A;  4YPH A;  3ZR0 A;  3GZ6 A;  1PVF A;  5ANV A;  4S2V A;  5FSO A;  1VC9 A;  1RRQ A;  3AC9 A;  1SU2 A;  5ANS A;  2ICK A;  1V8N A;  5GHP A;  4ZG0 A;  3BHO A;  3Q2S A;  2QJO A;  1PPV A;  1Q54 A;  1IRY A;  2PNY A;  5FSN A;  3I7V A;  2A8Q A; 
#chains in the Genus database with same CATH homology
 3X0R A;  4JZV A;  3DKU A;  3GZ8 A;  2A8R A;  1XSB A;  1MQE A;  3SON A;  1OW2 A;  3CNG A;  1TUM A;  4J7G A;  1VIU A;  3DUP A;  4JZT A;  2DUK A;  3X0N A;  2JVB A;  3N9U A;  5IW4 A;  5GHO A;  1VK6 A;  3A6U A;  5BS6 A;  2GT2 A;  4J7H A;  3ACA A;  5FSM A;  1NQZ A;  1RYA A;  3O52 A;  5ANT A;  3EEU A;  4YOQ A;  5ANW A;  1V8T A;  2I6K A;  3RH7 A;  2FVV A;  2O5F A;  3O8S A;  2J8Q A;  3MCF A;  5GHQ A;  3HYQ A;  4N1T A;  4V14 A;  5GHJ A;  4HVY A;  3E57 A;  4S2Y A;  3P6Y A;  1V8V A;  1KTG A;  2CZR A;  5DD4 A;  1NQY A;  1Q33 A;  3O69 A;  2G73 A;  1I9A A;  2B0V A;  1XSC A;  1K26 A;  2I8U A;  3EF5 A;  3GRN A;  1PUQ A;  3ID9 A;  1MP2 A;  1V8U A;  2DSD A;  1MK1 A;  3FCM A;  3MGM A;  1X51 A;  5DEQ A;  3Q1P A;  5LPG A;  1V8W A;  4S2X A;  3X0J A;  3EXQ A;  1SOI A;  1PUS A;  2CL3 A;  1MR2 A;  3Q2T A;  4S2W A;  3MDG A;  2B2K A;  2ICJ A;  1F3Y A;  2I8T A;  3L85 A;  2PQV A;  3A6V A;  3J7Y e;  3FJY A;  5DDG A;  1V8R A;  1NFS A;  1PPW A;  3X0O A;  3X0S A;  2KDW A;  3FK9 A;  2VNP A;  2YVN A;  3F13 A;  2FKB A;  4N1U A;  5FSL A;  4ICK A;  2RRK A;  2GB5 A;  5C7Q A;  5C8L A;  3WHW A;  3BAP A;  3R03 A;  1NFZ A;  1SJY A;  3SMD A;  1VHG A;  2O1C A;  3G0Q A;  5DPK A;  3GZ5 A;  5ISY A;  1X84 A;  2QKM B;  2W4E A;  3X0L A;  1U20 A;  4KTB A;  3A6S A;  4IJX A;  3X0K A;  4JZS A;  1SZ3 A;  3QSJ A;  1VRL A;  1R67 A;  1VIQ A;  3GG6 A;  5I8U A;  4KYX A;  3KVH A;  1JRK A;  5GHI A;  5IW5 A;  1HZT A;  5CFJ A;  3COU A;  3P5T A;  1GA7 A;  3A6T A;  4KG4 A;  4HFQ A;  1G9Q A;  3U53 A;  1VC8 A;  1RRS A;  1MUT A;  1XSA A;  4YPR A;  1PPX A;  1Q27 A;  3MDI A;  3O61 A;  1G0S A;  1MQW A;  1X83 A;  2A8S A;  1V8S A;  2XSQ A;  4NFW A;  3H95 A;  4KG3 A;  4MPO A;  3F6A A;  1V8L A;  1V8I A;  2R5W A;  3X0P A;  3FFU A;  3OGA A;  2Q9P A;  3Q93 A;  1VCD A;  4NFX A;  4K6E A;  5FSI A;  2A6T A;  2AZW A;  3I9X A;  2DHO A;  2KDV A;  1PUN A;  2DSC A;  2VNQ A;  2DSB A;  3SHD A;  2YVP A;  3O6Z A;  4ILQ A;  1QVJ A;  1VHZ A;  2O5W A;  2YVM A;  4C9W A;  5GHN A;  5BON A;  2FML A;  3EES A;  2YVO A;  3Q4I A;  3HHJ A;  5FSK A;  5HZX A;  3BM4 A;  3ZR1 A;  3X0M A;  1V8Y A;  2A8T A;  3GWY A;  3FSP A;  1JKN A;  4DYW A;  2A8P A;  5C7T A;  5GHM A;  1KT9 A;  3X0Q A;  4C9X A;  1KHZ A;  1K2E A;  2G74 A;  5CFI A;  2B06 A;  4JZU A;  3Q91 A;  5ANU A;  2YYH A;  3I7U A;  3X0I A;  1HX3 A;  2QJT A;  1V8M A;  2GT4 A;  3N77 A;  4YPH A;  3ZR0 A;  3GZ6 A;  1PVF A;  5ANV A;  4S2V A;  5FSO A;  1VC9 A;  1RRQ A;  3AC9 A;  1SU2 A;  5ANS A;  2ICK A;  1V8N A;  5GHP A;  4ZG0 A;  3BHO A;  3Q2S A;  2QJO A;  1PPV A;  1Q54 A;  1IRY A;  2PNY A;  5FSN A;  3I7V A;  2A8Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...