5IW6A

Anti-cd20 monoclonal antibody fc fragment
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
209
structure length
209
Chain Sequence
b'GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Structure of anti-CD20 monoclonal antibody Fc fragment at 2.34 Angstroms resolution
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iw6A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iw6A01
3C5JA 4Y8DC 3KXFA 4WFFE 4PGJA 4XPGH 3VFNB 4LF3B 4JVWA 1CE1L 1DLHB 4KU1A 2NY7H 3TBVA 5HHMD 2E5EA 4UT9H 4Z95H 4JQIH 4UIMA 1YEHL 4YEEA 4UTAL 1CG9B 1JNNH 5I19H 2Q20A 5FUOH 4GAGH 2QQNH 5LKNA 4MD5A 4OLVH 4NUGH 3ZTJG 1UWGL 2EE6A 1OQOA 3GI9L 2ZWLT 5DVLA 2I27N 3ZKMD 3C5ZB 1C08B 4M7LT 5K9OB 1DQQB 1BD2E 2W9EL 1IAIL 3CDYA 3H9SE 1W0WA 1F90H 3SOBL 3U79A 1U8OA 3UPAA 4X5XA 4P46D 5I8EB 5DA4A 1WZ1H 3RAJL 2NTSP 4M5ZL 3QBTB 3F7QA 3MO1B 3H8NA 5IB1A 4ZTPH 3PQYE 1OF2A 1PVHA 2HRLA 3S35H 3CXDH 3EJZD 4QOKB 4XPAH 1FORH 1YEKL 2FO1A 5DC9B 3BQUD 5ERWA 4LPWA 1R5WA 1VACA 3UBXI 1ES0A 4B0MM 4L4VE 3EDJA 3PG2A 5GGRY 4LL9A 2ITCA 4OLYH 4FZ8L 2LTQB 1JE6A 3KYOA 4LCWD 2AQ1A 4XC1H 3FO1A 2OQJB 3HC4L 1F2QA 4J3UA 5BZDB 4GMSL 4AL8H 1A22B 1NCNA 5JORB 2X4QA 3WS6C 4WU7A 5F97E 4YHIA 5A2IH 1XGTB 4X7EC 4BH7B 3TZVA 6FABH 5D71L 2DQFA 2YUZA 4Z6AT 1E0OB 1AGBB 2E6PA 4JDTL 3HG1D 4XT1C 4U6YB 3T0AA 2HT2C 3ARQA 4PJ5A 1AGFB 1X5XA 4NUJA 3MJGX 3OR7B 4H1LA 2I26N 4Y16C 1RIUH 2FH6A 3G6DH 3KNBB 2VH5L 4X6FA 5D70H 5D9SB 2B1HH 3K4ZA 5EUOF 3VXMA 1OP3K 4M93C 1KEGL 1NMAH 4Q9RH 3B9KC 1G6RH 1TJHL 1NCDL 4HKXA 1FDLH 5GZNC 4KKBD 3V4UL 5DMGD 1MREL 5EU6D 5FUCC 2EH7H 4HQQL 2O61A 1UWXK 4HT1H 4QHUA 5ACLA 3K81A 1B2WL 4KAQH 4OKVA 3RKDC 3I6LE 1P7HL 1RURL 1OP5H 4D0BA 2KQNA 3MLUH 2BCKA 5KSVA 1X5KA 1QD0A 3NMEA 3LOWA 4IMKA 5C0GB 2V2XA 3P2TA 4H20H 1RZJC 3LPGA 4LVEA 5ESVA 3BP5A 3RWFB 2WINA 4E41D 5KTEH 4XPFH 5J56B 2AK4E 5FKPB 1R3HA 1IC7H 1DQJA 4APQA 5C09E 2CK0L 3L5WB 4BYHA 1CD8A 4PRIA 3KS0J 1A6PA 2FLBT 3QWQB 4I8DA 4YXLH 5GGQH 4ZUWA 4NHCL 5KW9H 1UJ3A 1QSFA 4TRPL 1IC1A 2YRPA 3VXRA 2CO7B 3MV7B 3W9DB 2MQCA 3B8YA 3ZYJA 3IVKA 3TYFA 5F7KC 4LNRB 4M7LH 1N0XH 5HYEA 4PLOB 2AAVA 4YGVB 4FMKA 5LJYH 5DWUH 3D2UA 5DI8B 1MPAL 2OL3B 3B5GA 2NY2D 4UV7L 1JTTA 3DURA 3MBEB 4XNXL 2JLLA 2HP4A 4HXBH 1JNLH 1DEEB 5HGBB 3BWUC 3U83A 2VDNL 1RZKH 5FM4A 3H0TB 1JHLL 1NFIA 5BXFB 2PR4L 5FA4A 3KJ4C 3KDMB 1TDQA 2VLKE 1G9NL 1DFBH 3WUWG 4DQOL 1NUGA 3AREB 4WI2A 2EC9T 3GHBH 2XN9B 8FABA 4ZAKB 4MLIA 1ORQA 3DMMC 3GMPA 3OR6A 4WWKD 3SCMA 4G42A 1L7IL 3VXSB 1TCRB 3MSPA 2Z0BA 1V3LA 4ODSH 3AU1B 4P2OC 5IUSA 3BVNA 2Q3ZA 4JRXA 3VXUA 3QIBC 1IZKA 4J3OC 4PTUB 5CKGA 1CR9H 4G7YL 3BKJH 5C0RH 4M3JA 5I1AA 4W68A 4F7MB 3BZFA 3WNNA 4NO3B 3MJ9L 4XI5C 5TF0A 1OAXH 4JM2B 2YK1H 4PP1D 2R0ZH 5TH2B 1PX3A 1U8PB 1ETZB 2NMSA 1WWWX 2UWEA 4JKPH 4X9HA 2DI9A 1U93B 3J7HA 4Q6IB 5SWSE 3P73A 4L3CA 3IU4L 1M05B 4JG1H 1FO0L 4PY7B 4R8WH 4X6BB 1NFDA 3D69B 5JZ7D 4WY7L 3QEGL 5C0JB 4QHNA 3C60C 2F54B 2BVQB 3QDJE 5IP4A 1PLGL 5DHVH 2L7JA 4PJAF 4QRRB 1FCCA 3MBXL 5GQBA 3NIFF 2EDYA 3SKJH 3ZYZA 3U4BL 2MHAB 5E94B 1HZHH 5DXWA 1KPUB 4R7DA 3ZKND 2DMCA 2D31A 4HH8A 5E03A 3BIKA 1N6QH 5C08A 4PG9A 4FABH 2JELL 4JGJA 1KGCD 2I25N 3ARDC 4DVBB 2AEIT 2HJLB 2J8HA 1H5BB 3SE3C 4D94A 2R1YA 3LN5A 1O0VA 3KLHD 1U8IB 2VLRE 4TULH 1BFOB 1NGYA 2X09A 5SX5K 4G3YH 5EO9B 3RWGA 4ZO7A 3DV4A 1F4AA 1LE9A 3PV6A 1BGXL 4KTYA 4P23D 4P48A 3NACH 1U8NA 1JGDB 3IS0X 4ZD3H 2UVEA 3RVXD 5JO5A 3MOAH 1Q0YL 4MXQC 2IBBA 5IVXA 2PW1B 3IFLL 5I6XC 2CRYA 4RMSA 4JO1L 5ADOL 4DFHA 3IXTA 4HKZA 2E7MA 2FHCA 5CILL 5LVEA 5DFVD 3SDCA 3DTXA 5EOQH 1ZLVK 1FBIH 4RBPK 1UA6H 1OPGH 1SJXA 4LHUB 43CAA 5HYJB 4LLVA 2R0KL 1M7IB 2OXHA 4LU5H 2ZPKH 4P4RA 1AY1L 4NZJA 4OZIF 1SY6L 1O5DT 3K2UL 3TA3B 4ELME 2VRAA 4DZBA 3RL1A 4G9FB 1OTUD 1ZV5A 2YUWA 1PGRB 5A3ID 3S5LB 1B4RA 4Y5XA 1AGEA 4NKMB 3REVA 1E4XH 2LQRA 5HDQL 4OCNC 5D2NA 5C2BL 5I18H 1J0HA 3OXRA 3KYNB 2XXCB 1T22B 1U42A 4W70A 3SJVA 2AJUH 1EK3A 1ADQA 1QLEL 2IQAA 1S3KL 2DQHH 3T08A 5FO7A 3AC0A 1A9EA 5CJXA 2HWZH 4F57L 1YJDL 2AI0L 3NZ8A 2EEBA 5C0FA 4WUKH 5LAXA 2KBGA 2IBZX 2C4XA 1T7YA 5E8DH 3VXTB 3P40A 4U1SA 4U6XA 5ANME 2JB5H 3BKYH 5D7KD 2Y7QA 5E5RB 1FN4B 1YEIL 5EU6E 5SWZE 4PJIE 1AXTH 1RPQA 1DBAL 5BMFH 1KPVB 3FFCA 5CKAA 1U58A 1D6EB 2R23A 5DJAA 3IXAB 5IEKA 4QYOA 2I5YL 3D25B 1H3PH 1EEUA 5AAMA 1WC7A 2B39A 1JUFA 3BPCB 2DWDA 3IU3B 4I4WA 1HH9B 4OQTL 1NCBH 3CCHA 4UT6L 2CPCA 4C83A 5J06A 3NH7L 2VQ1B 2X4SA 5HHPB 3L3IA 1J1XL 1I1AC 4F80A 3NZHH 4OTXL 5IOPA 1EFXA 5HYSA 4NNPH 5H35B 2PTTB 3H6JA 5FK9A 2VZSA 4YX2H 5JW3H 2R9HD 1HHKB 2PNDA 3U7WL 3UZVB 3SKNA 5CBAB 1ZHLA 2VC2H 4L4TD 2BJML 2P7TA 3VFPA 3KLDA 2DD8L 2D2OA 1UB6B 1JZ4A 5C2UB 3MRIA 5FGCE 2X40A 1T6VN 2X89A 3C5JB 3SDAD 3KXFB 1IM3B 5FYLL 3BDXA 4JFED 1JGEB 2DMBA 2HTLD 3JUYA 4FG6D 2Z9TA 4UAOB 4X4ME 4XGZB 2HT3C 3KG5A 4LBEB 5F89A 3TBVB 2Y23A 4JY5H 4J6RH 3MREA 1S5IH 4TNWF 2IMNA 4UIMB 2Z4QA 1EIBA 4NWTH 5EU7C 1J8HE 5DURB 4GBXA 3QHTC 1DBJH 4OCSL 2CDEB 5CIPH 2GTZA 3FHAA 1RFDL 4ENEC 1ZHKB 1Q94B 4GG6A 1W0VA 4CVXB 4Z76B 4ZNCD 5MEQA 2QSQA 1KCLA 1DCLA 1GGCL 2FX8L 1X4ZA 3EYVA 5TDPA 1PEWA 3ZE2F 3QDMD 3QXAB 4X0KA 3RGHA 3QUZD 4GKNB 2OR7A 4KMTL 3D9AH 3MRMA 4OM0H 3BKCH 3VWKA 1U8OB 2ZSWB 3SDXF 2X4RA 3NGBB 5IB1B 1HCVA 3AM8A 1NBZA 1F4XL 1BFVL 5FO9A 1JHKH 1FNGA 2VR5A 4R90L 4LSRH 5HVGB 3C6LC 5C6TL 2BVEA 1GGTA 4WI6A 5ERWB 1LDPH 1VACB 3WLWD 1ES0B 4MJIB 1NEZG 4BFGA 3CNKA 3P11L 1NCCL 1U6AH 3ZMRA 5DR5L 3WUZA 4K3EH 1MJUH 1X5JA 3ARRA 1OAQL 2ITCB 3Q5OA 4NN6B 5I71C 3CK0H 1MELA 1KN4H 1P5UA 1FNEA 4TTGA 1G7JB 3NABH 1QBLH 2QQQA 3FO1B 1OP5K 3SE4C 3RJDA 3QWOB 1U3YA 2I60H 2JB6B 4ZXBB 1N2RA 2X4QB 3RKPA 4ETQA 2D7NA 5CZVH 4Z78A 4JFFB 1F6AB 3TZVB 1A7QH 2NY0B 4POZC 2ARJA 4HBCL 4OLZL 3VE0A 1NGPL 4G43A 1MIMH 4WW2B 2EDXA 2NW3A 3VRIB 9CGTA 2EC9U 4X6FB 1MH5A 4Q6YA 2VL4A 5JUEH 1B6DA 5CHNA 1AP2B 2DKMA 4OFYA 2IPUK 3BN3B 5D72L 3BW9B 1MJ7H 3VCLB 4H88L 2NY4C 2AJXL 4YHOL 3QUMH 2BX5A 5JHDB 5D5MB 1JK8B 2O61B 4KROC 2JIXD 1HSBA 1PG7L 4XH2A 4IRJB 4YLQT 1CXHA 4OKVB 5H94A 3MRQA 1KIUA 4DVRL 2CR6A 1EERB 3E2HC 4NPYA 3NBNA 4HV8B 1FRGL 5KSVB 2H6PB 2JKXA 1J12A 3GM0A 4OFKA 2YR3A 3BP5B 1IGFH 2WINB 3VI3E 1NSNL 5I73B 4Y4KA 3RTQB 2VXSL 4UIKL 4CMMB 3DARA 5FUZL 4CDGC 1BX2B 1A3LL 1TNNA 3LHPH 2E9WA 4PRIB 3HZKA 1ZLUH 4P2RD 2A74B 3AS1A 4YFDB 1BQLH 2XICA 5MP6H 1BBDL 5DT1L 1BFSA 3VXRB 5J11C 1Q9WB 3T3MF 3O3EB 3I6GB 2XIDA 1YNTA 1KJMB 4DEPC 4PUBL 3PDGA 2E7BA 1CD9B 3IVKB 3TYFB 5KVMC 1AHWB 5C1MB 1GGYA 2C26A 3K8LA 2BNRE 3DROA 1GZQA 3LMJH 3MRKA 3O3UN 3INUH 2R1XA 5I30L 1H3GA 1E4XI 3ILPA 4JANA 1J88A 4ALAH 3UJIL 1RZGA 3N1FC 3PABA 3IF1B 4OBSA 5K9QG 1BVLA 4N9OB 2OBGA 3RY5A 2XNAA 3QDAA 2OR8A 1T20B 2P5EA 3QULA 1NFIB 4BSWB 5FA4B 1NMCC 4PJGE 4XP6H 1PY4A 5D7KE 4XBGA 1GZPB 4O5LH 2XZAH 3TPKA 2ADGA 1TJIL 1S7TB 4F2MA 3ZE1E 1JYVA 3GMPB 3WDJA 5I1KH 3SGJA 2X70B 2VXTH 2HFTA 4MJ6A 4FP8H 4HCRL 2QADD 3QIWC 2FJGA 3FT4A 4MDIB 4NIKB 3P30L 4G8GD 5A2LH 2AABL 4HZAA 1FGVL 1BZ9A 3EFDL 2Z8RA 5L7XL 4K2UL 1CGWA 3RGVC 5I1JH 3V4VH 3RWJA 3WUWA 4IRSA 3FN3A 4OD3H 3G5XB 3WXWH 4NQDA 2F9BT 3OX8A 3NCEB 1NJ9A 4ODXA 5IESL 4NQXB 4KMQA 1G7HB 5GS1A 2B5IB 3GNML 4XP9H 1K6QH 4ERSH 1RZ7H 3G6JA 1QYGL 1OWWA 5DJCA 3JUZA 1RUKH 2JCCE 2Y5TA 4XVJH 2RJMA 3MCKB 5D7JD 4BFIA 4MD0A 4PJFA 2A83B 3CFJA 4MJ5A 3MLYL 3IRPX 1IGYB 2EO1A 4DUWA 4GW4A 5F7HA 5KJRH 5D96B 4R7DB 1ZOXA 1GAFH 4OCWL 4M5YL 2D31B 1YNLL 1F58L 3BIKB 3WIFA 2XWTA 4P3CL 1BWWA 2OYPA 1BREA 1T1ZB 1XIWD 4U1NB 5T33L 5I1HL 3CX5J 5EWIL 3X3FL 2YMXH 1ZHBB 5HGGS 2COQA 1CN4A 1IKFH 4NO2A 3RWGB 2D7TL 2E8YA 2UY6A 3DV4B 1LE9B 2WIIA 1L4IA 2ADJB 4ZS7H 4LASH 4YBQD 3C5SB 5CBEB 5C8JA 1EGJA 1U8NB 3T4YB 4Q9BA 3ZDXF 3V6ZB 1Z9SA 4R2GC 1OSZA 5E2TH 5JO5B 1CDYA 2B2XH 4XMLH 3ZKMC 4EDXA 5D6DA 2XRAH 3S96A 2OSLA 3GIVA 5LGHL 1J05B 2VXVL 4HKZB 1A47A 5DK3A 4X9IA 5HSFA 1MWAB 1IRAY 4P46C 4M7ZC 2YD8A 1EDQA 2J6EL 3C5ZD 3D6GA 3MGAA 3VWJB 1WIOA 1D9KB 1QLFB 2DQEL 5KSAD 3VDBA 4P4RB 4NQEE 3EJZC 4RISH 3CDCA 12E8L 3MNVB 1XCQA 4DZBB 1OSPL 4QXTA 3T2QA 3KPNA 3UP1A 4QOKD 5CAYB 4JHZA 5E8NB 5J1SC 3DVFA 1X4YA 4PR5B 4U1LB 1TVHB 4RIRB 5E00A 3HPLB 3MCLL 4LIQH 3MOQA 4PRHA 2WK2A 4PLKD 5FO7B 3QWRD 2EDWA 4TYUA 5D1XC 3QQNA 3GMMA 3TO4A 3T0EE 2YZ8A 4ZPTB 2H1PL 1J0KA 1UC6A 3BDBA 3VRLF 5LXGH 4U1SB 1YNKL 1BLNB 1N59B 3RDTD 2VAAB 2JJTC 4ISVA 5CMAA 4ODWA 1T83C 3QNYA 3O6KH 3PXHA 3X3GH 2R23B 5DJAB 1I7ZB 5IF0A 3KPTA 1Q72L 1ED3A 1JUFB 4N0UB 4H8WC 1KTKE 4KKBC 5AYUL 3FRUA 1QFPA 1BZQK 1NBVL 3QG7H 5DVNA 1P2CA 2IAMA 4MDJA 1A6WL 1QKZH 5IOPB 1EFXB 2Q1EA 3JXAA 3GIZH 1XCTA 5I1DB 2EXYC 1UACL 5FK9B 4AIXA 1HHHA 2AEQH 1A3RH 4HJGA 1ZHLB 5ID0A 4KI5F 3MUHL 5GHWL 3L5IA 4OI8A 5I8KL 3TBWB 4OD1H 1T5XB 3PWUB 4WJ5B 4JFDB 1GOHA 4JB9L 1CDJA 4M8VA 4AENA 4P57A 1I3GH 4YHYC 2AGJH 2Q8AL 4OGXL 4JCMA 5E1AB 5F89B 3MREB 4RX4D 4Y1AE 5FYKD 2Z4QB 2I24N 1RZIB 2Y36H 1PYWA 2BSSA 2O5YL 3CVHB 4WI4A 2GTZB 4P5TA 5I1IH 1O7VA 5KG9B 1FG2A 4GG6B 5MEQB 3MV7D 2XZCH 4IOFD 1OGAE 3O6LH 4HWNA 5HI5D 4X5WA 5TDNB 2EYTB 4LLUB 5IB4A 5FM5O 3HS0A 1A7NL 2NY2C 3HNVL 3QHZH 4NP4L 5DJXA 3PWPB 1VB9A 3SGDH 4XZUB 1RZFL 3UTQA 5CJOL 4G5ZL 1MHPL 5I2IB 3VWKB 4WO4B 4PJEE 4WW2F 4FQIL 2BMKA 3MRGA 5DEGA 3MBED 1CI5A 3ULVF 4PYGA 4AEIL 4IS6A 5FO9B 1FNGB 3QHFH 5EBLA 4G8GE 5SWQB 4WWKC 5IKCA 3FFDB 3Q2CA 5D5MF 5I8OH 3HLAA 5JXED 5MI0C 3ARED 4JHAL 3SO3C 4XNQB 2XN9D 4U1GC 4ZAKD 5F3HB 3VXSD 5D1ZB 2FL5A 35C8L 5DJ8B 1WAAE 2F58H 5ENWA 1CICA 3BWAA 1RZJH 4LCIH 5EN2A 1VKXA 2GSGB 4PP1C 1CLYL 3BUYB 2YPKA 4K94L 3HCVB 4RZCA 5ALBH 1QR1B 1X7QA 1N2RB 4HUMB 4FQHB 5FYLE 1NBYA 1PBYA 2A0LC 2ORBH 4JM2D 1WCQA 4JPKL 2CH8A 3PL6A 4HMDA 4QRPE 3EYFB 5JZ7C 2D9CA 1A2YA 4OT1L 2WSKA 5INDA 5M95B 2GKIA 1NEZA 3M45A 3WFEH 1HI6A 1P7QB 2EIBA 2N4IA 1AR2A 1NEUA 1XGQB 4FQCH 4L29B 5BRZA 4XCCH 2F54D 4GRMA 5IFHL 1YMMB 4QRRD 5A2FA 3LB6C 3W9EA 4F58H 1K9TA 2FGWH 3PV7A 5DYOB 3BPNB 3BSZH 4YDKH 4KK5D 4YDLB 1B4JH 1DBKL 2BY2A 4OF8A 4KRMB 3G5ZB 1HSBB 5INCA 3UYOD 1MFCH 1C1EL 1L0QA 4XPTH 4RMVA 5H94B 4PV8A 1QSEA 3MRQB 4G6ML 4D9LH 1NAML 2R1WA 4PRDA 3KLHC 3S34L 1DQLL 2KZWA 4FFVD 3DBXB 1EMTH 1INDH 1GGBL 2VLJA 5E2VL 1KC5L 3O11A 1AXSB 3CZFA 4IMLA 3P4OA 1CE6B 4RRPG 1WSST 3TN0B 5EO1A 1W8OA 3MRLB 3W2DL 5IW1A 4Y4KB 2EIEA 1N4XL 2PXYB 4JHWL 2E9BA 2HRPH 1Y6KR 1KSRA 3B2VH 2NX5B 5J7CC 3SO5A 3T3PE 2YS4A 5JIHA 2HMIC 3PHOA 4Y16A 2JK5B 5B3JE 5DFVC 5D7LA 2WLYA 3LY6A 3MA7B 5ELIA 4OCXH 1CK0L 2A1WH 4JZJC 3PP4L 1JMXA 3S37H 4QNPE 4Y4HA 4MGXA 3NN8A 1PJ9A 2ATPB 3HC3H 2L4OA 4CUCA 4LHUD 1RU9H 3PNWA 4DWHA 1ZHNA 3BESR 5HYJD 1OTUC 2WWKO 3MRKB 2VLLA 4X98B 5A3IC 3TA3D 1NFDF 5DSCA 1RZGB 5C71A 4MMZC 4G9FD 1AI1H 4AT6B 4Y0GA 2P5EB 4H0GA 5ICXA 1BJ8A 3RNKA 4YHZH 5FOJA 2X4UA 3IB4A 2WUCH 1UM5H 2ADGB 5KAQF 1A7PH 4PJHA 1JFQL 5EZJA 3ZHLA 1CQYA 4YIQA 2XI9A 4H5SB 4MCZA 5DZOA 1JPFA 1ZT4B 4BZ2H 3KPQA 1NGXA 4WENB 1XGRB 3FKUS 4S11A 1V05A 2GSIA 4TQEH 3WKML 1TQCC 5C3TA 1JWSA 3SBWC 5EU7E 1TPXC 3FT4B 3VFRB 3OKKB 4D0DA 1D5ZA 4JREB 3HFMH 2AJSL 4M8QB 5DHYB 1BZ9B 3GKWL 4AG4L 2XTJE 1S8DB 2CKBL 3H9HB 3MR9B 4IRSB 4OLXL 1BM3L 1U36A 1T0MA 5IVXF 2DI7A 3RZWA 4NQDB 4WUUA 2HVKB 2MKLC 1SMAA 2YRZA 1CBVL 3TCLA 1LO4H 3DSFH 3DI3B 4AQ1B 5TQ0H 5I16B 1WIUA 4MD0B 4U3CA 4BFIB 4KHXH 3RU8H 3CFJB 4OGAD 3PIQA 4XCFL 3MV8E 3QEQB 5CJ5A 1NMBH 3PGDB 3WIFB 4ZSOB 4FG6C 1DP0A 4LLQB 4PJBA 3KYKH 5E6IA 3Q5TA 4D3CH 1OTTC 3MV7E 4LNVA 3KXFD 1CFSA 4QTIL 4B7LA 3VGEA 2AKRB 4IDJL 4LSDA 2GUOA 1UZ6E 1CFTB 2B4CL 4NO2B 4K9EL 3IDJA 4AEHH 3THMH 1ZTXL 4HK3J 3DXAA 5C8JB 3ECBA 5ISZA 4WEUD 3UJTH 5E8PA 3DGGA 4ACPA 5DURD 4OZGB 4X8XA 3E3QC 3LSOA 3QUZC 3OAZH 4EDXB 2A6IA 3S96B 4O2CA 3SGDI 2NY3B 1IARB 4Z7UA 4KKCC 4Q9QH 2EH8H 2ZSVA 4IRZL 4LEXL 5HHVH 3GI8H 3O2VL 3TGXA 4GAYA 3NCBB 5AUMA 1A7OL 2G60H 4GKZB 5IB2A 2EDDA 2UZIH 3VXSE 4K8RL 1A1OA 4I2XA 1QFHA 3U46B 1F8TH 1HQ4A 2V2WA 1NFKA 3EO9H 3WLWC 4KI5D 3KR3L 1EJOH 1MWAL 2F8XC 1WCBA 1FVEB 3RI5F 2VDRL 2VDQL 2ZCLH 5EO0B 4DTGL 4LSUH 1S9VA 4S1SH 2R0WH 2GQHA 4OZHA 5T3ZD 3D3VB 1NUFA 3UJJH 1P84K 4GSDL 2ERJB 3LKOB 3L5JA 5D1QA 2XG5A 1Y18A 2YPLA 4QRRE 4ZXBD 3DRQB 4OF7A 1C12A 3H7BB 2FX9H 4P4KA 1J0YA 3SN6N 1MAML 4JO2H 2Y1VA 2IG2L 2DQJH 4JFFD 3AXLA 1MSPA 3TZVD 3KJ6L 4ISVB 2V9TA 1I9IL 5J4MA 1LEIA 2CSPA 3BJ91 4LSVH 2NY0D 2LU3A 1IQWH 3A6BH 3O41B 4GG6F 1MRDH 5EUKB 2BHZA 4HS8H 2IGFH 4WRLA 3RWHA 5BV7C 1WGOA 4Z0XA 3ULVD 2BDNH 4HX1A 3RHWK 1P2CB 2CKNA 2NZ9D 4HIHA 1CXLA 3ARWA 3IDYC 1XCTB 2XACC 1VEOA 5JHDD 5D2LA 4M43L 5T1MA 1P9MA 1DJSA 2EXWC 3OKNA 1UCTA 4HJGB 4YDIH 4FQQA 3L3DB 4HJ0C 2AK1H 3MOBH 3GB7A 1IFHH 3LKSB 4QXGH 3B4NA 4LLMA 4FZEH 1KCVL 1LO3L 3HNSL 1T04B 4QWWD 1I9RH 4AENB 5L9DH 1P7KA 5F88A 4ONOA 5E8OA 3IRZA 1EXUA 4ONFL 3PWLB 4S2SA 5GSRB 1DL7L 3RTQD 3NA4A 3TNNB 4APQD 5SX4H 1X5AA 2NXZC 4PRID 3CDGA 3PDOB 1KCSL 4NM4L 5EOTA 1PYWB 5BCAA 3U9PH 5LWYL 1S7XB 4B7IA 1KNOB 1QSFD 4P5TB 4WV1A 5ESQA 3VXRD 3NIDF 2D03H 4CU6A 1ULVA 4NKOB 5GGUB 3OJDA 2WW8A 1MF2H 3QA3A 4N8PA 4JM4L 1JZ6A 4OKDA 4AY0A 3TNMA 1YN6A 3CVHL 3FL7A 2VXQH 4NYLB 3CMOH 2QR0A 5F9WC 5GRUL 3HR6A 1OTSD 3GSNH 3QNZB 1JYXA 3F7YB 4O2FB 3OKDB 3OHXB 5DMIH 4NJAL 1BQHG 2A6KB 2ICWA 3B2UC 1HHIB 4XVTL 4BKLB 2FBJH 4YZFE 3CFKA 5IKCB 4X5LA 5DK2B 1ROWA 3EIFA 3MRHA 2RCSL 4L8SB 4LOUD 3GSRA 3P77B 5CGYD 1J1PL 1OD9A 1XF5A 2O26U 2QADC 5H37G 3TLRA 4NHUB 2IH1B 3O4LE 1U8QA 4OCYH 5L8LB 1AC0A 1CICB 3BWAB 1UH4A 4KUZH 4X99A 4F3FA 1VKXB 1MCPL 2CRMA 3U0PB 4OJFH 4U1HB 4XVUC 3VGFA 4C56B 4NKIH 3P9LB 5HDBF 1X7QB 3MGOA 3S37X 3GM8A 3BZDA 1VESA 1G7LA 3PL6B 5KSBB 5FFLA 2FIKB 3F7PC 5B8CC 4HIEB 1A2YB 1FZMA 3O3AA 3EJYD 4M1GH 1NEZB 5ECJE 3V5KB 2FB4L 3I6KA 3CVIL 2QJDA 1JPTL 1BD2A 1S9YA 1XH3A 3H9SA 2V7NA 4WHYH 2DQTH 2EDLA 1LO2L 5K59E 4R26H 1KF9B 2H32B 1IQDB 3F6IA 3W9EB 2EE2A 2Z31C 4UNVA 3PQYA 4FXGA 1ZA3B 4XBPB 3RVWD 3DGCR 5E0QA 3T09A 3V0WH 1XIWC 2A9ML 5ADPL 2BVOA 1OT1A 4IJ3B 2BSED 3SE4A 2JF1A 5GRVL 5DQJA 2R1WB 4IOIB 3QFDA 4L4VA 3HAEH 1MIEL 5E7BA 3MV9B 2G5BB 4XP4H 3UTSA 4B41A 5IK3B 3X17A 1KJVB 2VLJB 3MRJA 1QOKA 4X7SL 1XGUB 3WD5L 4LKCB 4BK4A 3P4MA 1P4IH 3MLRL 2DBLL 1JN6A 2W0KA 5CUSL 5LGJA 1BZ7B 5ICZA 2H8PA 2VDPH 3P9MA 1HOCB 3PHOB 1WVZA 4M62L 3H42L 5ICYB 4L8CB 4K8RD 4RMRA 3IDNA 5DUMH 1NH6A 1FE8H 1VADA 4UOJA 3C5ZC 3CU7A 4F33B 1G84A 3T0VA 2EO9A 3L7EB 4PGCA 1K5NA 1QFUH 1TVDA 3LEVL 5DRWB 3QG6B 3C8KB 1UZ8B 1I8IA 2MWCA 5HXMA 2EDKA 4J3VA 4MJIE 3ULUF 3PNWB 3VWJD 4RRPA 1ZHNB 4S1DC 5EOCJ 3SQOH 4JO4L 5E9DB 1D9KD 3BRDA 5ABDE 1WBXB 2DYPB 3A6CH 2F15A 3KPRB 2GT9B 2W65A 1T1WA 3LRHA 2FYYB 2VDLL 2EYSB 3HPJA 3CIQA 3WSQH 1KFAL 4Z7WB 2V17H 1P6AB 1NGZA 4J8RA 4LPUA 3LZFL 3HZMA 4PJFF 2LTQC 4L9LC 2OZ4H 1AJ7L 3OAYK 2ICWI 3B9VA 3FQWA 5CJQH 1I3UA 2FWOB 5CSZB 4YIQB 4QGTA 5I74B 2YPVL 2AK4A 4FXKA 4PRNA 4MS8D 1IAKA 4LEOA 5C09A 4HWBL 3RDTC 5GS0L 4QHKI 5GS3A 3WHE0 4ZUTB 3UZEA 4TSAH 3F5WA 5C07E 5LBSH 1D5ZB 4ZS6D 1U8KB 4R4BA 3N0PB 2NCMA 5F9OL 4ONHA 3TT1L 3RWCA 1Q1JL 1W72A 2AJVL 5JHDE 3VD9A 1WV7T 1KJ3H 2K3TA 4BH8A 2VTFA 2X4OA 4X7DC 3LCYA 2QQKL 15C8L 4OZGF 2OXGA 3OAUH 3BE1L 3SE8H 1I8KB 3QAZB 4U1JA 3DETD 5DMKA 4UQ2A 1UENA 3OAZK 3V4PL 2EKSB 1QFOA 3F7RA 2H26A 5I9QC 4JQVC 4ONGH 1FFRA 1EFXD 4GXUM 2PTVA 2GJJA 3L1OH 1QQDB 2DDQH 3DVGA 3AUVA 4KRPC 1CDBA 3ULUL 4FQJH 3SE9L 1T03H 1LO0L 3EFFB 1HSAA 4K7PH 1I85C 3PIQB 4EUPG 4EVNB 3UAJD 2VLKA 4O58H 1SM3L 4LGSB 3EW3B 3QUYA 2Z35A 4R4FH 3DECA 5KSUA 4I13B 1EEYA 4GAJL 1DQMH 1F42A 5E6IB 3CH1A 2FEEL 4CVWA 2AS5M 3WHE1 5BS0A 4PJ8A 3LV3A 4WGWB 4JFDD 5SX4I 3ZYOA 2KH2B 1UXSA 5HHNB 5DS8B 3TVMA 4NQCA 1FC1A 5CCKL 2HAZA 3LEYH 1OAYH 1N7MH 2NLJA 3IDJB 3IAQA 3LS4H 4K07A 4RMWA 2CR3A 2OTWA 1F4YH 1G7MA 2BOBA 2Y5EA 1FLRL 1FYTE 3Q3GA 1CLZL 4G9DB 2QSCL 4IOFC 4Z5RA 1OAZL 5TJWK 5ISZB 3AAZA 3DGGB 3L95A 4OV6F 2HFGL 5HI5C 4HS6A 4ZQKB 4YAQA 2BRQA 5FHAL 1NL0H 2A6IB 5SWSA 5BQ7B 1JZ7A 2GAZA 1QNZH 4YFEA 4J4PA 3H9ZA 4C54A 5ITFB 4X4XA 3C2AH 1NC2A 4PRPB 4P5MA 1A6AA 4KV5F 4ZOEA 3MBEC 4OM1L 3ZO0A 3PWPD 4H8WH 3S4SG 4U6HA 4X6CA 1AIFB 3QI9B 3VWKD 4I2XB 4WO4D 3T2OA 4NFCA 1KTDB 2GJ6B 1DBMH 4YE4L 5JXEC 2RFXB 2VE6A 3AREC 2PW2B 4WTWA 2NY1C 1WCBB 4ZAKC 4DGIL 1UB5B 3TH2T 1F97A 1MCRA 4OGZA 5KANI 3GBNH 3N85L 1ZLWH 4N0YH 5FIEA 1I8LC 1S9VB 1IAOA 1JNHA 5DD1L 2V5TA 4OZHB 2VLRA 4GRWE 2X44D 4NDMB 5D1ZD 5GSVA 4I5BA 4FN0A 5JPNB 1I7RB 1A02N 2P49B 5D1QB 3FZUD 4PREA 5T3XE 2YPLB 4UDUA 2OP4H 2WAHA 4J3XA 4TVPL 4YFLI 1GC1C 4DKEH 2B0SL 3X11B 1U3JA 3GSUB 5CP7A 1XF2A 3AXLB 3GMOA 3B8SA 3IJSA 1YY9D 3JWDL 3B9EA 4PJCB 3D18A 4G8FB 3BQUA 4BQ8A 4RGNB 4CBPA 1JZ2A 4QXUH 3LN4A 2EICA 5FYJD 4MHHG 1P7QD 2ICCA 3RWEA 2IADA 4MNQB 4UNUA 4J3WA 1R3IL 5F72S 4Q2ZA 4KK5C 3QPXL 4MQSB 3FONA 3TBSA 2AXHA 4MCYB 3RWHB 3SKOA 2NY5C 5GRZA 5FHBH 4ELMA 2VR9A 1CIUA 3FMGH 1YMMD 2W60A 1K4CB 4HC1L 1ZLSH 4D8PB 4A6YH 5T1MB 3ZE0E 1YPZE 3BZ4A 4Z7QE 4R96B 3BEVB 2IH3B 3F12B 3S36H 5HYQA 3NCYP 3QJFA 3GB7B 4UUJA 3T2NL 4Y7MA 2OI9C 5DQDL 3HG1A 4M7JL 3UTZA 5IMKA 1MCCA 3Q6GL 1MI5B 1BVKB 4EJ1C 3QIUA 1P7KB 3KWWA 3TN0D 4Q0XH 3MRRA 1EXUB 3MLPA 4Y4KD 5FV2A 5I75B 2PXYD 5ANMA 1I1RA 2NX5D 4RFOL 4X7TB 2OJZL 4GXVH 1H3TA 4V1DE 4D9QE 3CDGB 2YXMA 4MVBD 5EOTB 5EU6A 4J12A 4UTBH 5SWZA 4PJIA 3T0XA 2DQDL 5K9KB 4WV1B 5ESQB 4DK6A 4ZODA 3ROOA 1K3ZA 4MXVE 4M1DL 2VITA 4PGDA 1OQXA 3ZL4H 5EG6C 1OGTA 5KSBF 3MACH 3OJDB 2DQUH 1G6RB 4LRNL 4X8JB 1BBJA 3QA3B 3QCVH 2NYYD 5E70A 3EDFA 5JMOC 1UYWL 1MFAL 4Y89A 1YN6B 1V7MH 3WL9A 4HS3B 4X7CC 1KN2H 2QR0B 2BNQB 2J7LA 2NZIA 3EYUL 2MNUA 4CW1B 1TJGL 1TNMA 3GRWH 4KDTA 5E8EB 1MJ8H 1YEJH 2F19L 2P5ED 3D39E 2C7UB 2F5BL 3V6OE 1ZKAA 3D1MC 3CFKB 1YC7A 4WHTB 1KBGH 2AQ2A 4KVNL 4RWYH 3IDGA 4P9HL 3RBSA 4FNLH 1S7RA 3MLSH 3DX9A 5I1GL 4MXWL 1YQVL 2V2TA 4X4MA 5BVJB 5FDWB 1UKQA 4N0UE 2BOCA 2X4PA 3EOAB 4LARH 3DX6B 4WCYH 3FQUA 3KPOA 3F58H 4JZOA 3JV5A 2QKIA 2J8UA 4ZOCA 1L6ZA 2VJXA 1BQHA 3DO7A 4LGRB 1G7LB 1BQUA 5T3XH 3FCTA 4IRSD 1FZMB 4NRXA 3FOMA 3ULUD 1JHTB 3NOIA 4NQDD 2UZXB 5IHBA 3BGMA 4L3EB 4PIRF 3I6KB 2OMNA 3H9SB 1XH3B 5E08L 3FJTA 3MPCA 4BQCA 2P24A 3GZKA 4OGAC 4IIQA 4WW1B 4FA8A 4TOYH 2Q76B 2BFVH 4Z7VE 5GGRA 3B6SA 4MYWB 4QGYA 3U6RA 1AQKL 1U8LB 3V52L 4M6ML 3PQYB 5E5MA 3CC5B 1V3MA 4RNRB 4QHMA 2AERT 1M7XA 2VXUH 3QEQD 4OSUL 4RFEA 5J6HB 2NTFA 4ZUSA 4M1CC 1AE6H 2J88H 2ZOLA 4PPTA 1JGVL 3GSWB 3DUSA 1VEPA 3Q1SH 3QFDB 4L4VB 3RWIA 3T1FB 4UAOC 4ELKB 3S88H 1K8DB 1G7PA 4WTXA 4P3DA 5FA3A 1QHPA 3G6AA 3HMXL 4Z7OF 1LEGB 2MQ3A 4TSCL 4ORGA 2J4WH 4NOBA 4PJHF 1BAFL 2VDML 1N0LA 5K9JL 3PWPE 3VGGA 2H8PB 3P9MB 5F9AC 3DUHA 2P4AB 1E27A 2IQ9H 5IW6A 4HBQA 1RVFL 3B3IB 1KB5B 4O02H 3UO1H 5DHVB 3GRWA 2NY3D 4MAYB 1G9MC 1YDPA 3TIDB 3WO4C 4DN3L 5I15L 3NGBC 4KQ4L 4E42A 4KI5C 5GRJL 4PJ7B 3BP4A 1TITA 1BF2A 1YEDB 4P23A 1R0AH 1T1WB 3BKMH 4JLRB 4YR6B 4HKJA 2AVGA 5E2WH 1VCAA 5C9KA 3VJ6A 5AZEL 4LLYB 3V6FA 1IL1A 2A9NH 5FGRA 5L88L 4XTRC 3U7YH 1NGZB 1IEAB 3ARUA 1MCOH 5HVHB 3KPSB 2W1NA 5IMLB 4PJ9A 4EQ2A 4YUEL 4YWGH 1FHGA 3EOBA 4PJBF 5F1OB 2AK4B 1AQDA 1S7WB 1Z9OA 2UY7A 4PRNB 2YHGA 4H25A 4G6FD 3DI2B 4HWEH 4LEOB 5GJTH 1F11B 4PRBB 1V7NH 4LP4A 3TZVC 1TVBA 5E2UL 1KLGB 5J9PA 1YMME 1QFWH 1HN1A 3K8MA 4PS4H 2B20A 4R4BB 2NY0C 3N9GL 4HWUA 1RJZB 4ONHB 5IBTH 3RWCB 4BFBD 5HGHB 3MUZ1 4MNGE 1ZK9A 4DKFH 5IVOA 1LGVA 3M17B 4K23L 3ULVC 1S7SA 1KCRH 2NZ9C 1ZS8A 2BNUA 4FFZH 2BNRA 4CN1A 5F7DA 1PSKL 1N8ZA 1TQBB 3ROLA 4Z7UF 4UQ2B 5DDHA 3CSYB 3V5DA 4ZYKA 4GW1B 3WS3B 1JIBA 1GL4B 4Z18A 1EHLL 3MNZA 2XA8L 3BPOB 5JA9A 1I3RA 4YO0B 1SJVA 5E95B 1YY8A 3CPLA 4XNZC 3VU2A 1H8NA 2NX5E 2VUYA 3QP3A 4NM8L 1Z6JT 4IMKC 2Z35B 5F3BB 4QWWC 5KSUB 1CGSH 4FQLH 5C6WH 2E7LA 3VFUA 3LH2H 1R5VB 2GK0B 1N5YH 5HPMA 5I73C 4U49A 2UUDH 4X4YA 4PJ8B 4W4OA 3T2PA 3WEXA 3LQZB 4APQC 3GJFH 4LAJH 5DLMH 5HI3D 4F8QA 3ARBB 3GMQA 3U4EB 3UTPD 4OZHF 5DJYB 3CDFA 5FGSA 1UJ3C 3I3EA 1ZLWK 2OTWB 2ZP0T 3GDBA 3UX9B 2FBOJ 4LCYB 3FQRA 5DJDA 3MBXH 3MFFB 2XWBA 3NTCL 4EUPA 5JOEA 3AAZB 3L95B 5EU3A 5DJ0A 2Y06L 5C0CE 1CDIA 4YAQB 1AHWC 4P5TD 1M4KA 4L4TA 3QCTL 5CEZL 1ONQB 1MQKL 2GAZB 3QH3B 2WZPD 5JLZB 2J5LB 4N0CD 2A6DA 2DJUA 2MCG1 1OTSC 4P5MB 3SDAA 3QDJB 2CDFB 4OIIL 4PJCF 5EC1A 3WJLA 2X10A 3LS5H 1KLUB 1A9BA 2E3VA 2FD6L 4PD4K 1OAKL 1EX0A 2GJZA 2JCCA 3WIHL 3K4AA 4AM0A 5BV7H 2ATKB 3O2DL 3S36X 2VE6B 5M94B 3TT3L 1JWMA 4FQ2H 3I84A 4LOUC 3DHMA 5CGYC 5EZIL 3OWEA 2Y9RT 4G8IA 1ZVSB 2EEAA 3CXHK 1KPRB 3SCMC 4I3RL 4D0CA 3FN9A 1CGXA 4MSWA 5HHOE 3TFKD 4JCLA 5BZWA 1IAOB 5JTWA 2N56A 2OTUA 2VLRB 1OCWL 2C3HA 1ZT7A 5EFIB 1P1ZA 3QZWG 4G8EA 3EYSL 5EZOH 5IVNA 1CGYA 1FL6B 5J6GA 5CIPB 3S4SA 1CICD 1FAKT 3RY6A 1RZ8B 5T1KA 1MOEA 2O93L 4QRSA 4XPGL 2QHLA 4C56D 4Q9CA 5AG9A 4K3JH 1ACYH 3BUTA 2NY7L 4L8DA 2AXFB 1P69B 3PL6D 4UT9L 4Z95L 3VFSA 5CP7B 2R8SH 1V3KA 2R69H 4JQIL 2YD1A 2E27L 2B5IC 2HTKD 3QEQE 1CXKA 1IC5H 2H3NB 4LCUA 1JNNL 4E5XB 3HI1B 2C9AA 3D18B 5I19L 3FO2B 4OGYH 4R97C 5FUOL 3LN4B 3NFNB 3GSOB 4GAGL 3MJ9A 1F3RB 2QQNL 5HD8D 3RWEB 5GGVY 3WHXB 4OLVL 2Q7YB 4NUGL 2NY6C 4QRQB 5EU4A 2AXJA 5HVFB 5EBMB 3RVWC 3SKOB 2MFNA 4ELMB 2PF6A 4NSKB 4KZEL 2SEBA 5D96C 4PJDE 1FO0A 2F53B 2W60B 1IGJA 3U7AA 1F90L 4HIJB 3IS1X 1WZ1L 2DI8A 1AGDA 5IR1A 2EIZB 4FQXA 2ARJQ 1AC6A 1X5YA 1I8MB 1Z3GH 4ZTPL 1YEIH 3MV9D 3OZ9H 3LN9A 1RY7B 4DZ8A 4XPAL 1FORL 5C0AE 2R2EB 3I9GH 2VLJD 5C0EB 1LDSA 3IDXH 5IMKB 2G75B 4JO3L 3QIUB 4MJ2A 3T0EA 1NDGB 4YHPB 3KWWB 2LU4A 4XRCA 1VFAB 1J5OH 3MRRB 4OLYL 2HJFA 5ANMB 5CJBA 2VIRB 4XC1L 5FM8A 1H3XA 3V9FA 5SWZB 3EAKA 3EO1B 1JGLH 3T77A 4AL8L 2JIXA 3VDCA 4L3AA 1VPOH 4LVHB 4HIIA 1WBZA 3ROOB 5TGBB 3SKMB 2RAMA 1D9KC 4P2QE 4Y5YA 1XF3B 4HUVA 1OGTB 5FKAA 6FABL 3E6FA 5I1CH 3L3HB 4TVPE 3QUMB 3LKNA 2NQCA 1QR4A 4O2EB 4LHUG 3TM6A 5DJ2B 4NZRH 3D3VE 5E9DD 3WL9B 2DYPD 3UDWA 3BZEB 3QQ4B 3LDBC 3D87B 3KPRD 2AXGB 4Y5XC 2YWZA 1RIUL 4FFWC 1RUMH 3G6DL 5D70L 4RCAA 1PFCA 5BW7A 5I66A 2B1HL 4PJXE 1FYHB 2ZJSH 3SDDB 4Q9RL 1NMAL 1G6RL 4P2RA 1FDLL 3RY4A 3I2CH 1SY6A 3S5LG 5JPMA 2EH7L 1M6OB 5CJXC 5FGCB 3VH8A 4HT1L 1RJCA 3GGWA 4KAQL 4MS8C 5BVPH 3B9DA 2BY1A 1S7RB 4ZFOL 2V2TB 1QFWI 1KYOK 2NXYD 1IGTA 3OKYA 1RUQH 3MLUL 4ZS6C 5AD0A 5F9DC 5DTFB 3L3GB 4Y1AA 5DA0B 3W0WE 4H20L 2XQBH 3L3OA 2HKHH 5KTEL 1J8HB 4XPFL 1D5BA 4PBVC 1IC7L 3GHEL 1KULA 5CZXC 4Y5VA 3FAXA 3DETC 3FCTB 4S0TD 1RJYB 4YXLL 3FOMB 1DVFA 5GGQL 4XCEA 5KW9L 5CEYA 4NO5A 4WI8A 5IFAH 3GSXB 1KCKA 3BGMB 3OTTA 4WUUD 1R24A 1X4XA 3G9AB 5EPMB 4PJEA 4ZDHB 4IIQB 4EI6A 4M7LL 1N0XL 2HKFH 1CWVA 4LLWA 5DMYA 3LPWA 1I7TB 2APVA 3TIEB 5T1DH 4OQTA 5C0BE 4S1QH 4G8GA 1BVZA 5DWUL 1I7UB 1WBYB 1XAUA 1UWEH 3OKOA 3OKMA 2PKDA 4HXBL 1JNLL 4NJ9H 3DUSB 3JTTB 1RZKL 5E6ID 4JDVB 4ZUVA 4D9RD 1WAAA 4ODVH 4LVOB 4OZIA 4XPHH 4GRLB 4LSPH 5CEZD 2GIYA 3WNPA 3GHBL 4RGMC 5ACZB 4GBXC 3VGAC 3FB5B 3MJ8A 2RBLA 1HQRA 1U2CA 4ODSL 5TF1H 1CDHA 5D7JA 2AJYH 5ISZD 4EEEA 1ZGLA 4JGUA 1QSZA 1E27B 1CR9L 5IW6B 3BKJL 5C0RL 1VDGA 1QO3A 2O5ZH 2YD6A 2YC1B 3DVNA 1OAXL 4YPJA 2YK1L 4P2CG 1OAUH 2R0ZL 3ZKXB 1FAIH 4OZFH 1YDPB 3T0BA 2ZUXA 4P3WA 4PRPD 3VWKC 4JKPL 3GFUA 3R0MA 3WLBB 5BOPA 1FZOA 5IBUB 4KFZC 3VFNA 3AM8C 5H2BA 4X6EB 1Y0LB 4R8WL 2BVPA 1DLHA 3SPVB 3QI9D 5J1TC 4G6JH 4JE4B 1KB5L 4I0PB 4C4KO 4Z8FL 2GJ6D 2ICEA 4F7CB 4HKJB 5FUZH 2OJEA 4C56E 1CG9A 4JZNB 1R3JB 3SKJL 1UG9A 4YHLH 1WQVT 5D1ZC 1MLBA 4K3HA 1MCSA 4LKXB 4JFHD 5MENE 4LMQI 1HZHL 1N26A 4PJ9B 3ARGB 1KT2B 1N6QL 3CU1A 4NO0A 4R7NB 4DJMA 4HFUH 2W07A 1RHHB 4FABL 1MRCH 5CD5D 1WICA 1C08A 1IAIM 5K9OA 5FYKH 1DQQA 4KJYB 5KSAA 3BEWB 5IEHB 3BYTA 2IPTH 5D1QD 5I8EA 1R6VA 4TULL 5GGTH 1YY9C 2YPLD 2K1MA 4G3YL 2UUDK 2VAJA 3MO1A 4GW5A 3UJIH 3RX5A 3TEUA 1FGNH 2LV4A 2V5YA 1U92B 2N7BA 3OPZH 3NACL 4ZD3L 3L9RA 3EYQD 3MOAL 1H3UA 4KY1H 4RGND 3T0WA 4MA7H 4ZFZA 4LAQH 1J86A 1ERNA 4YHNB 2BNRB 3BPNC 4MNQD 4UT7H 5GS2D 1AFVH 4YDLC 3V8OA 5IJKC 5DDHB 3QWRA 4DCQB 2OL3H 3I02A 5EOQL 4EZMA 2DLHA 3F65A 1FBIL 1UA6L 1OPGL 1R3KB 2FHBA 2OQJA 3FN0H 5IQ9B 1BOGA 2P8PB 3QXVA 5BZDA 25C8H 2PN5A 4LU5L 3U30C 4OAWB 2ZPKL 4GQ9H 5JORA 1IE5A 3KAAA 1XGTA 4PJGB 3F7VB 5A16A 1A64A 3NPSC 1L6XA 4BH7A 4I77H 1A5FH 3MRFB 1KENH 3TN0C 1UCBH 1FL3A 1RD6A 1AGBA 3U0TA 1T0NA 4Y4KC 1E4XL 1ZGLP 2DTSA 2I9TA 5I18L 1MI5D 2H45A 4UU9B 3OR7A 4CKVX 4MVBC 5D9SA 1CFQA 2AJUL 4F37K 5T5NG 1Q8MA 2DQHL 3TBYB 5JOPD 2HWZL 1HKLH 4OD2B 3KPRE 1IGIH 5DVMA 4WUKL 1II4E 2ENYA 1KJ2H 4KKLC 1EHXA 1WUNT 1X5LA 1GC1H 1WFTA 1JWUB 1J8KA 1RQ5A 1PQZB 4Z7WE 5E8DL 2NYYC 4I0CC 4NC2B 3BH8B 4QTHB 3BKYL 4B5EA 2R15A 3ARYA 1AXTL 5F7YC 5GRVK 5BMFL 2CGRL 5C0GA 4CVZB 3WXVH 1M7DB 2E7CA 1QPPA 3RWFA 4GKSB 5EIQA 3D0VB 1H3PL 1OARH 2EC8A 4LVNB 4OF0A 2JCCB 3DO3A 3OG6B 2NY5H 2BNQD 4HIXH 3HZYB 1NCBL 1EZVX 4HK3N 4RX4A 3MV8A 4ELMF 1K4DB 4RMQA 5LCVH 4OF6A 5L6YH 4FOMA 3NZHL 2YBRA 5KSAB 4NNPL 4D0CB 3CFCH 4YX2L 5JW3L 3MV7A 2XFXA 3REWB 4S1RH 1T5WB 1W0YT 2ITDB 1ORSA 4WFFD 2VC2L 5GISH 1KCUH 3AROA 1ZT7B 4LNRA 1CQKA 4G8EB 3LIZH 5HY9A 1BJ1H 1QRNE 5DUBA 5T1LB 1QFWM 1YEGL 3T0DA 5T1KB 1SEQH 2IBGA 5L0QB 4QRSB 5DI8A 4JR9H 4IRSC 4KTEH 1A7BA 1OB1A 3ULUC 3MBEA 12E8H 1DEEA 4L8DB 5HGBA 4JY5L 4H26B 1S5IL 4NN5C 2V5MA 4WHDA 4HCRA 3VFSB 3H0TA 2M8XA 4XHJD 3PWJB 4XP1H 3DPBA 5GS1C 4NWUH 3KDMA 1PKQB 4M03A 1X5ZA 4NWTL 1WFOA 1EV2E 5JXEA 1DBJL 4PJIF 4HUKB 1IGMH 4DAGH 4L3ED 2XN9A 4NGHH 4NCC2 1CDUA 5FF6B 3MCLH 3QZWA 3PP3H 3H9SD 4M48H 3VXSA 4PB9H 4NQEB 3HC0B 3AU1A 5KVFH 2R29H 2SEBB 4YNYB 4PTUA 32C2A 1D6VH 2RR3A 3PQYD 3D9AL 4OM0L 5IGXH 4F7MA 3LQAC 2ZOKA 3BKCL 4HF5H 2APTA 3RIAK 4NO3A 5FYKU 4JM2A 3L3KB 5IR1B 4MX7B 5DC0A 5TH2A 2DLFH 4FQXB 1ETZA 4L4VD 1JHKL 1KIRA 4DZ8B 5D4QA 4LSRL 4Q6IA 1M05A 5KS9E 4PY7A 4X6BA 1LDPL 3D69A 3NAAH 4M9PA 3C08H 5C0JA 3T0EB 3Q48A 2F54A 2BVQA 4XRCB 5CSBA 1U6AL 5E6ZA 4K3EL 1MJUL 5F6HJ 3LKRB 4YDJB 4QRRA 3CK0L 1KN4L 5D6DC 1UXWB 3ZDYE 5JW4N 3NABL 1QBLL 1SQ2N 2NY3C 1CLCA 4PJ5E 2CQVA 2GJ6E 5E94A 4UILH 1UACH 2I60L 2VO5A 1KPUA 1S7UA 4BFEA 1WBZB 1FL5B 3O6FA 1XMWA 3QISA 4MAYD 5CZVL 3CFBB 5C70A 5E2JA 4DVBA 4HUVB 2HJLA 3E6FB 5JNYB 1A7QL 1H5BA 4I48B 3HE6A 4FTVE 1BFOA 1KG0B 4P59H 5EO9A 1G7IB 3WFHB 1CCZA 2BSTB 2W59A 1MIML 1DUZB 1F3DH 3T8XA 2J6EA 5JUEL 1JGUH 1TETH 2PW1A 3QUML 2O5YH 2MPAH 3LRSA 3QO1A 4BQBA 3KPSD 3GSQB 5K93A 3BIAX 2ERJC 3GGWB 1B0RB 4P2OB 3VFGH 4LCCA 4LPYA 3QIBB 2KZ1B 1INEH 2XOTA 2AK4D 3K3QA 1IGTB 4LHUA 1EHNA 3QNXB 3VFVA 5AD0B 4XCNB 2FCBA 3ABZA 4ODUB 3TA3A 5ID1A 1IGFL 2YSSB 1AGCB 4TNWK 1RIVH 4Y5VB 3S5LA 2EE9A 4NKMA 3LHPL 1OGAB 1OLZA 3C60B 5MP6L 5AYQA 3KYNA 4N0FB 4F8TA 2IAMC 3FTGA 2LAGB 1S7QB 5T5FH 1T7VA 1G9MH 3MXWH 5L2JB 1R24B 4QLRA 5K33A 4PJEB 4F7EB 5F1KC 1MI5E 3BGFB 5B22A 4F7TB 2PYEE 3LMJL 3VXTA 3W5NA 3INUL 2HLFD 4QEGA 4OV5B 1A7RH 4ALAL 4W6XB 4HPYH 5HI3C 3OKMB 1VFMA 4GMTH 2EYRB 4KC3B 5T3ZH 3VXUE 1HKFA 1A4KA 3O3DB 4N5UA 4XP6L 4PJ8D 3QPQC 3JTSB 3BPCA 4O5LL 3ARBD 3QXTA 1A6UH 2XZAL 5HGDB 2X9XA 2UWEE 4PY8I 1U41A 2VQ1A 1FH5H 4PG2A 5HHPA 5I1KL 4JFYB 4P5TC 3VI3F 5I6XB 1YEFH 2VXTL 1ZWIA 1BP3B 3BISA 2BNQE 4FP8L 4U3HA 3FQTB 4Z7NE 2BHYA 4QRPB 4N0CC 5IROA 1HHKA 3QEUB 4EOWH 5CBAA 2VQUA 3DOSA 4NQSA 4J4PD 3O9WA 4H1LH 1UB6A 5I1JL 3V4VL 3ULVH 3RIFF 3QDJD 3P0YH 3RZCB 1IM3A 2RB8A 4OD3L 3WNOA 3WXWL 4XCYA 1FZOB 5E2VH 1JGEA 5H2BB 4XGZA 4Q97A 2BVPB 1D5MB 3JV0A 5C08E 4W6WB 4L1HA 4LBEA 3BH9B 4XP9L 1K6QL 1WLHA 4ERSL 4NZDA 1KELH 2ICEB 1RZ7L 1HE7A 1C16B 4N1HB 2OJEB 3ES6B 2CDEA 4BM7A 1RUKL 4XVJL 3EGSB 1MLBB 1ZHKA 1Q94A 4J1UA 4LSTH 4CVXA 4Z76A 4PJGF 1EBPA 1CICC 5KJRL 3QFJB 2GW5A 1GAFL 1XEDA 2VLRD 5HDLA 2ZZUT 3QXAA 4NO0B 4HUXB 1L7TH 3ZE1F 4GKNA 4L3EE 5FB8B 2YMXL 3H2WA 5EU5B 1BPVA 3PL6C 2HVJB 4I3GA 1IKFL 2ZSWA 4GW5B 3AVEA 4U6VH 4ZS7L 4LASL 5HD8C 2X4TA 3L9RB 1R3LA 5E2TL 3BAEH 3QXUA 2B2XL 4XMLL 5IJVB 2Y25A 4ZFZB 5KN5B 4MJIA 5E56A 4XXCC 2XRAL 4PD4J 5IT2H 3CSBA 2WWMD 1I1AB 5HYFA 5JMRA 1NKRA 2GI7A 3RX7A 1CVRA 3CLEH 1G7JA 1NGWB 3I02B 5DRZA 5D2NE 3GUTA 2F53D 1BOGB 1MNUH 2UVFA 3QWOA 4XNUH 1XR8B 2HLAA 2JB6A 4ZXBA 2B7DT 2RHEA 1YECL 2JCCF 3HKFA 4DUXA 5A16B 4JFFA 4KK8C 5F44A 1F6AA 3SGKA 2A2QT 2WQRA 1T1XA 3ALPA 2DQGH 1FL3B 3U0TB 1T0NB 4U3XA 2I9TB 3RUGB 1E6JH 1GRWA 5A40E 3QIUD 1RSFA 4WW2A 1LO5A 3U36B 4LIQL 3VRIA 2VYRE 5AG8A 4KRNA 1CFQB 3OB0H 5AZ2H 1E6OH 1AP2A 3O45A 5C07A 3BW9A 3VCLA 4PJ7E 4P0DA 2UYLB 5AAWA 1FFNA 2ESVB 5J12B 4GG8B 5D5MA 5JHDA 2XTJB 1JK8A 2CUIA 4Y4HC 4HHAB 5SWZD 3DRTA 4IRJA 4XCFH 5LXGL 3FB7B 2EDJA 3VMOA 4Y2OA 4HV8A 3RA7H 3KPSE 2H6PA 4MA8H 4N8VB 5E24E 2QBWA 2DICA 3O6KL 2W9DH 2DF3A 3X3GL 1U95A 5C3LD 5ILTH 5JOFA 4JJHA 2DBJA 3VMNA 4ZPVB 3RTQA 4CMMA 3RVTD 3C6LB 3MV8B 3QG7L 5TPWH 1BX2A 4RA3A 5JW4Q 1MVUB 3SDDD 3PP3K 1QKZL 2YBRB 1UADC 1CFBA 2A74A 3GIZL 2D9QB 5I74C 1Z9LA 2NXYC 1Q9WA 3O3EA 3I6GA 5I71B 2AEQL 1KJMA 2XFXB 4GH7B 1A3RL 2D7OA 1ORSB 5JIPA 1AHWA 4LEXH 4HLZG 4XWOD 4OD1L 3NCMA 2BSRB 5HY9B 2AEPH 5DUBB 1BFTA 3RFZC 2F74B 5KBNC 4IBLT 1B0GA 1T80A 1I3GL 4YHMH 1J8HD 2AGJL 2H2PC 3IF1A 1OB1B 1EA9C 4X4ZA 1BEYH 3BO8B 4HXAL 1KTLA 5JR1H 3HI6H 1T20A 3KR3H 4JFZH 3BP7B 3QAZC 4BSWA 1S9KC 2Y36L 1UM4H 3IDIB 1GZPA 4U1KB 3D0LA 2Y07H 5I1IL 3IAGC 1S7TA 3GSNB 3C2SA 4YDVB 4YXHH 1HHJB 2XZCL 3QZWB 2CKBA 4RAVB 2X70A 3O6LL 4TUKH 2D0FA 2QV2A 3QRGH 3ZDZE 1F00I 3MROA 4KROB 4O4YH 32C2B 3UTTE 1A6TA 3BN9D 3QHZL 5CLWA 4N5EC 3KLAA 2EDRA 4MDIA 2ZOKB 5E6IC 4OCRH 1E28B 3KPPB 3E2HB 4ETYA 2D7MA 2XPGA 1I9JH 4MJ4A 1ADQH 1KYOJ 2J8OA 4DN4H 2P46B 1KIRB 3QHFL 3G5XA 4YC2C 2HJKB 5I8OL 4NQXA 2XKNB 1VGEH 1G7HA 4GRLD 3RWDB 2JE8A 5A1AA 1SMOA 3OJMB 2F58L 3QUKA 3MCKA 1RZJL 4LCIL 1TFHA 4Y4FA 2A83A 1Q0XH 1IGYA 1S7UB 2FO4B 3O6FB 3CSPA 2ORBL 3MV01 5ETUB 1HNGA 1T1ZA 4U1NA 1MCLA 3MA9H 3HE6B 1ZHBA 3NCFB 4MB4A 3WFEL 4KJWD 3BXNB 5EH1A 4FQCL 3WYRA 1MUJB 1P6FA 4XCCL 1YYLH 4I0PD 2ADJA 3T8XB 5CBEA 1U8JB 3C5SA 1NMCB 1DL7H 4PJEF 3T4YA 2MTPA 3V6ZA 1NUDA 3BHBA 3MRBB 4F58L 2HT4D 2FGWL 3BSZL 2ZUSA 4YDKL 3LRSB 1B4JL 2FJHB 3QO1B 5MHSE 1MAKA 1J05A 1MFCL 4F9PC 4KTDL 4PP2B 4XPTL 1X3DA 4PJ9D 4D9LL 1MWAA 3ARGD 3IAPA 4LCCB 4LHQB 1Y6MR 5D1QC 3QIWB 1LK2B 2X9WA 2VB5A 3VWJA 5DQ9B 1EMTL 3IFPB 4P4KC 1WJ3A 1INDL 3VFVB 1D9KA 1QLFA 3WE6B 1WAAF 5GGSY 2VABA 4V1DA 4JRWA 2A77H 5ID1B 3EYQC 3MNVA 3RGVB 2E9JA 2F53E 4RGNC 1CU4L 2HRPL 3B2VL 3V8CA 4XVTH 5E8NA 4AMKH 1BOYA 2HH0H 4PR5A 4U1LA 1TVHA 4RIRA 1F3JA 1MJJA 3OF6D 4MA3B 2A1WL 4OCXL 3RP1A 2EZ0D 3HPLA 3FTGB 4OB5H 4DGVH 2BNRD 3S37L 3ZYIA 4HZLB 5F9JB 5C0ND 4HMEA 5ALCH 2XG4A 5EZLB 4HUWA 3N1GC 4B53A 1P9MC 3GO1H 3PHQB 1SVCP 2IPKB 5EIIB 3HC3L 1A4JA 1W2KT 4OBRA 1RU9L 4KQ3H 4ZPTA 4I9WE 3IDMA 3AS0A 2WBJA 3D39A 2DQIH 1CGUA 4XMKH 3V6OA 3ZTJH 5CGTA 1BLNA 1N59A 1AH1A 3JV4B 3U48A 2VAAA 5GRYA 1AI1L 1AR1D 5F7MC 1RJLA 1WZLA 1A4KB 3O4LB 1I7ZA 4YHZL 3EUUA 4EIGB 2M2DA 4N0UA 2WUCL 1UM5L 3ARFA 3IETB 1A7PL 1MFBH 4R2GB 2W9LA 4BUHA 4EQ3A 3S35X 4F15C 4WV1C 3V5HB 4BZ2L 1ZWIB 3UPRA 3KLSA 3N50A 5I1DA 4TQEL 4EBQH 3T3PF 4ZFGH 3MUGA 1EAPA 5B3JF 4X7FC 5FYJH 3ULSB 2IJ0C 4XAWH 3HFML 2Z92B 4NQSB 2VWEE 4LDOB 3R8BB 3O9WB 3TBWA 1D7FA 1T5XA 3PWUA 4WJ5A 4QNPF 4BZYA 2EE3A 1C5BH 3A67H 3MLTA 4JFDA 4JFPB 5D6CB 3WV0A 1IEHA 3TP4A 1KTRL 4XCYB 5DMJB 2VDOH 1SBSH 1OW0A 1J1OH 5E1AA 3U82B 3FT2A 5DEZA 1LO4L 1RZIA 3DSFL 5GIRB 3CVHA 5TQ0L 5EORH 3HE7A 2WMPA 2P5WE 1EEQA 4KHXL 3RU8L 1Q9OB 5KG9A 4J1UB 2R0LH 5D1XB 1LNUB 2ZUVA 3ZHDA 1HXYB 1NMBL 5I1EH 5EBWB 5TDNA 1UEMA 2EYTA 2FZ3B 3OXSA 4LLUA 3W39B 4XNYH 3KYKL 2WV3A 1IGCH 4XMPH 4D3CL 1KXQE 3PWPA 4M6AA 4ZG1A 4XZUA 5T1LD 2C3VB 1KIQA 1IEBB 4Z9KB 5I2IA 2CJUH 2XXMB 3DYMA 5T1KD 4WO4A 4XHJC 4ZFFB 5JDJA 1JF1B 4KZDH 3THML 1U3HA 1FNLA 1DBBH 2AP2A 2HA1A 3LKQA 2X4TB 5SWQA 1R3LB 3OB0K 3FFDA 4X9FA 1GCFA 5IWLA 1UVQB 4XNQA 5BJTB 2B1AL 5F3HA 5DVKA 4QY8B 4Q9QL 5D1ZA 4DOHB 3MRCB 2EH8L 4NQED 5DJ8A 5GZND 5HHVL 3GI8L 5DRZB 4YHKH 1V3JA 4HFWB 3T4AB 3VXQB 3MODH 3STZA 2GSGA 1AO7B 3GUTB 2G60L 3BUYA 2HLAB 3HCVA 1WTGT 2UZIL 1QR1A 4PRHE 4FQHA 1F8TL 3UYPA 2YKLH 2CLVA 1WWBX 2KUTA 3EO9L 3EYFA 4FQXD 1EJOL 1T1XB 4LPVA 3UBXG 3AY4A 3HZVB 2ZCLL 1P7QA 2HFFA 4LSUL 1XGQA 1PZ5B 4L29A 4S1SL 3I50H 1NAMB 3T0ED 4KVCH 1LO5B 2R0WL 4K55A 4TNVF 3VI4E 5JQ6H 2RGSA 1UZ6F 1YMMA 3UJJL 1XF4A 2XY2A 3O45B 5DC4B 5C07B 2ICES 4MLSA 5DYOA 2DB8A 5IJKA 1HIMH 4NBXB 1FFNB 4MNGA 3T65A 4HPOH 3IFOB 3ULUH 3DRTB 4NC1C 5CINH 3G5ZA 4MAUH 4K3DH 3MXVH 4WHCA 4TVSa 2GITB 2Q8BH 2FX9L 3UYRH 2FATH 4JO2L 2DQJL 3DBXA 3FO9B 3G04B 3VD3A 2BC4B 1FIEA 1AXSA 1MCWW 1MVFA 5F93C 3O6MH 1U95B 4RQQB 3AFLA 3TV3H 1CE6A 5J13B 1IQWL 1TZHA 3TN0A 4DGYH 5JOFB 3A6BL 3MRLA 5JDSA 4HH9A 4HS8L 2PXYA 2IGFL 3D85A 2NX5A 5F6IC 5HVHC 3NCJH 3LD8B 2BDNL 5MI0B 2JK5A 1IBGH 1IT9H 3LQAH 3SO3B 4UMGA 3MA7A 4DUVA 3M07A 4YH6A 2WWKT 5DD5H 3RX8A 2Q6WA 4HGKC 4P2OD 4JM2F 4YDIL 4ZO8A 1ZANH 3QIBD 2AK1L 4IDLA 3VFMB 4ZUUB 3MOBL 1FNFA 2ATPA 5FYJU 1IFHL 4QXGL 2Z93B 1EGJH 3BYYA 4Y2DA 4FZEL 1GVIA 2P8LB 4XP5H 4XI5D 4Y1AD 4X98A 1I9RL 2WQ8A 3QQ3B 1FYTB 5L9DL 1B0GB 4MQXC 1Z0NA 1HDMA 3UROR 4XBEH 1F4WH 4AT6A 1G0YR 3FQNA 1KTLB 3PGFH 4HWBA 4FS0A 4JDZA 4LIQE 4MQ7B 3S3SA 4YFLF 1OGAD 3U9PL 2IALA 1DVFD 1WEJH 3C60D 4NKDB 3D0LB 3HHRB 3VXOB 1HWHB 1DDHB 3BPOC 5KOVC 4PLJC 2D03L 4AYFA 4H5SA 2CKBB 5J1AA 1ZT4A 2HLFC 4C58B 3L5XL 4YPGB 5AWNH 1MF2L 3MROB 1XGRA 3QUYC 1I1FB 4ZO9A 1A6TB 2V5SA 1FNSH 1URLA 3KPLB 1MEXH 3EBAA 3O81A 5IMOA 2VXQL 3L3JB 3KLAB 3VFRA 8CGTA 3OKKA 3CMOL 3GSNL 5EBGA 4M8QA 4PJ8C 1MQ8A 3QQ9D 5DHYA 3S6CA 3RI5K 5IB3B 1S8DA 3ARBC 2XPGB 1ZAGA 1ZXQA 5DMIL 3H9HA 3TVMC 3UTOA 3MR9A 1H3VA 3HMWH 4OFVA 2FBJL 4R3SA 4GRWB 3IGAA 1QBAA 1K2DB 4L5FH 2HVKA 3VG9B 2CK2A 2Z8VC 1QRKA 3L5HA 2XV6B 4MXQD 5HBBA 4OCYL 4JQXA 3QUKB 4JZJB 2EDTA 5FYLD 5I16A 4KUZL 2I07A 4Y4FB 4J4PC 2J5LC 5DGQA 4OJFL 1T4KB 4QRPD 5BRZE 3QEQA 4P99A 4NKIL 3M1BA 5F7NC 3ZZ1A 3PGDA 3AS3A 1XGYH 4ZSOA 4LLQA 4M61B 4Z77A 3VGBA 3CFDB 3RZCD 1I1YB 2AKRA 2VQTA 4M1GL 4TSBH 4DW2H 1CFTA 4WEBH 1QSEE 4PJDA 1J18A 4XPBL 4M6NH 1U91A 1MCHA 5DRXB 1ZEAH 3MRNB 5FV1L 2DQTL 1YPZB 2I9LB 3BHBB 4R26L 3VD4A 3R4DA 4WNQA 4OZGA 3V0WL 4YZFF 2FHFA 3IJHB 1PKQE 3QFJD 1VFOA 4UI2A 3OKEB 4NO0D 5DUPH 1TQCB 3DNKA 5I1LB 4XP4L 2QQLH 1TPXB 1CT8B 4GJTB 2IMMA 4GKZA 2ED9A 1YMHA 4LFHD 2V9QA 1LQSR 2VABB 3TC9A 1SYSB 4V1DB 3U46A 4JN2B 5FUCE 4WWID 5GZOD 3BQUC 1OT2A 3ARZA 1P4IL 2BP3A 1MCBA 3WJJA 2KDGA 1FVEA 2VDPL 2OMBA 3NFSH 3TPUA 2WWMC 4TPRH 3H7LA 2K9UA 2F5AH 2H9GA 2PCPB 5EO0A 2JJVA 5DUML 1C8PA 1F3JB 1MJJB 4M7KH 2BVUA 3EDDA 1ND0B 1CFVH 5HTSA 3D3VA 1I1AD 5I1GH 4XVSH 2IANB 3RL2B 4L1DA 1DQTA 1QFUL 1MCQA 4HUWB 4K7FA 3MRPB 3LKOA 1A4JB 2VISB 1ZE3C 3ZLQC 3SQOL 5K59F 4PJXA 2FLRT 3IDMB 4RAUA 3DRQA 2VOTA 2WBJB 3D39B 3A6CL 3H7BA 5TQ2H 1EUUA 3VG0H 4U0RC 1T21B 3I75A 4LPCA 3QIUC 3FT3A 3WSQL 3VW3H 2CLZB 4HC1A 1U8HB 1FV1A 4JN1H 1RJLB 2V17L 4JVPA 2HT3D 4V2BA 2ADIB 3GSVB 1BIIA 3O41A 1MHCB 2OZ4L 4NCC1 5EUKA 3ARFB 3JSSA 1LMKA 1X44A 5JXAH 1LK3H 1GIGH 3W0WA 5CJQL 1MHEB 4NKQB 5DMGC 5E08H 5CP3A 4LVHC 4EI5B 4HK0A 3UPRB 4WDIB 3TYGH 1KEMH 2ESVD 3C09B 2XTJD 1MHHB 3MUGB 4TSAL 1EAPB 3RBGA 1CD0A 3L3DA 5LBSL 4G6KH 3WFDH 1G6VK 5E4EB 1WWAX 5D7IE 1P4BH 4PY8J 4UDTB 3LKSA 1KJ3L 1FJ1B 1WISA 1RUPH 3MLTB 4OFIA 2H32H 2P8MA 3RVTC 1L0YA 1T04A 4Z7VB 4BK5A 4XWGL 3OAUL 4KDTC 3SE8L 4ZOAA 4ORZC 3PWLA 5GSRA 5C0BA 3TNNA 3C6LD 3FT2B 3MV8D 3PDOA 3HE7B 1S7XA 2DDQL 1KNOA 3L1OL 4WFGE 5D8JH 2PTUA 2X9YA 3GJEA 4FQJL 3K7UA 1T03L 4K7PL 3DXAE 2DIJA 4R4FL 2GY5A 4NKOA 3G5YA 5GGUA 2ID5A 1DQML 3OXSB 5CD3B 3H3BC 1TCMA 2K7PA 3BRGC 4RMTA 2FX7H 4NYLA 5F7EH 1KIQB 2OK0H 2ZCKH 4GUPB 1WT5A 3VRJB 1YYMH 3QNZA 2VSCA 3F7YA 4O2FA 4YK4B 2IPUG 2DAVA 3OKDA 3LEYL 1OAYL 3OHXA 3V6BR 1N7ML 3LS4L 1JPGA 1U3HB 2A6KA 1HHIA 2VR4A 4BKLA 3P0VH 1F4YL 3BP6A 4NZUH 5TFSH 3LKQB 1JMZA 2R4RH 4JKWA 5DK2A 4L8SA 4IIQC 4TUOA 5BV7B 1D5IH 3BD3A 3P77A 1NL0L 1QNZL 3BN9C 3NPZB 4LP5A 4NHUA 2IH1A 3IDYB 4J23A 2MSPA 3C2AL 2X7LB 5IFJB 5DFWH 4KROD 3STZB 1MCIA 3U0PA 1B9ZA 4U1HA 3GK8H 1IC4H 2FECI 1I75A 1UM6H 4OLWH 3W5MA 4JAMA 4C56A 4H8WL 3P9LA 4NRZB 3IKKA 5T5NF 4I18B 4UV4H 4WFHE 5SV3A 1CLOH 1IMHC 4LGPB 1DBML 3KPMA 5KSBA 2FIKA 2CLVB 4GRLC 4HIEA 3JWOC 5MERB 1NGQH 2DTMH 2ZKHH 3MLXH 3N1PC 1C5CH 1LP9E 3V5KA 1T6WA 5LG1A 3GBNL 4LSQH 2WP3O 2FH8A 2L0DA 4DKAA 2HFFB 4N0YL 2YXFA 2G5RA 1ZLUK 1F02I 2HG5B 2FIRT 2NXZB 1C7TA 1WK0A 2H32A 4XXCA 1IQDA 1C7SA 1XF4B 3ZKNC 3HMXA 1CVSC 4U1MB 1ZA3A 4XBPA 4MNGB 3ZKXC 3T65B 1NLDH 2XY1A 3SDYH 2HFEA 3OB8A 4M02A 4G80B 4MB3A 1H8SA 1FZJB 4L4JA 3SGEH 2OP4L 3O6FD 4DKEL 4IOIA 1T1YB 4KJWC 3MV9A 1NCWH 2G5BA 1H3WM 3UBXA 2P44B 1H15A 5GGVH 2IEPA 4P23C 5F9WB 5IK3A 3HE6D 1KJVA 3PUCA 5D2LE 5KZCB 3NIGE 2DM4A 3O4OB 2GTWB 3QFJE 4PB0H 3WFBH 4QXUL 1XGUA 1GGIH 3RVXC 1J87A 5I76B 4NNYA 4LKCA 1TZHB 2HT4C 1L9MA 3RPIB 5JDSB 4HH9B 2V7HB 1BZ7A 5E7FA 5DZLA 5FHBL 4CN6A 3D85B 3FMGL 4L8BA 1HOCA 5ICYA 3CX5K 4PJ9C 4L8CA 2QHRH 4ESKA 5KVGH 4Q7DA 1X5FA 1FVCB 3FHQA 1ZLSL 5D93B 4R0LB 1QPXA 5HYSG 4A6YL 4F33A 3AGVA 3EJJX 3L7EA 4JKKA 2Q6WB 5CEZH 3MYZA 2EDNA 3R1GH 5DRWA 3QG6A 4E0RB 3C8KA 3QIWD 1UZ8A 3S36L 3VFTA 1YC8A 4JY4B 4GRWF 3BPLC 2ILLA 3QEHA 4Y2DB 5E9DA 1WBXA 1OM3H 2DN7A 2DYPA 3BT2H 4CVUA 1FFPA 3KPRA 2GT9A 2FD6H 4OFPA 4Y19E 4HUNB 3TBTA 3RGVD 1RULH 2FYYA 2EYSA 1HDMB 4Q0XL 1DSFH 2IFFH 3PJSB 5C0CB 4Z7WA 3QO0B 4UOW0 3FQNB 4GXVL 3NA9H 4JDZB 2MJWA 3MMEB 3E6HB 5C0NC 4UTBL 4ODBD 5TDOB 2IALB 4RWHA 4KK6D 2FWOA 5CSZA 2Z31B 1XFPA 5J1AB 1B88A 3ZL4L 4BUGA 3MACL 3RUGE 2DQUL 4MZ3A 1GPOH 1XIWB 4HD9A 4EN3B 1PY9A 2NR6D 3QCVL 4JY6B 3LRGA 2LAAA 4U05A 4ZUTA 1IZJA 4U2ZA 4EDWH 2YN5A 1AR1C 5IMOB 1V7ML 3L7FA 2E7LC 5BO1H 1KN2L 1U8MB 1U8KA 2CMRH 2N1KA 1VEMA 1N5AB 4W4OC 2ESVE 3GEWB 5HHOB 3MRDB 3ZE0F 1YPZF 4ZOBA 3GRWL 1MJ8L 1YEJL 4Z7QF 4R3SB 2E27H 4IHOB 3M8OH 3O4LD 3E0GA 3IGAB 2EDOA 4IOSD 2E6QA 3W11D 3ARVA 1KBGL 3BFOA 4BZ1H 1QRNA 1I8KA 4WGVB 4RWYL 1QA9B 5TE4H 4FNLL 4WU5B 3MLSL 4R2GD 4UOW1 1B0WA 2EKSA 2R9HC 3PWNB 4JPWH 4CJ1A 4KZEH 2DIAA 1QQDA 2I07B 5ESAB 4LARL 4WCYL 5FECB 1S9XB 3EFFA 3BDYH 3F58L 4EVNA 3M1BB 3SDAC 2XZQH 3WJLC 1DLFH 3HUJE 5GS2H 2HTLC 4EXKA 3O9WD 1SJHB 4Z77B 4LVNC 3HN3A 5T3XL 4MXVF 4OLUH 5HHNA 5DS8A 1FZKB 2E8ZA 4PJDB 4JO3H 4HDIB 5FM5M 2IF7A 1U91B 4RA0C 3V0VB 3UTSE 1FVDA 3DIFB 4TOYL 4NFDA 2BFVL 4WTZG 3IFNH 4G9DA 4L9LB 2ED7A 1T2QH 43C9B 4M9OA 1HILB 4ZQKA 3WIHA 4WNQB 1H0DB 1FPTH 3FOLB 4MMXC 5BQ7A 1G9NC 3O2DA 3B43A 2VXUL 4KJQD 4N8CH 5D1XD 5KS9A 5C0AB 2YD7A 3RY6C 5ITFA 1AE6L 2J88L 4PRPA 3Q1SL 5L0QC 3RDTB 2GFBB 1YUHB 3S88L 4QF1B 2E9IA 1YMHB 4MQTB 1AIFA 2XQYK 3QI9A 2J4WL 4F9LA 1KTDA 3O2WH 2GJ6A 4NC1E 2RFXA 3SDXB 2PW2A 4OZFB 1T66D 1HYRC 3MGTB 2P1YA 4NQVB 1UB5A 3TPUB 4P2QB 4UINL 2AEWA 4WFEE 2H9GB 2IQ9L 2MQ0A 1NLBH 3I85A 1FG9C 1RK0B 2BRRH 1QEWB 3HRPA 4MJID 1SEBA 4FTVA 4O02L 1IKNA 4P9MH 3UO1L 5F8QC 5I9QB 1FP5A 4NDMA 4KRPB 4RAHA 2PO6A 1N6UA 1MY5A 2EXYD 5JPNA 1T2JA 1I7RA 4K7FB 4F9PA 5B39G 5CEXB 1AO7D 4FQXC 2APWA 4Z7VF 4PJXB 4BSJA 1JPST 1S7VB 4RAUB 4MWFB 4JRYE 3WNLA 4MA1B 2HN7B 5EC2A 1R0AL 4PFEA 3F8UB 3X11A 3QDGE 3PWVA 3I75B 3BKML 3GSUA 3GHEH 3U0WH 5E2WL 5K9QI 3FT3B 1HINH 3T0EC 4PJCA 4G8FA 2A9NL 3STLA 1FV1B 3TO2A 1N3NA 3U7YL 5BOZG 4O9HH 2H2SD 1A14H 1BIIB 2FJFA 1MCOL 5F7WC 5B38B 2ZUTA 3TWCH 4MNQA 1JF6A 3W0WB 4MCYA 3MLVH 1U9KA 4YWGL 3GMLB 3SGEI 5C07D 1KIPB 3MUY1 1K4CA 4HK0B 5DHXB 3HI5H 4HWEL 2G2RB 4D8PA 2ZUQB 5GJTL 1ZT1B 1V7NL 4Y5YC 3X14A 2WBKA 2R2HB 4IRJD 3KHQA 1QFWL 4R96A 3BEVA 4PS4L 2IH3A 3F12A 3DVIA 4YBLC 2DLGA 5IBTL 4JGMA 1HWGB 5DD3H 3UDWC 1G9EA 1DEDA 4DKFL 3DSNA 3W82A 2P8MB 1NC4B 1MI5A 1BVKA 5BW7C 1KCRL 4FFZL 2PYEA 2NY1B 3EOYG 4KKAD 4JG0H 5C0BB 4FRWA 5BS0E 1GOGA 4X7TA 5F1NB 1TMCB 4UQ3B 1YEEH 2ED8A 1E4WH 3IKCA 5LQBH 1KUMA 2PYFB 4NQCE 4F37F 5K9KA 1LILA 3GJEB 7FABH 3UXFA 3K74B 3STBA 2DKUA 4OFDA 5L2KB 2AJZA 4YGAB 2FR4B 1CGSL 3G5YB 4FQLL 1G6RA 5I17B 4X8JA 3LH2L 5DK0A 1N5YL 2CD0A 1X5HA 1KJ2B 2W0FA 2YUXA 2ZNXA 3QCUH 3T04D 1YJDC 4HS3A 1T0PB 5DLML 4Y5VC 2A0LD 1FYTD 1NAKH 2BNQA 3U9UB 4ZFOA 4KJPD 4CW1A 5JHLH 1KB5H 1DVFC 4Z8FH 1JPGB 3RVVD 2OR9H 2YUVA 5E8EA 3BP6B 3GMRB 2C7UA 4X6CE 4WHTA 2X4NA 3WFCH 2O5XH 4TUOB 5HHME 3BGFC 1VFBA 1FQ9C 2ENSA 3LB6D 5BVJA 3A0OA 5IIEB 1A0QH 5FDWA 2Q86B 5C9JA 3EOAA 4CU7A 3K0WA 3DX6A 3QQ9C 5CWSB 4HEPG 1JPSH 1TZIB 5A2JH 3LS5L 4JAMB 1INQB 3TJEH 3AMKA 4U1IB 5BV7L 2CUMA 2XWJA 4K71C 2OI9B 5MENB 3KPMB 1LD9B 1AD0B 4FQ2L 4URTB 1QP1A 1BIHA 1JHTA 3N1QC 4PBXA 1PAMA 1G7QB 3ARPA 3S98A 4L3EA 5IM7B 3LEXB 1XR9B 5D7JC 3FO0H 2HMID 2V9RA 4WW1A 4MD4B 2Q76A 5EOCH 5T3XD 4OUOA 5JA8B 3Q5YA 1U8LA 5EZOL 1W72H 3G5VB 4I3SL 4Y4FD 4ZTOH 4LRIC 3E1F1 3CC5A 4RNRA 4BELD 2OCFD 2HFEB 4K3JL 1ACYL 5J6HA 3RZCC 4LCWE 5F1IA 3GSWA 3T1FA 1EO8H 1K8IB 4ELKA 2R8SL 2NPLX 1K8DA 1WWCA 3UBXB 2R69L 3RIAF 1H15B 4YQXH 4KKNA 5FAAA 1DE4B 5IVZB 1IC5L 2VL5B 4KPHH 4CNIB 4J3SA 1SBBA 4YBQC 1LEGA 4OGYL 1RUAH 5HHXH 1R5IA 4Z0BH 5IBUG 4NNYB 3EYOA 2R56H 1VFUA 3G08B 4AK1A 2ZUWA 1A6VH 3VMPA 3OGCB 1P4LA 3HG1E 4L8BB 4JFOB 3WN5A 3O3BA 4O51B 4X6DE 2WUBH 1WFUA 3VXPB 1MFDH 5IHUL 1WIPA 3B3IA 4HJJL 1KB5A 4MNHB 1LE5A 5C0IB 5DHVA 3C8HA 4MAYA 3Q0HA 5KSAC 3TIDA 5F96H 4LSSH 1Z3GL 5JW5A 4JJ5B 3VFWA 3VFTB 3OZ9L 4JPVH 3B83A 4OIAA 5GZOC 4LHJB 3IJYA 4NBYB 2CGRH 1PEZA 3QEHB 2DIBA 4QRUA 3I9GL 1TZGH 3IDXL 4DOHE 4PJ7A 4GKOA 3S8WA 1FFPB 1YEDA 4V1DD 4D9QD 5GJSH 3GBLA 3TBTB 5DEFB 2ADFH 4CADB 1MFNA 4JLRA 4YR6A 1AO7E 4RGOH 1J5OL 1UJTA 4LQFH 5KVEH 2APXA 5KVDH 4LLYA 5JW4R 1F6FB 4E41E 4S0SD 1IEAA 4PLKC 5J8OA 4LQ1A 3KPSA 1JGLL 4RDQG 4PV9A 1VPOL 3O0RH 4UB0H 3VD7A 1FIGH 2IAND 5E99H 1S7WA 4M6OH 3HNTH 5I1CL 6CGTA 1F11A 4PRBA 4GS7B 3MJ7A 1YEGH 4NZRL 1KLGA 4PJDF 3L7FB 2WBJD 3D39D 2WANA 5FO8A 1SHMA 5EA0H 2EDHA 1RJZA 3FRPG 1RUML 2R4SH 1OTTD 3RRQA 5HGHA 2W0PA 4OIBA 4OF5A 2ZJSL 3M17A 2J8UE 3I2CL 4CDHA 4CL7A