5IWAE

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
157
structure length
157
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKGEAHAQAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S2
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
total genus 36
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5iwaE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5iwaE02
3T1YI 4FWDA 4ED4A 4DUYE 2E1RA 4DR3I 4JI3E 1J5EE 2HKJA 2V34A 4FW9A 3J81Q 3WU3A 3M6AA 3C4BA 2JVAA 4JI2E 4PRXA 4JI6I 4DV3E 4DV4E 5CFFE 3D4JA 1EKZA 2YT4A 4WUDA 1FNMA 3CWVA 1X47A 2UXDI 4JG4A 1IBMI 2HK2A 1N34I 2J7KA 1DARA 4B3TI 2RS6A 3LLHA 1HR0I 2HFUA 4LFCE 3ZZTA 2V2ZA 2ZM6E 2E5LI 2L3JA 4DV7E 4K0KI 1T4LB 2UXCE 1RQ0A 2B7VA 4DPXA 4JI4E 4M2ZA 4GKKE 4JI5I 1FI4A 5LMNI 1NZ0A 2NUEA 5IT9C 3WU4A 4YY3I 1YYWA 4HACA 4Z7CA 2ZITA 4NXME 5LMUE 2UUAI 4JI1I 4DR2I 2R3VA 1QU6A 1MU5A 2GS8A 4DR7I 4LF5E 4WYQB 1PKPA 2N3HA 4URLA 2VQEE 4DUZE 4OOGC 4JI8I 4AQYI 4B3ME 4I3HA 1Z5AA 3WU5A 4B3SI 2HFSA 4M1KA 3J7Yp 4DPYA 1N36E 4EMDA 4HYMA 4DPTA 4KHPI 3LTOA 4FN5A 2UXBI 5GMEA 2DEIA 4X8WA 4JYAE 4FWHA 4X65I 2B7TA 1XNRI 3LPSA 2RSMA 1ZM4A 4DV6E 4DR4I 1WHQA 1IBLE 4FWGA 1ZBTA 4X66I 1HNXE 3F0NA 4DU8A 2DEJA 1XHKA 2BM0A 1Z5BA 4LF7E 3GONA 4LFAI 4WUCA 1J26A 1UHZA 1NHJA 2CZ9A 4LFBE 4WUBA 5LL6R 1B62A 4LF4I 5IT9Q 4DV2E 1X49A 4DKKA 3ADLA 4RPFA 1D6TA 4GKJE 4DUYI 2VF3A 4JI3I 1HNWE 3Q1QA 1XMOE 1DI2A 2RTXA 4DPWA 2V2QA 4JI2I 2LJHA 4DV3I 5A2QQ 4JV5I 4HACB 2VQFE 1H74A 1H73A 2Q2EB 2UUCI 2F4VE 3LNUA 4JI7I 4YHHI 1ZM3A 4JI0E 1Z0TA 3PYDA 4DR5E 2UXCI 1I94E 3T1YE 3J80Q 1XNQI 1KTVA 3WU6A 4JI4I 1ELOA 1N0UA 4WFTA 2AJ4A 1STUA 1NHIA 3K17A 3ZZUA 4Z7YA 4DV0I 1N32E 4X64I 1YYKA 2LRSA 4JI6E 4NXMI 3VYYA 5IWAI 4B3RI 1Z0EA 1WHNA 2LUPB 4LF5I 3QT7A 2EFGA 2VQEI 1ZM2A 2L3CA 1IBME 1IBKI 3OTOE 1YZ9A 1A6FA 4P52A 4B3TE 1HNZI 2NUFA 2V8PA 4B3MI 2LTSA 2L2KB 1RR9A 4R1FA 2LBSB 3PYEA 3HTXA 1N36I 3T1HI 1UILA 2UU9I 4USMA 4UT4A 4X62I 1NHHA 3P1XA 1FWLA 3V5RA 3JAMC 2HHHI 1KIJA 1IBLI 2CPNA 4YY3E 2A2CA 2BM1A 3QT5A 1X48A 1WUUA 4PRVA 4DV1I 1XMQI 1YYOA 4LF9E 4DR2E 4LF7I 4LF6E 3ZKDA 1U2RA 4ZVIA 1H7UA 4DV5E 2EZ6A 4DV2I 1N0VC 5FLXC 4JI8E 4DR1E 1Z0BA 4OX9I 4B3SE 1S4EA 2N3GA 1HNWI 4M30A 1B63A 2B3TB 1XMOI 5L3JA 3V2UC 1FJGE 1Z0WA 4LF8E 3QT6A 4X65E 1T4NA 1J5EI 1T4OA 2UUBE 4NXNE 4UTGA 2DIXA 3ZKBA 4DPUA 4DV4I 3PYGA 2F4VI 1MX0A 4DR6E 4MYUA 5BR8E 4MYTA 1ZXMA 4JI0I 2X36A 4DR5I 2XEXA 1I94I 3JAMQ 1N33E 1Z0CA 2L2MA 2DMYA 4LFCI 1UEKA 1Z0GA 2ZM6I 1MG7A 2KHXA 4DV7I 2NPFA 3ZM7A 1VISA 3B82A 2A2DA 2NA2A 1N32I 4GKKI 2IHR1 4DR3E 1Z59A 5FLXQ 1H72C 4JV5E 2ZBKB 5LMUI 3OTOI 2UUCE 2DB2A 3H4LA 2NUGA 4JI7E 1Z5CA 4YHHE 1RREA 2UXDE 2R42A 4DUZI 1N34E 2X7IA 2L33A 1HR0E 3QT8A 1XNQE 1PIEA 1Z0VA 4USKA 2LUQA 1ZM9A 2RS7A 2E5LE 1O0WA 4K0KE 4HY1A 4DV0E 1EI1A 5GMDA 1GQEA 3C4TA 2BV3A 3J7AG 4X64E 4JI5E 4JYAI 3K1JA 5IWAE 5LMNE 3ADGA 4LF9I 4B3RE 1OJ4A 4LF6I 4DV6I 4DXLA 3PYFA 4DV5I 1RC7A 1HNXI 1S16A 4PU9A 1IBKE 1PVGA 2UUAE 4JI1E 1HNZE 5A2QC 4DR1I 4DR7E 4LFBI 3J81C 1EA6A 3B8HA 4HXZA 4XTJA 3T1HE 2UU9E 1KVKA 3ZZ0A 4GKJI 1FJGI 4AQYE 3VYXA 4X62E 2HK3A 4LF8I 1QZRA 1BKNA 4P7AA 2HHHE 1ZXNA 2MDRA 4NXNI 3J80C 4KHPE 2UUBI 1K47A 2UXBE 1FKAE 4DU7A 4KQVA 1XNRE 2OI2A 4DV1E 1XMQE 4DR6I 5BR8I 4DR4E 3ADJA 2VQFI 3J7AM 4X66E 2HKEA 2V2VA 1N33I 3HULA 1FWKA 2L2NA 2WW4A 3B78A 4LFAE 2LTRA 1H7SA 2LJPA 3ADIA 1KKHA 2JY9A 4OX9E 4LF4E
chains in the Genus database with same CATH superfamily
3P3GA 3T1YI 3IWBA 2EPKX 3PS1A 2YSPA 2YTNA 4FWDA 2JT2A 2IESA 4LPFA 3JU0A 2V89A 1NCSA 4DUYE 4NHRA 4ED4A 3ECRA 1YH8A 2E1RA 4FW5A 1QNTA 3HKMA 4DR3I 2YTQA 3EPJA 1TN9A 4JI3E 2H36X 5KL3A 1J5EE 3GCMA 4NBQA 3IWDA 2HKJA 2V34A 2EMIA 3MHSC 1G2FC 3EQ1A 4FW9A 2FGGA 3M6AA 4WPYA 3M99B 3WU3A 3C4BA 2JVAA 4JI2E 4PRXA 4JI6I 4DV3E 2LO3A 4DV4E 4HEIA 2PO1B 5CFFE 3D4JA 1EKZA 2JPAA 2YT4A 2JE6B 4WUDA 1FNMA 1USVA 2WZOA 3CWVA 2EN1A 4BA1A 4WSGA 2C39A 1X47A 2UXDI 3PS3A 1RMDA 4Q28A 3ZOQB 4JG4A 1IBMI 2R76A 3AV0A 4P78A 2AE8A 2HK2A 4ZYHA 1DARA 2J7KA 1N34I 3OMLA 2RS6A 3LLHA 1HR0I 4B3TI 1XMQI 2I9IA 5K36F 2HFUA 5EKWA 4LFCE 2NN6C 4IFDE 2EORA 1UDNA 4J8ZA 3ZZTA 2V2ZA 2YTOA 4LU9A 2ZM6E 2E5LI 2L3JA 4DV7E 1YHCA 2NN6B 4K0KI 5KL2A 1T4LB 1DQ3A 3F6HA 2UXCE 2PNZB 1WXRA 5DNYA 1RQ0A 2B7VA 4DPXA 1X6FA 1L4SA 3RMPA 4JI4E 4M2ZA 4GKKE 4JI5I 4X9JA 4R2PA 5C0XD 3NZKA 1FI4A 5LMNI 2M7QA 1NZ0A 2RQLA 3EPKA 2NUEA 5IT9C 2JOXA 2V85A 2YTEA 3WU4A 4YY3I 2YU5A 2EMCA 4F9CB 1YYWA 2PO0B 5AE2A 4R03A 4HACA 4Z7CA 2EOYA 2ZITA 3UHMA 2EM2A 4ISAA 2LJUA 5LMUE 4NXME 1P42A 5A6JA 1EH8A 2UUAI 4JI1I 4DR2I 2V83A 2PO1A 2R3VA 3K85A 1G2DC 2JE6A 2ENCA 1QU6A 1MU5A 2GS8A 3J81Q 4DR7I 5LLQA 4LF5E 4WYQB 1PKPA 2N3HA 4URLA 2YZTA 4DV1I 2VQEE 1UBDC 4LF7I 2HC5A 4DR4I 4IFDD 2EPOA 3HJCA 4DUZE 4O5GA 1A1HA 4OOGC 2R1FA 4JI8I 3GLLA 4AQYI 3AUZA 4B3ME 2YU8A 2RSIA 1Z5AA 4I3HA 3WU5A 4B3SI 2HFSA 4RHBB 5AC5A 4M1KA 5KL4A 2NN6A 3J7Yp 4DPYA 4DMIA 1N36E 4EMDA 4HYMA 1X3CA 3C6MA 2G7HA 1A1IA 4DPTA 4KHPI 3LTOA 4FN5A 2CTDA 3HPSA 1Y4SA 2UXBI 1JK1A 2L8TA 5GMEA 2DEIA 4X8WA 2EMKA 3K6QA 4JYAE 2DMIA 4FWHA 3VK6A 2EPZA 4X65I 2B7TA 1XNRI 1KJKA 3P06A 2NN6E 3LPSA 1ZBQA 2RSMA 1ZM4A 1YUJA 4DV6E 2GQ0A 4MU3A 4FW4A 1WHQA 1IBLE 1ZBTA 4F2JC 1MEYC 4FWGA 4FK5C 2E1MA 2D9HA 5A6KA 2JEBA 4X66I 1HNXE 2ENHA 5C0XE 3F0NA 4DU8A 2DEJA 4IS1C 1P47A 1XHKA 4LOMA 2BM0A 1Z5BA 4LF7E 3Q6MA 3GONA 4N3OA 4WUCA 3H09A 4LFAI 1J26A 4WXDA 4BA1B 2C39B 1UHZA 1NHJA 1EH7A 2CZ9A 4LFBE 2EPAA 5LL6R 4WUBA 1B62A 4GQUA 4LF4I 5KL5A 2JWOA 5IT9Q 4DV2E 1X49A 4NZVA 5AE3A 2LT7A 4DKKA 3ADLA 2KOUA 3QG5C 1WRJA 4RPFA 4MQYA 1D6TA 1KYQA 3C6KA 4GKJE 5JEAA 4DUYI 2EQ1A 2GLIA 2VF3A 5KL6A 4ZYGA 1ZU1A 2VESA 1Y5YA 2B9DA 2WBTA 1IMUA 5FWKA 1HK7A 2EL6A 1OYRA 1HNWE 4JI3I 2M1SA 1DGCA 4QNKA 1XMOE 3Q1QA 2CT1A 1DI2A 2EOOA 2RTXA 4F9BB 5A6BA 4DPWA 2V2QA 2EMYA 4JI2I 3U1YA 2LJHA 4DV3I 5F3WA 2IERA 2YPNA 1BBOA 2IOQA 3L7ZA 1WJPA 2EJ4A 2EN3A 5A2QQ 1NEIA 3KZZA 4JV5I 4IZKA 2V86A 5AE1A 4HACB 1PJQA 2Z5BA 1E3HA 2VQFE 4R2AA 1H74A 2PNLA 1H73A 2BA0G 4R2SA 2Q2EB 2UUCI 2F4VE 3LNUA 2V87A 1UDSA 4JI7I 2PO2A 1BB8A 4YHHI 1ZM3A 2KONA 4JI0E 1Z0TA 3PYDA 1RHYA 4DR5E 2UXCI 2EM8A 1I94E 4MU4A 3T1YE 3BGHA 3J80Q 1XNQI 2DLKA 1KTVA 2BA0D 3WU6A 1ELOA 4JI4I 4RH8A 1N0UA 4WFTA 3BF2A 2AJ4A 4OO1C 1STUA 1YSAC 4IJDA 2O1VA 1NHIA 3K17A 3VHTB 4Z7YA 3ZZUA 4DV0I 5A6AA 1N32E 2EPLX 4X64I 1VI7A 2EOZA 2LRSA 4BC9A 2YRHA 4JI6E 1YYKA 2O3ZA 3VYYA 3B4TA 4MU1A 4ZYEA 5IWAI 4NXMI 2HGHA 4L8NA 2C37A 4B3RI 3THOB 2LE2A 2EN7A 2NN6F 2L92A 1Z0EA 1WHNA 4KZSA 2LUPB 3THNA 4LF5I 3QT7A 2EOJA 2FV4B 2EFGA 1SR9A 2JEBB 1ZM2A 2VQEI 2L3CA 1OYSA 1IBME 1YUIA 1IBKI 3OTOE 1YZ9A 1A6FA 4P52A 2MC5A 4B3TE 1HNZI 4Q35B 2NUFA 2V8PA 3Q6NA 4TUIA 4B3MI 4N4RB 2LTSA 4FW7A 4IZJA 4F6MA 2ODRD 5IV8B 2L2KB 1RR9A 4R1FA 1AAYA 2LBSB 3PYEA 4AIMA 2ELYA 3HTXA 1N36I 3FIGA 5JEAC 2NABA 3T1HI 1UILA 2EOXA 2WNRA 4USMA 4UT4A 2UU9I 2F1DA 4X62I 5JEAB 1NHHA 4LCFA 2ENAA 2M9AA 3P1XA 1JK2A 5K36A 2EOQA 1FWLA 3V5RA 2UUBI 3JAMC 2Z5CA 4OZEA 2HHHI 4L5NC 4OO1A 1KIJA 1IBLI 2CPNA 4YY3E 3MSWA 2A2CA 2BM1A 3PRYA 2LCEA 3MHHC 5A69A 4BC7A 3QT5A 1X48A 5JEAF 1PJSA 2WP8A 1WUUA 3L7ZB 2N8XA 1Y60A 4MDTA 1YYOA 4LF9E 4DR2E 4PRVA 2EOHA 2HJJA 4LF6E 4M9VC 3ZKDA 1R6LA 4R2EA 4IZKB 4F9AB 1U2RA 2WBUA 2Z5BB 4ZVIA 1H7UA 4DV5E 2EZ6A 1OYPA 2PNMA 4U3DA 2EM9A 2EMBA 2M4IA 4DV2I 1SFEA 4I8OA 5AASA 1N0VC 2GHFA 4M0VA 2V8QB 3EPHA 2DSYA 5FLXC 3P3CA 4JI8E 2PO2B 4DR1E 1Z0BA 2EMGA 5EL9A 4OX9I 1A1LA 4FW3A 2JYAA 4B3SE 1R6MA 1S4EA 1A1KA 2N3GA 4FW6A 1HNWI 3EPLA 4M30A 1B63A 2B3TB 1XMOI 2YTFA 3BBGA 2DGCA 5L3JA 2EMXA 3GMEA 2EM5A 2EM7A 1AH5A 3V2UC 2YSOA 1FJGE 2V88A 4IFDC 1Z0WA 1MGTA 1B69A 4LF8E 3QT6A 4X65E 2GO4A 2EMAA 2EOEA 1T4NA 3CDJA 4QNJA 1J5EI 1F2IG 1T4OA 2UUBE 4NXNE 5T6JA 2EL5A 2EQ3A 2I13A 2NN6D 2CVEA 3CDIA 2DIXA 2IOPA 4UTGA 3ZKBA 1A1JA 4DPUA 4DV4I 3PYGA 2C37B 5JEAE 1Y4UA 1GTKA 2L6MA 2F4VI 2EM4A 4HTGA 4KWYA 2EPXA 2O1TA 4MU0A 2Q8UA 4R2RA 1MX0A 2PRTA 4DR6E 4MYUA 2CGEA 5BR8E 1X6HA 4MYTA 1TF6A 2EE8A 1ZXMA 2BR2A 4JI0I 1A1FA 1PJTA 2X36A 4DR5I 2XEXA 1I94I 1UDQA 3JAMQ 1N33E 2EMWA 2L2MA 1Z0CA 5C0XA 2DMYA 2EM0A 2EN8A 2EL4A 2YTDA 2YTGA 5DRRA 4LFCI 1UEKA 3P76A 4R2DA 4IZJB 1Z0GA 2ZM6I 1MG7A 3F6GA 2KHXA 2YTIA 4DV7I 2EPUA 4BS9A 2NPFA 3ZM7A 1VISA 2C38A 2A2DA 3B82A 3PS2A 1EH6A 2EMHA 2EN6A 2NA2A 2MC6A 2VRDA 2WNRB 2K4VA 2O1WA 1N32I 5K36C 1XXEA 2EPPA 2DRPA 4GKKI 4GEQB 2YRMA 5DRPA 3P3EA 4J3DA 2EWLA 2IHR1 5K36B 2EP3A 4BMJA 2EMZA 4DR3E 2Z5CB 2JEAA 1Z59A 1N3GA 4BA2A 5FLXQ 5JEAD 4IFDA 4OO1B 2ADRA 1H72C 4WSPA 2FTXB 4JV5E 5IXMB 2ZBKB 2EM3A 2Z5EA 3DD6A 5LMUI 2WCC3 3OTOI 1A1GA 3TQMA 2WP8B 4O24A 5A6BD 4AIDA 2UUCE 2EOFA 2DB2A 3H4LA 2DLQA 4IS9A 4TUGA 2JXPA 2NUGA 4JI7E 4OO1F 1Z5CA 4YHHE 2YTPA 1RREA 5KL7A 4MLVA 2UXDE 4F54A 4BCAA 1E3PA 2R42A 4BBYA 4GZNC 4DUZI 1N34E 2YTJA 2X7IA 2L33A 1HR0E 3QT8A 1X5WA 2EMFA 2JP9A 1XNQE 4P7DA 1PIEA 2JOBA 1Z0VA 4USKA 2LUQA 4O43A 3KWRA 1ZM9A 2RS7A 1YFHA 2E72A 1PDAA 4LCGA 2E5LE 3LMLA 4LTYA 1O0WA 2GO3A 4K0KE 2EPNA 4HY1A 2EN4A 4BHCA 2BBGA 3L00A 4DV0E 1EI1A 5GMDA 1X6EA 1GQEA 3C4TA 2BV3A 3J7AG 4X64E 4JI5E 2CG9A 4JYAI 1IQOA 3K1JA 5IWAE 5LMNE 3IWCA 2MKNA 3ADGA 4LF9I 1T38A 4B3RE 1OJ4A 4LF6I 4DV6I 1ZAAC 4DXLA 3PYFA 2LMZA 1IQSA 4DV5I 3UK3C 1RC7A 1HNXI 1S16A 2EQ0A 5TSEA 3DF6A 4PU9A 1IBKE 3H1CA 1YPNA 1PVGA 2UUAE 4JI1E 4U3BA 5K36E 4LCHA 1HNZE 2A25A 5A2QC 3M85G 3HPZA 2J65A 4DR1I 2EPRA 4DR7E 3M7NG 4OO1E 4LFBI 3J81C 2BR2B 4R2QA 4WX9A 5C0XC 1EA6A 3B8HA 3KZYA 2ELZA 4HXZA 2GPIA 2PNZA 4XTJA 5C0XB 2JR1A 3T1HE 2YRKA 2UU9E 1KVKA 3ZZ0A 2EPMX 4GKJI 1FJGI 4AM3A 4AQYE 5DROA 3VYXA 4X62E 5DRQA 2HK3A 2EMLA 2K7IA 4OKGA 3HQ1A 4ZYDA 4LF8I 3M85D 3M7ND 2C38B 4O4KA 1Z1BA 3DJWA 1QZRA 3KRNA 4IZJD 1BKNA 5DNXA 4P7AA 3HXLA 5ADZA 4BHBA 2MDRA 3J80C 2HHHE 4KHPE 1ZXNA 4NXNI 4R8OA 2ODRC 2PO0A 2J7JA 1K47A 5C0XF 2UXBE 1FKAE 1ZR9A 4WXCA 2CSHA 1Y6ZA 2VE7C 4DU7A 4R2CA 2EPCA 4KQVA 1USUA 2JEAB 2LV2A 2WBSA 4BA2B 1XNRE 2BA1G 2OI2A 4DV1E 1XMQE 4DR6I 4IFDB 2MDGA 1TF3A 5BR8I 4DR4E 3BIDA 2EOSA 3ADJA 5K36D 1LLMC 5AC4A 2EN2A 2O1UA 2VQFI 3J7AM 4X66E 1UDOA 3JTZA 2HKEA 2V2VA 5ELWA 4OO1D 2BB8A 2F8BA 4MLQA 2RPCA 1FWKA 3HULA 1N33I 2YWQA 2L2NA 1BBGA 2LVHA 2VF1A 2WW4A 3B78A 4LFAE 2EOMA 3U1KA 1T39A 4F6NA 2LTRA 1UN6B 1H7SA 5DNLA 2LJPA 4IFDF 3ADIA 2BA1D 2MKDA 2EOIA 1KKHA 2JY9A 4OX9E 1GZ6A 2EM6A 4LF4E
chains in the Genus database with same CATH topology
3T1YI 3IWBA 4FWDA 3JU0A 2V89A 4ED4A 4DUYE 2E1RA 4DR3I 4JI3E 2H36X 1J5EE 3IWDA 2HKJA 2V34A 4FW9A 3J81Q 3WU3A 2FGGA 3M6AA 4WPYA 3C4BA 2JVAA 4JI2E 4PRXA 4JI6I 4DV3E 4DV4E 5CFFE 3D4JA 1EKZA 2YT4A 4WUDA 1FNMA 1USVA 2WZOA 3CWVA 1X47A 2UXDI 4Q28A 3ZOQB 4JG4A 1IBMI 3AV0A 2HK2A 4P78A 1N34I 2J7KA 1DARA 4B3TI 3OMLA 2RS6A 3LLHA 1HR0I 2HFUA 4LFCE 4J8ZA 3ZZTA 2V2ZA 2ZM6E 4LU9A 2E5LI 2L3JA 4DV7E 4K0KI 1T4LB 1DQ3A 3F6HA 2UXCE 1WXRA 5DNYA 1RQ0A 2B7VA 4DPXA 3RMPA 4JI4E 4M2ZA 4GKKE 4JI5I 1FI4A 5LMNI 2M7QA 1NZ0A 2NUEA 5IT9C 2JOXA 2V85A 3WU4A 4YY3I 4F9CB 1YYWA 5AE2A 4R03A 4HACA 4Z7CA 2ZITA 4NXME 5LMUE 2UUAI 4JI1I 4DR2I 2V83A 2R3VA 3K85A 1QU6A 1MU5A 2GS8A 4DR7I 4LF5E 4WYQB 1PKPA 2N3HA 4URLA 2YZTA 2VQEE 3HJCA 4DUZE 4OOGC 4JI8I 4AQYI 3AUZA 4B3ME 4I3HA 1Z5AA 3WU5A 4B3SI 2HFSA 4M1KA 3J7Yp 4DPYA 4DMIA 1N36E 4EMDA 4HYMA 2G7HA 4DPTA 4KHPI 3LTOA 4FN5A 3HPSA 1Y4SA 2UXBI 2L8TA 5GMEA 2DEIA 4X8WA 3K6QA 4JYAE 4FWHA 4X65I 3VK6A 2B7TA 1XNRI 3P06A 3LPSA 1ZBQA 2RSMA 1ZM4A 2GQ0A 4DV6E 4DR4I 1WHQA 1IBLE 1ZBTA 4FWGA 2E1MA 4X66I 1HNXE 3F0NA 4DU8A 2DEJA 1XHKA 2BM0A 1Z5BA 4LF7E 3Q6MA 3GONA 4N3OA 4WUCA 3H09A 4LFAI 1J26A 1UHZA 1NHJA 2CZ9A 4LFBE 5LL6R 4WUBA 1B62A 4LF4I 2JWOA 5IT9Q 4DV2E 1X49A 5AE3A 4DKKA 3ADLA 2KOUA 4RPFA 1D6TA 4GKJE 4DUYI 2VF3A 2B9DA 5FWKA 1HK7A 4JI3I 1HNWE 2M1SA 3Q1QA 1XMOE 1DI2A 2RTXA 4F9BB 4DPWA 2V2QA 4JI2I 2LJHA 4DV3I 5F3WA 2IOQA 5A2QQ 4JV5I 4IZKA 2V86A 5AE1A 4HACB 2Z5BA 2VQFE 1H74A 2PNLA 1H73A 2Q2EB 2UUCI 2F4VE 3LNUA 2V87A 4JI7I 4YHHI 1ZM3A 2KONA 4JI0E 1Z0TA 3PYDA 4DR5E 2UXCI 1I94E 3T1YE 3J80Q 1XNQI 1KTVA 3WU6A 4JI4I 1ELOA 1N0UA 4WFTA 2AJ4A 1STUA 2O1VA 1NHIA 3K17A 3ZZUA 4Z7YA 4DV0I 1N32E 4X64I 1YYKA 2LRSA 4BC9A 4JI6E 4NXMI 3VYYA 5IWAI 4L8NA 4B3RI 2LE2A 2L92A 1Z0EA 1WHNA 4KZSA 2LUPB 4LF5I 3QT7A 2FV4B 2EFGA 1SR9A 2VQEI 1ZM2A 2L3CA 1IBME 1IBKI 3OTOE 1YZ9A 1A6FA 4P52A 2MC5A 4B3TE 1HNZI 2NUFA 2V8PA 3Q6NA 4TUIA 4B3MI 2LTSA 4IZJA 2ODRD 2L2KB 1RR9A 4R1FA 2LBSB 3PYEA 3HTXA 1N36I 3FIGA 3T1HI 1UILA 2UU9I 4USMA 4UT4A 4X62I 1NHHA 3P1XA 1FWLA 3V5RA 3JAMC 2Z5CA 2HHHI 4L5NC 1KIJA 1IBLI 2CPNA 4YY3E 3MSWA 2A2CA 2BM1A 3PRYA 4BC7A 3QT5A 1X48A 1WUUA 4PRVA 4DV1I 1XMQI 1YYOA 4LF9E 4DR2E 4LF7I 4LF6E 3ZKDA 4IZKB 4F9AB 1U2RA 2Z5BB 4ZVIA 1H7UA 4DV5E 2EZ6A 2PNMA 2M4IA 4DV2I 4I8OA 5AASA 1N0VC 4M0VA 2V8QB 2DSYA 5FLXC 4JI8E 4DR1E 1Z0BA 4OX9I 4B3SE 1S4EA 2N3GA 1HNWI 4M30A 1B63A 2B3TB 1XMOI 5L3JA 3V2UC 1FJGE 2V88A 1Z0WA 4LF8E 3QT6A 4X65E 1T4NA 1J5EI 1T4OA 2UUBE 4NXNE 5T6JA 4UTGA 2DIXA 2IOPA 3ZKBA 4DPUA 4DV4I 3PYGA 1Y4UA 2L6MA 2F4VI 2O1TA 1MX0A 4DR6E 4MYUA 2CGEA 5BR8E 4MYTA 1ZXMA 4JI0I 2X36A 4DR5I 2XEXA 1I94I 3JAMQ 1N33E 1Z0CA 2L2MA 2DMYA 4LFCI 1UEKA 4IZJB 1Z0GA 2ZM6I 1MG7A 3F6GA 2KHXA 4DV7I 4BS9A 2NPFA 3ZM7A 1VISA 3B82A 2A2DA 2NA2A 2MC6A 2K4VA 2O1WA 1N32I 4GKKI 4GEQB 2EWLA 2IHR1 4BMJA 4DR3E 2Z5CB 1Z59A 5FLXQ 1H72C 4WSPA 2FTXB 4JV5E 2ZBKB 2Z5EA 5LMUI 3OTOI 2UUCE 2DB2A 3H4LA 4TUGA 2NUGA 4JI7E 1Z5CA 4YHHE 1RREA 2UXDE 4F54A 4BCAA 2R42A 4DUZI 4BBYA 1N34E 2X7IA 2L33A 1HR0E 3QT8A 1XNQE 4P7DA 1PIEA 2JOBA 1Z0VA 4USKA 2LUQA 3KWRA 1ZM9A 2RS7A 2E5LE 3LMLA 4LTYA 1O0WA 4K0KE 4HY1A 4DV0E 1EI1A 5GMDA 1GQEA 3C4TA 2BV3A 3J7AG 4X64E 4JI5E 2CG9A 4JYAI 3K1JA 5IWAE 5LMNE 3IWCA 3ADGA 4LF9I 4B3RE 1OJ4A 4LF6I 4DV6I 4DXLA 3PYFA 2LMZA 4DV5I 1RC7A 1HNXI 1S16A 3DF6A 4PU9A 1IBKE 1PVGA 2UUAE 4JI1E 1HNZE 5A2QC 3HPZA 4DR1I 4DR7E 4LFBI 3J81C 1EA6A 3B8HA 4HXZA 4XTJA 2JR1A 3T1HE 2UU9E 1KVKA 3ZZ0A 4GKJI 1FJGI 4AQYE 3VYXA 4X62E 2HK3A 3HQ1A 4LF8I 1QZRA 3DJWA 4IZJD 1BKNA 4P7AA 3HXLA 5ADZA 2HHHE 2MDRA 3J80C 1ZXNA 4KHPE 4NXNI 2UUBI 4R8OA 2ODRC 1K47A 2UXBE 1FKAE 1Y6ZA 2VE7C 4DU7A 4KQVA 1USUA 1XNRE 2OI2A 4DV1E 1XMQE 4DR6I 5BR8I 4DR4E 3ADJA 2VQFI 2O1UA 3J7AM 4X66E 2HKEA 3JTZA 2V2VA 2F8BA 1N33I 3HULA 1FWKA 2L2NA 2VF1A 2WW4A 3B78A 4LFAE 2LTRA 1H7SA 2LJPA 3ADIA 1KKHA 2JY9A 4OX9E 1GZ6A 4LF4E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Y I;  4FWD A;  4ED4 A;  4DUY E;  2E1R A;  4DR3 I;  4JI3 E;  1J5E E;  2HKJ A;  2V34 A;  4FW9 A;  3J81 Q;  3WU3 A;  3M6A A;  3C4B A;  2JVA A;  4JI2 E;  4PRX A;  4JI6 I;  4DV3 E;  4DV4 E;  5CFF E;  3D4J A;  1EKZ A;  2YT4 A;  4WUD A;  1FNM A;  3CWV A;  1X47 A;  2UXD I;  4JG4 A;  1IBM I;  2HK2 A;  1N34 I;  2J7K A;  1DAR A;  4B3T I;  2RS6 A;  3LLH A;  1HR0 I;  2HFU A;  4LFC E;  3ZZT A;  2V2Z A;  2ZM6 E;  2E5L I;  2L3J A;  4DV7 E;  4K0K I;  1T4L B;  2UXC E;  1RQ0 A;  2B7V A;  4DPX A;  4JI4 E;  4M2Z A;  4GKK E;  4JI5 I;  1FI4 A;  5LMN I;  1NZ0 A;  2NUE A;  5IT9 C;  3WU4 A;  4YY3 I;  1YYW A;  4HAC A;  4Z7C A;  2ZIT A;  4NXM E;  5LMU E;  2UUA I;  4JI1 I;  4DR2 I;  2R3V A;  1QU6 A;  1MU5 A;  2GS8 A;  4DR7 I;  4LF5 E;  4WYQ B;  1PKP A;  2N3H A;  4URL A;  2VQE E;  4DUZ E;  4OOG C;  4JI8 I;  4AQY I;  4B3M E;  4I3H A;  1Z5A A;  3WU5 A;  4B3S I;  2HFS A;  4M1K A;  3J7Y p;  4DPY A;  1N36 E;  4EMD A;  4HYM A;  4DPT A;  4KHP I;  3LTO A;  4FN5 A;  2UXB I;  5GME A;  2DEI A;  4X8W A;  4JYA E;  4FWH A;  4X65 I;  2B7T A;  1XNR I;  3LPS A;  2RSM A;  1ZM4 A;  4DV6 E;  4DR4 I;  1WHQ A;  1IBL E;  4FWG A;  1ZBT A;  4X66 I;  1HNX E;  3F0N A;  4DU8 A;  2DEJ A;  1XHK A;  2BM0 A;  1Z5B A;  4LF7 E;  3GON A;  4LFA I;  4WUC A;  1J26 A;  1UHZ A;  1NHJ A;  2CZ9 A;  4LFB E;  4WUB A;  5LL6 R;  1B62 A;  4LF4 I;  5IT9 Q;  4DV2 E;  1X49 A;  4DKK A;  3ADL A;  4RPF A;  1D6T A;  4GKJ E;  4DUY I;  2VF3 A;  4JI3 I;  1HNW E;  3Q1Q A;  1XMO E;  1DI2 A;  2RTX A;  4DPW A;  2V2Q A;  4JI2 I;  2LJH A;  4DV3 I;  5A2Q Q;  4JV5 I;  4HAC B;  2VQF E;  1H74 A;  1H73 A;  2Q2E B;  2UUC I;  2F4V E;  3LNU A;  4JI7 I;  4YHH I;  1ZM3 A;  4JI0 E;  1Z0T A;  3PYD A;  4DR5 E;  2UXC I;  1I94 E;  3T1Y E;  3J80 Q;  1XNQ I;  1KTV A;  3WU6 A;  4JI4 I;  1ELO A;  1N0U A;  4WFT A;  2AJ4 A;  1STU A;  1NHI A;  3K17 A;  3ZZU A;  4Z7Y A;  4DV0 I;  1N32 E;  4X64 I;  1YYK A;  2LRS A;  4JI6 E;  4NXM I;  3VYY A;  5IWA I;  4B3R I;  1Z0E A;  1WHN A;  2LUP B;  4LF5 I;  3QT7 A;  2EFG A;  2VQE I;  1ZM2 A;  2L3C A;  1IBM E;  1IBK I;  3OTO E;  1YZ9 A;  1A6F A;  4P52 A;  4B3T E;  1HNZ I;  2NUF A;  2V8P A;  4B3M I;  2LTS A;  2L2K B;  1RR9 A;  4R1F A;  2LBS B;  3PYE A;  3HTX A;  1N36 I;  3T1H I;  1UIL A;  2UU9 I;  4USM A;  4UT4 A;  4X62 I;  1NHH A;  3P1X A;  1FWL A;  3V5R A;  3JAM C;  2HHH I;  1KIJ A;  1IBL I;  2CPN A;  4YY3 E;  2A2C A;  2BM1 A;  3QT5 A;  1X48 A;  1WUU A;  4PRV A;  4DV1 I;  1XMQ I;  1YYO A;  4LF9 E;  4DR2 E;  4LF7 I;  4LF6 E;  3ZKD A;  1U2R A;  4ZVI A;  1H7U A;  4DV5 E;  2EZ6 A;  4DV2 I;  1N0V C;  5FLX C;  4JI8 E;  4DR1 E;  1Z0B A;  4OX9 I;  4B3S E;  1S4E A;  2N3G A;  1HNW I;  4M30 A;  1B63 A;  2B3T B;  1XMO I;  5L3J A;  3V2U C;  1FJG E;  1Z0W A;  4LF8 E;  3QT6 A;  4X65 E;  1T4N A;  1J5E I;  1T4O A;  2UUB E;  4NXN E;  4UTG A;  2DIX A;  3ZKB A;  4DPU A;  4DV4 I;  3PYG A;  2F4V I;  1MX0 A;  4DR6 E;  4MYU A;  5BR8 E;  4MYT A;  1ZXM A;  4JI0 I;  2X36 A;  4DR5 I;  2XEX A;  1I94 I;  3JAM Q;  1N33 E;  1Z0C A;  2L2M A;  2DMY A;  4LFC I;  1UEK A;  1Z0G A;  2ZM6 I;  1MG7 A;  2KHX A;  4DV7 I;  2NPF A;  3ZM7 A;  1VIS A;  3B82 A;  2A2D A;  2NA2 A;  1N32 I;  4GKK I;  2IHR 1;  4DR3 E;  1Z59 A;  5FLX Q;  1H72 C;  4JV5 E;  2ZBK B;  5LMU I;  3OTO I;  2UUC E;  2DB2 A;  3H4L A;  2NUG A;  4JI7 E;  1Z5C A;  4YHH E;  1RRE A;  2UXD E;  2R42 A;  4DUZ I;  1N34 E;  2X7I A;  2L33 A;  1HR0 E;  3QT8 A;  1XNQ E;  1PIE A;  1Z0V A;  4USK A;  2LUQ A;  1ZM9 A;  2RS7 A;  2E5L E;  1O0W A;  4K0K E;  4HY1 A;  4DV0 E;  1EI1 A;  5GMD A;  1GQE A;  3C4T A;  2BV3 A;  3J7A G;  4X64 E;  4JI5 E;  4JYA I;  3K1J A;  5IWA E;  5LMN E;  3ADG A;  4LF9 I;  4B3R E;  1OJ4 A;  4LF6 I;  4DV6 I;  4DXL A;  3PYF A;  4DV5 I;  1RC7 A;  1HNX I;  1S16 A;  4PU9 A;  1IBK E;  1PVG A;  2UUA E;  4JI1 E;  1HNZ E;  5A2Q C;  4DR1 I;  4DR7 E;  4LFB I;  3J81 C;  1EA6 A;  3B8H A;  4HXZ A;  4XTJ A;  3T1H E;  2UU9 E;  1KVK A;  3ZZ0 A;  4GKJ I;  1FJG I;  4AQY E;  3VYX A;  4X62 E;  2HK3 A;  4LF8 I;  1QZR A;  1BKN A;  4P7A A;  2HHH E;  1ZXN A;  2MDR A;  4NXN I;  3J80 C;  4KHP E;  2UUB I;  1K47 A;  2UXB E;  1FKA E;  4DU7 A;  4KQV A;  1XNR E;  2OI2 A;  4DV1 E;  1XMQ E;  4DR6 I;  5BR8 I;  4DR4 E;  3ADJ A;  2VQF I;  3J7A M;  4X66 E;  2HKE A;  2V2V A;  1N33 I;  3HUL A;  1FWK A;  2L2N A;  2WW4 A;  3B78 A;  4LFA E;  2LTR A;  1H7S A;  2LJP A;  3ADI A;  1KKH A;  2JY9 A;  4OX9 E;  4LF4 E; 
#chains in the Genus database with same CATH topology
 3P3G A;  3T1Y I;  3IWB A;  2EPK X;  3PS1 A;  2YSP A;  2YTN A;  4FWD A;  2JT2 A;  2IES A;  4LPF A;  3JU0 A;  2V89 A;  1NCS A;  4DUY E;  4NHR A;  4ED4 A;  3ECR A;  1YH8 A;  2E1R A;  4FW5 A;  1QNT A;  3HKM A;  4DR3 I;  2YTQ A;  3EPJ A;  1TN9 A;  4JI3 E;  2H36 X;  5KL3 A;  1J5E E;  3GCM A;  4NBQ A;  3IWD A;  2HKJ A;  2V34 A;  2EMI A;  3MHS C;  1G2F C;  3EQ1 A;  4FW9 A;  2FGG A;  3M6A A;  4WPY A;  3M99 B;  3WU3 A;  3C4B A;  2JVA A;  4JI2 E;  4PRX A;  4JI6 I;  4DV3 E;  2LO3 A;  4DV4 E;  4HEI A;  2PO1 B;  5CFF E;  3D4J A;  1EKZ A;  2JPA A;  2YT4 A;  2JE6 B;  4WUD A;  1FNM A;  1USV A;  2WZO A;  3CWV A;  2EN1 A;  4BA1 A;  4WSG A;  2C39 A;  1X47 A;  2UXD I;  3PS3 A;  1RMD A;  4Q28 A;  3ZOQ B;  4JG4 A;  1IBM I;  2R76 A;  3AV0 A;  4P78 A;  2AE8 A;  2HK2 A;  4ZYH A;  1DAR A;  2J7K A;  1N34 I;  3OML A;  2RS6 A;  3LLH A;  1HR0 I;  4B3T I;  1XMQ I;  2I9I A;  5K36 F;  2HFU A;  5EKW A;  4LFC E;  2NN6 C;  4IFD E;  2EOR A;  1UDN A;  4J8Z A;  3ZZT A;  2V2Z A;  2YTO A;  4LU9 A;  2ZM6 E;  2E5L I;  2L3J A;  4DV7 E;  1YHC A;  2NN6 B;  4K0K I;  5KL2 A;  1T4L B;  1DQ3 A;  3F6H A;  2UXC E;  2PNZ B;  1WXR A;  5DNY A;  1RQ0 A;  2B7V A;  4DPX A;  1X6F A;  1L4S A;  3RMP A;  4JI4 E;  4M2Z A;  4GKK E;  4JI5 I;  4X9J A;  4R2P A;  5C0X D;  3NZK A;  1FI4 A;  5LMN I;  2M7Q A;  1NZ0 A;  2RQL A;  3EPK A;  2NUE A;  5IT9 C;  2JOX A;  2V85 A;  2YTE A;  3WU4 A;  4YY3 I;  2YU5 A;  2EMC A;  4F9C B;  1YYW A;  2PO0 B;  5AE2 A;  4R03 A;  4HAC A;  4Z7C A;  2EOY A;  2ZIT A;  3UHM A;  2EM2 A;  4ISA A;  2LJU A;  5LMU E;  4NXM E;  1P42 A;  5A6J A;  1EH8 A;  2UUA I;  4JI1 I;  4DR2 I;  2V83 A;  2PO1 A;  2R3V A;  3K85 A;  1G2D C;  2JE6 A;  2ENC A;  1QU6 A;  1MU5 A;  2GS8 A;  3J81 Q;  4DR7 I;  5LLQ A;  4LF5 E;  4WYQ B;  1PKP A;  2N3H A;  4URL A;  2YZT A;  4DV1 I;  2VQE E;  1UBD C;  4LF7 I;  2HC5 A;  4DR4 I;  4IFD D;  2EPO A;  3HJC A;  4DUZ E;  4O5G A;  1A1H A;  4OOG C;  2R1F A;  4JI8 I;  3GLL A;  4AQY I;  3AUZ A;  4B3M E;  2YU8 A;  2RSI A;  1Z5A A;  4I3H A;  3WU5 A;  4B3S I;  2HFS A;  4RHB B;  5AC5 A;  4M1K A;  5KL4 A;  2NN6 A;  3J7Y p;  4DPY A;  4DMI A;  1N36 E;  4EMD A;  4HYM A;  1X3C A;  3C6M A;  2G7H A;  1A1I A;  4DPT A;  4KHP I;  3LTO A;  4FN5 A;  2CTD A;  3HPS A;  1Y4S A;  2UXB I;  1JK1 A;  2L8T A;  5GME A;  2DEI A;  4X8W A;  2EMK A;  3K6Q A;  4JYA E;  2DMI A;  4FWH A;  3VK6 A;  2EPZ A;  4X65 I;  2B7T A;  1XNR I;  1KJK A;  3P06 A;  2NN6 E;  3LPS A;  1ZBQ A;  2RSM A;  1ZM4 A;  1YUJ A;  4DV6 E;  2GQ0 A;  4MU3 A;  4FW4 A;  1WHQ A;  1IBL E;  1ZBT A;  4F2J C;  1MEY C;  4FWG A;  4FK5 C;  2E1M A;  2D9H A;  5A6K A;  2JEB A;  4X66 I;  1HNX E;  2ENH A;  5C0X E;  3F0N A;  4DU8 A;  2DEJ A;  4IS1 C;  1P47 A;  1XHK A;  4LOM A;  2BM0 A;  1Z5B A;  4LF7 E;  3Q6M A;  3GON A;  4N3O A;  4WUC A;  3H09 A;  4LFA I;  1J26 A;  4WXD A;  4BA1 B;  2C39 B;  1UHZ A;  1NHJ A;  1EH7 A;  2CZ9 A;  4LFB E;  2EPA A;  5LL6 R;  4WUB A;  1B62 A;  4GQU A;  4LF4 I;  5KL5 A;  2JWO A;  5IT9 Q;  4DV2 E;  1X49 A;  4NZV A;  5AE3 A;  2LT7 A;  4DKK A;  3ADL A;  2KOU A;  3QG5 C;  1WRJ A;  4RPF A;  4MQY A;  1D6T A;  1KYQ A;  3C6K A;  4GKJ E;  5JEA A;  4DUY I;  2EQ1 A;  2GLI A;  2VF3 A;  5KL6 A;  4ZYG A;  1ZU1 A;  2VES A;  1Y5Y A;  2B9D A;  2WBT A;  1IMU A;  5FWK A;  1HK7 A;  2EL6 A;  1OYR A;  1HNW E;  4JI3 I;  2M1S A;  1DGC A;  4QNK A;  1XMO E;  3Q1Q A;  2CT1 A;  1DI2 A;  2EOO A;  2RTX A;  4F9B B;  5A6B A;  4DPW A;  2V2Q A;  2EMY A;  4JI2 I;  3U1Y A;  2LJH A;  4DV3 I;  5F3W A;  2IER A;  2YPN A;  1BBO A;  2IOQ A;  3L7Z A;  1WJP A;  2EJ4 A;  2EN3 A;  5A2Q Q;  1NEI A;  3KZZ A;  4JV5 I;  4IZK A;  2V86 A;  5AE1 A;  4HAC B;  1PJQ A;  2Z5B A;  1E3H A;  2VQF E;  4R2A A;  1H74 A;  2PNL A;  1H73 A;  2BA0 G;  4R2S A;  2Q2E B;  2UUC I;  2F4V E;  3LNU A;  2V87 A;  1UDS A;  4JI7 I;  2PO2 A;  1BB8 A;  4YHH I;  1ZM3 A;  2KON A;  4JI0 E;  1Z0T A;  3PYD A;  1RHY A;  4DR5 E;  2UXC I;  2EM8 A;  1I94 E;  4MU4 A;  3T1Y E;  3BGH A;  3J80 Q;  1XNQ I;  2DLK A;  1KTV A;  2BA0 D;  3WU6 A;  1ELO A;  4JI4 I;  4RH8 A;  1N0U A;  4WFT A;  3BF2 A;  2AJ4 A;  4OO1 C;  1STU A;  1YSA C;  4IJD A;  2O1V A;  1NHI A;  3K17 A;  3VHT B;  4Z7Y A;  3ZZU A;  4DV0 I;  5A6A A;  1N32 E;  2EPL X;  4X64 I;  1VI7 A;  2EOZ A;  2LRS A;  4BC9 A;  2YRH A;  4JI6 E;  1YYK A;  2O3Z A;  3VYY A;  3B4T A;  4MU1 A;  4ZYE A;  5IWA I;  4NXM I;  2HGH A;  4L8N A;  2C37 A;  4B3R I;  3THO B;  2LE2 A;  2EN7 A;  2NN6 F;  2L92 A;  1Z0E A;  1WHN A;  4KZS A;  2LUP B;  3THN A;  4LF5 I;  3QT7 A;  2EOJ A;  2FV4 B;  2EFG A;  1SR9 A;  2JEB B;  1ZM2 A;  2VQE I;  2L3C A;  1OYS A;  1IBM E;  1YUI A;  1IBK I;  3OTO E;  1YZ9 A;  1A6F A;  4P52 A;  2MC5 A;  4B3T E;  1HNZ I;  4Q35 B;  2NUF A;  2V8P A;  3Q6N A;  4TUI A;  4B3M I;  4N4R B;  2LTS A;  4FW7 A;  4IZJ A;  4F6M A;  2ODR D;  5IV8 B;  2L2K B;  1RR9 A;  4R1F A;  1AAY A;  2LBS B;  3PYE A;  4AIM A;  2ELY A;  3HTX A;  1N36 I;  3FIG A;  5JEA C;  2NAB A;  3T1H I;  1UIL A;  2EOX A;  2WNR A;  4USM A;  4UT4 A;  2UU9 I;  2F1D A;  4X62 I;  5JEA B;  1NHH A;  4LCF A;  2ENA A;  2M9A A;  3P1X A;  1JK2 A;  5K36 A;  2EOQ A;  1FWL A;  3V5R A;  2UUB I;  3JAM C;  2Z5C A;  4OZE A;  2HHH I;  4L5N C;  4OO1 A;  1KIJ A;  1IBL I;  2CPN A;  4YY3 E;  3MSW A;  2A2C A;  2BM1 A;  3PRY A;  2LCE A;  3MHH C;  5A69 A;  4BC7 A;  3QT5 A;  1X48 A;  5JEA F;  1PJS A;  2WP8 A;  1WUU A;  3L7Z B;  2N8X A;  1Y60 A;  4MDT A;  1YYO A;  4LF9 E;  4DR2 E;  4PRV A;  2EOH A;  2HJJ A;  4LF6 E;  4M9V C;  3ZKD A;  1R6L A;  4R2E A;  4IZK B;  4F9A B;  1U2R A;  2WBU A;  2Z5B B;  4ZVI A;  1H7U A;  4DV5 E;  2EZ6 A;  1OYP A;  2PNM A;  4U3D A;  2EM9 A;  2EMB A;  2M4I A;  4DV2 I;  1SFE A;  4I8O A;  5AAS A;  1N0V C;  2GHF A;  4M0V A;  2V8Q B;  3EPH A;  2DSY A;  5FLX C;  3P3C A;  4JI8 E;  2PO2 B;  4DR1 E;  1Z0B A;  2EMG A;  5EL9 A;  4OX9 I;  1A1L A;  4FW3 A;  2JYA A;  4B3S E;  1R6M A;  1S4E A;  1A1K A;  2N3G A;  4FW6 A;  1HNW I;  3EPL A;  4M30 A;  1B63 A;  2B3T B;  1XMO I;  2YTF A;  3BBG A;  2DGC A;  5L3J A;  2EMX A;  3GME A;  2EM5 A;  2EM7 A;  1AH5 A;  3V2U C;  2YSO A;  1FJG E;  2V88 A;  4IFD C;  1Z0W A;  1MGT A;  1B69 A;  4LF8 E;  3QT6 A;  4X65 E;  2GO4 A;  2EMA A;  2EOE A;  1T4N A;  3CDJ A;  4QNJ A;  1J5E I;  1F2I G;  1T4O A;  2UUB E;  4NXN E;  5T6J A;  2EL5 A;  2EQ3 A;  2I13 A;  2NN6 D;  2CVE A;  3CDI A;  2DIX A;  2IOP A;  4UTG A;  3ZKB A;  1A1J A;  4DPU A;  4DV4 I;  3PYG A;  2C37 B;  5JEA E;  1Y4U A;  1GTK A;  2L6M A;  2F4V I;  2EM4 A;  4HTG A;  4KWY A;  2EPX A;  2O1T A;  4MU0 A;  2Q8U A;  4R2R A;  1MX0 A;  2PRT A;  4DR6 E;  4MYU A;  2CGE A;  5BR8 E;  1X6H A;  4MYT A;  1TF6 A;  2EE8 A;  1ZXM A;  2BR2 A;  4JI0 I;  1A1F A;  1PJT A;  2X36 A;  4DR5 I;  2XEX A;  1I94 I;  1UDQ A;  3JAM Q;  1N33 E;  2EMW A;  2L2M A;  1Z0C A;  5C0X A;  2DMY A;  2EM0 A;  2EN8 A;  2EL4 A;  2YTD A;  2YTG A;  5DRR A;  4LFC I;  1UEK A;  3P76 A;  4R2D A;  4IZJ B;  1Z0G A;  2ZM6 I;  1MG7 A;  3F6G A;  2KHX A;  2YTI A;  4DV7 I;  2EPU A;  4BS9 A;  2NPF A;  3ZM7 A;  1VIS A;  2C38 A;  2A2D A;  3B82 A;  3PS2 A;  1EH6 A;  2EMH A;  2EN6 A;  2NA2 A;  2MC6 A;  2VRD A;  2WNR B;  2K4V A;  2O1W A;  1N32 I;  5K36 C;  1XXE A;  2EPP A;  2DRP A;  4GKK I;  4GEQ B;  2YRM A;  5DRP A;  3P3E A;  4J3D A;  2EWL A;  2IHR 1;  5K36 B;  2EP3 A;  4BMJ A;  2EMZ A;  4DR3 E;  2Z5C B;  2JEA A;  1Z59 A;  1N3G A;  4BA2 A;  5FLX Q;  5JEA D;  4IFD A;  4OO1 B;  2ADR A;  1H72 C;  4WSP A;  2FTX B;  4JV5 E;  5IXM B;  2ZBK B;  2EM3 A;  2Z5E A;  3DD6 A;  5LMU I;  2WCC 3;  3OTO I;  1A1G A;  3TQM A;  2WP8 B;  4O24 A;  5A6B D;  4AID A;  2UUC E;  2EOF A;  2DB2 A;  3H4L A;  2DLQ A;  4IS9 A;  4TUG A;  2JXP A;  2NUG A;  4JI7 E;  4OO1 F;  1Z5C A;  4YHH E;  2YTP A;  1RRE A;  5KL7 A;  4MLV A;  2UXD E;  4F54 A;  4BCA A;  1E3P A;  2R42 A;  4BBY A;  4GZN C;  4DUZ I;  1N34 E;  2YTJ A;  2X7I A;  2L33 A;  1HR0 E;  3QT8 A;  1X5W A;  2EMF A;  2JP9 A;  1XNQ E;  4P7D A;  1PIE A;  2JOB A;  1Z0V A;  4USK A;  2LUQ A;  4O43 A;  3KWR A;  1ZM9 A;  2RS7 A;  1YFH A;  2E72 A;  1PDA A;  4LCG A;  2E5L E;  3LML A;  4LTY A;  1O0W A;  2GO3 A;  4K0K E;  2EPN A;  4HY1 A;  2EN4 A;  4BHC A;  2BBG A;  3L00 A;  4DV0 E;  1EI1 A;  5GMD A;  1X6E A;  1GQE A;  3C4T A;  2BV3 A;  3J7A G;  4X64 E;  4JI5 E;  2CG9 A;  4JYA I;  1IQO A;  3K1J A;  5IWA E;  5LMN E;  3IWC A;  2MKN A;  3ADG A;  4LF9 I;  1T38 A;  4B3R E;  1OJ4 A;  4LF6 I;  4DV6 I;  1ZAA C;  4DXL A;  3PYF A;  2LMZ A;  1IQS A;  4DV5 I;  3UK3 C;  1RC7 A;  1HNX I;  1S16 A;  2EQ0 A;  5TSE A;  3DF6 A;  4PU9 A;  1IBK E;  3H1C A;  1YPN A;  1PVG A;  2UUA E;  4JI1 E;  4U3B A;  5K36 E;  4LCH A;  1HNZ E;  2A25 A;  5A2Q C;  3M85 G;  3HPZ A;  2J65 A;  4DR1 I;  2EPR A;  4DR7 E;  3M7N G;  4OO1 E;  4LFB I;  3J81 C;  2BR2 B;  4R2Q A;  4WX9 A;  5C0X C;  1EA6 A;  3B8H A;  3KZY A;  2ELZ A;  4HXZ A;  2GPI A;  2PNZ A;  4XTJ A;  5C0X B;  2JR1 A;  3T1H E;  2YRK A;  2UU9 E;  1KVK A;  3ZZ0 A;  2EPM X;  4GKJ I;  1FJG I;  4AM3 A;  4AQY E;  5DRO A;  3VYX A;  4X62 E;  5DRQ A;  2HK3 A;  2EML A;  2K7I A;  4OKG A;  3HQ1 A;  4ZYD A;  4LF8 I;  3M85 D;  3M7N D;  2C38 B;  4O4K A;  1Z1B A;  3DJW A;  1QZR A;  3KRN A;  4IZJ D;  1BKN A;  5DNX A;  4P7A A;  3HXL A;  5ADZ A;  4BHB A;  2MDR A;  3J80 C;  2HHH E;  4KHP E;  1ZXN A;  4NXN I;  4R8O A;  2ODR C;  2PO0 A;  2J7J A;  1K47 A;  5C0X F;  2UXB E;  1FKA E;  1ZR9 A;  4WXC A;  2CSH A;  1Y6Z A;  2VE7 C;  4DU7 A;  4R2C A;  2EPC A;  4KQV A;  1USU A;  2JEA B;  2LV2 A;  2WBS A;  4BA2 B;  1XNR E;  2BA1 G;  2OI2 A;  4DV1 E;  1XMQ E;  4DR6 I;  4IFD B;  2MDG A;  1TF3 A;  5BR8 I;  4DR4 E;  3BID A;  2EOS A;  3ADJ A;  5K36 D;  1LLM C;  5AC4 A;  2EN2 A;  2O1U A;  2VQF I;  3J7A M;  4X66 E;  1UDO A;  3JTZ A;  2HKE A;  2V2V A;  5ELW A;  4OO1 D;  2BB8 A;  2F8B A;  4MLQ A;  2RPC A;  1FWK A;  3HUL A;  1N33 I;  2YWQ A;  2L2N A;  1BBG A;  2LVH A;  2VF1 A;  2WW4 A;  3B78 A;  4LFA E;  2EOM A;  3U1K A;  1T39 A;  4F6N A;  2LTR A;  1UN6 B;  1H7S A;  5DNL A;  2LJP A;  4IFD F;  3ADI A;  2BA1 D;  2MKD A;  2EOI A;  1KKH A;  2JY9 A;  4OX9 E;  1GZ6 A;  2EM6 A;  4LF4 E; 
#chains in the Genus database with same CATH homology
 3T1Y I;  3IWB A;  4FWD A;  3JU0 A;  2V89 A;  4ED4 A;  4DUY E;  2E1R A;  4DR3 I;  4JI3 E;  2H36 X;  1J5E E;  3IWD A;  2HKJ A;  2V34 A;  4FW9 A;  3J81 Q;  3WU3 A;  2FGG A;  3M6A A;  4WPY A;  3C4B A;  2JVA A;  4JI2 E;  4PRX A;  4JI6 I;  4DV3 E;  4DV4 E;  5CFF E;  3D4J A;  1EKZ A;  2YT4 A;  4WUD A;  1FNM A;  1USV A;  2WZO A;  3CWV A;  1X47 A;  2UXD I;  4Q28 A;  3ZOQ B;  4JG4 A;  1IBM I;  3AV0 A;  2HK2 A;  4P78 A;  1N34 I;  2J7K A;  1DAR A;  4B3T I;  3OML A;  2RS6 A;  3LLH A;  1HR0 I;  2HFU A;  4LFC E;  4J8Z A;  3ZZT A;  2V2Z A;  2ZM6 E;  4LU9 A;  2E5L I;  2L3J A;  4DV7 E;  4K0K I;  1T4L B;  1DQ3 A;  3F6H A;  2UXC E;  1WXR A;  5DNY A;  1RQ0 A;  2B7V A;  4DPX A;  3RMP A;  4JI4 E;  4M2Z A;  4GKK E;  4JI5 I;  1FI4 A;  5LMN I;  2M7Q A;  1NZ0 A;  2NUE A;  5IT9 C;  2JOX A;  2V85 A;  3WU4 A;  4YY3 I;  4F9C B;  1YYW A;  5AE2 A;  4R03 A;  4HAC A;  4Z7C A;  2ZIT A;  4NXM E;  5LMU E;  2UUA I;  4JI1 I;  4DR2 I;  2V83 A;  2R3V A;  3K85 A;  1QU6 A;  1MU5 A;  2GS8 A;  4DR7 I;  4LF5 E;  4WYQ B;  1PKP A;  2N3H A;  4URL A;  2YZT A;  2VQE E;  3HJC A;  4DUZ E;  4OOG C;  4JI8 I;  4AQY I;  3AUZ A;  4B3M E;  4I3H A;  1Z5A A;  3WU5 A;  4B3S I;  2HFS A;  4M1K A;  3J7Y p;  4DPY A;  4DMI A;  1N36 E;  4EMD A;  4HYM A;  2G7H A;  4DPT A;  4KHP I;  3LTO A;  4FN5 A;  3HPS A;  1Y4S A;  2UXB I;  2L8T A;  5GME A;  2DEI A;  4X8W A;  3K6Q A;  4JYA E;  4FWH A;  4X65 I;  3VK6 A;  2B7T A;  1XNR I;  3P06 A;  3LPS A;  1ZBQ A;  2RSM A;  1ZM4 A;  2GQ0 A;  4DV6 E;  4DR4 I;  1WHQ A;  1IBL E;  1ZBT A;  4FWG A;  2E1M A;  4X66 I;  1HNX E;  3F0N A;  4DU8 A;  2DEJ A;  1XHK A;  2BM0 A;  1Z5B A;  4LF7 E;  3Q6M A;  3GON A;  4N3O A;  4WUC A;  3H09 A;  4LFA I;  1J26 A;  1UHZ A;  1NHJ A;  2CZ9 A;  4LFB E;  5LL6 R;  4WUB A;  1B62 A;  4LF4 I;  2JWO A;  5IT9 Q;  4DV2 E;  1X49 A;  5AE3 A;  4DKK A;  3ADL A;  2KOU A;  4RPF A;  1D6T A;  4GKJ E;  4DUY I;  2VF3 A;  2B9D A;  5FWK A;  1HK7 A;  4JI3 I;  1HNW E;  2M1S A;  3Q1Q A;  1XMO E;  1DI2 A;  2RTX A;  4F9B B;  4DPW A;  2V2Q A;  4JI2 I;  2LJH A;  4DV3 I;  5F3W A;  2IOQ A;  5A2Q Q;  4JV5 I;  4IZK A;  2V86 A;  5AE1 A;  4HAC B;  2Z5B A;  2VQF E;  1H74 A;  2PNL A;  1H73 A;  2Q2E B;  2UUC I;  2F4V E;  3LNU A;  2V87 A;  4JI7 I;  4YHH I;  1ZM3 A;  2KON A;  4JI0 E;  1Z0T A;  3PYD A;  4DR5 E;  2UXC I;  1I94 E;  3T1Y E;  3J80 Q;  1XNQ I;  1KTV A;  3WU6 A;  4JI4 I;  1ELO A;  1N0U A;  4WFT A;  2AJ4 A;  1STU A;  2O1V A;  1NHI A;  3K17 A;  3ZZU A;  4Z7Y A;  4DV0 I;  1N32 E;  4X64 I;  1YYK A;  2LRS A;  4BC9 A;  4JI6 E;  4NXM I;  3VYY A;  5IWA I;  4L8N A;  4B3R I;  2LE2 A;  2L92 A;  1Z0E A;  1WHN A;  4KZS A;  2LUP B;  4LF5 I;  3QT7 A;  2FV4 B;  2EFG A;  1SR9 A;  2VQE I;  1ZM2 A;  2L3C A;  1IBM E;  1IBK I;  3OTO E;  1YZ9 A;  1A6F A;  4P52 A;  2MC5 A;  4B3T E;  1HNZ I;  2NUF A;  2V8P A;  3Q6N A;  4TUI A;  4B3M I;  2LTS A;  4IZJ A;  2ODR D;  2L2K B;  1RR9 A;  4R1F A;  2LBS B;  3PYE A;  3HTX A;  1N36 I;  3FIG A;  3T1H I;  1UIL A;  2UU9 I;  4USM A;  4UT4 A;  4X62 I;  1NHH A;  3P1X A;  1FWL A;  3V5R A;  3JAM C;  2Z5C A;  2HHH I;  4L5N C;  1KIJ A;  1IBL I;  2CPN A;  4YY3 E;  3MSW A;  2A2C A;  2BM1 A;  3PRY A;  4BC7 A;  3QT5 A;  1X48 A;  1WUU A;  4PRV A;  4DV1 I;  1XMQ I;  1YYO A;  4LF9 E;  4DR2 E;  4LF7 I;  4LF6 E;  3ZKD A;  4IZK B;  4F9A B;  1U2R A;  2Z5B B;  4ZVI A;  1H7U A;  4DV5 E;  2EZ6 A;  2PNM A;  2M4I A;  4DV2 I;  4I8O A;  5AAS A;  1N0V C;  4M0V A;  2V8Q B;  2DSY A;  5FLX C;  4JI8 E;  4DR1 E;  1Z0B A;  4OX9 I;  4B3S E;  1S4E A;  2N3G A;  1HNW I;  4M30 A;  1B63 A;  2B3T B;  1XMO I;  5L3J A;  3V2U C;  1FJG E;  2V88 A;  1Z0W A;  4LF8 E;  3QT6 A;  4X65 E;  1T4N A;  1J5E I;  1T4O A;  2UUB E;  4NXN E;  5T6J A;  4UTG A;  2DIX A;  2IOP A;  3ZKB A;  4DPU A;  4DV4 I;  3PYG A;  1Y4U A;  2L6M A;  2F4V I;  2O1T A;  1MX0 A;  4DR6 E;  4MYU A;  2CGE A;  5BR8 E;  4MYT A;  1ZXM A;  4JI0 I;  2X36 A;  4DR5 I;  2XEX A;  1I94 I;  3JAM Q;  1N33 E;  1Z0C A;  2L2M A;  2DMY A;  4LFC I;  1UEK A;  4IZJ B;  1Z0G A;  2ZM6 I;  1MG7 A;  3F6G A;  2KHX A;  4DV7 I;  4BS9 A;  2NPF A;  3ZM7 A;  1VIS A;  3B82 A;  2A2D A;  2NA2 A;  2MC6 A;  2K4V A;  2O1W A;  1N32 I;  4GKK I;  4GEQ B;  2EWL A;  2IHR 1;  4BMJ A;  4DR3 E;  2Z5C B;  1Z59 A;  5FLX Q;  1H72 C;  4WSP A;  2FTX B;  4JV5 E;  2ZBK B;  2Z5E A;  5LMU I;  3OTO I;  2UUC E;  2DB2 A;  3H4L A;  4TUG A;  2NUG A;  4JI7 E;  1Z5C A;  4YHH E;  1RRE A;  2UXD E;  4F54 A;  4BCA A;  2R42 A;  4DUZ I;  4BBY A;  1N34 E;  2X7I A;  2L33 A;  1HR0 E;  3QT8 A;  1XNQ E;  4P7D A;  1PIE A;  2JOB A;  1Z0V A;  4USK A;  2LUQ A;  3KWR A;  1ZM9 A;  2RS7 A;  2E5L E;  3LML A;  4LTY A;  1O0W A;  4K0K E;  4HY1 A;  4DV0 E;  1EI1 A;  5GMD A;  1GQE A;  3C4T A;  2BV3 A;  3J7A G;  4X64 E;  4JI5 E;  2CG9 A;  4JYA I;  3K1J A;  5IWA E;  5LMN E;  3IWC A;  3ADG A;  4LF9 I;  4B3R E;  1OJ4 A;  4LF6 I;  4DV6 I;  4DXL A;  3PYF A;  2LMZ A;  4DV5 I;  1RC7 A;  1HNX I;  1S16 A;  3DF6 A;  4PU9 A;  1IBK E;  1PVG A;  2UUA E;  4JI1 E;  1HNZ E;  5A2Q C;  3HPZ A;  4DR1 I;  4DR7 E;  4LFB I;  3J81 C;  1EA6 A;  3B8H A;  4HXZ A;  4XTJ A;  2JR1 A;  3T1H E;  2UU9 E;  1KVK A;  3ZZ0 A;  4GKJ I;  1FJG I;  4AQY E;  3VYX A;  4X62 E;  2HK3 A;  3HQ1 A;  4LF8 I;  1QZR A;  3DJW A;  4IZJ D;  1BKN A;  4P7A A;  3HXL A;  5ADZ A;  2HHH E;  2MDR A;  3J80 C;  1ZXN A;  4KHP E;  4NXN I;  2UUB I;  4R8O A;  2ODR C;  1K47 A;  2UXB E;  1FKA E;  1Y6Z A;  2VE7 C;  4DU7 A;  4KQV A;  1USU A;  1XNR E;  2OI2 A;  4DV1 E;  1XMQ E;  4DR6 I;  5BR8 I;  4DR4 E;  3ADJ A;  2VQF I;  2O1U A;  3J7A M;  4X66 E;  2HKE A;  3JTZ A;  2V2V A;  2F8B A;  1N33 I;  3HUL A;  1FWK A;  2L2N A;  2VF1 A;  2WW4 A;  3B78 A;  4LFA E;  2LTR A;  1H7S A;  2LJP A;  3ADI A;  1KKH A;  2JY9 A;  4OX9 E;  1GZ6 A;  4LF4 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...