5IWAE

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
157
structure length
157
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKGEAHAQAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S2
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
total genus 36
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5iwaE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5iwaE02
2DB2A 4EMDA 4LF5E 1B63A 4DV6I 4X8WA 1MX0A 3T1YE 1STUA 5LMUE 2DEIA 2IHR1 4JI7I 1QZRA 2UXCE 2LUPB 4YHHE 2UUAE 4JI5E 4M1KA 1IBMI 3B78A 3M6AA 5LL6R 5GMDA 3PYGA 2B7TA 2V2ZA 1XMOE 3QT5A 4DR7I 4LF7E 4I3HA 2VF3A 2J7KA 4X66I 3QT8A 1H7SA 1XNQI 4B3TE 1X48A 5CFFE 2LBSB 4YY3I 1S4EA 4X62I 1FNMA 4HYMA 2N3GA 1PVGA 2BV3A 4LF4E 4JV5I 1Z5CA 4DR4I 3J7AM 1WHQA 4KHPI 1Z5AA 3PYFA 2NUEA 1J26A 2R42A 2UXBE 2VQFI 2ZM6I 3QT7A 3J81Q 1ZM2A 4XTJA 3LPSA 4DV4I 4DV7I 4GKJI 4FWHA 4DV3E 1N34I 4LFCE 4JI3I 4GKKI 4LF9I 4B3RI 1HNWE 4UT4A 1IBLI 1YYWA 4JYAI 2ZITA 4DR3I 1H7UA 3LLHA 4X64E 1HNXE 4JI0E 3OTOE 4DU8A 4USMA 1KVKA 2UUCE 3D4JA 4RPFA 2RTXA 3ADIA 1ZM9A 4OX9I 4DUZE 1N36E 2ZBKB 3WU4A 1HR0I 4DV2E 4AQYI 4JI4E 4B3SI 4ED4A 4PU9A 1ZXNA 2NUFA 4DV5E 1XHKA 1I94E 3ZM7A 4Z7CA 2RS6A 1MU5A 2CPNA 1N0UA 2CZ9A 4DR6E 3K17A 2X7IA 4M2ZA 1NHHA 2DMYA 1XNRE 1RR9A 4JI1I 1Z0TA 1FJGE 4DV0I 2L3CA 2UXDE 2R3VA 2L33A 1HNZI 1BKNA 4DPUA 3WU6A 4DR5I 3P1XA 2VQEI 5FLXQ 3JAMC 5BR8I 1Z0CA 3K1JA 4JI7E 3T1HI 3V5RA 4DXLA 4M30A 4LFBI 1X49A 4DUYI 1IBME 2B7VA 4LFAI 2F4VI 3LTOA 1Z5BA 1MG7A 1YYOA 2E1RA 1ZM4A 4X66E 2LTSA 1GQEA 2AJ4A 4DPWA 1XNQE 4LF8E 4MYTA 3GONA 1XMQI 1Z0VA 4YY3E 4NXNE 1KKHA 5IWAI 2RSMA 4JV5E 4DR4E 1KIJA 2HHHE 2UUBE 4Z7YA 4MYUA 1N33I 2VQFE 2RS7A 2ZM6E 4ZVIA 4JI5I 4DV1I 4DV4E 1DARA 1YYKA 4DV7E 1N34E 4JI3E 4GKKE 1QU6A 1IBLE 4JYAE 2KHXA 1FI4A 2WW4A 4DR3E 2BM1A 1FWKA 1KTVA 2NPFA 4DU7A 2LJPA 4WUBA 4OX9E 4JI6I 1N32I 1WHNA 4B3MI 2LJHA 4DR1E 3PYDA 3J80Q 3J7AG 1Z0EA 1PKPA 4AQYE 1WUUA 4B3SE 3J81C 2UXBI 3C4BA 1ZM3A 2DEJA 4DR2I 4HXZA 2V2VA 4JI8I 5LMNI 1VISA 5IT9Q 4DV3I 3HTXA 4X65E 1J5EE 5A2QQ 2DIXA 4X64I 4JI1E 3LNUA 4DV0E 4JI0I 1HNZE 3OTOI 4NXMI 4LF6I 4DKKA 2UUCI 4DR5E 4KQVA 3WU5A 4DUZI 2VQEE 5BR8E 1OJ4A 2UU9E 4HACA 1A6FA 4JI2I 1UHZA 3T1HE 4UTGA 1IBKI 2B3TB 4LFBE 4DV6E 4DUYE 1UEKA 4JI4I 3WU3A 2F4VE 2X36A 3ADGA 2LUQA 1RQ0A 3ZZ0A 1FKAE 1EA6A 3QT6A 4FWGA 4USKA 2LTRA 4K0KI 2V8PA 1ZBTA 3ZZTA 2E5LI 1Z0WA 5L3JA 1XMQE 1X47A 1U2RA 4URLA 4DR7E 1NHIA 1XNRI 2NA2A 1NZ0A 5IWAE 2UXDI 4P52A 3F0NA 5FLXC 1ZXMA 4X62E 2A2DA 1S16A 2HK2A 1N33E 4FN5A 4DPYA 2HKEA 1T4LB 2EFGA 4LF5I 2JY9A 1EI1A 2L2NA 4DV1E 4KHPE 3T1YI 5LMUI 4DPXA 4R1FA 2UXCI 4YHHI 2UUAI 3J7Yp 2L2MA 4P7AA 3B8HA 2LRSA 4GKJE 4LF9E 4B3RE 4LF8I 2HKJA 1XMOI 2HK3A 2OI2A 3C4TA 4LF7I 4NXNI 4JI6E 1N32E 4HACB 4B3ME 4B3TI 2V2QA 2HHHI 3ZKBA 2UUBI 2V34A 4OOGC 2XEXA 4HY1A 3Q1QA 3ZZUA 2A2CA 4LF4I 2HFUA 4DR2E 4WUCA 1HR0E 1FWLA 4JI8E 5LMNE 2EZ6A 2L2KB 1Z59A 3VYYA 4FW9A 4DPTA 4WYQB 1T4OA 2L3JA 4WUDA 4LFCI 1N0VC 1H73A 4NXME 1HNWI 4LF6E 1PIEA 4JG4A 4PRXA 1D6TA 1B62A 4FWDA 1HNXI 4JI2E 3J80C 1IBKE 4DR1I 2BM0A 5GMEA 1N36I 1T4NA 3H4LA 1Z0GA 1EKZA 2GS8A 3JAMQ 3VYXA 1H72C 3V2UC 1RREA 1H74A 5IT9C 1DI2A 1RC7A 2YT4A 4DV2I 2NUGA 4LFAE 3PYEA 4K0KE 2Q2EB 5A2QC 4DV5I 4X65I 1I94I 2E5LE 1Z0BA 3CWVA 1K47A 1J5EI 1NHJA 3HULA 4DR6I 1O0WA 2MDRA 3ZKDA 1YZ9A 2N3HA 2JVAA 2HFSA 3ADLA 3ADJA 4WFTA 3B82A 4PRVA 1UILA 1FJGI 1ELOA 2UU9I
chains in the Genus database with same CATH superfamily
2DB2A 2EOYA 2I9IA 4EMDA 2LCEA 4LF5E 2EOJA 1IQSA 3EPJA 1B63A 1A1HA 4X8WA 4DV6I 1MX0A 3UHMA 1N3GA 2VRDA 1STUA 3IWBA 3T1YE 5LMUE 4R2EA 3U1YA 2CVEA 2CT1A 2DEIA 2IHR1 2M4IA 2EM3A 3C6MA 1QZRA 2Z5BB 4JI7I 2GLIA 1DQ3A 3KZZA 4YHHE 2MKDA 2LUPB 4KWYA 2UUAE 4JI5E 2UXCE 4M1KA 1A1KA 1IBMI 3B78A 3M6AA 3MHHC 5LL6R 1UDOA 5GMDA 1EH6A 3PYGA 3Q6NA 3F6GA 3IWDA 3CDIA 3THOB 2MC5A 2BBGA 2B7TA 4O4KA 5KL2A 1A1JA 1XMOE 2DRPA 2V2ZA 4RH8A 3QT5A 4ISAA 2ODRD 2JR1A 1A1FA 1RMDA 4OO1B 4MLVA 5KL4A 4LF7E 4I3HA 4DR7I 2VF3A 2J7KA 4X66I 2EMHA 1OYRA 3K6QA 1NCSA 2M7QA 1AAYA 2MKNA 1H7SA 3HJCA 3QT8A 3U1KA 2HC5A 1XNQI 4B3TE 3B4TA 3GLLA 1X48A 4IFDF 4F6NA 5CFFE 2JEBA 1UDNA 2JWOA 2BA1D 2LBSB 1RHYA 3THNA 1S4EA 5EL9A 4YY3I 2KOUA 2DSYA 4X62I 4HEIA 1FNMA 1BBGA 1VI7A 3AV0A 3JU0A 2DLKA 4HYMA 2N3GA 2YTJA 4I8OA 4LF4E 1PVGA 2BV3A 2EMIA 2BA0D 4JV5I 2EM6A 1Z5CA 2V83A 4DR4I 1BB8A 4J3DA 3J7AM 1WHQA 2EN4A 2DMIA 4MLQA 2EE8A 4KHPI 1Z5AA 3PYFA 2NUEA 1J26A 2R42A 4OO1D 3H09A 2PO0B 2BA1G 2UXBE 1R6LA 2YWQA 2VQFI 2ZM6I 3QT7A 4WSGA 3J81Q 1ZM2A 2EN3A 2N8XA 4GEQB 4NBQA 4XTJA 3LPSA 4IZKB 2BA0G 3JTZA 5K36A 5C0XC 4DV4I 4BA2A 4DV7I 4GKJI 4FWHA 3MHSC 4DV3E 4LFCE 1N34I 4JI3I 4L5NC 2V85A 4GKKI 4LF9I 4B3RI 1HNWE 5A6AA 1P47A 4UT4A 1IBLI 1YYWA 2PNZA 2C38A 4JYAI 2NN6C 2WBUA 2ZITA 1H7UA 2EN6A 4DR3I 3LLHA 4X64E 5KL6A 3H1CA 1HNXE 5JEAB 2VF1A 2K4VA 4JI0E 3OTOE 4DU8A 2JOBA 2YTGA 1YFHA 4LCHA 4USMA 1KVKA 1PJSA 2UUCE 3D4JA 2CGEA 2RTXA 4R8OA 3ADIA 4RPFA 5C0XA 1ZM9A 1KYQA 2HJJA 2YTEA 4DUZE 4OX9I 1ZBQA 1N36E 2JXPA 2ZBKB 2J7JA 5DRQA 3WU4A 4MU3A 2NN6E 3FIGA 4QNKA 5ADZA 1HR0I 2EOMA 2NABA 1T39A 4DV2E 2FV4B 4AQYI 4JI4E 4B3SI 2EOEA 2YRHA 4OO1F 4ED4A 2M9AA 4PU9A 1ZXNA 5KL3A 1WJPA 1X6FA 3QG5C 2NUFA 4DV5E 4MDTA 5JEAD 1XHKA 2J65A 1I94E 2PO1A 2EOXA 3LMLA 1YUIA 3ZM7A 2JE6A 4Z7CA 4F9BB 2ENCA 2RS6A 1MU5A 2CPNA 4F54A 1N0UA 2F1DA 2VESA 2EL5A 2CZ9A 4DR6E 5KL7A 4N3OA 2EWLA 1OYPA 3K17A 2X7IA 4M2ZA 1NHHA 2DMYA 1YHCA 2D9HA 4F9CB 2JEBB 1PJQA 3L00A 1GTKA 1XNRE 3UK3C 5F3WA 1RR9A 2VE7C 4JI1I 2RSIA 1Z0TA 1FJGE 4DV0I 2L3CA 1EH8A 2UXDE 2L33A 2R3VA 4MQYA 1BKNA 2Z5CA 1HNZI 4DPUA 3WU6A 4DR5I 3P1XA 2VQEI 5FLXQ 3JAMC 5BR8I 2YTDA 2EPMX 1Z0CA 3K1JA 5DNYA 4JI7E 4R03A 3NZKA 5AE2A 4P7DA 3T1HI 3P76A 4R2RA 3V5RA 2B9DA 2EPPA 4DXLA 4WXDA 4M30A 4LFBI 1X49A 4DUYI 1IBME 5K36B 3PS2A 4BA2B 2MDGA 2B7VA 4LFAI 2F4VI 4BS9A 3LTOA 1Z5BA 2KONA 2WBSA 5JEAF 4AIMA 2EM8A 2IERA 5AASA 4WXCA 3L7ZA 2C38B 1MG7A 1YYOA 2E1RA 1ZM4A 4X66E 2LTSA 1GQEA 3TQMA 2AJ4A 4DPWA 2JPAA 2EMXA 1XNQE 4LF8E 4FW3A 4MYTA 3MSWA 2JT2A 3GONA 1XMQI 2EMLA 1Z0VA 4YY3E 2O1VA 5C0XB 5T6JA 2EOQA 2LO3A 4BC7A 4NXNE 1KKHA 1Y6ZA 4NHRA 3BF2A 5K36D 2WBTA 5IWAI 2YTOA 2GO4A 2EMZA 2RSMA 4JV5E 5ELWA 4DR4E 2GPIA 1KIJA 4AIDA 2HHHE 1USVA 2EOIA 4DMIA 2UUBE 1USUA 4Z7YA 4FW5A 4F6MA 1JK1A 2EMAA 4IFDE 4ZYGA 2F8BA 4R2SA 2PO2A 4MYUA 1N33I 2VQFE 2RS7A 2DLQA 2ZM6E 4Q28A 4ZVIA 3P3EA 2PO1B 4JI5I 4LU9A 4MU0A 3F6HA 4DV1I 4DV4E 1DARA 1OYSA 4R2AA 1YYKA 4DV7E 2JE6B 3PS3A 1N34E 3P3CA 1X3CA 5C0XD 2JEAA 4JI3E 2WP8A 1X6EA 2LV2A 4GKKE 1TF3A 2ELZA 1QU6A 4HTGA 1IBLE 4AM3A 4JYAE 4X9JA 4F9AB 2KHXA 5LLQA 2EOOA 4ZYDA 1FI4A 4FK5C 2WW4A 4DR3E 2EM4A 2BM1A 1ZU1A 1T38A 1FWKA 1KTVA 4ZYEA 1F2IG 2LVHA 2NPFA 2EPUA 2RPCA 2Z5CB 2EORA 4DU7A 2V8QB 2V87A 1UBDC 2LJPA 1NEIA 4MU4A 4WUBA 4OX9E 3P3GA 4JI6I 2L8TA 4R2CA 5K36F 2E1MA 5A69A 1WHNA 1WXRA 1N32I 4B3MI 2LJHA 1BBOA 2ELYA 2EPLX 4DR1E 2CTDA 2EPZA 3PYDA 2R76A 5K36E 1IQOA 3J80Q 5AC4A 3J7AG 1A1LA 1Z0EA 1IMUA 1PKPA 4AQYE 4M9VC 4B3SE 1WUUA 3J81C 2UXBI 2Z5BA 4BBYA 4BHBA 2WNRA 3C4BA 1Z1BA 3HQ1A 1ZM3A 2DEJA 2NN6A 4DR2I 3VHTB 2JP9A 4N4RB 1ZR9A 2V2VA 2ADRA 3L7ZB 4HXZA 4JI8I 4BCAA 5LMNI 1VISA 3BIDA 5IT9Q 2EMYA 4DV3I 5C0XF 2I13A 2C39A 3HTXA 2EM2A 4BMJA 5AE3A 4X65E 2O3ZA 2EMWA 4LPFA 4OO1E 2GQ0A 2L6MA 1J5EE 1L4SA 5A2QQ 2AE8A 4FW6A 2C37A 1WRJA 2DIXA 4X64I 4JI1E 3LNUA 2A25A 2YSOA 4DV0E 5DROA 5AC5A 1HNZE 4JI0I 2YTPA 2EPCA 3OTOI 2GO3A 4NXMI 4LF6I 4DKKA 2UUCI 3BBGA 3EQ1A 4LTYA 5A6BA 4DR5E 1Y5YA 2YTFA 2BR2A 4KQVA 3WU5A 4DUZI 2VQEE 2FGGA 2EOFA 5BR8E 1X5WA 5DNXA 1XXEA 2EM5A 1OJ4A 2PO2B 2UU9E 4HACA 3EPLA 1A6FA 4M0VA 1UHZA 4JI2I 1EH7A 1YPNA 2EMFA 3T1HE 4UTGA 1IBKI 2B3TB 2EMKA 4LFBE 4DV6E 4DUYE 5EKWA 1YSAC 1UEKA 2EN7A 4JI4I 1LLMC 3M7ND 2JEAB 4IZJA 2CSHA 2YTQA 2WP8B 3WU3A 2F4VE 2X36A 2RQLA 2EQ0A 3ADGA 2LUQA 1RQ0A 4BA1A 4FW4A 3ZZ0A 3P06A 1FKAE 1EA6A 3QT6A 4FWGA 1TF6A 4USKA 2O1TA 2EPOA 2EM7A 4O5GA 2LTRA 4K0KI 5AE1A 2V8PA 1ZBTA 3ZZTA 3CDJA 3OMLA 3M85D 3M7NG 5KL5A 2E5LI 1Z0WA 4R2QA 2YSPA 2LT7A 1X47A 1XMQE 1U2RA 2O1UA 2PNZB 4URLA 4DR7E 1NHIA 2PNLA 5A6JA 1XNRI 2NA2A 1SR9A 4LCFA 3Q6MA 1NZ0A 5JEAE 5IWAE 4IFDC 2UXDI 4P52A 3F0NA 5FLXC 2EQ3A 3C6KA 1ZXMA 2CG9A 2R1FA 5A6KA 4NZVA 1G2DC 4X62E 3M85G 2K7IA 2EPAA 2A2DA 1S16A 2HK2A 3EPKA 1N33E 2YPNA 4FN5A 2EOHA 4DPYA 2EM9A 1A1IA 3KZYA 2WNRB 4RHBB 2WZOA 1T4LB 1G2FC 3M99B 2EFGA 2HKEA 2EOZA 2JY9A 2NN6B 1EI1A 4LF5I 2L2NA 2YTNA 3KWRA 2JOXA 4DV1E 4KHPE 3T1YI 5LMUI 1UDSA 3AUZA 4DPXA 4IFDA 2EPNA 5FWKA 4R1FA 3HPSA 3HKMA 2C39B 3PS1A 2YTIA 2UXCI 1PDAA 4YHHI 3RMPA 2UUAI 4U3DA 3J7Yp 2L2MA 3HPZA 2EQ1A 3K85A 4P7AA 1GZ6A 2YRKA 2M1SA 3B8HA 2EPXA 2C37B 2LRSA 4GKJE 3HXLA 5DRPA 3DD6A 4TUIA 4O43A 4GZNC 4LF9E 4B3RE 4LF8I 2YRMA 2HKJA 1B69A 1XMOI 2ODRC 2HK3A 2OI2A 2EP3A 4R2PA 2NN6D 3C4TA 3GCMA 4LF7I 1TN9A 2BR2B 4NXNI 2LMZA 5K36C 4JI6E 4GQUA 2MC6A 1N32E 4OKGA 5L3JA 4HACB 4B3ME 4B3TI 2V2QA 2HHHI 1P42A 3ZKBA 2HGHA 3ZOQB 4ZYHA 2UUBI 2V34A 3BGHA 1PJTA 4OOGC 2EJ4A 2XEXA 1R6MA 2L92A 4HY1A 4BHCA 3Q1QA 5IXMB 3ZZUA 4IJDA 2A2CA 4IZJB 4LF4I 2PNMA 2HFUA 1Y4SA 1UN6B 4DR2E 4WUCA 2EMBA 1Y4UA 1YH8A 1HR0E 1FWLA 4JI8E 4BA1B 5LMNE 2EZ6A 2L2KB 1Z59A 1QNTA 2YZTA 2PRTA 3VYYA 5A6BD 2IOQA 4OO1C 4FW9A 1Y60A 4LOMA 4DPTA 4IS9A 4F2JC 4WYQB 5DNLA 4IS1C 1ZAAC 2V89A 1T4OA 1UDQA 3KRNA 2EPRA 2GHFA 2LJUA 2L3JA 1JK2A 3PRYA 4WUDA 2ENHA 2LE2A 3IWCA 2Q8UA 3VK6A 2WCC3 4Q35B 1MEYC 1N0VC 2O1WA 4FW7A 5DRRA 4LFCI 1H73A 2FTXB 4NXME 1YUJA 1HNWI 4LF6E 4IZJD 2JYAA 1PIEA 4JG4A 4MU1A 4PRXA 5C0XE 1SFEA 2EMGA 4OO1A 1D6TA 1MGTA 2NN6F 1B62A 3ECRA 1DGCA 4FWDA 5IV8B 1HNXI 2EM0A 4JI2E 2EMCA 3J80C 1IBKE 4DR1I 2EOSA 1AH5A 2V88A 2BM0A 4OZEA 2BB8A 5GMEA 3DJWA 4TUGA 1N36I 2EN1A 1KJKA 4L8NA 1T4NA 3H4LA 4QNJA 2IOPA 4IFDB 1Z0GA 1EKZA 2GS8A 3JAMQ 3DF6A 2E72A 2EL4A 3VYXA 1H72C 3V2UC 1RREA 1H74A 2EPKX 4KZSA 4LCGA 4U3BA 5IT9C 3GMEA 4WPYA 1DI2A 2V86A 1RC7A 2YT4A 2IESA 1HK7A 2NUGA 4DV2I 2PO0A 4LFAE 4WSPA 3PYEA 4K0KE 5JEAC 2Q2EB 5A2QC 1A1GA 4DV5I 4WX9A 4X65I 2YU5A 1I94I 2E5LE 4BC9A 1Z0BA 1K47A 3CWVA 2EN8A 3EPHA 4IZKA 2Z5EA 1X6HA 1NHJA 1J5EI 2ENAA 3HULA 5TSEA 2YU8A 2H36X 2EN2A 4P78A 1E3HA 4DR6I 4J8ZA 1O0WA 4R2DA 4IFDD 2G7HA 2MDRA 3ZKDA 1E3PA 1YZ9A 2N3HA 2JVAA 2HFSA 3ADLA 3ADJA 4WFTA 2DGCA 3B82A 4PRVA 1UILA 2EL6A 4O24A 5JEAA 1FJGI 1ELOA 2UU9I
chains in the Genus database with same CATH topology
2DB2A 4EMDA 4LF5E 1B63A 4DV6I 4X8WA 1MX0A 3IWBA 1STUA 3T1YE 5LMUE 2DEIA 2IHR1 2M4IA 2Z5BB 1QZRA 4JI7I 2UXCE 1DQ3A 4YHHE 2LUPB 2UUAE 4JI5E 4M1KA 1IBMI 3B78A 3M6AA 5LL6R 5GMDA 3PYGA 3Q6NA 3F6GA 3IWDA 2MC5A 2B7TA 2V2ZA 1XMOE 3QT5A 2ODRD 2JR1A 4DR7I 4LF7E 4I3HA 2VF3A 2J7KA 4X66I 3K6QA 3QT8A 2M7QA 1H7SA 3HJCA 1XNQI 4B3TE 1X48A 5CFFE 2JWOA 2LBSB 4YY3I 1S4EA 2KOUA 2DSYA 4X62I 1FNMA 3AV0A 3JU0A 4HYMA 2N3GA 4I8OA 1PVGA 4LF4E 2BV3A 4JV5I 1Z5CA 4DR4I 2V83A 3J7AM 1WHQA 4KHPI 1Z5AA 3PYFA 2NUEA 1J26A 2R42A 3H09A 2UXBE 2VQFI 2ZM6I 3QT7A 3J81Q 1ZM2A 4GEQB 4XTJA 3LPSA 4IZKB 3JTZA 4DV4I 4DV7I 4GKJI 4FWHA 4DV3E 1N34I 4LFCE 4JI3I 4L5NC 2V85A 4GKKI 4LF9I 4B3RI 1HNWE 4UT4A 1IBLI 1YYWA 4JYAI 2ZITA 4DR3I 1H7UA 3LLHA 4X64E 1HNXE 2VF1A 2K4VA 4JI0E 3OTOE 4DU8A 2JOBA 4USMA 1KVKA 2UUCE 3D4JA 4RPFA 2CGEA 2RTXA 4R8OA 3ADIA 1ZM9A 4OX9I 4DUZE 1ZBQA 1N36E 2ZBKB 3WU4A 3FIGA 5ADZA 1HR0I 4DV2E 2FV4B 4AQYI 4JI4E 4B3SI 4ED4A 4PU9A 1ZXNA 2NUFA 4DV5E 1XHKA 1I94E 3LMLA 3ZM7A 4Z7CA 4F9BB 2RS6A 1MU5A 2CPNA 4F54A 1N0UA 2CZ9A 4DR6E 4N3OA 2EWLA 3K17A 2X7IA 4M2ZA 1NHHA 2DMYA 4F9CB 1XNRE 5F3WA 1RR9A 2VE7C 4JI1I 1Z0TA 1FJGE 4DV0I 2L3CA 2UXDE 2R3VA 2L33A 1HNZI 1BKNA 2Z5CA 4DPUA 3WU6A 4DR5I 3P1XA 2VQEI 5FLXQ 3JAMC 5BR8I 1Z0CA 3K1JA 5DNYA 4JI7E 4R03A 5AE2A 4P7DA 3T1HI 3V5RA 4DXLA 2B9DA 4M30A 4LFBI 1X49A 4DUYI 1IBME 2B7VA 4LFAI 2F4VI 4BS9A 3LTOA 1Z5BA 2KONA 5AASA 1MG7A 1YYOA 2E1RA 1ZM4A 4X66E 2LTSA 1GQEA 2AJ4A 4DPWA 1XNQE 4LF8E 4MYTA 3MSWA 3GONA 1XMQI 1Z0VA 4YY3E 2O1VA 5T6JA 4BC7A 4NXNE 1KKHA 1Y6ZA 5IWAI 2RSMA 4JV5E 4DR4E 1KIJA 2HHHE 1USVA 4DMIA 2UUBE 1USUA 4Z7YA 2F8BA 4MYUA 1N33I 2VQFE 2RS7A 2ZM6E 4Q28A 4ZVIA 4JI5I 4LU9A 4DV1I 3F6HA 4DV4E 1DARA 1YYKA 4DV7E 1N34E 4JI3E 4GKKE 1QU6A 1IBLE 4JYAE 4F9AB 2KHXA 1FI4A 2WW4A 4DR3E 2BM1A 1FWKA 1KTVA 2NPFA 2Z5CB 4DU7A 2V8QB 2V87A 2LJPA 4WUBA 4OX9E 4JI6I 2L8TA 2E1MA 1N32I 1WHNA 1WXRA 4B3MI 2LJHA 4DR1E 3PYDA 3J80Q 3J7AG 1Z0EA 1PKPA 4AQYE 1WUUA 4B3SE 3J81C 2UXBI 2Z5BA 4BBYA 3C4BA 3HQ1A 1ZM3A 2DEJA 4DR2I 4HXZA 2V2VA 4JI8I 4BCAA 5LMNI 1VISA 5IT9Q 4DV3I 3HTXA 4BMJA 5AE3A 4X65E 2GQ0A 2L6MA 1J5EE 5A2QQ 2DIXA 4X64I 4JI1E 3LNUA 4DV0E 4JI0I 1HNZE 3OTOI 4NXMI 4LF6I 4DKKA 2UUCI 4LTYA 4DR5E 4KQVA 3WU5A 4DUZI 2VQEE 2FGGA 5BR8E 1OJ4A 2UU9E 4HACA 1A6FA 4JI2I 4M0VA 1UHZA 3T1HE 4UTGA 1IBKI 2B3TB 4LFBE 4DV6E 4DUYE 1UEKA 4JI4I 4IZJA 3WU3A 2F4VE 2X36A 3ADGA 2LUQA 1RQ0A 3ZZ0A 3P06A 1FKAE 1EA6A 3QT6A 4FWGA 4USKA 2O1TA 2LTRA 4K0KI 5AE1A 2V8PA 1ZBTA 3ZZTA 3OMLA 2E5LI 1Z0WA 2O1UA 5L3JA 1XMQE 1X47A 1U2RA 4URLA 4DR7E 1NHIA 2PNLA 1XNRI 2NA2A 1SR9A 3Q6MA 1NZ0A 5IWAE 2UXDI 4P52A 3F0NA 5FLXC 1ZXMA 2CG9A 4X62E 2A2DA 1S16A 2HK2A 1N33E 4FN5A 4DPYA 2HKEA 2WZOA 1T4LB 2EFGA 4LF5I 2JY9A 1EI1A 2L2NA 3KWRA 2JOXA 4DV1E 4KHPE 3T1YI 5LMUI 3AUZA 4DPXA 5FWKA 4R1FA 3HPSA 2UXCI 4YHHI 3RMPA 2UUAI 3J7Yp 3HPZA 2L2MA 3K85A 4P7AA 1GZ6A 2M1SA 3B8HA 2LRSA 4GKJE 3HXLA 4TUIA 4LF9E 4B3RE 4LF8I 2HKJA 1XMOI 2ODRC 2HK3A 2OI2A 3C4TA 4LF7I 4NXNI 2LMZA 4JI6E 2MC6A 1N32E 4HACB 4B3ME 4B3TI 2V2QA 2HHHI 3ZKBA 3ZOQB 2UUBI 2V34A 4OOGC 2XEXA 2L92A 4HY1A 3Q1QA 3ZZUA 2A2CA 4IZJB 4LF4I 2PNMA 2HFUA 1Y4SA 4DR2E 4WUCA 1Y4UA 1HR0E 1FWLA 4JI8E 5LMNE 2EZ6A 2L2KB 1Z59A 2YZTA 2IOQA 3VYYA 4FW9A 4DPTA 4WYQB 2V89A 1T4OA 2L3JA 4WUDA 3PRYA 2LE2A 3IWCA 3VK6A 4LFCI 1N0VC 2O1WA 1H73A 2FTXB 4NXME 1HNWI 4LF6E 4IZJD 1PIEA 4JG4A 4PRXA 1D6TA 1B62A 4FWDA 1HNXI 4JI2E 3J80C 1IBKE 4DR1I 2V88A 2BM0A 5GMEA 3DJWA 4TUGA 1N36I 4L8NA 1T4NA 3H4LA 2IOPA 1Z0GA 1EKZA 2GS8A 3JAMQ 3DF6A 3VYXA 1H72C 3V2UC 1RREA 1H74A 4KZSA 5IT9C 4WPYA 1DI2A 2V86A 1RC7A 2YT4A 1HK7A 2NUGA 4DV2I 4LFAE 4WSPA 3PYEA 4K0KE 2Q2EB 5A2QC 4DV5I 4X65I 1I94I 2E5LE 4BC9A 1Z0BA 1K47A 3CWVA 4IZKA 1J5EI 2Z5EA 1NHJA 3HULA 2H36X 4P78A 4DR6I 1O0WA 4J8ZA 2G7HA 2MDRA 3ZKDA 1YZ9A 2N3HA 2JVAA 2HFSA 3ADLA 3ADJA 4WFTA 3B82A 4PRVA 1UILA 1FJGI 1ELOA 2UU9I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DB2 A;  4EMD A;  4LF5 E;  1B63 A;  4DV6 I;  4X8W A;  1MX0 A;  3T1Y E;  1STU A;  5LMU E;  2DEI A;  2IHR 1;  4JI7 I;  1QZR A;  2UXC E;  2LUP B;  4YHH E;  2UUA E;  4JI5 E;  4M1K A;  1IBM I;  3B78 A;  3M6A A;  5LL6 R;  5GMD A;  3PYG A;  2B7T A;  2V2Z A;  1XMO E;  3QT5 A;  4DR7 I;  4LF7 E;  4I3H A;  2VF3 A;  2J7K A;  4X66 I;  3QT8 A;  1H7S A;  1XNQ I;  4B3T E;  1X48 A;  5CFF E;  2LBS B;  4YY3 I;  1S4E A;  4X62 I;  1FNM A;  4HYM A;  2N3G A;  1PVG A;  2BV3 A;  4LF4 E;  4JV5 I;  1Z5C A;  4DR4 I;  3J7A M;  1WHQ A;  4KHP I;  1Z5A A;  3PYF A;  2NUE A;  1J26 A;  2R42 A;  2UXB E;  2VQF I;  2ZM6 I;  3QT7 A;  3J81 Q;  1ZM2 A;  4XTJ A;  3LPS A;  4DV4 I;  4DV7 I;  4GKJ I;  4FWH A;  4DV3 E;  1N34 I;  4LFC E;  4JI3 I;  4GKK I;  4LF9 I;  4B3R I;  1HNW E;  4UT4 A;  1IBL I;  1YYW A;  4JYA I;  2ZIT A;  4DR3 I;  1H7U A;  3LLH A;  4X64 E;  1HNX E;  4JI0 E;  3OTO E;  4DU8 A;  4USM A;  1KVK A;  2UUC E;  3D4J A;  4RPF A;  2RTX A;  3ADI A;  1ZM9 A;  4OX9 I;  4DUZ E;  1N36 E;  2ZBK B;  3WU4 A;  1HR0 I;  4DV2 E;  4AQY I;  4JI4 E;  4B3S I;  4ED4 A;  4PU9 A;  1ZXN A;  2NUF A;  4DV5 E;  1XHK A;  1I94 E;  3ZM7 A;  4Z7C A;  2RS6 A;  1MU5 A;  2CPN A;  1N0U A;  2CZ9 A;  4DR6 E;  3K17 A;  2X7I A;  4M2Z A;  1NHH A;  2DMY A;  1XNR E;  1RR9 A;  4JI1 I;  1Z0T A;  1FJG E;  4DV0 I;  2L3C A;  2UXD E;  2R3V A;  2L33 A;  1HNZ I;  1BKN A;  4DPU A;  3WU6 A;  4DR5 I;  3P1X A;  2VQE I;  5FLX Q;  3JAM C;  5BR8 I;  1Z0C A;  3K1J A;  4JI7 E;  3T1H I;  3V5R A;  4DXL A;  4M30 A;  4LFB I;  1X49 A;  4DUY I;  1IBM E;  2B7V A;  4LFA I;  2F4V I;  3LTO A;  1Z5B A;  1MG7 A;  1YYO A;  2E1R A;  1ZM4 A;  4X66 E;  2LTS A;  1GQE A;  2AJ4 A;  4DPW A;  1XNQ E;  4LF8 E;  4MYT A;  3GON A;  1XMQ I;  1Z0V A;  4YY3 E;  4NXN E;  1KKH A;  5IWA I;  2RSM A;  4JV5 E;  4DR4 E;  1KIJ A;  2HHH E;  2UUB E;  4Z7Y A;  4MYU A;  1N33 I;  2VQF E;  2RS7 A;  2ZM6 E;  4ZVI A;  4JI5 I;  4DV1 I;  4DV4 E;  1DAR A;  1YYK A;  4DV7 E;  1N34 E;  4JI3 E;  4GKK E;  1QU6 A;  1IBL E;  4JYA E;  2KHX A;  1FI4 A;  2WW4 A;  4DR3 E;  2BM1 A;  1FWK A;  1KTV A;  2NPF A;  4DU7 A;  2LJP A;  4WUB A;  4OX9 E;  4JI6 I;  1N32 I;  1WHN A;  4B3M I;  2LJH A;  4DR1 E;  3PYD A;  3J80 Q;  3J7A G;  1Z0E A;  1PKP A;  4AQY E;  1WUU A;  4B3S E;  3J81 C;  2UXB I;  3C4B A;  1ZM3 A;  2DEJ A;  4DR2 I;  4HXZ A;  2V2V A;  4JI8 I;  5LMN I;  1VIS A;  5IT9 Q;  4DV3 I;  3HTX A;  4X65 E;  1J5E E;  5A2Q Q;  2DIX A;  4X64 I;  4JI1 E;  3LNU A;  4DV0 E;  4JI0 I;  1HNZ E;  3OTO I;  4NXM I;  4LF6 I;  4DKK A;  2UUC I;  4DR5 E;  4KQV A;  3WU5 A;  4DUZ I;  2VQE E;  5BR8 E;  1OJ4 A;  2UU9 E;  4HAC A;  1A6F A;  4JI2 I;  1UHZ A;  3T1H E;  4UTG A;  1IBK I;  2B3T B;  4LFB E;  4DV6 E;  4DUY E;  1UEK A;  4JI4 I;  3WU3 A;  2F4V E;  2X36 A;  3ADG A;  2LUQ A;  1RQ0 A;  3ZZ0 A;  1FKA E;  1EA6 A;  3QT6 A;  4FWG A;  4USK A;  2LTR A;  4K0K I;  2V8P A;  1ZBT A;  3ZZT A;  2E5L I;  1Z0W A;  5L3J A;  1XMQ E;  1X47 A;  1U2R A;  4URL A;  4DR7 E;  1NHI A;  1XNR I;  2NA2 A;  1NZ0 A;  5IWA E;  2UXD I;  4P52 A;  3F0N A;  5FLX C;  1ZXM A;  4X62 E;  2A2D A;  1S16 A;  2HK2 A;  1N33 E;  4FN5 A;  4DPY A;  2HKE A;  1T4L B;  2EFG A;  4LF5 I;  2JY9 A;  1EI1 A;  2L2N A;  4DV1 E;  4KHP E;  3T1Y I;  5LMU I;  4DPX A;  4R1F A;  2UXC I;  4YHH I;  2UUA I;  3J7Y p;  2L2M A;  4P7A A;  3B8H A;  2LRS A;  4GKJ E;  4LF9 E;  4B3R E;  4LF8 I;  2HKJ A;  1XMO I;  2HK3 A;  2OI2 A;  3C4T A;  4LF7 I;  4NXN I;  4JI6 E;  1N32 E;  4HAC B;  4B3M E;  4B3T I;  2V2Q A;  2HHH I;  3ZKB A;  2UUB I;  2V34 A;  4OOG C;  2XEX A;  4HY1 A;  3Q1Q A;  3ZZU A;  2A2C A;  4LF4 I;  2HFU A;  4DR2 E;  4WUC A;  1HR0 E;  1FWL A;  4JI8 E;  5LMN E;  2EZ6 A;  2L2K B;  1Z59 A;  3VYY A;  4FW9 A;  4DPT A;  4WYQ B;  1T4O A;  2L3J A;  4WUD A;  4LFC I;  1N0V C;  1H73 A;  4NXM E;  1HNW I;  4LF6 E;  1PIE A;  4JG4 A;  4PRX A;  1D6T A;  1B62 A;  4FWD A;  1HNX I;  4JI2 E;  3J80 C;  1IBK E;  4DR1 I;  2BM0 A;  5GME A;  1N36 I;  1T4N A;  3H4L A;  1Z0G A;  1EKZ A;  2GS8 A;  3JAM Q;  3VYX A;  1H72 C;  3V2U C;  1RRE A;  1H74 A;  5IT9 C;  1DI2 A;  1RC7 A;  2YT4 A;  4DV2 I;  2NUG A;  4LFA E;  3PYE A;  4K0K E;  2Q2E B;  5A2Q C;  4DV5 I;  4X65 I;  1I94 I;  2E5L E;  1Z0B A;  3CWV A;  1K47 A;  1J5E I;  1NHJ A;  3HUL A;  4DR6 I;  1O0W A;  2MDR A;  3ZKD A;  1YZ9 A;  2N3H A;  2JVA A;  2HFS A;  3ADL A;  3ADJ A;  4WFT A;  3B82 A;  4PRV A;  1UIL A;  1FJG I;  1ELO A;  2UU9 I; 
#chains in the Genus database with same CATH topology
 2DB2 A;  2EOY A;  2I9I A;  4EMD A;  2LCE A;  4LF5 E;  2EOJ A;  1IQS A;  3EPJ A;  1B63 A;  1A1H A;  4X8W A;  4DV6 I;  1MX0 A;  3UHM A;  1N3G A;  2VRD A;  1STU A;  3IWB A;  3T1Y E;  5LMU E;  4R2E A;  3U1Y A;  2CVE A;  2CT1 A;  2DEI A;  2IHR 1;  2M4I A;  2EM3 A;  3C6M A;  1QZR A;  2Z5B B;  4JI7 I;  2GLI A;  1DQ3 A;  3KZZ A;  4YHH E;  2MKD A;  2LUP B;  4KWY A;  2UUA E;  4JI5 E;  2UXC E;  4M1K A;  1A1K A;  1IBM I;  3B78 A;  3M6A A;  3MHH C;  5LL6 R;  1UDO A;  5GMD A;  1EH6 A;  3PYG A;  3Q6N A;  3F6G A;  3IWD A;  3CDI A;  3THO B;  2MC5 A;  2BBG A;  2B7T A;  4O4K A;  5KL2 A;  1A1J A;  1XMO E;  2DRP A;  2V2Z A;  4RH8 A;  3QT5 A;  4ISA A;  2ODR D;  2JR1 A;  1A1F A;  1RMD A;  4OO1 B;  4MLV A;  5KL4 A;  4LF7 E;  4I3H A;  4DR7 I;  2VF3 A;  2J7K A;  4X66 I;  2EMH A;  1OYR A;  3K6Q A;  1NCS A;  2M7Q A;  1AAY A;  2MKN A;  1H7S A;  3HJC A;  3QT8 A;  3U1K A;  2HC5 A;  1XNQ I;  4B3T E;  3B4T A;  3GLL A;  1X48 A;  4IFD F;  4F6N A;  5CFF E;  2JEB A;  1UDN A;  2JWO A;  2BA1 D;  2LBS B;  1RHY A;  3THN A;  1S4E A;  5EL9 A;  4YY3 I;  2KOU A;  2DSY A;  4X62 I;  4HEI A;  1FNM A;  1BBG A;  1VI7 A;  3AV0 A;  3JU0 A;  2DLK A;  4HYM A;  2N3G A;  2YTJ A;  4I8O A;  4LF4 E;  1PVG A;  2BV3 A;  2EMI A;  2BA0 D;  4JV5 I;  2EM6 A;  1Z5C A;  2V83 A;  4DR4 I;  1BB8 A;  4J3D A;  3J7A M;  1WHQ A;  2EN4 A;  2DMI A;  4MLQ A;  2EE8 A;  4KHP I;  1Z5A A;  3PYF A;  2NUE A;  1J26 A;  2R42 A;  4OO1 D;  3H09 A;  2PO0 B;  2BA1 G;  2UXB E;  1R6L A;  2YWQ A;  2VQF I;  2ZM6 I;  3QT7 A;  4WSG A;  3J81 Q;  1ZM2 A;  2EN3 A;  2N8X A;  4GEQ B;  4NBQ A;  4XTJ A;  3LPS A;  4IZK B;  2BA0 G;  3JTZ A;  5K36 A;  5C0X C;  4DV4 I;  4BA2 A;  4DV7 I;  4GKJ I;  4FWH A;  3MHS C;  4DV3 E;  4LFC E;  1N34 I;  4JI3 I;  4L5N C;  2V85 A;  4GKK I;  4LF9 I;  4B3R I;  1HNW E;  5A6A A;  1P47 A;  4UT4 A;  1IBL I;  1YYW A;  2PNZ A;  2C38 A;  4JYA I;  2NN6 C;  2WBU A;  2ZIT A;  1H7U A;  2EN6 A;  4DR3 I;  3LLH A;  4X64 E;  5KL6 A;  3H1C A;  1HNX E;  5JEA B;  2VF1 A;  2K4V A;  4JI0 E;  3OTO E;  4DU8 A;  2JOB A;  2YTG A;  1YFH A;  4LCH A;  4USM A;  1KVK A;  1PJS A;  2UUC E;  3D4J A;  2CGE A;  2RTX A;  4R8O A;  3ADI A;  4RPF A;  5C0X A;  1ZM9 A;  1KYQ A;  2HJJ A;  2YTE A;  4DUZ E;  4OX9 I;  1ZBQ A;  1N36 E;  2JXP A;  2ZBK B;  2J7J A;  5DRQ A;  3WU4 A;  4MU3 A;  2NN6 E;  3FIG A;  4QNK A;  5ADZ A;  1HR0 I;  2EOM A;  2NAB A;  1T39 A;  4DV2 E;  2FV4 B;  4AQY I;  4JI4 E;  4B3S I;  2EOE A;  2YRH A;  4OO1 F;  4ED4 A;  2M9A A;  4PU9 A;  1ZXN A;  5KL3 A;  1WJP A;  1X6F A;  3QG5 C;  2NUF A;  4DV5 E;  4MDT A;  5JEA D;  1XHK A;  2J65 A;  1I94 E;  2PO1 A;  2EOX A;  3LML A;  1YUI A;  3ZM7 A;  2JE6 A;  4Z7C A;  4F9B B;  2ENC A;  2RS6 A;  1MU5 A;  2CPN A;  4F54 A;  1N0U A;  2F1D A;  2VES A;  2EL5 A;  2CZ9 A;  4DR6 E;  5KL7 A;  4N3O A;  2EWL A;  1OYP A;  3K17 A;  2X7I A;  4M2Z A;  1NHH A;  2DMY A;  1YHC A;  2D9H A;  4F9C B;  2JEB B;  1PJQ A;  3L00 A;  1GTK A;  1XNR E;  3UK3 C;  5F3W A;  1RR9 A;  2VE7 C;  4JI1 I;  2RSI A;  1Z0T A;  1FJG E;  4DV0 I;  2L3C A;  1EH8 A;  2UXD E;  2L33 A;  2R3V A;  4MQY A;  1BKN A;  2Z5C A;  1HNZ I;  4DPU A;  3WU6 A;  4DR5 I;  3P1X A;  2VQE I;  5FLX Q;  3JAM C;  5BR8 I;  2YTD A;  2EPM X;  1Z0C A;  3K1J A;  5DNY A;  4JI7 E;  4R03 A;  3NZK A;  5AE2 A;  4P7D A;  3T1H I;  3P76 A;  4R2R A;  3V5R A;  2B9D A;  2EPP A;  4DXL A;  4WXD A;  4M30 A;  4LFB I;  1X49 A;  4DUY I;  1IBM E;  5K36 B;  3PS2 A;  4BA2 B;  2MDG A;  2B7V A;  4LFA I;  2F4V I;  4BS9 A;  3LTO A;  1Z5B A;  2KON A;  2WBS A;  5JEA F;  4AIM A;  2EM8 A;  2IER A;  5AAS A;  4WXC A;  3L7Z A;  2C38 B;  1MG7 A;  1YYO A;  2E1R A;  1ZM4 A;  4X66 E;  2LTS A;  1GQE A;  3TQM A;  2AJ4 A;  4DPW A;  2JPA A;  2EMX A;  1XNQ E;  4LF8 E;  4FW3 A;  4MYT A;  3MSW A;  2JT2 A;  3GON A;  1XMQ I;  2EML A;  1Z0V A;  4YY3 E;  2O1V A;  5C0X B;  5T6J A;  2EOQ A;  2LO3 A;  4BC7 A;  4NXN E;  1KKH A;  1Y6Z A;  4NHR A;  3BF2 A;  5K36 D;  2WBT A;  5IWA I;  2YTO A;  2GO4 A;  2EMZ A;  2RSM A;  4JV5 E;  5ELW A;  4DR4 E;  2GPI A;  1KIJ A;  4AID A;  2HHH E;  1USV A;  2EOI A;  4DMI A;  2UUB E;  1USU A;  4Z7Y A;  4FW5 A;  4F6M A;  1JK1 A;  2EMA A;  4IFD E;  4ZYG A;  2F8B A;  4R2S A;  2PO2 A;  4MYU A;  1N33 I;  2VQF E;  2RS7 A;  2DLQ A;  2ZM6 E;  4Q28 A;  4ZVI A;  3P3E A;  2PO1 B;  4JI5 I;  4LU9 A;  4MU0 A;  3F6H A;  4DV1 I;  4DV4 E;  1DAR A;  1OYS A;  4R2A A;  1YYK A;  4DV7 E;  2JE6 B;  3PS3 A;  1N34 E;  3P3C A;  1X3C A;  5C0X D;  2JEA A;  4JI3 E;  2WP8 A;  1X6E A;  2LV2 A;  4GKK E;  1TF3 A;  2ELZ A;  1QU6 A;  4HTG A;  1IBL E;  4AM3 A;  4JYA E;  4X9J A;  4F9A B;  2KHX A;  5LLQ A;  2EOO A;  4ZYD A;  1FI4 A;  4FK5 C;  2WW4 A;  4DR3 E;  2EM4 A;  2BM1 A;  1ZU1 A;  1T38 A;  1FWK A;  1KTV A;  4ZYE A;  1F2I G;  2LVH A;  2NPF A;  2EPU A;  2RPC A;  2Z5C B;  2EOR A;  4DU7 A;  2V8Q B;  2V87 A;  1UBD C;  2LJP A;  1NEI A;  4MU4 A;  4WUB A;  4OX9 E;  3P3G A;  4JI6 I;  2L8T A;  4R2C A;  5K36 F;  2E1M A;  5A69 A;  1WHN A;  1WXR A;  1N32 I;  4B3M I;  2LJH A;  1BBO A;  2ELY A;  2EPL X;  4DR1 E;  2CTD A;  2EPZ A;  3PYD A;  2R76 A;  5K36 E;  1IQO A;  3J80 Q;  5AC4 A;  3J7A G;  1A1L A;  1Z0E A;  1IMU A;  1PKP A;  4AQY E;  4M9V C;  4B3S E;  1WUU A;  3J81 C;  2UXB I;  2Z5B A;  4BBY A;  4BHB A;  2WNR A;  3C4B A;  1Z1B A;  3HQ1 A;  1ZM3 A;  2DEJ A;  2NN6 A;  4DR2 I;  3VHT B;  2JP9 A;  4N4R B;  1ZR9 A;  2V2V A;  2ADR A;  3L7Z B;  4HXZ A;  4JI8 I;  4BCA A;  5LMN I;  1VIS A;  3BID A;  5IT9 Q;  2EMY A;  4DV3 I;  5C0X F;  2I13 A;  2C39 A;  3HTX A;  2EM2 A;  4BMJ A;  5AE3 A;  4X65 E;  2O3Z A;  2EMW A;  4LPF A;  4OO1 E;  2GQ0 A;  2L6M A;  1J5E E;  1L4S A;  5A2Q Q;  2AE8 A;  4FW6 A;  2C37 A;  1WRJ A;  2DIX A;  4X64 I;  4JI1 E;  3LNU A;  2A25 A;  2YSO A;  4DV0 E;  5DRO A;  5AC5 A;  1HNZ E;  4JI0 I;  2YTP A;  2EPC A;  3OTO I;  2GO3 A;  4NXM I;  4LF6 I;  4DKK A;  2UUC I;  3BBG A;  3EQ1 A;  4LTY A;  5A6B A;  4DR5 E;  1Y5Y A;  2YTF A;  2BR2 A;  4KQV A;  3WU5 A;  4DUZ I;  2VQE E;  2FGG A;  2EOF A;  5BR8 E;  1X5W A;  5DNX A;  1XXE A;  2EM5 A;  1OJ4 A;  2PO2 B;  2UU9 E;  4HAC A;  3EPL A;  1A6F A;  4M0V A;  1UHZ A;  4JI2 I;  1EH7 A;  1YPN A;  2EMF A;  3T1H E;  4UTG A;  1IBK I;  2B3T B;  2EMK A;  4LFB E;  4DV6 E;  4DUY E;  5EKW A;  1YSA C;  1UEK A;  2EN7 A;  4JI4 I;  1LLM C;  3M7N D;  2JEA B;  4IZJ A;  2CSH A;  2YTQ A;  2WP8 B;  3WU3 A;  2F4V E;  2X36 A;  2RQL A;  2EQ0 A;  3ADG A;  2LUQ A;  1RQ0 A;  4BA1 A;  4FW4 A;  3ZZ0 A;  3P06 A;  1FKA E;  1EA6 A;  3QT6 A;  4FWG A;  1TF6 A;  4USK A;  2O1T A;  2EPO A;  2EM7 A;  4O5G A;  2LTR A;  4K0K I;  5AE1 A;  2V8P A;  1ZBT A;  3ZZT A;  3CDJ A;  3OML A;  3M85 D;  3M7N G;  5KL5 A;  2E5L I;  1Z0W A;  4R2Q A;  2YSP A;  2LT7 A;  1X47 A;  1XMQ E;  1U2R A;  2O1U A;  2PNZ B;  4URL A;  4DR7 E;  1NHI A;  2PNL A;  5A6J A;  1XNR I;  2NA2 A;  1SR9 A;  4LCF A;  3Q6M A;  1NZ0 A;  5JEA E;  5IWA E;  4IFD C;  2UXD I;  4P52 A;  3F0N A;  5FLX C;  2EQ3 A;  3C6K A;  1ZXM A;  2CG9 A;  2R1F A;  5A6K A;  4NZV A;  1G2D C;  4X62 E;  3M85 G;  2K7I A;  2EPA A;  2A2D A;  1S16 A;  2HK2 A;  3EPK A;  1N33 E;  2YPN A;  4FN5 A;  2EOH A;  4DPY A;  2EM9 A;  1A1I A;  3KZY A;  2WNR B;  4RHB B;  2WZO A;  1T4L B;  1G2F C;  3M99 B;  2EFG A;  2HKE A;  2EOZ A;  2JY9 A;  2NN6 B;  1EI1 A;  4LF5 I;  2L2N A;  2YTN A;  3KWR A;  2JOX A;  4DV1 E;  4KHP E;  3T1Y I;  5LMU I;  1UDS A;  3AUZ A;  4DPX A;  4IFD A;  2EPN A;  5FWK A;  4R1F A;  3HPS A;  3HKM A;  2C39 B;  3PS1 A;  2YTI A;  2UXC I;  1PDA A;  4YHH I;  3RMP A;  2UUA I;  4U3D A;  3J7Y p;  2L2M A;  3HPZ A;  2EQ1 A;  3K85 A;  4P7A A;  1GZ6 A;  2YRK A;  2M1S A;  3B8H A;  2EPX A;  2C37 B;  2LRS A;  4GKJ E;  3HXL A;  5DRP A;  3DD6 A;  4TUI A;  4O43 A;  4GZN C;  4LF9 E;  4B3R E;  4LF8 I;  2YRM A;  2HKJ A;  1B69 A;  1XMO I;  2ODR C;  2HK3 A;  2OI2 A;  2EP3 A;  4R2P A;  2NN6 D;  3C4T A;  3GCM A;  4LF7 I;  1TN9 A;  2BR2 B;  4NXN I;  2LMZ A;  5K36 C;  4JI6 E;  4GQU A;  2MC6 A;  1N32 E;  4OKG A;  5L3J A;  4HAC B;  4B3M E;  4B3T I;  2V2Q A;  2HHH I;  1P42 A;  3ZKB A;  2HGH A;  3ZOQ B;  4ZYH A;  2UUB I;  2V34 A;  3BGH A;  1PJT A;  4OOG C;  2EJ4 A;  2XEX A;  1R6M A;  2L92 A;  4HY1 A;  4BHC A;  3Q1Q A;  5IXM B;  3ZZU A;  4IJD A;  2A2C A;  4IZJ B;  4LF4 I;  2PNM A;  2HFU A;  1Y4S A;  1UN6 B;  4DR2 E;  4WUC A;  2EMB A;  1Y4U A;  1YH8 A;  1HR0 E;  1FWL A;  4JI8 E;  4BA1 B;  5LMN E;  2EZ6 A;  2L2K B;  1Z59 A;  1QNT A;  2YZT A;  2PRT A;  3VYY A;  5A6B D;  2IOQ A;  4OO1 C;  4FW9 A;  1Y60 A;  4LOM A;  4DPT A;  4IS9 A;  4F2J C;  4WYQ B;  5DNL A;  4IS1 C;  1ZAA C;  2V89 A;  1T4O A;  1UDQ A;  3KRN A;  2EPR A;  2GHF A;  2LJU A;  2L3J A;  1JK2 A;  3PRY A;  4WUD A;  2ENH A;  2LE2 A;  3IWC A;  2Q8U A;  3VK6 A;  2WCC 3;  4Q35 B;  1MEY C;  1N0V C;  2O1W A;  4FW7 A;  5DRR A;  4LFC I;  1H73 A;  2FTX B;  4NXM E;  1YUJ A;  1HNW I;  4LF6 E;  4IZJ D;  2JYA A;  1PIE A;  4JG4 A;  4MU1 A;  4PRX A;  5C0X E;  1SFE A;  2EMG A;  4OO1 A;  1D6T A;  1MGT A;  2NN6 F;  1B62 A;  3ECR A;  1DGC A;  4FWD A;  5IV8 B;  1HNX I;  2EM0 A;  4JI2 E;  2EMC A;  3J80 C;  1IBK E;  4DR1 I;  2EOS A;  1AH5 A;  2V88 A;  2BM0 A;  4OZE A;  2BB8 A;  5GME A;  3DJW A;  4TUG A;  1N36 I;  2EN1 A;  1KJK A;  4L8N A;  1T4N A;  3H4L A;  4QNJ A;  2IOP A;  4IFD B;  1Z0G A;  1EKZ A;  2GS8 A;  3JAM Q;  3DF6 A;  2E72 A;  2EL4 A;  3VYX A;  1H72 C;  3V2U C;  1RRE A;  1H74 A;  2EPK X;  4KZS A;  4LCG A;  4U3B A;  5IT9 C;  3GME A;  4WPY A;  1DI2 A;  2V86 A;  1RC7 A;  2YT4 A;  2IES A;  1HK7 A;  2NUG A;  4DV2 I;  2PO0 A;  4LFA E;  4WSP A;  3PYE A;  4K0K E;  5JEA C;  2Q2E B;  5A2Q C;  1A1G A;  4DV5 I;  4WX9 A;  4X65 I;  2YU5 A;  1I94 I;  2E5L E;  4BC9 A;  1Z0B A;  1K47 A;  3CWV A;  2EN8 A;  3EPH A;  4IZK A;  2Z5E A;  1X6H A;  1NHJ A;  1J5E I;  2ENA A;  3HUL A;  5TSE A;  2YU8 A;  2H36 X;  2EN2 A;  4P78 A;  1E3H A;  4DR6 I;  4J8Z A;  1O0W A;  4R2D A;  4IFD D;  2G7H A;  2MDR A;  3ZKD A;  1E3P A;  1YZ9 A;  2N3H A;  2JVA A;  2HFS A;  3ADL A;  3ADJ A;  4WFT A;  2DGC A;  3B82 A;  4PRV A;  1UIL A;  2EL6 A;  4O24 A;  5JEA A;  1FJG I;  1ELO A;  2UU9 I; 
#chains in the Genus database with same CATH homology
 2DB2 A;  4EMD A;  4LF5 E;  1B63 A;  4DV6 I;  4X8W A;  1MX0 A;  3IWB A;  1STU A;  3T1Y E;  5LMU E;  2DEI A;  2IHR 1;  2M4I A;  2Z5B B;  1QZR A;  4JI7 I;  2UXC E;  1DQ3 A;  4YHH E;  2LUP B;  2UUA E;  4JI5 E;  4M1K A;  1IBM I;  3B78 A;  3M6A A;  5LL6 R;  5GMD A;  3PYG A;  3Q6N A;  3F6G A;  3IWD A;  2MC5 A;  2B7T A;  2V2Z A;  1XMO E;  3QT5 A;  2ODR D;  2JR1 A;  4DR7 I;  4LF7 E;  4I3H A;  2VF3 A;  2J7K A;  4X66 I;  3K6Q A;  3QT8 A;  2M7Q A;  1H7S A;  3HJC A;  1XNQ I;  4B3T E;  1X48 A;  5CFF E;  2JWO A;  2LBS B;  4YY3 I;  1S4E A;  2KOU A;  2DSY A;  4X62 I;  1FNM A;  3AV0 A;  3JU0 A;  4HYM A;  2N3G A;  4I8O A;  1PVG A;  4LF4 E;  2BV3 A;  4JV5 I;  1Z5C A;  4DR4 I;  2V83 A;  3J7A M;  1WHQ A;  4KHP I;  1Z5A A;  3PYF A;  2NUE A;  1J26 A;  2R42 A;  3H09 A;  2UXB E;  2VQF I;  2ZM6 I;  3QT7 A;  3J81 Q;  1ZM2 A;  4GEQ B;  4XTJ A;  3LPS A;  4IZK B;  3JTZ A;  4DV4 I;  4DV7 I;  4GKJ I;  4FWH A;  4DV3 E;  1N34 I;  4LFC E;  4JI3 I;  4L5N C;  2V85 A;  4GKK I;  4LF9 I;  4B3R I;  1HNW E;  4UT4 A;  1IBL I;  1YYW A;  4JYA I;  2ZIT A;  4DR3 I;  1H7U A;  3LLH A;  4X64 E;  1HNX E;  2VF1 A;  2K4V A;  4JI0 E;  3OTO E;  4DU8 A;  2JOB A;  4USM A;  1KVK A;  2UUC E;  3D4J A;  4RPF A;  2CGE A;  2RTX A;  4R8O A;  3ADI A;  1ZM9 A;  4OX9 I;  4DUZ E;  1ZBQ A;  1N36 E;  2ZBK B;  3WU4 A;  3FIG A;  5ADZ A;  1HR0 I;  4DV2 E;  2FV4 B;  4AQY I;  4JI4 E;  4B3S I;  4ED4 A;  4PU9 A;  1ZXN A;  2NUF A;  4DV5 E;  1XHK A;  1I94 E;  3LML A;  3ZM7 A;  4Z7C A;  4F9B B;  2RS6 A;  1MU5 A;  2CPN A;  4F54 A;  1N0U A;  2CZ9 A;  4DR6 E;  4N3O A;  2EWL A;  3K17 A;  2X7I A;  4M2Z A;  1NHH A;  2DMY A;  4F9C B;  1XNR E;  5F3W A;  1RR9 A;  2VE7 C;  4JI1 I;  1Z0T A;  1FJG E;  4DV0 I;  2L3C A;  2UXD E;  2R3V A;  2L33 A;  1HNZ I;  1BKN A;  2Z5C A;  4DPU A;  3WU6 A;  4DR5 I;  3P1X A;  2VQE I;  5FLX Q;  3JAM C;  5BR8 I;  1Z0C A;  3K1J A;  5DNY A;  4JI7 E;  4R03 A;  5AE2 A;  4P7D A;  3T1H I;  3V5R A;  4DXL A;  2B9D A;  4M30 A;  4LFB I;  1X49 A;  4DUY I;  1IBM E;  2B7V A;  4LFA I;  2F4V I;  4BS9 A;  3LTO A;  1Z5B A;  2KON A;  5AAS A;  1MG7 A;  1YYO A;  2E1R A;  1ZM4 A;  4X66 E;  2LTS A;  1GQE A;  2AJ4 A;  4DPW A;  1XNQ E;  4LF8 E;  4MYT A;  3MSW A;  3GON A;  1XMQ I;  1Z0V A;  4YY3 E;  2O1V A;  5T6J A;  4BC7 A;  4NXN E;  1KKH A;  1Y6Z A;  5IWA I;  2RSM A;  4JV5 E;  4DR4 E;  1KIJ A;  2HHH E;  1USV A;  4DMI A;  2UUB E;  1USU A;  4Z7Y A;  2F8B A;  4MYU A;  1N33 I;  2VQF E;  2RS7 A;  2ZM6 E;  4Q28 A;  4ZVI A;  4JI5 I;  4LU9 A;  4DV1 I;  3F6H A;  4DV4 E;  1DAR A;  1YYK A;  4DV7 E;  1N34 E;  4JI3 E;  4GKK E;  1QU6 A;  1IBL E;  4JYA E;  4F9A B;  2KHX A;  1FI4 A;  2WW4 A;  4DR3 E;  2BM1 A;  1FWK A;  1KTV A;  2NPF A;  2Z5C B;  4DU7 A;  2V8Q B;  2V87 A;  2LJP A;  4WUB A;  4OX9 E;  4JI6 I;  2L8T A;  2E1M A;  1N32 I;  1WHN A;  1WXR A;  4B3M I;  2LJH A;  4DR1 E;  3PYD A;  3J80 Q;  3J7A G;  1Z0E A;  1PKP A;  4AQY E;  1WUU A;  4B3S E;  3J81 C;  2UXB I;  2Z5B A;  4BBY A;  3C4B A;  3HQ1 A;  1ZM3 A;  2DEJ A;  4DR2 I;  4HXZ A;  2V2V A;  4JI8 I;  4BCA A;  5LMN I;  1VIS A;  5IT9 Q;  4DV3 I;  3HTX A;  4BMJ A;  5AE3 A;  4X65 E;  2GQ0 A;  2L6M A;  1J5E E;  5A2Q Q;  2DIX A;  4X64 I;  4JI1 E;  3LNU A;  4DV0 E;  4JI0 I;  1HNZ E;  3OTO I;  4NXM I;  4LF6 I;  4DKK A;  2UUC I;  4LTY A;  4DR5 E;  4KQV A;  3WU5 A;  4DUZ I;  2VQE E;  2FGG A;  5BR8 E;  1OJ4 A;  2UU9 E;  4HAC A;  1A6F A;  4JI2 I;  4M0V A;  1UHZ A;  3T1H E;  4UTG A;  1IBK I;  2B3T B;  4LFB E;  4DV6 E;  4DUY E;  1UEK A;  4JI4 I;  4IZJ A;  3WU3 A;  2F4V E;  2X36 A;  3ADG A;  2LUQ A;  1RQ0 A;  3ZZ0 A;  3P06 A;  1FKA E;  1EA6 A;  3QT6 A;  4FWG A;  4USK A;  2O1T A;  2LTR A;  4K0K I;  5AE1 A;  2V8P A;  1ZBT A;  3ZZT A;  3OML A;  2E5L I;  1Z0W A;  2O1U A;  5L3J A;  1XMQ E;  1X47 A;  1U2R A;  4URL A;  4DR7 E;  1NHI A;  2PNL A;  1XNR I;  2NA2 A;  1SR9 A;  3Q6M A;  1NZ0 A;  5IWA E;  2UXD I;  4P52 A;  3F0N A;  5FLX C;  1ZXM A;  2CG9 A;  4X62 E;  2A2D A;  1S16 A;  2HK2 A;  1N33 E;  4FN5 A;  4DPY A;  2HKE A;  2WZO A;  1T4L B;  2EFG A;  4LF5 I;  2JY9 A;  1EI1 A;  2L2N A;  3KWR A;  2JOX A;  4DV1 E;  4KHP E;  3T1Y I;  5LMU I;  3AUZ A;  4DPX A;  5FWK A;  4R1F A;  3HPS A;  2UXC I;  4YHH I;  3RMP A;  2UUA I;  3J7Y p;  3HPZ A;  2L2M A;  3K85 A;  4P7A A;  1GZ6 A;  2M1S A;  3B8H A;  2LRS A;  4GKJ E;  3HXL A;  4TUI A;  4LF9 E;  4B3R E;  4LF8 I;  2HKJ A;  1XMO I;  2ODR C;  2HK3 A;  2OI2 A;  3C4T A;  4LF7 I;  4NXN I;  2LMZ A;  4JI6 E;  2MC6 A;  1N32 E;  4HAC B;  4B3M E;  4B3T I;  2V2Q A;  2HHH I;  3ZKB A;  3ZOQ B;  2UUB I;  2V34 A;  4OOG C;  2XEX A;  2L92 A;  4HY1 A;  3Q1Q A;  3ZZU A;  2A2C A;  4IZJ B;  4LF4 I;  2PNM A;  2HFU A;  1Y4S A;  4DR2 E;  4WUC A;  1Y4U A;  1HR0 E;  1FWL A;  4JI8 E;  5LMN E;  2EZ6 A;  2L2K B;  1Z59 A;  2YZT A;  2IOQ A;  3VYY A;  4FW9 A;  4DPT A;  4WYQ B;  2V89 A;  1T4O A;  2L3J A;  4WUD A;  3PRY A;  2LE2 A;  3IWC A;  3VK6 A;  4LFC I;  1N0V C;  2O1W A;  1H73 A;  2FTX B;  4NXM E;  1HNW I;  4LF6 E;  4IZJ D;  1PIE A;  4JG4 A;  4PRX A;  1D6T A;  1B62 A;  4FWD A;  1HNX I;  4JI2 E;  3J80 C;  1IBK E;  4DR1 I;  2V88 A;  2BM0 A;  5GME A;  3DJW A;  4TUG A;  1N36 I;  4L8N A;  1T4N A;  3H4L A;  2IOP A;  1Z0G A;  1EKZ A;  2GS8 A;  3JAM Q;  3DF6 A;  3VYX A;  1H72 C;  3V2U C;  1RRE A;  1H74 A;  4KZS A;  5IT9 C;  4WPY A;  1DI2 A;  2V86 A;  1RC7 A;  2YT4 A;  1HK7 A;  2NUG A;  4DV2 I;  4LFA E;  4WSP A;  3PYE A;  4K0K E;  2Q2E B;  5A2Q C;  4DV5 I;  4X65 I;  1I94 I;  2E5L E;  4BC9 A;  1Z0B A;  1K47 A;  3CWV A;  4IZK A;  1J5E I;  2Z5E A;  1NHJ A;  3HUL A;  2H36 X;  4P78 A;  4DR6 I;  1O0W A;  4J8Z A;  2G7H A;  2MDR A;  3ZKD A;  1YZ9 A;  2N3H A;  2JVA A;  2HFS A;  3ADL A;  3ADJ A;  4WFT A;  3B82 A;  4PRV A;  1UIL A;  1FJG I;  1ELO A;  2UU9 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...