5IWAL

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule keywords 30S ribosomal protein S2
molecule tags Translation
total genus 20
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5iwaL00
4YWKA 4UP7A 5IYBG 4OWXB 1Q7YC 3E0EA 2UUBQ 4X62L 4BY7H 4IOAA 3FKIG 1I94Q 4X66L 3HOZH 3M4QA 1PV4A 3TQYA 1T9HA 4MNOA 2JE6I 1PH8A 1EQQA 1Y1WH 4DV2Q 5BR8L 1XMOQ 1L1OC 1IBLQ 4IJLA 1FGUA 2AKWB 1EYGA 3EIVA 4APVA 1ASYA 3ULPA 3F2DA 1A8VA 1Q81C 5AJ3L 1BBWA 3L0OA 3CMEA 4LNQA 4A3CH 1QUQB 2CWPA 4LF4Q 1UE6A 2ZTDA 4JI2L 4OO1I 2H5XA 2DUDA 3OYYA 2VQEQ 4OX9Q 3MXNB 1HJPA 4BBRH 4YHHQ 5M3FH 2L15A 2EQSA 1MIUA 3D0FA 4DAYB 4DUZL 4HJAA 3T1YL 4B3SQ 3I4MG 1XMQL 3RN2A 2K5NA 4UP9A 2K75A 2WFWA 3IRBA 4DV6Q 1J5EL 3OW2A 4JG2A 5GAHC 1X65A 3PUYA 1GD7A 4P74A 3GTLH 1XJVA 4A3IG 2I5MX 3HOYG 3J80i 3E9IA 3ERSX 2KHIA 1IBML 1L1OA 2JQOA 1HZCA 5M5YH 4A3KH 1K73C 2UXBQ 1VCIA 3PUVA 4EQ5A 1E22A 1VQCA 4LF7Q 4A76A 2HQLA 4JI5Q 2NN6G 1YBYA 2AWOA 4BY1H 1N9WA 4A3DG 3H0GG 4WJ4A 1X6OA 4GKJQ 3PO2G 1XPOA 2QEXA 3GTGH 4HJ9A 4XTCS 5LMUL 4DR5L 4A3BH 3S1QH 1X56A 5FLXc 1H95A 1V9PA 1YHAA 4DV1L 2E2IH 3AEVA 4DV5Q 3UE0A 5HY6A 5M3MH 3ULJA 2EIFA 1I6HH 4HIKA 2JJQA 1N32Q 3TS2A 2UU9L 3NENA 4JV5L 1Q8KA 1N34Q 4DR2Q 2R93G 1G6PA 2C35B 1B7YB 4GLAC 1EQRA 3PO3H 3PIOA 2ID0A 2AMCB 1KIXA 1HNWL 4JBWA 4GKKL 1QZHA 4A93H 1YI2A 4YCUA 2MO1A 4BY7G 1V1QA 5M5WH 5IT9c 3H15A 2UXCL 5C4XH 1D8LA 2N49A 4LF6L 3HOZG 4HJ7A 4JI3L 3FHWA 4UP8A 5C3EH 3U58A 1HNZL 2OTLA 4NXML 3DLLA 1RIPA 4JI1L 1E1OA 1Y1WG 1PA6A 2D62A 3RZOH 3BU2A 2LXJA 4AYBG 2VW9A 2NN6I 4LUZA 4A3CG 4P75A 1TXYA 5IP9G 1Z9FA 2Z0SA 5FLMH 1A62A 4KHPQ 4YY3L 2JA6G 1VQEA 4LFBQ 1C9OA 4KHZA 4DV0Q 1XNRQ 2Z6KA 4X65Q 1S40A 2Y0SG 4P71A 4BBRG 5M3FG 1XPUA 5IYDG 1YJNA 1VQ7A 1N33Q 1YHQA 2MFIA 3K7UC 3MEFA 1M90C 4L5SA 2JA7H 1IBKQ 1CKNB 2PQAB 3A0JA 4JYAQ 1VQOA 4DR1Q 3FP9A 1NBWA 3WWVA 3I4NH 4GNXC 2ZJPA 4YWLA 1YZ6A 2K50A 4MTNA 3PUZA 1PH5A 1PH9A 1S3OA 1OXVA 4A3KG 1JB7A 1WCMH 5ELOA 1A63A 1VQMA 1OXUA 4POGA 4BBSH 1N8RC 4DV3Q 4B3RL 1B8AA 5JEAJ 4L5RC 5C0XJ 2KCTA 2HHHL 4BY1G 2WB1E 3CCUA 3I56A 4DUYQ 2NVTH 4GNXB 1L2FA 3I2ZA 3HFZB 2BH2A 2RHSB 4AH6A 1JJGA 4L5QA 1X54A 3PGZA 2ASBA 2Q2HA 1UWVA 1NY4A 4DR7Q 1YNXA 1W3SA 1SLJA 4A3BG 3L7ZC 4DAMA 4DK3C 5JEAG 2R6GA 5C0XG 1TWGH 3HOXH 2YTXA 2XTIA 2ZM6Q 3J7A5 3W1BA 2PNHA 2AHOB 5M3MG 2E2JH 4LFCL 1VQFA 2OWOA 1WOCA 5GAGC 3OTOQ 4DV4Q 2HIVA 2VUMG 4IFDJ 4A3LH 4A3MG 1Q46A 3PSIA 1O7IA 3CCQA 1EIFA 3AFPA 1X3EA 3RZDH 3PO3G 1B70B 2PI2E 4MZ9A 2E5LL 3KYHC 5IWAL 3PF5A 3H3VI 5LMNQ 5K36G 1KHIA 1HR0L 4IFDG 4UPAA 1D7QA 4B3TQ 1Y14B 3M4OH 2RHQB 1PH4A 3KDFB 3B6YA 2VQFQ 4GOPB 4LF8Q 2D0PA 1QZGA 5C4XG 1K83H 2KCMA 4R4TA 1K8GA 1BKBA 4QL5A 3S16H 4R4OA 4X64L 1BBUA 5C3EG 2UXDQ 4HJ8A 3J7ZC 2V1CC 3F8TA 2YU9H 4AQYL 2JEAI 4NXNL 3DM3A 3KJPA 5IP7H 3VDYA 1IYJB 1MKHA 4YWMA 1XNQL 1PH2A 5FLMG 3G4SA 3GTKH 3M3YH 2GN5A 3CCMA 3UDXA 1OTCA 1EUJA 2OQ0A 1VQLA 1VQ8A 1LTLA 4GN3B 2VL6A 4HIOA 5J3BA 2UUCQ 1VQBA 2LXKA 2QGQA 1C0AA 4JI7Q 2WAQE 1HR0W 4JI0Q 1DGSA 1X55A 1E1TA 4O2DA 2BA1A 3PUWA 1QUQA 2JA7G 1UEBA 5FJ8H 1FVIA 1WYDA 2NVXH 2ZJRA 3KF6B 1AH9A 1Q1BA 2PMZE 4JOIC 2UUAL 4IPDA 4JI8L 4DR3Q 1M1KC 2N8NA 5IYCH 1P16A 2I5LX 4A3JH 2ZTEA 3NBHB 4POFA 1PYBA 4GN5A 1HNXQ 1V43A 1VQ5A 3M85A 1VQ6A 3GTQH 3GTPH 1SMXA 2JEBI 4IFDI 1Y1VH 4LF5L 3S1NH 1WCMG 1N36L 1KL9A 2YTYA 1Q12A 4B3ML 1VQIA 1Q86C 4TQUS 1I3QH 2RF4A 1KRTA 2MO0A 4P73A 2A19A 3TS0A 3CCVA 3M7NA 4GN4B 4A4IA 3A74A 3J81j 1YHBA 3PIPA 1YJWA 2R92H 3GTMH 4KI0A 2Q2TA 4DR4Q 1UE7A 3K0XA 1YITA 5JJLA 1TWAH 2IX1A 1CKMA 4DV7L 2OQKA 4C2MH 3S15H 3CCRA 1OXSC 4DR6L 3HOXG 4C3IH 4IJHA 1FL0A 3K7AH 4LFAL 2ATWA 2F4VL 1Q1EA 2NVYH 1E24A 3NELA 4IO9A 3T1HQ 1A0IA 4JOIA 1OXTA 1X3GA 2KENA 4A3LG 1KXLA 4JI4L 4JI6L 1FJGL 1VQPA 2IX0A 2NZOA 4LW1A 4LF9L 5HGQA 4BXXH 1KD1C 1K9MC 2YTVA 3CCSA 4A3EH 4X62Q 1PHJA 1K0RA 5GQOA 3RN5A 4Y52H 4X66Q 3W5OA 1GM5A 3KOJA 4QGUA 1XPRA 5C44H 1PH6A 1NE3A 4K0KL 4H02A 1X3FA 2UUBL 1IXRA 2OTJA 2IHFA 5BR8Q 4NB3A 2HIXA 3G71A 5IYBH 1I94L 2E2HH 1EFWA 1YJ9A 1SE8A 2B63H 1HZ9A 1E3PA 1SROA 1TWFH 4DKAC 4FDBA 4DK6C 5H1SE 5IP7G 2R7ZH 5AJ3Q 4DV2L 1XMOL 1IBLL 3TRZA 4NPSA 3CC2A 3JAMc 1TWCH 4JI2Q 3U4ZA 3E9HA 2CCZA 1GO3E 3A5UA 2YYZA 4DUZQ 3T1YQ 4LF4L 2CQOA 4PZ8A 2IT1A 1XMQQ 2VQEL 5FJ8G 1BVSA 4IPGA 1PH1A 1J5EQ 4OX9L 3CPFA 4YHHL 3S17H 2MQHA 4B3SL 3CQZH 2LSSA 4A3JG 5IYCG 1QVGA 4AIMA 1P8LA 3S2HH 1IBMQ 5C4JH 2VY3A 4DV6L 3A5ZB 4WJ3M 1TWHH 2D0OA 4RMFA 4ALPA 1CKNA 2PQAA 4L5TA 4JBKA 5JJIA 2IHEA 4J15A 4PG3A 4Y7NH 3CD6A 1S72A 4R4QA 2JA5H 3HOYH 2UXBL 2CWAA 4X6AH 2I5HA 3RLFA 4LF7L 3M9BA 4JI5L 4A3FH 1YIJA 2R92G 1LM0A 5LMUQ 4DR5Q 3BJUA 3PV0A 4R4IA 1NJIC 4DV1Q 2A1AA 3JC66 3U4VA 4GKJL 4GOPC 2JK8A 2WP8J 5IY0A 4DNIA 3H0GH 1MJEA 2CKZB 4GNXA 1CSQA 1XTDA 1QVCA 2UU9Q 3HOVH 2KBNA 4JV5Q 5EAYA 3UE1A 1WJJA 4DV5L 3SGIA 4A75A 1UE5A 2K52A 3U50C 2A8VA 3D31A 4A93G 3HOUH 4OONA 1N32L 2MNAA 4BXXG 3TREA 1Q82C 2RCNA 1HNWQ 4GKKQ 5GROA 2Q2IA 1N34L 4DR2L 3TEHB 4BA2I 4A3EG 1HZBA 3S14H 3BZKA 4RG1A 3J81c 1HZAA 2UXCQ 4LF6Q 2R93H 1I50H 5C44G 4JI3Q 1VQ4A 4AYBE 3GTOH 1HNZQ 4NXMQ 3Q8DA 3LGJA 4JI1Q 3M4PA 3STBD 4QJFA 2B63G 3K8AA 3KDFA 3I4OA 1L0WA 1GKHA 1WFQA 4GOPA 2R7ZG 1AE3A 2R7DA 4HJ5A 1JMCA 1QVFA 4O0AA 5C0XI 4GLXA 4YY3Q 2Y0SE 1SR3A 2HT1A 2ZJQA 2B3GA 1KC8C 2NVQH 1ASZA 2Q2UA 3S1MH 4TVAB 3CW2C 1CKOA 2AWNA 1VS0A 1K8AC 4KHPL 3NEMA 4LFBL 3CP0A 3CF5A 4EX5A 3UDFA 5IP9H 3KJOA 4DV0L 2N78A 4OWWB 1XNRL 4X65L 4A3GH 4OXPA 3CCLA 4PMWA 2JA6H 3I4NG 5DLQE 3KF8B 1L1OB 1WI5A 3K81C 1N33L 2JA8H 1EWIA 1NMFA 3CC4A 1IBKL 5IYDH 4BBSG 4JYAL 3ULLA 3GDEA 4DR1L 3H3VH 3CPWA 2R7FA 3F2BA 2YV5A 3EBEA 3HKZE 1YVCA 3KF6A 4B3RQ 1AE2A 1UE1A 1SN8A 2HHHQ 2OCEA 1VQAA 2JA5G 4R4CA 2K14A 2VNUD 1G291 1SFOH 4JCVE 1U0LA 1PVOA 4A3FG 4DV3L 2CFMA 3KFUA 3STBC 3RLOA 1RL2A 4GS3A 4HIMA 1VQGA 1J6QA 5IE8A 4DUYL 3J80c 2K5HA 1X9NA 1GVPA 2WB1G 4LFCQ 4DR7L 3HOWH 2N3SA 3HOVG 1IZ6A 1VQKA 2K5VA 2ZM6L 3AYHB 1E7ZA 1VQDA 3UDIA 2E5LQ 1EIYB 5IWAQ 1K3RA 2F3IA 1U5KA 3OTOL 4DV4L 3HOUG 1HR0Q 2IY5B 3KLWA 3CC7A 1C7YA 4OWTB 2VUMH 4A3MH 4QIWE 1PYSB 3PUXA 5LMNL 2Z6KC 3JAMi 3S24A 4BA1I 3GO5A 4X64Q 4C3HH 3CMAA 4B3TL 3FKIH 3S2DH 4JBMA 1W2BA 2ZTCA 2VQFL 4LF8L 2DGYA 1PFSA 3EN2A 1EOVA 4AQYQ 4NXNQ 4LUOA 4LUVA 5E7NA 3L2PA 2ES2A 2UXDL 3ICEA 3RR5A 1XNQQ 2VS1A 1G51A 2BA0A 2FXQA 3ER0A 4YCVA 3K80C 2EXDA 4DPGA 2NZHA 1VQNA 3BZCA 4R1JA 1JE5A 3AQQA 3CAMA 3AFQA 1YEZA 4IPHA 4GLVB 3RNUA 4JC0A 3W1GA 1JJ2A 4QQBX 2UUCL 4A3GG 4IPCA 2I0QA 1OXXK 2UUAQ 4JI8Q 5LMNW 3GD7A 4JI7L 4JI0L 3I4MH 4IOCA 1Y1VG 2E8GA 2JA9A 2KHJA 2JA8G 2B29A 2WAQG 4XIGS 4C3JH 5GADC 1LYLA 3CCEA 1JT8A 4LF5Q 4PZ6A 3ZJYC 4DR3L 1N36Q 4A3IH 4B3MQ 1KQSA 3G6EA 1VQ9A 3HKSA 1LUZA 4KLKA 4QY7A 1HNXL 1CUKA 1NTGA 1CSPA 2BH8A 4LWCA 1NMGA 2GVAA 1SRUA 3F2CA 2PI2A 3UDGA 3CXCA 4A3DH 3CCJA 4DV7Q 3PO2H 2ALYB 4DR6Q 1JJCB 1IL2A 4DR4L 1VQHA 1VQJA 4PZ7A 4LFAQ 2F4VQ 4OO1G 3F1ZA 3HKZG 2F52A 1KRSA 3HOWG 4YCWA 3J81i 3PF4A 1Z47A 2VZAA 4P72A 4HIDA 4ME3A 3I7FA 3G48A 4JI4Q 4JI6Q 1FJGQ 3S1RH 2K4KA 1R9TH 2QA4A 4LF9Q 4UY8C 3GTJH 3T1HL 3I55A 2GVBA 1HH2P 5JJKA 1PH7A 1I5FA 1KAWA 4JBJA 1PH3A 1MJCA 2XGTA 3PCOB 5M5XH 5ELNA 3RLNA 5GAEC 4K0KQ
chains in the Genus database with same CATH superfamily
5CV9A 5I2XA 4OWXB 1MI2A 2M00A 4X62L 1EWHA 2SNSA 1PV4A 3TQYA 1PH8A 2LFNA 4DV2Q 3HKZB 2F0OA 4KMUC 4HCSA 4ABNA 1A8VA 1Q81C 1I4RA 1BBWA 2B2YC 5AJ3L 3CMEA 1O7YA 2GA4B 3MXUA 2ENBA 4NMZA 1UE6A 4JI2L 3MEHA 2DY7A 4H13C 2VUMB 3MXNB 1HJPA 4LAAA 4IALA 1MIUA 3T1YL 4DAYB 3H91A 2PZUA 1XMQL 1SBBB 2WFWA 2MGSA 1X65A 3C1FA 2KHIA 3KF8A 2JQOA 4PMBA 2UXBQ 5I9PA 3HG9A 1E22A 4RCNA 4LF7Q 4ILWA 4JI5Q 3RZOB 1ET6A 1YBYA 3P20A 2AWOA 4BY1H 3D4WA 3QR8A 1PTOC 4HJ9A 4XTCS 3NE5B 1MD2D 5D65A 3UE0A 5M3MH 1I6HH 4HIKA 2JJQA 4PQXA 1N32Q 3TS2A 1H9RA 3NENA 4JV5L 2JA7B 4KJOA 4FF4A 1HQMC 1EY8A 4IUNA 5JPMC 1QZHA 1YI2A 1EEFD 3NWTA 4YCUA 4ZQ3A 3MC0B 2UXCL 5C4XH 2N49A 5A35A 3HOZG 1SNPA 2NBFA 3FHWA 3U58A 1HNZL 3R2TA 2OTLA 1QNUA 3DLLA 1PA6A 1XXGA 3BU2A 2AQ3B 4FXDA 4P75A 1TXYA 1Z9FA 1EQVA 1K3BC 3HOXB 4LFBQ 2Z9HA 3K57A 4DV0Q 1XNRQ 2Z6KA 4DXFA 4BBRG 2G9HD 3T4AC 1YJNA 3K7UC 3MEFA 2K04A 1CKNB 4XQQA 1KNEA 3FP9A 1ML0D 3GV6A 3OW7A 4ZRZA 4O42A 3M4OB 4GNXC 4YWLA 3PUZA 1MHWC 4K8IA 1PH9A 1OXVA 4POGA 1QNKA 3W3AA 2HHHL 4BS9A 1K0SA 3CCUA 1O7ZA 4IUVA 4JW0A 3BDLA 4N8X1 4CDCC 4DR7Q 4FVMA 1VMCA 1SLJA 1W3SA 3L7ZC 4OELB 5BN4A 3W1BA 2PNHA 1A3VA 4IFDJ 3OTOQ 2VUMG 4JVZA 4KTAA 3R3OA 3CCQA 1EIFA 2ZT9C 2NVXB 4G7HC 1Y8PB 3RZDH 4MZ9A 4K2KA 3KYHC 5IWAL 2C5CA 2QCPX 1KHIA 1I4QA 5CV5A 1PH4A 1SMYC 3KDFB 5KGUA 4LF8Q 2D0PA 2DNCA 4N9TA 1K8GA 3S16H 1I3QB 2N88A 3CKIB 4IUUA 4HJ8A 3J7ZC 2BE5C 3F8TA 4X3UA 4XXEA 1SYDA 5T1IA 3DM3A 2B2UA 1LACA 1I6HB 1MBYA 5E1FA 4C2MB 2LKVA 4F87A 5FLMG 3GTKH 1OTCA 2VL6A 1DYQA 4ZLTF 2QGQA 3NPPA 2MUYA 4O2DA 1L0YB 3PUWA 5IIFA 2JA7G 1FVIA 4DFAA 1AH9A 1KDBA 1XYIA 4IPDA 2UUAL 4A3EB 2RCFA 2ZTEA 5COYA 4IFDI 1B50A 3T13A 3J7AF 2Z4HA 1N36L 4KY6A 3SEBA 1STHA 2TSSA 4TQUS 3J7AV 2CQAA 4ZUIA 5E3FA 3VYTA 2EY6A 1TWFB 2A19A 3J80L 4DK1A 3M7NA 4GN4B 3QWNA 3PIPA 3GTMH 1YHBA 4H7BA 4UHVA 5EKKA 2SOBA 3K0XA 2OF1A 1YITA 1TWAH 1F77A 3S15H 3CCRA 4CDFC 3HOXG 2KCCA 4F7XA 1X3PA 4IO9A 4JI4L 4J8QA 2RDHA 4LW1A 4BXXH 3NHHA 2YTVA 2KEEA 5C4JB 2M9VA 1K0RA 4NP5A 1Y8NB 1XPRA 5LHY1 5C44H 4H02A 4CBVA 2B39A 3ERQA 2HIXA 2JA5B 1E0BA 1KLUD 2KQ3A 2NUCA 1E3PA 1FYCA 1K8OA 4DKAC 1K28A 1QB5D 4DV2L 2L1BA 2Q8IB 3JAMc 2C9OA 4K8JA 3U4ZA 5EGTA 4HR7B 2R3ZA 1E2VA 3RZDB 3IL8A 4DUZQ 4RWSC 2CQOA 2IT1A 3JAME 1KNAA 1GHKA 4XDXA 3S16B 3TP6A 2HD3A 3L3OC 1IBMQ 2VY3A 5JVH3 4XT1B 1I50B 1PTOF 4MHEA 4L6TB 2IHEA 3TZDA 1S72A 3GTKB 2UXBL 2CWAA 2K5WA 2I5HA 4KN7C 4LF7L 4DGZA 3M9BA 4JI5L 3RD4A 4DR5Q 2A1AA 2F3VA 4GOPC 4DNIA 1CQVA 4OIJA 4CDDC 4GNXA 3ND8A 3NQIA 4A75A 1UE5A 2K52A 4A3GB 2CW0D 2KJXA 1N32L 1BUVT 4IUPA 2MNAA 3TREA 1Q82C 1HNWQ 1DZ1A 1EOTA 5GROA 4BA2I 3Q24A 4ULLA 1QOHA 1HZBA 3GQBA 3O13A 4A3EG 3S14H 5DM73 2R93H 3GTMB 3MWYW 4XQJA 3VR2A 1UAPA 1IW7C 1G6ZA 1TWAB 3S15B 3NBIA 1VF5C 1L0WA 1GKHA 2R7ZG 3Q0AA 1AE3A 1JMCA 1BCPB 5C0XI 4YY3Q 2ZJQA 2K05A 2NVQH 1ASZA 3DWAA 1CKOA 4LFBL 1FGBD 3CF5A 4DV0L 3KJOA 1XNRL 2E74C 2JA6H 1L1OB 2B2TC 2JA8H 1EWIA 1NMFA 2F0HA 3NUCA 3GDEA 2L12A 3CPWA 3FKIB 3QJYA 1YVCA 2OT2A 4B3RQ 4S3SA 2K28A 1AE2A 1KDCA 3SK4A 2OCEA 1VQAA 2JA5G 2WACA 3NBHA 1U0LA 3MXGA 2CFMA 4HIMA 3E6ZX 2A6EC 1GVPA 4LFCQ 4DR7L 4RCOA 1GJXA 5DEHA 1EYAA 1AFPA 2F0SA 1XWEA 3AYHB 1TKWB 1ZYRC 1UUPA 2VB2X 3WOFA 3OTOL 1QG7A 3I4MB 4RKBA 1HR0Q 5CBAE 1PZID 4FP5D 1C7YA 1SAPA 3EQLC 2XSCA 4OWTB 1SYGA 5KNBA 4QIWE 3DXJC 2HUGA 4KV6A 4LF8L 4B08A 3K59A 3EN2A 1EOVA 1JQYD 4NXNQ 2ES2A 1XNQQ 3OIPA 4A3DB 2JN4A 3NQTA 2FXQA 2A6HC 1XTCD 3K80C 4YIJA 4OIKA 4PV1C 2EY2A 2QW7A 1YEZA 1WD0A 2OEOA 3S1RB 3RNUA 3FRPB 1DONA 3I70A 3S14B 4A3GG 2I0QA 1OXXK 5LMNW 2R93B 3GD7A 2A68D 2HCIA 2Q8RE 5CGKA 5J1ZA 1ESRA 4EQNA 3IFDA 4BY7B 1HRJA 3G6EA 1V1PB 4KLKA 1GUSA 1CUKA 1CSPA 2NVQB 1JCKB 1RDPD 2ALYB 4DR6Q 1JJCB 1IL2A 4K5XA 4LFAQ 2FMCA 3F1ZA 2JA6B 2F52A 2A74C 1PDQA 3J81i 3PF4A 3G48A 2EVBA 1LT5D 1R9TH 3GTJH 2PZTA 5JJKA 3TN2A 2XGTA 3RLNA 3CU7A 4YWKA 2UUBQ 3U9SA 4C56C 3FKIG 5CYUA 4A3KB 3HOZH 1Z7TA 1T9HA 4MNOA 1HUMA 1IBLQ 2AKWB 1EYGA 1PZKD 3EIVA 3GTGB 4DNTB 3S1QB 1UNSA 4A3BB 3L0OA 3BS1A 3FVQA 4OO1I 2H5XA 1NSNS 4BBRH 4HJAA 4DUZL 3I4MG 1WTOA 3R93A 1Y8OB 4UP9A 4DV6Q 3OW2A 4JG2A 1EYCA 2E2DC 3PUYA 1IKLA 4P74A 2CVRA 2I5MX 5M5WB 2PYKA 5DM63 1IBML 4G7ZC 3CRKC 5M5YH 1K73C 2J7ZA 3PUVA 5C3EB 4EQ5A 4QIWB 2JYOA 1N9WA 4A3DG 4WJ4A 1X6OA 4KN4C 1BF4A 4HEDA 4R8NA 4DR5L 1X56A 5CMDA 2E2IH 1YHAA 3AEVA 3QOLA 4DV5Q 1TR5A 5CR3A 5HY6A 2EIFA 1HTPA 3MFYA 4DR2Q 2R93G 1G6PA 5ELDA 1VMPA 2PZWA 1HNWL 4UAIA 1KTKA 2QDBA 4BY7G 1HA5A 3H15A 1STYA 1D8LA 5J39A 3C1EA 4HJ7A 2LS01 1RIPA 1Y1WG 3RZOH 2EYJA 2NVTB 2LXJA 3A56A 2NN6I 4FXKC 4LUZA 3I73A 5FLMH 3C2PA 2Z0SA 1S5CD 4ZYSA 4KHPQ 4YY3L 2JA6G 3Q23A 4KHZA 4ME5A 1Q3LA 3VR5A 4P71A 5M3FG 1XPUA 3ONAB 1N33Q 2XRQD 1YHQA 2JA7H 1WTQA 1M90C 4M1UB 4L5SA 4KKTA 2PQAB 4JYAQ 2WKDA 1VQOA 4RH6A 3MZ5A 4QMGA 1YZ6A 2AQ2B 5LL6X 1S3OA 4A3KG 1RD9D 1A63A 4DV3Q 4B3RL 2DN8A 1EU4A 4K6DA 4PMCA 3I2ZA 1TS5A 2EYMA 2RHSB 4AH6A 1JJGA 5BN3A 3PGZA 2ASBA 4RGMA 1YNND 1YNXA 4A3BG 5AFWA 2HDLA 4V0BA 3VYUA 5C4HA 5JEAG 5C0XG 2R6GA 2B2UC 3HOXH 1J8IA 5KIXA 4LFCL 1VQFA 1NR2A 3OIQA 3PSIA 1SDFA 4R9WA 4XT3B 2P5ZX 2PI2E 4WORA 2QKIC 5M5YB 2X69A 3H3VI 2F0VA 5K36G 4NKLA 1HR0L 4H44C 4UPAA 3IFTA 5IT9L 4B3TQ 3M4OH 2RHQB 1EY0A 3GTQB 1MSGA 3B6YA 2VQFQ 1BR9A 3FDTA 3S1NB 2EYLA 1PFMA 4R4TA 1LTGD 4V190 5C3EG 2B2VA 1GXDC 3Q22A 1AZQA 2Z4IA 3OWEB 3VR4A 2E2IB 4NXNL 3DWQA 2F0LA 3KJPA 3VDYA 1IYJB 1MKHA 1XNQL 1F9QA 1PH2A 3G4SA 2O5IC 1YNJD 1EUJA 2OQ0A 4CKCA 1LTLA 4GN3B 2DNEA 1DOLA 1VQBA 2LXKA 4L63B 3M4YA 4QB4A 5M9OA 1HCZA 3DHQA 3OOCA 1UEBA 2NVXH 1WTRA 1O7LA 1EY7A 4DR3Q 1EIHA 1P16A 3MXNA 1STEA 1D5XC 1PYBA 4GN5A 1SEBD 1V43A 4DAYA 1VQ5A 1VQ6A 3GTPH 2BDOA 1Y1VH 5KNDA 1KL9A 2FJ2A 1VQIA 3K58A 1U9RA 1I3QH 1Q86C 2E2HB 2B8FA 1KRTA 1SYCA 2J0TD 4P73A 4J1MA 5FKAC 3CCVA 2RSOA 1EQTA 3EFXD 1FNUA 2EOTA 1CKMA 4C2MH 3SVMA 1OXSC 4DR6L 4IJHA 1ILQA 1FL0A 3K7AH 5D3DA 3TP5A 4LFAL 1Q1EA 2RVLA 5EPKA 4I7ZC 3T1HQ 1OXTA 1O80A 1X3GA 2LMCB 1VQPA 2IX0A 3S17B 3VYSA 3S2HB 1F9SA 4A3EH 1CHQD 3HEJA 2V4DA 3RMHA 1CI3M 5C5MA 1NE3A 1L0XB 2VXWA 3KUPA 3I3CA 3NTKA 5C6AA 5JAVA 2UUBL 2X6GA 4MTKA 2PCFB 4NB3A 3OSOA 1SE8A 1YJ9A 1NUCA 1HZ9A 1TWFH 4A3FB 2R7ZH 1IBLL 2RA4A 4Z9CB 2K33A 3A7AB 1ZEQX 1CM9A 2JXMB 3A5UA 4JK1C 3W2DA 2PNRC 2KHSA 1C8CA 1PRTD 3HOUB 1BVSA 3CPFA 2EJGC 1DD2A 5FK9C 2SEBD 1P8LA 5C4JH 4DV6L 3D6CA 3GTOB 4WJ3M 5A2QL 2K5QA 5C3WA 1CKNA 2A5HA 4L5TA 4ALPA 5JJIA 4PG3A 4NDXA 2EE1A 2JA5H 5JVG3 3HOYH 1A15A 3LX0A 3RLFA 2IW3A 4LMQD 1LM0A 3PIP3 3BJUA 5KEEA 4DV1Q 3HP3A 3U4VA 2DY8A 4GZYC 1B3AA 1B9NA 1B44D 2F0TA 3H0GH 3S9WA 2CKZB 2UU9Q 1GOZA 3UE1A 4DV5L 5I9OA 1EY5A 3U50C 4EQPA 2XN9C 3GTPB 1Y1VB 4GKKQ 1D5MC 4DR2L 1DXMA 1LABA 3KBXA 3BZKA 4RG1A 4ZCKA 3X3NA 1I50H 1QWYA 1BCPC 1VQ4A 3EVQA 4JI1Q 3M4PA 4U68A 5ISRA 1TS4A 2HQEA 1SFOB 1B4OA 3K8AA 3KDFA 3CRLC 4HCEA 1PRTB 3K7AB 1CT1D 4HJ5A 4O0AA 1PTOD 3K5LA 3VR3A 2B3GA 3AB9A 3HOWB 1M8AA 1VS0A 4KHPL 3NEMA 5F2DA 3CP0A 3UDFA 2J4XA 2L11A 4A3GH 5DLQE 1JB3A 4X3SA 1WI5A 3K81C 1X3QA 1N33L 1ILPA 3E0JA 3CC4A 4IURA 5IYDH 5IGFA 2EYPA 5EPLA 3T56B 4JYAL 2QILA 4XYOA 2IPKD 1F2YA 1EWCA 2WV6D 3F2BA 1W6KA 1GHJA 2YV5A 2R7ZB 1PLFA 3URYA 2MP1A 1CA5A 1SN8A 1CFMA 1CQFA 1ONLA 4R4CA 4JCVE 4A3FG 4DV3L 4KY5A 5FO8B 1SNQA 3RLOA 1RTOA 1J6QA 1EIGA 1I4GA 1V1OA 2XVSA 4KK7A 3I90A 1X9NA 3OMCA 1GUNA 3V96A 2K5VA 1DCZA 1E7ZA 3I8ZA 1VQDA 4CKBA 1MSHA 1EIYB 2MHVA 3HOUG 1CK1A 1S4ZA 2O2LD 2IY5B 1HUNA 1I4PA 1LT6D 5CV6A 3CC7A 4ZK9B 1E2ZA 1PTOB 3RUZA 1PYSB 3HOYB 1IYVA 1O78A 1LTSD 3F2UA 2ICEC 4X64Q 4B3TL 3LWUA 1HTLD 3FKIH 4JBMA 2ZTCA 2VQFL 3NP8A 1PFSA 1LT3D 4AQYQ 4LUOA 3L2PA 4ZKCB 3H0GB 2XRSD 5DAUA 1DJRD 2VS1A 1AZPA 1G51A 2BA0A 3ER0A 3PO2B 5DNFA 2EXDA 3H94A 2KUMA 1JWMD 3AQQA 4K14A 2EYHA 4GLVB 3W1GA 4ID6A 5C5LA 1S5BD 3BDOA 4JI8Q 2B2WA 3I4MH 1D2BA 2KEDA 4IOCA 1VDZA 1Y1VG 2JA9A 5M5XB 1WTXA 1JT8A 1LYLA 2BDNA 3CCEA 4DR3L 1SMYD 5HURA 3V05A 2F0MA 1CTMA 3DEOA 1VQ9A 3I91A 5IGGA 2BE5D 1C48A 2O4XA 1NMGA 1SRUA 3F2CA 4FF3A 4A3DH 2KVMA 1VQJA 2O5JC 4K2LA 3J7YW 2F1MA 3HOWG 1H9KA 3P1HA 4ME3A 1FJGQ 3S1RH 2K4KA 1B2TA 1U4PA 4LF9Q 3T1HL 4ZAIA 2EYOA 3R8BA 1KLGD 4JBJA 3PCOB 5IT9c 4K0KQ 4UP7A 3J81L 1IKMA 3WDNA 1EY6A 2IJ0A 4WJWA 4BY7H 1C4QA 1QE6A 2K32A 3OWFA 4HTHA 3M4QA 2JE6I 1EQQA 1Y1WH 1JE4A 5IT9E 1XMOQ 2F0DA 1ENCA 4IJLA 1FGUA 4APVA 1ASYA 3ULPA 4HMIA 2D5DA 4LNQA 1QUQB 1DOMA 2CWPA 4LF4Q 2ZTDA 1NAPA 1PMRA 2VQEQ 4YHHQ 5M3FH 4B3SQ 4B9XA 4EVOA 3PO3B 3RN2A 2K5NA 2K5DA 2ZXRA 2K75A 3GV3A 4C3JG 5GAHC 5KRUA 1XJVA 3HOYG 1SYBA 3J80i 1VF7A 3IAYA 4HSPA 1L1OA 4A3KH 3DMUA 1VCIA 2HQLA 1EZ8A 2ZXOA 2AUJD 3H0GG 4GKJQ 3PO2G 2I46A 1I4HA 2QEXA 3GTGH 2ZXPA 3S1QH 5JPNC 4A3BH 4K5VA 5JEAH 1H95A 5C0XH 1V9PA 4DV1L 1GUWA 3ULJA 1BCPF 2UU9L 2Z1CA 1Q8KA 2C35B 1B7YB 1EQRA 2ID0A 4N9PA 5K36H 3L9AX 1CHPD 4GKKL 1V1QA 5M5WH 1WCMB 4OEMB 2IL8A 4UP8A 5C3EH 4JI1L 1E1OA 1BNZA 2D62A 3P7JA 3CHBD 5EKLA 4A3CG 2SNMA 1JWUD 1VQEA 3QIAA 1C9OA 2NTSA 3N6RA 2EJFC 4X65Q 4Q5VA 1S40A 5IYDG 1JOOA 1SNOA 1EU3A 1IBKQ 3A0JA 1LTTD 3WWVA 1Y1WB 2K50A 1EFID 1PH5A 5EBDA 1KABA 1VQMA 1OXUA 4EGVA 5J22A 1B8AA 4XYQA 2WKCA 2KCTA 3TDQA 2WB1E 4DUYQ 3I56A 2NVTH 1L2FA 3HFZB 3SR1A 1V1PA 2BH2A 5A2QE 2B2VC 1UWVA 1NY4A 2NTTA 2NWGA 3DUZA 3P75A 5M3FB 4QCLA 4P2CB 1TWGH 5CORA 3G6JB 2ZM6Q 3J7A5 4DK0A 1H9SB 2AHOB 5EQ0A 2E2JH 4WFN3 1EL0A 1B1ZA 1F2LA 5GAGC 2HIVA 1RODA 2K03A 1O7IA 1ICWA 3MTSA 2PO4A 3PO3G 1JR0D 2WIIB 3MA2B 5LMNQ 4IFDG 2XNAC 5L37A 1Y14B 4GOPB 2KCMA 1BKBA 1PFNA 2D9UA 4QL5A 3MFGA 4R4OA 4X64L 2UXDQ 4J6HA 2A69D 2V1CC 1H9JA 2EY5A 4AQYL 2R92B 2EY1A 4TRDA 5I6WA 1LTBD 3D4DA 2A6ED 1Q8IA 4O1NA 3CCMA 2EZVA 3UDXA 4DAPA 1VQLA 1VQ8A 5J3BA 2UUCQ 1WTPA 3NTIA 2L9HA 3SDZA 4MN3A 1AP0A 4JI0Q 1DGSA 1X55A 2BA1A 1ZYRD 3QG1A 5ELCA 2ZJRA 3KF6B 1RF2D 1Q1BA 2CH4W 4JI8L 2N8NA 2I5LX 2F0PA 4POFA 2EYFA 5KYLA 3GTQH 1SMXA 3S1NH 1WCMG 1Q12A 3T53B 2MO0A 2B63B 2QF7A 3HS0C 3TS0A 4FO2A 4A4IA 3J81j 3A74A 1YJWA 4KI0A 2Q2TA 5IGDA 2A6HD 5JJLA 2M2LA 1BBXC 4IZ8A 2IX1A 2FHTA 1NNXA 2F0NA 1JICA 4C3IH 5FLXL 1STBA 1EY9A 1STGA 2NVYH 4WRDA 5IGBA 1R4QB 1TS3A 1A0IA 1EEID 2KENA 4JOIA 1KXLA 4A3LG 3NSWA 1M4VA 1YNJC 1FJGL 2RDGA 2NZOA 4LF9L 1DOKA 3CQZB 1F9PA 1TY2A 2H4OA 3CCSA 1T5EA 3RN5A 4Y52H 4X66Q 3W5OA 4QGUA 1TWHB 1FNWA 1RTNA 4K0KL 4DU9A 1X3FA 1IXRA 2OTJA 2IHFA 1JORA 5BR8Q 2VB3X 5JJZA 2NB0A 3G71A 2DJFC 5IYBH 2E2HH 5EJWA 1EFWA 3GTLH 1TWGB 2EDGA 3AU7A 4DK6C 1I4XA 1S5FD 5IP7G 1XMOL 2E2JB 4NPSA 1TWCH 2WB1B 2CCZA 3HOVB 5I4DA 4LF4L 4CJ1B 3NTHA 1RKNA 2PPBC 4G4KA 2VQEL 2H1EA 5FJ8G 1X32A 4IPGA 3H6MA 1J5EQ 4YHHL 5CV8A 3S17H 4B3SL 1TS2A 3I4LA 4XQNA 5G3LF 4A3JG 5IYCG 3S2HH 4DXGA 3A5ZB 2PQAA 2XIWA 3CD6A 2K6AA 4R4QA 4A3FH 1RCVD 3BVGA 2R92G 5LMUQ 3PV0A 4R4IA 1NJIC 3JC66 4GKJL 2WP8J 1BXTA 1ICFB 2JP1A 5EBCA 4RHSA 3HGBA 1CSQA 1XTDA 4ZUJA 4CHTB 2KBNA 1WJJA 4M8AA 3SGIA 3K0YA 3HOUH 2G9DA 2CH4A 2KCNA 1PRTC 3J81c 1WVLA 4LF6Q 4JI3Q 4AYBE 3GTOH 4NXMQ 1HHVA 3ZYYX 3STBD 4KKSA 1D1KA 5D14A 2EJMA 3H09A 2B63G 3J81E 4C3IB 3I4OA 1WFQA 1BOSA 3U9OA 2R7DA 1QVFA 2NVYB 4F8MA 4KD4A 2MPMA 4G7OC 4GLXA 2Y0SE 4L8JA 3S1MH 1D1IA 4TVAB 1AEXA 3CW2C 1K8AC 3PQIA 1A3TA 4EX5A 5IP9H 2JSOA 1U4LA 4OWWB 4X65L 3CCLA 4E6IA 3BYTB 3KF8B 3MHBA 4DN4M 3D4RA 1ZXTA 1IBKL 2F0UA 3SHLA 1F2ZA 3H3VH 4F88A 3GTLB 1ET9A 3EBEA 5I6YA 3S2DB 5CBEE 3K5MA 1QJOA 3TSSA 1JC7A 1UE1A 4UDUC 3TBIB 4H0LC 4X3KA 1TWCB 1CA6A 2VNUD 1G291 1SFOH 1TQOA 3KFUA 4K5WA 4GS3A 1G8ZD 4DUYL 4CJ2C 2WB1G 4FF1A 3HOWH 3HOVG 5ELEA 5FO9B 1GUGA 3A8IE 2ZM6L 2F0EA 3UDIA 2E5LQ 3HRZC 1PXUA 4RAUC 5EKIA 1SE4A 5IGCA 2RBMA 4JPBW 1LT4D 1JOQA 4A3MH 4A3IB 2L5TA 2B2WC 3PUXA 5LMNL 3JAMi 3QO2A 3S24A 3GO5A 4C3HH 3CMAA 1EYDA 2DGYA 4ZKBB 1IYUA 2UXDL 3ICEA 3RR5A 1D5ZC 1SJED 4YCVA 2X6LA 1R4PB 4DPGA 1VQNA 3BZCA 3BDCA 4IPHA 3FMCA 4JC0A 4X3TA 2UUCL 1SSOA 3Q6SA 5KYIA 4JI0L 4TSSA 1SJHD 2KHJA 3E5SA 3EROA 2B29A 4C3JH 4XIGS 5GADC 4LF5Q 1PTOH 4HAEA 2D2CC 4OL7A 3ZJYC 5TSSA 4B3MQ 2XWBB 3HKSA 1LUZA 3ND9A 1CZGA 4QY7A 1QCBD 1HA6A 1WTVA 4LWCA 1S5ED 4AYBB 3S1MB 4C3IG 2PI2A 3KLRA 3CXCA 3CCJA 4DV7Q 3PO2H 1ENAA 1VQHA 1STAA 2F4VQ 5E4WC 4OO1G 3HKZG 1KRSA 4YCWA 2Z8LA 2VZAA 4P72A 4JI6Q 3I7FA 2Y0SB 2QA4A 1G91A 5BN5A 3I55A 1STNA 1HH2P 1DM0B 1PH3A 1MJCA 5M5XH 2AUKA 5GAEC 5IYBG 1Q7YC 3E0EA 4KKUA 4IOAA 1I94Q 4X66L 5LL6S 3PIO3 5I2YA 2EXZA 4BY1B 5BR8L 1L1OC 1HFGA 4FF2A 2F0FA 4CKEA 3F2DA 2B8GA 4A3CH 1AN8A 1LTRD 2ICIA 3NXWA 3OPOA 5KNCA 5M3MB 2DUDA 3OYYA 5ELFA 4OX9Q 4A3MB 2L15A 2EQSA 1PZJD 3D0FA 2CW0C 3FEWX 4C3HB 3IRBA 1J5EL 2Z6BA 1GD7A 4A3IG 3E9IA 3ERSX 3FPPA 1GUOA 5C4XB 2FINB 1LV9A 1HZCA 3K5OA 4FYDA 1VQCA 3BVMA 3LWEA 4A76A 4FNFA 2NN6G 3PMFA 2B2YA 1LTAD 4I65A 1XPOA 5LMUL 4KY7A 3SK5A 2SDFA 5FLXc 1PRTF 2TMPA 1CZWA 4C3JB 3VA5A 3K6OA 1N34Q 1NR4A 5FLXE 4GLAC 3PO3H 4OGQC 3PIOA 4RA8A 2AMCB 1FR3A 1KIXA 3A7LA 4IFDH 4JBWA 4A93H 1RJTA 1TVXA 1D6EC 3TMEA 3R2IA 1PFBA 2OXPA 2MO1A 2N55A 2F0IA 4LF6L 3OMGA 4JI3L 4NXML 2RSNA 3VR6A 4AYBG 1QILA 2VW9A 3A8KE 3TZUA 5IP9G 1A62A 1B53A 2NYZD 1I6VC 2Y0SG 2G5DA 2AQ1B 2NZ1D 1EZ6A 1VQ7A 2MFIA 4RGTA 1UEAB 3WOEA 1AW7A 2F3WA 4DR1Q 1NBWA 4KD3A 3I4NH 2ZJPA 1HXYD 2PW5A 4MTNA 3HZXA 1SNCA 1BCPD 2RKSA 1JB7A 1WCMH 5ELOA 2F0KA 4BBSH 1N8RC 1ESFA 3AMUA 5EPJA 5JEAJ 4L5RC 5C0XJ 4BY1G 5C3XA 4GNXB 1WTHA 3IKJA 1LLRD 1X54A 4L5QA 2Q2HA 4DAMA 4DK3C 2YTXA 2XTIA 3T51B 5M3MG 2K1BA 1JOKA 4FXGC 2OWOA 1WOCA 2R61A 1W6JA 4N8FA 4DV4Q 4A3LH 4A3MG 2IWHA 1Q46A 2E76C 3AFPA 2A68C 3BVZA 1X3EA 1B70B 2E5LL 3X3MA 4C3HG 3PF5A 4CDEC 3DWPA 1D7QA 4G57A 5FO7B 4BWGB 4OHJA 1II3A 4RGNA 4LK1C 1QZGA 5C4XG 1K83H 2FFKB 1F9RA 1BBUA 2YU9H 2JEAI 5IP7H 1U4MA 2QDLA 5FOBB 4YWMA 4RGOS 3LNNA 3M3YH 2GN5A 1G2TA 2KECA 1B3QA 1WTWA 4HIOA 1A3UA 1RHPA 4RFBA 1C0AA 4JI7Q 2WAQE 5NUCA 1HR0W 4CJ0B 1E1TA 2Q8TA 1NCVA 4A93B 1QUQA 1XX8A 5FJ8H 4EQOA 1WYDA 4IQZA 3NK9A 3MVVA 4DAVA 3C3LA 2PMZE 4JOIC 1KDAA 1M1KC 3KK7A 1BO0A 4PNYA 4A3JH 5IYCH 3NBHB 5C44B 1HNXQ 3M85A 2JEBI 4LF5L 1TU2B 2YTYA 4B3ML 1KAAA 4IUTA 1S5DD 3TP8A 1IL8A 2RF4A 1F2MA 3E3XA 4DR4Q 5HGTA 3DM1A 2R92H 1K8MA 4TKOB 2A69C 1TY0A 1UE7A 2KOLA 1Z6HA 4DV7L 2OQKA 1U4RA 2L55A 2ATWA 2F4VL 3NELA 1E24A 3UI2A 4JI6L 5C4ZA 3I4NB 5HGQA 1KD1C 1K9MC 4BBSB 4X62Q 1PHJA 5GQOA 4RKLA 1GM5A 3KOJA 3SK8A 1ZKOA 1PH6A 5K5PA 5T1GA 1I94L 2E75C 4HMJA 4LJZC 2B63H 1SROA 4FDBA 5H1SE 5AJ3Q 3TRZA 3CC2A 4JI2Q 3FPUB 3E9HA 2EPBA 3D8GA 1A2UA 1T5XD 1GO3E 2YYZA 3T1YQ 3BG3A 4PZ8A 1XMQQ 3N52A 1PH1A 4OX9L 2MQHA 1K83B 2K7VA 3I72A 4DNRB 1ENFA 3CQZH 3VYRA 1Y69U 2LSSA 1LO5D 1QVGA 1SE3A 4AIMA 1JWSD 1IW7D 4NW2A 2FMMA 1V8QA 3A54A 2YU9B 1SNDA 1TWHH 2D0OA 4RMFA 4B9WA 4JBKA 4KJNA 4J15A 4Y7NH 2I07B 5CC4A 3M3YB 4X6AH 1YIJA 5E4XA 3EA6A 2L0CA 3VA7A 1TT2A 2JK8A 5IY0A 2IX3A 1MJEA 1QVCA 3HOVH 3NWSA 4JV5Q 2PW7A 4Q0FA 5EAYA 4A3JB 4K6LA 1SYFA 3D31A 2A8VA 4A93G 4OONA 1B9MA 3QOJA 4BXXG 1LTID 2RCNA 2JA8B 1H9SA 4QF4A 2Q2IA 1N34L 4I7AA 2WAQB 3SK6A 3TEHB 5D3IB 2UXCQ 1HZAA 5IOCA 5C44G 2PMZB 1HNZQ 1FD7D 3LGJA 3Q8DA 2RQXA 3D3RA 1J9OA 3A55A 5CV7A 4HN7A 4QJFA 1A2TA 1BDOA 3M7GA 4ODGA 5G3LD 4GOPA 2A73B 3DEPA 1A6XA 2HT1A 1SR3A 1YNNC 4MIUA 2F03A 1KC8C 5IGEA 2Q2UA 1TIID 1EY4A 2AWNA 3MAQA 4QUFA 2N78A 4OXPA 4PMWA 2LY7A 3I4NG 1SE2A 4IUQA 4BBSG 3ULLA 4DR1L 2R7FA 1SNMA 1IHZA 3HKZE 3KF6A 3A8JE 2HHHQ 3G7LA 5CV4A 2K14A 2BOSA 1PVOA 3STBC 1RL2A 2F0WA 2DJGC 1VQGA 5IE8A 1H9MA 3J80c 2K5HA 1SYEA 3BYYB 4OO1H 4CGYB 1HQRD 2F0JA 3V2TA 2N3SA 3KBGA 1IZ6A 4DA2A 1VQKA 2B2TA 3MXPA 3J80E 4DF7A 5IWAQ 1K3RA 2F3IA 1U5KA 4DV4L 1Q90A 3KLWA 2QEJC 4Y7NB 2VUMH 4QUCA 4IN3A 2BCOA 2XWJB 2Z6KC 2CHBD 3KLSA 4BA1I 2F0GA 5JOBA 2L4NA 3OHXC 3S2DH 1W2BA 1SXTA 3SE0A 3SXHA 5IODA 1HPCA 4RHRA 4LUVA 5E7NA 2PQEA 2KA7A 3C46A 2RDFA 3JAML 1E2WA 2NZHA 4R1JA 1JE5A 3GP7A 3CAMA 2MJ8A 3AFQA 1MGSA 1R9TB 1JJ2A 4QQBX 4HSVA 3GTJB 1OO9B 4IPCA 2UUAQ 1G2SA 4JI7L 2E8GA 2JA8G 3T16A 1PYWD 2WAQG 3BZDB 4C1NI 4PZ6A 2HCCA 2WINB 4A3IH 1N36Q 4U673 1KQSA 3ITPA 3HOZB 1BQQT 3D6WA 1HNXL 1NTGA 2NN6H 3KLSX 3EJIA 1HFNA 2BH8A 2GVAA 4R8IA 1WD1A 4KHVA 3UDGA 2F4IA 4DR4L 3TP7A 3H3VC 4PZ7A 1FNVA 4C1NK 3QB3A 2HDMA 1Z47A 4HIDA 4JI4Q 2K01A 1GUTA 4BBRB 4UY8C 2F0QA 5ELBA 2GVBA 3K5NA 1I5FA 1KAWA 1PH7A 5ELNA
chains in the Genus database with same CATH topology
4YWKA 4UP7A 5IYBG 4OWXB 1Q7YC 3E0EA 2UUBQ 4X62L 4BY7H 4IOAA 3FKIG 1I94Q 4X66L 3HOZH 3M4QA 1PV4A 3TQYA 1T9HA 4MNOA 2JE6I 1PH8A 1EQQA 1Y1WH 4DV2Q 5BR8L 1XMOQ 1L1OC 1IBLQ 4IJLA 1FGUA 2AKWB 1EYGA 3EIVA 4APVA 1ASYA 3ULPA 3F2DA 1A8VA 1Q81C 5AJ3L 1BBWA 3L0OA 3CMEA 4LNQA 4A3CH 1QUQB 2CWPA 4LF4Q 1UE6A 2ZTDA 4JI2L 4OO1I 2H5XA 2DUDA 3OYYA 2VQEQ 4OX9Q 3MXNB 1HJPA 4BBRH 4YHHQ 5M3FH 2L15A 2EQSA 1MIUA 3D0FA 4DAYB 4DUZL 4HJAA 3T1YL 4B3SQ 3I4MG 1XMQL 3RN2A 2K5NA 4UP9A 2K75A 2WFWA 3IRBA 4DV6Q 1J5EL 3OW2A 4JG2A 5GAHC 1X65A 3PUYA 1GD7A 4P74A 3GTLH 1XJVA 4A3IG 2I5MX 3HOYG 3J80i 3E9IA 3ERSX 2KHIA 1IBML 1L1OA 2JQOA 1HZCA 5M5YH 4A3KH 1K73C 2UXBQ 1VCIA 3PUVA 4EQ5A 1E22A 1VQCA 4LF7Q 4A76A 2HQLA 4JI5Q 2NN6G 1YBYA 2AWOA 4BY1H 1N9WA 4A3DG 3H0GG 4WJ4A 1X6OA 4GKJQ 3PO2G 1XPOA 2QEXA 3GTGH 4HJ9A 4XTCS 5LMUL 4DR5L 4A3BH 3S1QH 1X56A 5FLXc 1H95A 1V9PA 1YHAA 4DV1L 2E2IH 3AEVA 4DV5Q 3UE0A 5HY6A 5M3MH 3ULJA 2EIFA 1I6HH 4HIKA 2JJQA 1N32Q 3TS2A 2UU9L 3NENA 4JV5L 1Q8KA 1N34Q 4DR2Q 2R93G 1G6PA 2C35B 1B7YB 4GLAC 1EQRA 3PO3H 3PIOA 2ID0A 2AMCB 1KIXA 1HNWL 4JBWA 4GKKL 1QZHA 4A93H 1YI2A 4YCUA 2MO1A 4BY7G 1V1QA 5M5WH 5IT9c 3H15A 2UXCL 5C4XH 1D8LA 2N49A 4LF6L 3HOZG 4HJ7A 4JI3L 3FHWA 4UP8A 5C3EH 3U58A 1HNZL 2OTLA 4NXML 3DLLA 1RIPA 4JI1L 1E1OA 1Y1WG 1PA6A 2D62A 3RZOH 3BU2A 2LXJA 4AYBG 2VW9A 2NN6I 4LUZA 4A3CG 4P75A 1TXYA 5IP9G 1Z9FA 2Z0SA 5FLMH 1A62A 4KHPQ 4YY3L 2JA6G 1VQEA 4LFBQ 1C9OA 4KHZA 4DV0Q 1XNRQ 2Z6KA 4X65Q 1S40A 2Y0SG 4P71A 4BBRG 5M3FG 1XPUA 5IYDG 1YJNA 1VQ7A 1N33Q 1YHQA 2MFIA 3K7UC 3MEFA 1M90C 4L5SA 2JA7H 1IBKQ 1CKNB 2PQAB 3A0JA 4JYAQ 1VQOA 4DR1Q 3FP9A 1NBWA 3WWVA 3I4NH 4GNXC 2ZJPA 4YWLA 1YZ6A 2K50A 4MTNA 3PUZA 1PH5A 1PH9A 1S3OA 1OXVA 4A3KG 1JB7A 1WCMH 5ELOA 1A63A 1VQMA 1OXUA 4POGA 4BBSH 1N8RC 4DV3Q 4B3RL 1B8AA 5JEAJ 4L5RC 5C0XJ 2KCTA 2HHHL 4BY1G 2WB1E 3CCUA 3I56A 4DUYQ 2NVTH 4GNXB 1L2FA 3I2ZA 3HFZB 2BH2A 2RHSB 4AH6A 1JJGA 4L5QA 1X54A 3PGZA 2ASBA 2Q2HA 1UWVA 1NY4A 4DR7Q 1YNXA 1W3SA 1SLJA 4A3BG 3L7ZC 4DAMA 4DK3C 5JEAG 2R6GA 5C0XG 1TWGH 3HOXH 2YTXA 2XTIA 2ZM6Q 3J7A5 3W1BA 2PNHA 2AHOB 5M3MG 2E2JH 4LFCL 1VQFA 2OWOA 1WOCA 5GAGC 3OTOQ 4DV4Q 2HIVA 2VUMG 4IFDJ 4A3LH 4A3MG 1Q46A 3PSIA 1O7IA 3CCQA 1EIFA 3AFPA 1X3EA 3RZDH 3PO3G 1B70B 2PI2E 4MZ9A 2E5LL 3KYHC 5IWAL 3PF5A 3H3VI 5LMNQ 5K36G 1KHIA 1HR0L 4IFDG 4UPAA 1D7QA 4B3TQ 1Y14B 3M4OH 2RHQB 1PH4A 3KDFB 3B6YA 2VQFQ 4GOPB 4LF8Q 2D0PA 1QZGA 5C4XG 1K83H 2KCMA 4R4TA 1K8GA 1BKBA 4QL5A 3S16H 4R4OA 4X64L 1BBUA 5C3EG 2UXDQ 4HJ8A 3J7ZC 2V1CC 3F8TA 2YU9H 4AQYL 2JEAI 4NXNL 3DM3A 3KJPA 5IP7H 3VDYA 1IYJB 1MKHA 4YWMA 1XNQL 1PH2A 5FLMG 3G4SA 3GTKH 3M3YH 2GN5A 3CCMA 3UDXA 1OTCA 1EUJA 2OQ0A 1VQLA 1VQ8A 1LTLA 4GN3B 2VL6A 4HIOA 5J3BA 2UUCQ 1VQBA 2LXKA 2QGQA 1C0AA 4JI7Q 2WAQE 1HR0W 4JI0Q 1DGSA 1X55A 1E1TA 4O2DA 2BA1A 3PUWA 1QUQA 2JA7G 1UEBA 5FJ8H 1FVIA 1WYDA 2NVXH 2ZJRA 3KF6B 1AH9A 1Q1BA 2PMZE 4JOIC 2UUAL 4IPDA 4JI8L 4DR3Q 1M1KC 2N8NA 5IYCH 1P16A 2I5LX 4A3JH 2ZTEA 3NBHB 4POFA 1PYBA 4GN5A 1HNXQ 1V43A 1VQ5A 3M85A 1VQ6A 3GTQH 3GTPH 1SMXA 2JEBI 4IFDI 1Y1VH 4LF5L 3S1NH 1WCMG 1N36L 1KL9A 2YTYA 1Q12A 4B3ML 1VQIA 1Q86C 4TQUS 1I3QH 2RF4A 1KRTA 2MO0A 4P73A 2A19A 3TS0A 3CCVA 3M7NA 4GN4B 4A4IA 3A74A 3J81j 1YHBA 3PIPA 1YJWA 2R92H 3GTMH 4KI0A 2Q2TA 4DR4Q 1UE7A 3K0XA 1YITA 5JJLA 1TWAH 2IX1A 1CKMA 4DV7L 2OQKA 4C2MH 3S15H 3CCRA 1OXSC 4DR6L 3HOXG 4C3IH 4IJHA 1FL0A 3K7AH 4LFAL 2ATWA 2F4VL 1Q1EA 2NVYH 1E24A 3NELA 4IO9A 3T1HQ 1A0IA 4JOIA 1OXTA 1X3GA 2KENA 4A3LG 1KXLA 4JI4L 4JI6L 1FJGL 1VQPA 2IX0A 2NZOA 4LW1A 4LF9L 5HGQA 4BXXH 1KD1C 1K9MC 2YTVA 3CCSA 4A3EH 4X62Q 1PHJA 1K0RA 5GQOA 3RN5A 4Y52H 4X66Q 3W5OA 1GM5A 3KOJA 4QGUA 1XPRA 5C44H 1PH6A 1NE3A 4K0KL 4H02A 1X3FA 2UUBL 1IXRA 2OTJA 2IHFA 5BR8Q 4NB3A 2HIXA 3G71A 5IYBH 1I94L 2E2HH 1EFWA 1YJ9A 1SE8A 2B63H 1HZ9A 1E3PA 1SROA 1TWFH 4DKAC 4FDBA 4DK6C 5H1SE 5IP7G 2R7ZH 5AJ3Q 4DV2L 1XMOL 1IBLL 3TRZA 4NPSA 3CC2A 3JAMc 1TWCH 4JI2Q 3U4ZA 3E9HA 2CCZA 1GO3E 3A5UA 2YYZA 4DUZQ 3T1YQ 4LF4L 2CQOA 4PZ8A 2IT1A 1XMQQ 2VQEL 5FJ8G 1BVSA 4IPGA 1PH1A 1J5EQ 4OX9L 3CPFA 4YHHL 3S17H 2MQHA 4B3SL 3CQZH 2LSSA 4A3JG 5IYCG 1QVGA 4AIMA 1P8LA 3S2HH 1IBMQ 5C4JH 2VY3A 4DV6L 3A5ZB 4WJ3M 1TWHH 2D0OA 4RMFA 4ALPA 1CKNA 2PQAA 4L5TA 4JBKA 5JJIA 2IHEA 4J15A 4PG3A 4Y7NH 3CD6A 1S72A 4R4QA 2JA5H 3HOYH 2UXBL 2CWAA 4X6AH 2I5HA 3RLFA 4LF7L 3M9BA 4JI5L 4A3FH 1YIJA 2R92G 1LM0A 5LMUQ 4DR5Q 3BJUA 3PV0A 4R4IA 1NJIC 4DV1Q 2A1AA 3JC66 3U4VA 4GKJL 4GOPC 2JK8A 2WP8J 5IY0A 4DNIA 3H0GH 1MJEA 2CKZB 4GNXA 1CSQA 1XTDA 1QVCA 2UU9Q 3HOVH 2KBNA 4JV5Q 5EAYA 3UE1A 1WJJA 4DV5L 3SGIA 4A75A 1UE5A 2K52A 3U50C 2A8VA 3D31A 4A93G 3HOUH 4OONA 1N32L 2MNAA 4BXXG 3TREA 1Q82C 2RCNA 1HNWQ 4GKKQ 5GROA 2Q2IA 1N34L 4DR2L 3TEHB 4BA2I 4A3EG 1HZBA 3S14H 3BZKA 4RG1A 3J81c 1HZAA 2UXCQ 4LF6Q 2R93H 1I50H 5C44G 4JI3Q 1VQ4A 4AYBE 3GTOH 1HNZQ 4NXMQ 3Q8DA 3LGJA 4JI1Q 3M4PA 3STBD 4QJFA 2B63G 3K8AA 3KDFA 3I4OA 1L0WA 1GKHA 1WFQA 4GOPA 2R7ZG 1AE3A 2R7DA 4HJ5A 1JMCA 1QVFA 4O0AA 5C0XI 4GLXA 4YY3Q 2Y0SE 1SR3A 2HT1A 2ZJQA 2B3GA 1KC8C 2NVQH 1ASZA 2Q2UA 3S1MH 4TVAB 3CW2C 1CKOA 2AWNA 1VS0A 1K8AC 4KHPL 3NEMA 4LFBL 3CP0A 3CF5A 4EX5A 3UDFA 5IP9H 3KJOA 4DV0L 2N78A 4OWWB 1XNRL 4X65L 4A3GH 4OXPA 3CCLA 4PMWA 2JA6H 3I4NG 5DLQE 3KF8B 1L1OB 1WI5A 3K81C 1N33L 2JA8H 1EWIA 1NMFA 3CC4A 1IBKL 5IYDH 4BBSG 4JYAL 3ULLA 3GDEA 4DR1L 3H3VH 3CPWA 2R7FA 3F2BA 2YV5A 3EBEA 3HKZE 1YVCA 3KF6A 4B3RQ 1AE2A 1UE1A 1SN8A 2HHHQ 2OCEA 1VQAA 2JA5G 4R4CA 2K14A 2VNUD 1G291 1SFOH 4JCVE 1U0LA 1PVOA 4A3FG 4DV3L 2CFMA 3KFUA 3STBC 3RLOA 1RL2A 4GS3A 4HIMA 1VQGA 1J6QA 5IE8A 4DUYL 3J80c 2K5HA 1X9NA 1GVPA 2WB1G 4LFCQ 4DR7L 3HOWH 2N3SA 3HOVG 1IZ6A 1VQKA 2K5VA 2ZM6L 3AYHB 1E7ZA 1VQDA 3UDIA 2E5LQ 1EIYB 5IWAQ 1K3RA 2F3IA 1U5KA 3OTOL 4DV4L 3HOUG 1HR0Q 2IY5B 3KLWA 3CC7A 1C7YA 4OWTB 2VUMH 4A3MH 4QIWE 1PYSB 3PUXA 5LMNL 2Z6KC 3JAMi 3S24A 4BA1I 3GO5A 4X64Q 4C3HH 3CMAA 4B3TL 3FKIH 3S2DH 4JBMA 1W2BA 2ZTCA 2VQFL 4LF8L 2DGYA 1PFSA 3EN2A 1EOVA 4AQYQ 4NXNQ 4LUOA 4LUVA 5E7NA 3L2PA 2ES2A 2UXDL 3ICEA 3RR5A 1XNQQ 2VS1A 1G51A 2BA0A 2FXQA 3ER0A 4YCVA 3K80C 2EXDA 4DPGA 2NZHA 1VQNA 3BZCA 4R1JA 1JE5A 3AQQA 3CAMA 3AFQA 1YEZA 4IPHA 4GLVB 3RNUA 4JC0A 3W1GA 1JJ2A 4QQBX 2UUCL 4A3GG 4IPCA 2I0QA 1OXXK 2UUAQ 4JI8Q 5LMNW 3GD7A 4JI7L 4JI0L 3I4MH 4IOCA 1Y1VG 2E8GA 2JA9A 2KHJA 2JA8G 2B29A 2WAQG 4XIGS 4C3JH 5GADC 1LYLA 3CCEA 1JT8A 4LF5Q 4PZ6A 3ZJYC 4DR3L 1N36Q 4A3IH 4B3MQ 1KQSA 3G6EA 1VQ9A 3HKSA 1LUZA 4KLKA 4QY7A 1HNXL 1CUKA 1NTGA 1CSPA 2BH8A 4LWCA 1NMGA 2GVAA 1SRUA 3F2CA 2PI2A 3UDGA 3CXCA 4A3DH 3CCJA 4DV7Q 3PO2H 2ALYB 4DR6Q 1JJCB 1IL2A 4DR4L 1VQHA 1VQJA 4PZ7A 4LFAQ 2F4VQ 4OO1G 3F1ZA 3HKZG 2F52A 1KRSA 3HOWG 4YCWA 3J81i 3PF4A 1Z47A 2VZAA 4P72A 4HIDA 4ME3A 3I7FA 3G48A 4JI4Q 4JI6Q 1FJGQ 3S1RH 2K4KA 1R9TH 2QA4A 4LF9Q 4UY8C 3GTJH 3T1HL 3I55A 2GVBA 1HH2P 5JJKA 1PH7A 1I5FA 1KAWA 4JBJA 1PH3A 1MJCA 2XGTA 3PCOB 5M5XH 5ELNA 3RLNA 5GAEC 4K0KQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YWK A;  4UP7 A;  5IYB G;  4OWX B;  1Q7Y C;  3E0E A;  2UUB Q;  4X62 L;  4BY7 H;  4IOA A;  3FKI G;  1I94 Q;  4X66 L;  3HOZ H;  3M4Q A;  1PV4 A;  3TQY A;  1T9H A;  4MNO A;  2JE6 I;  1PH8 A;  1EQQ A;  1Y1W H;  4DV2 Q;  5BR8 L;  1XMO Q;  1L1O C;  1IBL Q;  4IJL A;  1FGU A;  2AKW B;  1EYG A;  3EIV A;  4APV A;  1ASY A;  3ULP A;  3F2D A;  1A8V A;  1Q81 C;  5AJ3 L;  1BBW A;  3L0O A;  3CME A;  4LNQ A;  4A3C H;  1QUQ B;  2CWP A;  4LF4 Q;  1UE6 A;  2ZTD A;  4JI2 L;  4OO1 I;  2H5X A;  2DUD A;  3OYY A;  2VQE Q;  4OX9 Q;  3MXN B;  1HJP A;  4BBR H;  4YHH Q;  5M3F H;  2L15 A;  2EQS A;  1MIU A;  3D0F A;  4DAY B;  4DUZ L;  4HJA A;  3T1Y L;  4B3S Q;  3I4M G;  1XMQ L;  3RN2 A;  2K5N A;  4UP9 A;  2K75 A;  2WFW A;  3IRB A;  4DV6 Q;  1J5E L;  3OW2 A;  4JG2 A;  5GAH C;  1X65 A;  3PUY A;  1GD7 A;  4P74 A;  3GTL H;  1XJV A;  4A3I G;  2I5M X;  3HOY G;  3J80 i;  3E9I A;  3ERS X;  2KHI A;  1IBM L;  1L1O A;  2JQO A;  1HZC A;  5M5Y H;  4A3K H;  1K73 C;  2UXB Q;  1VCI A;  3PUV A;  4EQ5 A;  1E22 A;  1VQC A;  4LF7 Q;  4A76 A;  2HQL A;  4JI5 Q;  2NN6 G;  1YBY A;  2AWO A;  4BY1 H;  1N9W A;  4A3D G;  3H0G G;  4WJ4 A;  1X6O A;  4GKJ Q;  3PO2 G;  1XPO A;  2QEX A;  3GTG H;  4HJ9 A;  4XTC S;  5LMU L;  4DR5 L;  4A3B H;  3S1Q H;  1X56 A;  5FLX c;  1H95 A;  1V9P A;  1YHA A;  4DV1 L;  2E2I H;  3AEV A;  4DV5 Q;  3UE0 A;  5HY6 A;  5M3M H;  3ULJ A;  2EIF A;  1I6H H;  4HIK A;  2JJQ A;  1N32 Q;  3TS2 A;  2UU9 L;  3NEN A;  4JV5 L;  1Q8K A;  1N34 Q;  4DR2 Q;  2R93 G;  1G6P A;  2C35 B;  1B7Y B;  4GLA C;  1EQR A;  3PO3 H;  3PIO A;  2ID0 A;  2AMC B;  1KIX A;  1HNW L;  4JBW A;  4GKK L;  1QZH A;  4A93 H;  1YI2 A;  4YCU A;  2MO1 A;  4BY7 G;  1V1Q A;  5M5W H;  5IT9 c;  3H15 A;  2UXC L;  5C4X H;  1D8L A;  2N49 A;  4LF6 L;  3HOZ G;  4HJ7 A;  4JI3 L;  3FHW A;  4UP8 A;  5C3E H;  3U58 A;  1HNZ L;  2OTL A;  4NXM L;  3DLL A;  1RIP A;  4JI1 L;  1E1O A;  1Y1W G;  1PA6 A;  2D62 A;  3RZO H;  3BU2 A;  2LXJ A;  4AYB G;  2VW9 A;  2NN6 I;  4LUZ A;  4A3C G;  4P75 A;  1TXY A;  5IP9 G;  1Z9F A;  2Z0S A;  5FLM H;  1A62 A;  4KHP Q;  4YY3 L;  2JA6 G;  1VQE A;  4LFB Q;  1C9O A;  4KHZ A;  4DV0 Q;  1XNR Q;  2Z6K A;  4X65 Q;  1S40 A;  2Y0S G;  4P71 A;  4BBR G;  5M3F G;  1XPU A;  5IYD G;  1YJN A;  1VQ7 A;  1N33 Q;  1YHQ A;  2MFI A;  3K7U C;  3MEF A;  1M90 C;  4L5S A;  2JA7 H;  1IBK Q;  1CKN B;  2PQA B;  3A0J A;  4JYA Q;  1VQO A;  4DR1 Q;  3FP9 A;  1NBW A;  3WWV A;  3I4N H;  4GNX C;  2ZJP A;  4YWL A;  1YZ6 A;  2K50 A;  4MTN A;  3PUZ A;  1PH5 A;  1PH9 A;  1S3O A;  1OXV A;  4A3K G;  1JB7 A;  1WCM H;  5ELO A;  1A63 A;  1VQM A;  1OXU A;  4POG A;  4BBS H;  1N8R C;  4DV3 Q;  4B3R L;  1B8A A;  5JEA J;  4L5R C;  5C0X J;  2KCT A;  2HHH L;  4BY1 G;  2WB1 E;  3CCU A;  3I56 A;  4DUY Q;  2NVT H;  4GNX B;  1L2F A;  3I2Z A;  3HFZ B;  2BH2 A;  2RHS B;  4AH6 A;  1JJG A;  4L5Q A;  1X54 A;  3PGZ A;  2ASB A;  2Q2H A;  1UWV A;  1NY4 A;  4DR7 Q;  1YNX A;  1W3S A;  1SLJ A;  4A3B G;  3L7Z C;  4DAM A;  4DK3 C;  5JEA G;  2R6G A;  5C0X G;  1TWG H;  3HOX H;  2YTX A;  2XTI A;  2ZM6 Q;  3J7A 5;  3W1B A;  2PNH A;  2AHO B;  5M3M G;  2E2J H;  4LFC L;  1VQF A;  2OWO A;  1WOC A;  5GAG C;  3OTO Q;  4DV4 Q;  2HIV A;  2VUM G;  4IFD J;  4A3L H;  4A3M G;  1Q46 A;  3PSI A;  1O7I A;  3CCQ A;  1EIF A;  3AFP A;  1X3E A;  3RZD H;  3PO3 G;  1B70 B;  2PI2 E;  4MZ9 A;  2E5L L;  3KYH C;  5IWA L;  3PF5 A;  3H3V I;  5LMN Q;  5K36 G;  1KHI A;  1HR0 L;  4IFD G;  4UPA A;  1D7Q A;  4B3T Q;  1Y14 B;  3M4O H;  2RHQ B;  1PH4 A;  3KDF B;  3B6Y A;  2VQF Q;  4GOP B;  4LF8 Q;  2D0P A;  1QZG A;  5C4X G;  1K83 H;  2KCM A;  4R4T A;  1K8G A;  1BKB A;  4QL5 A;  3S16 H;  4R4O A;  4X64 L;  1BBU A;  5C3E G;  2UXD Q;  4HJ8 A;  3J7Z C;  2V1C C;  3F8T A;  2YU9 H;  4AQY L;  2JEA I;  4NXN L;  3DM3 A;  3KJP A;  5IP7 H;  3VDY A;  1IYJ B;  1MKH A;  4YWM A;  1XNQ L;  1PH2 A;  5FLM G;  3G4S A;  3GTK H;  3M3Y H;  2GN5 A;  3CCM A;  3UDX A;  1OTC A;  1EUJ A;  2OQ0 A;  1VQL A;  1VQ8 A;  1LTL A;  4GN3 B;  2VL6 A;  4HIO A;  5J3B A;  2UUC Q;  1VQB A;  2LXK A;  2QGQ A;  1C0A A;  4JI7 Q;  2WAQ E;  1HR0 W;  4JI0 Q;  1DGS A;  1X55 A;  1E1T A;  4O2D A;  2BA1 A;  3PUW A;  1QUQ A;  2JA7 G;  1UEB A;  5FJ8 H;  1FVI A;  1WYD A;  2NVX H;  2ZJR A;  3KF6 B;  1AH9 A;  1Q1B A;  2PMZ E;  4JOI C;  2UUA L;  4IPD A;  4JI8 L;  4DR3 Q;  1M1K C;  2N8N A;  5IYC H;  1P16 A;  2I5L X;  4A3J H;  2ZTE A;  3NBH B;  4POF A;  1PYB A;  4GN5 A;  1HNX Q;  1V43 A;  1VQ5 A;  3M85 A;  1VQ6 A;  3GTQ H;  3GTP H;  1SMX A;  2JEB I;  4IFD I;  1Y1V H;  4LF5 L;  3S1N H;  1WCM G;  1N36 L;  1KL9 A;  2YTY A;  1Q12 A;  4B3M L;  1VQI A;  1Q86 C;  4TQU S;  1I3Q H;  2RF4 A;  1KRT A;  2MO0 A;  4P73 A;  2A19 A;  3TS0 A;  3CCV A;  3M7N A;  4GN4 B;  4A4I A;  3A74 A;  3J81 j;  1YHB A;  3PIP A;  1YJW A;  2R92 H;  3GTM H;  4KI0 A;  2Q2T A;  4DR4 Q;  1UE7 A;  3K0X A;  1YIT A;  5JJL A;  1TWA H;  2IX1 A;  1CKM A;  4DV7 L;  2OQK A;  4C2M H;  3S15 H;  3CCR A;  1OXS C;  4DR6 L;  3HOX G;  4C3I H;  4IJH A;  1FL0 A;  3K7A H;  4LFA L;  2ATW A;  2F4V L;  1Q1E A;  2NVY H;  1E24 A;  3NEL A;  4IO9 A;  3T1H Q;  1A0I A;  4JOI A;  1OXT A;  1X3G A;  2KEN A;  4A3L G;  1KXL A;  4JI4 L;  4JI6 L;  1FJG L;  1VQP A;  2IX0 A;  2NZO A;  4LW1 A;  4LF9 L;  5HGQ A;  4BXX H;  1KD1 C;  1K9M C;  2YTV A;  3CCS A;  4A3E H;  4X62 Q;  1PHJ A;  1K0R A;  5GQO A;  3RN5 A;  4Y52 H;  4X66 Q;  3W5O A;  1GM5 A;  3KOJ A;  4QGU A;  1XPR A;  5C44 H;  1PH6 A;  1NE3 A;  4K0K L;  4H02 A;  1X3F A;  2UUB L;  1IXR A;  2OTJ A;  2IHF A;  5BR8 Q;  4NB3 A;  2HIX A;  3G71 A;  5IYB H;  1I94 L;  2E2H H;  1EFW A;  1YJ9 A;  1SE8 A;  2B63 H;  1HZ9 A;  1E3P A;  1SRO A;  1TWF H;  4DKA C;  4FDB A;  4DK6 C;  5H1S E;  5IP7 G;  2R7Z H;  5AJ3 Q;  4DV2 L;  1XMO L;  1IBL L;  3TRZ A;  4NPS A;  3CC2 A;  3JAM c;  1TWC H;  4JI2 Q;  3U4Z A;  3E9H A;  2CCZ A;  1GO3 E;  3A5U A;  2YYZ A;  4DUZ Q;  3T1Y Q;  4LF4 L;  2CQO A;  4PZ8 A;  2IT1 A;  1XMQ Q;  2VQE L;  5FJ8 G;  1BVS A;  4IPG A;  1PH1 A;  1J5E Q;  4OX9 L;  3CPF A;  4YHH L;  3S17 H;  2MQH A;  4B3S L;  3CQZ H;  2LSS A;  4A3J G;  5IYC G;  1QVG A;  4AIM A;  1P8L A;  3S2H H;  1IBM Q;  5C4J H;  2VY3 A;  4DV6 L;  3A5Z B;  4WJ3 M;  1TWH H;  2D0O A;  4RMF A;  4ALP A;  1CKN A;  2PQA A;  4L5T A;  4JBK A;  5JJI A;  2IHE A;  4J15 A;  4PG3 A;  4Y7N H;  3CD6 A;  1S72 A;  4R4Q A;  2JA5 H;  3HOY H;  2UXB L;  2CWA A;  4X6A H;  2I5H A;  3RLF A;  4LF7 L;  3M9B A;  4JI5 L;  4A3F H;  1YIJ A;  2R92 G;  1LM0 A;  5LMU Q;  4DR5 Q;  3BJU A;  3PV0 A;  4R4I A;  1NJI C;  4DV1 Q;  2A1A A;  3JC6 6;  3U4V A;  4GKJ L;  4GOP C;  2JK8 A;  2WP8 J;  5IY0 A;  4DNI A;  3H0G H;  1MJE A;  2CKZ B;  4GNX A;  1CSQ A;  1XTD A;  1QVC A;  2UU9 Q;  3HOV H;  2KBN A;  4JV5 Q;  5EAY A;  3UE1 A;  1WJJ A;  4DV5 L;  3SGI A;  4A75 A;  1UE5 A;  2K52 A;  3U50 C;  2A8V A;  3D31 A;  4A93 G;  3HOU H;  4OON A;  1N32 L;  2MNA A;  4BXX G;  3TRE A;  1Q82 C;  2RCN A;  1HNW Q;  4GKK Q;  5GRO A;  2Q2I A;  1N34 L;  4DR2 L;  3TEH B;  4BA2 I;  4A3E G;  1HZB A;  3S14 H;  3BZK A;  4RG1 A;  3J81 c;  1HZA A;  2UXC Q;  4LF6 Q;  2R93 H;  1I50 H;  5C44 G;  4JI3 Q;  1VQ4 A;  4AYB E;  3GTO H;  1HNZ Q;  4NXM Q;  3Q8D A;  3LGJ A;  4JI1 Q;  3M4P A;  3STB D;  4QJF A;  2B63 G;  3K8A A;  3KDF A;  3I4O A;  1L0W A;  1GKH A;  1WFQ A;  4GOP A;  2R7Z G;  1AE3 A;  2R7D A;  4HJ5 A;  1JMC A;  1QVF A;  4O0A A;  5C0X I;  4GLX A;  4YY3 Q;  2Y0S E;  1SR3 A;  2HT1 A;  2ZJQ A;  2B3G A;  1KC8 C;  2NVQ H;  1ASZ A;  2Q2U A;  3S1M H;  4TVA B;  3CW2 C;  1CKO A;  2AWN A;  1VS0 A;  1K8A C;  4KHP L;  3NEM A;  4LFB L;  3CP0 A;  3CF5 A;  4EX5 A;  3UDF A;  5IP9 H;  3KJO A;  4DV0 L;  2N78 A;  4OWW B;  1XNR L;  4X65 L;  4A3G H;  4OXP A;  3CCL A;  4PMW A;  2JA6 H;  3I4N G;  5DLQ E;  3KF8 B;  1L1O B;  1WI5 A;  3K81 C;  1N33 L;  2JA8 H;  1EWI A;  1NMF A;  3CC4 A;  1IBK L;  5IYD H;  4BBS G;  4JYA L;  3ULL A;  3GDE A;  4DR1 L;  3H3V H;  3CPW A;  2R7F A;  3F2B A;  2YV5 A;  3EBE A;  3HKZ E;  1YVC A;  3KF6 A;  4B3R Q;  1AE2 A;  1UE1 A;  1SN8 A;  2HHH Q;  2OCE A;  1VQA A;  2JA5 G;  4R4C A;  2K14 A;  2VNU D;  1G29 1;  1SFO H;  4JCV E;  1U0L A;  1PVO A;  4A3F G;  4DV3 L;  2CFM A;  3KFU A;  3STB C;  3RLO A;  1RL2 A;  4GS3 A;  4HIM A;  1VQG A;  1J6Q A;  5IE8 A;  4DUY L;  3J80 c;  2K5H A;  1X9N A;  1GVP A;  2WB1 G;  4LFC Q;  4DR7 L;  3HOW H;  2N3S A;  3HOV G;  1IZ6 A;  1VQK A;  2K5V A;  2ZM6 L;  3AYH B;  1E7Z A;  1VQD A;  3UDI A;  2E5L Q;  1EIY B;  5IWA Q;  1K3R A;  2F3I A;  1U5K A;  3OTO L;  4DV4 L;  3HOU G;  1HR0 Q;  2IY5 B;  3KLW A;  3CC7 A;  1C7Y A;  4OWT B;  2VUM H;  4A3M H;  4QIW E;  1PYS B;  3PUX A;  5LMN L;  2Z6K C;  3JAM i;  3S24 A;  4BA1 I;  3GO5 A;  4X64 Q;  4C3H H;  3CMA A;  4B3T L;  3FKI H;  3S2D H;  4JBM A;  1W2B A;  2ZTC A;  2VQF L;  4LF8 L;  2DGY A;  1PFS A;  3EN2 A;  1EOV A;  4AQY Q;  4NXN Q;  4LUO A;  4LUV A;  5E7N A;  3L2P A;  2ES2 A;  2UXD L;  3ICE A;  3RR5 A;  1XNQ Q;  2VS1 A;  1G51 A;  2BA0 A;  2FXQ A;  3ER0 A;  4YCV A;  3K80 C;  2EXD A;  4DPG A;  2NZH A;  1VQN A;  3BZC A;  4R1J A;  1JE5 A;  3AQQ A;  3CAM A;  3AFQ A;  1YEZ A;  4IPH A;  4GLV B;  3RNU A;  4JC0 A;  3W1G A;  1JJ2 A;  4QQB X;  2UUC L;  4A3G G;  4IPC A;  2I0Q A;  1OXX K;  2UUA Q;  4JI8 Q;  5LMN W;  3GD7 A;  4JI7 L;  4JI0 L;  3I4M H;  4IOC A;  1Y1V G;  2E8G A;  2JA9 A;  2KHJ A;  2JA8 G;  2B29 A;  2WAQ G;  4XIG S;  4C3J H;  5GAD C;  1LYL A;  3CCE A;  1JT8 A;  4LF5 Q;  4PZ6 A;  3ZJY C;  4DR3 L;  1N36 Q;  4A3I H;  4B3M Q;  1KQS A;  3G6E A;  1VQ9 A;  3HKS A;  1LUZ A;  4KLK A;  4QY7 A;  1HNX L;  1CUK A;  1NTG A;  1CSP A;  2BH8 A;  4LWC A;  1NMG A;  2GVA A;  1SRU A;  3F2C A;  2PI2 A;  3UDG A;  3CXC A;  4A3D H;  3CCJ A;  4DV7 Q;  3PO2 H;  2ALY B;  4DR6 Q;  1JJC B;  1IL2 A;  4DR4 L;  1VQH A;  1VQJ A;  4PZ7 A;  4LFA Q;  2F4V Q;  4OO1 G;  3F1Z A;  3HKZ G;  2F52 A;  1KRS A;  3HOW G;  4YCW A;  3J81 i;  3PF4 A;  1Z47 A;  2VZA A;  4P72 A;  4HID A;  4ME3 A;  3I7F A;  3G48 A;  4JI4 Q;  4JI6 Q;  1FJG Q;  3S1R H;  2K4K A;  1R9T H;  2QA4 A;  4LF9 Q;  4UY8 C;  3GTJ H;  3T1H L;  3I55 A;  2GVB A;  1HH2 P;  5JJK A;  1PH7 A;  1I5F A;  1KAW A;  4JBJ A;  1PH3 A;  1MJC A;  2XGT A;  3PCO B;  5M5X H;  5ELN A;  3RLN A;  5GAE C;  4K0K Q; 
#chains in the Genus database with same CATH topology
 5CV9 A;  5I2X A;  4OWX B;  1MI2 A;  2M00 A;  4X62 L;  1EWH A;  2SNS A;  1PV4 A;  3TQY A;  1PH8 A;  2LFN A;  4DV2 Q;  3HKZ B;  2F0O A;  4KMU C;  4HCS A;  4ABN A;  1A8V A;  1Q81 C;  1I4R A;  1BBW A;  2B2Y C;  5AJ3 L;  3CME A;  1O7Y A;  2GA4 B;  3MXU A;  2ENB A;  4NMZ A;  1UE6 A;  4JI2 L;  3MEH A;  2DY7 A;  4H13 C;  2VUM B;  3MXN B;  1HJP A;  4LAA A;  4IAL A;  1MIU A;  3T1Y L;  4DAY B;  3H91 A;  2PZU A;  1XMQ L;  1SBB B;  2WFW A;  2MGS A;  1X65 A;  3C1F A;  2KHI A;  3KF8 A;  2JQO A;  4PMB A;  2UXB Q;  5I9P A;  3HG9 A;  1E22 A;  4RCN A;  4LF7 Q;  4ILW A;  4JI5 Q;  3RZO B;  1ET6 A;  1YBY A;  3P20 A;  2AWO A;  4BY1 H;  3D4W A;  3QR8 A;  1PTO C;  4HJ9 A;  4XTC S;  3NE5 B;  1MD2 D;  5D65 A;  3UE0 A;  5M3M H;  1I6H H;  4HIK A;  2JJQ A;  4PQX A;  1N32 Q;  3TS2 A;  1H9R A;  3NEN A;  4JV5 L;  2JA7 B;  4KJO A;  4FF4 A;  1HQM C;  1EY8 A;  4IUN A;  5JPM C;  1QZH A;  1YI2 A;  1EEF D;  3NWT A;  4YCU A;  4ZQ3 A;  3MC0 B;  2UXC L;  5C4X H;  2N49 A;  5A35 A;  3HOZ G;  1SNP A;  2NBF A;  3FHW A;  3U58 A;  1HNZ L;  3R2T A;  2OTL A;  1QNU A;  3DLL A;  1PA6 A;  1XXG A;  3BU2 A;  2AQ3 B;  4FXD A;  4P75 A;  1TXY A;  1Z9F A;  1EQV A;  1K3B C;  3HOX B;  4LFB Q;  2Z9H A;  3K57 A;  4DV0 Q;  1XNR Q;  2Z6K A;  4DXF A;  4BBR G;  2G9H D;  3T4A C;  1YJN A;  3K7U C;  3MEF A;  2K04 A;  1CKN B;  4XQQ A;  1KNE A;  3FP9 A;  1ML0 D;  3GV6 A;  3OW7 A;  4ZRZ A;  4O42 A;  3M4O B;  4GNX C;  4YWL A;  3PUZ A;  1MHW C;  4K8I A;  1PH9 A;  1OXV A;  4POG A;  1QNK A;  3W3A A;  2HHH L;  4BS9 A;  1K0S A;  3CCU A;  1O7Z A;  4IUV A;  4JW0 A;  3BDL A;  4N8X 1;  4CDC C;  4DR7 Q;  4FVM A;  1VMC A;  1SLJ A;  1W3S A;  3L7Z C;  4OEL B;  5BN4 A;  3W1B A;  2PNH A;  1A3V A;  4IFD J;  3OTO Q;  2VUM G;  4JVZ A;  4KTA A;  3R3O A;  3CCQ A;  1EIF A;  2ZT9 C;  2NVX B;  4G7H C;  1Y8P B;  3RZD H;  4MZ9 A;  4K2K A;  3KYH C;  5IWA L;  2C5C A;  2QCP X;  1KHI A;  1I4Q A;  5CV5 A;  1PH4 A;  1SMY C;  3KDF B;  5KGU A;  4LF8 Q;  2D0P A;  2DNC A;  4N9T A;  1K8G A;  3S16 H;  1I3Q B;  2N88 A;  3CKI B;  4IUU A;  4HJ8 A;  3J7Z C;  2BE5 C;  3F8T A;  4X3U A;  4XXE A;  1SYD A;  5T1I A;  3DM3 A;  2B2U A;  1LAC A;  1I6H B;  1MBY A;  5E1F A;  4C2M B;  2LKV A;  4F87 A;  5FLM G;  3GTK H;  1OTC A;  2VL6 A;  1DYQ A;  4ZLT F;  2QGQ A;  3NPP A;  2MUY A;  4O2D A;  1L0Y B;  3PUW A;  5IIF A;  2JA7 G;  1FVI A;  4DFA A;  1AH9 A;  1KDB A;  1XYI A;  4IPD A;  2UUA L;  4A3E B;  2RCF A;  2ZTE A;  5COY A;  4IFD I;  1B50 A;  3T13 A;  3J7A F;  2Z4H A;  1N36 L;  4KY6 A;  3SEB A;  1STH A;  2TSS A;  4TQU S;  3J7A V;  2CQA A;  4ZUI A;  5E3F A;  3VYT A;  2EY6 A;  1TWF B;  2A19 A;  3J80 L;  4DK1 A;  3M7N A;  4GN4 B;  3QWN A;  3PIP A;  3GTM H;  1YHB A;  4H7B A;  4UHV A;  5EKK A;  2SOB A;  3K0X A;  2OF1 A;  1YIT A;  1TWA H;  1F77 A;  3S15 H;  3CCR A;  4CDF C;  3HOX G;  2KCC A;  4F7X A;  1X3P A;  4IO9 A;  4JI4 L;  4J8Q A;  2RDH A;  4LW1 A;  4BXX H;  3NHH A;  2YTV A;  2KEE A;  5C4J B;  2M9V A;  1K0R A;  4NP5 A;  1Y8N B;  1XPR A;  5LHY 1;  5C44 H;  4H02 A;  4CBV A;  2B39 A;  3ERQ A;  2HIX A;  2JA5 B;  1E0B A;  1KLU D;  2KQ3 A;  2NUC A;  1E3P A;  1FYC A;  1K8O A;  4DKA C;  1K28 A;  1QB5 D;  4DV2 L;  2L1B A;  2Q8I B;  3JAM c;  2C9O A;  4K8J A;  3U4Z A;  5EGT A;  4HR7 B;  2R3Z A;  1E2V A;  3RZD B;  3IL8 A;  4DUZ Q;  4RWS C;  2CQO A;  2IT1 A;  3JAM E;  1KNA A;  1GHK A;  4XDX A;  3S16 B;  3TP6 A;  2HD3 A;  3L3O C;  1IBM Q;  2VY3 A;  5JVH 3;  4XT1 B;  1I50 B;  1PTO F;  4MHE A;  4L6T B;  2IHE A;  3TZD A;  1S72 A;  3GTK B;  2UXB L;  2CWA A;  2K5W A;  2I5H A;  4KN7 C;  4LF7 L;  4DGZ A;  3M9B A;  4JI5 L;  3RD4 A;  4DR5 Q;  2A1A A;  2F3V A;  4GOP C;  4DNI A;  1CQV A;  4OIJ A;  4CDD C;  4GNX A;  3ND8 A;  3NQI A;  4A75 A;  1UE5 A;  2K52 A;  4A3G B;  2CW0 D;  2KJX A;  1N32 L;  1BUV T;  4IUP A;  2MNA A;  3TRE A;  1Q82 C;  1HNW Q;  1DZ1 A;  1EOT A;  5GRO A;  4BA2 I;  3Q24 A;  4ULL A;  1QOH A;  1HZB A;  3GQB A;  3O13 A;  4A3E G;  3S14 H;  5DM7 3;  2R93 H;  3GTM B;  3MWY W;  4XQJ A;  3VR2 A;  1UAP A;  1IW7 C;  1G6Z A;  1TWA B;  3S15 B;  3NBI A;  1VF5 C;  1L0W A;  1GKH A;  2R7Z G;  3Q0A A;  1AE3 A;  1JMC A;  1BCP B;  5C0X I;  4YY3 Q;  2ZJQ A;  2K05 A;  2NVQ H;  1ASZ A;  3DWA A;  1CKO A;  4LFB L;  1FGB D;  3CF5 A;  4DV0 L;  3KJO A;  1XNR L;  2E74 C;  2JA6 H;  1L1O B;  2B2T C;  2JA8 H;  1EWI A;  1NMF A;  2F0H A;  3NUC A;  3GDE A;  2L12 A;  3CPW A;  3FKI B;  3QJY A;  1YVC A;  2OT2 A;  4B3R Q;  4S3S A;  2K28 A;  1AE2 A;  1KDC A;  3SK4 A;  2OCE A;  1VQA A;  2JA5 G;  2WAC A;  3NBH A;  1U0L A;  3MXG A;  2CFM A;  4HIM A;  3E6Z X;  2A6E C;  1GVP A;  4LFC Q;  4DR7 L;  4RCO A;  1GJX A;  5DEH A;  1EYA A;  1AFP A;  2F0S A;  1XWE A;  3AYH B;  1TKW B;  1ZYR C;  1UUP A;  2VB2 X;  3WOF A;  3OTO L;  1QG7 A;  3I4M B;  4RKB A;  1HR0 Q;  5CBA E;  1PZI D;  4FP5 D;  1C7Y A;  1SAP A;  3EQL C;  2XSC A;  4OWT B;  1SYG A;  5KNB A;  4QIW E;  3DXJ C;  2HUG A;  4KV6 A;  4LF8 L;  4B08 A;  3K59 A;  3EN2 A;  1EOV A;  1JQY D;  4NXN Q;  2ES2 A;  1XNQ Q;  3OIP A;  4A3D B;  2JN4 A;  3NQT A;  2FXQ A;  2A6H C;  1XTC D;  3K80 C;  4YIJ A;  4OIK A;  4PV1 C;  2EY2 A;  2QW7 A;  1YEZ A;  1WD0 A;  2OEO A;  3S1R B;  3RNU A;  3FRP B;  1DON A;  3I70 A;  3S14 B;  4A3G G;  2I0Q A;  1OXX K;  5LMN W;  2R93 B;  3GD7 A;  2A68 D;  2HCI A;  2Q8R E;  5CGK A;  5J1Z A;  1ESR A;  4EQN A;  3IFD A;  4BY7 B;  1HRJ A;  3G6E A;  1V1P B;  4KLK A;  1GUS A;  1CUK A;  1CSP A;  2NVQ B;  1JCK B;  1RDP D;  2ALY B;  4DR6 Q;  1JJC B;  1IL2 A;  4K5X A;  4LFA Q;  2FMC A;  3F1Z A;  2JA6 B;  2F52 A;  2A74 C;  1PDQ A;  3J81 i;  3PF4 A;  3G48 A;  2EVB A;  1LT5 D;  1R9T H;  3GTJ H;  2PZT A;  5JJK A;  3TN2 A;  2XGT A;  3RLN A;  3CU7 A;  4YWK A;  2UUB Q;  3U9S A;  4C56 C;  3FKI G;  5CYU A;  4A3K B;  3HOZ H;  1Z7T A;  1T9H A;  4MNO A;  1HUM A;  1IBL Q;  2AKW B;  1EYG A;  1PZK D;  3EIV A;  3GTG B;  4DNT B;  3S1Q B;  1UNS A;  4A3B B;  3L0O A;  3BS1 A;  3FVQ A;  4OO1 I;  2H5X A;  1NSN S;  4BBR H;  4HJA A;  4DUZ L;  3I4M G;  1WTO A;  3R93 A;  1Y8O B;  4UP9 A;  4DV6 Q;  3OW2 A;  4JG2 A;  1EYC A;  2E2D C;  3PUY A;  1IKL A;  4P74 A;  2CVR A;  2I5M X;  5M5W B;  2PYK A;  5DM6 3;  1IBM L;  4G7Z C;  3CRK C;  5M5Y H;  1K73 C;  2J7Z A;  3PUV A;  5C3E B;  4EQ5 A;  4QIW B;  2JYO A;  1N9W A;  4A3D G;  4WJ4 A;  1X6O A;  4KN4 C;  1BF4 A;  4HED A;  4R8N A;  4DR5 L;  1X56 A;  5CMD A;  2E2I H;  1YHA A;  3AEV A;  3QOL A;  4DV5 Q;  1TR5 A;  5CR3 A;  5HY6 A;  2EIF A;  1HTP A;  3MFY A;  4DR2 Q;  2R93 G;  1G6P A;  5ELD A;  1VMP A;  2PZW A;  1HNW L;  4UAI A;  1KTK A;  2QDB A;  4BY7 G;  1HA5 A;  3H15 A;  1STY A;  1D8L A;  5J39 A;  3C1E A;  4HJ7 A;  2LS0 1;  1RIP A;  1Y1W G;  3RZO H;  2EYJ A;  2NVT B;  2LXJ A;  3A56 A;  2NN6 I;  4FXK C;  4LUZ A;  3I73 A;  5FLM H;  3C2P A;  2Z0S A;  1S5C D;  4ZYS A;  4KHP Q;  4YY3 L;  2JA6 G;  3Q23 A;  4KHZ A;  4ME5 A;  1Q3L A;  3VR5 A;  4P71 A;  5M3F G;  1XPU A;  3ONA B;  1N33 Q;  2XRQ D;  1YHQ A;  2JA7 H;  1WTQ A;  1M90 C;  4M1U B;  4L5S A;  4KKT A;  2PQA B;  4JYA Q;  2WKD A;  1VQO A;  4RH6 A;  3MZ5 A;  4QMG A;  1YZ6 A;  2AQ2 B;  5LL6 X;  1S3O A;  4A3K G;  1RD9 D;  1A63 A;  4DV3 Q;  4B3R L;  2DN8 A;  1EU4 A;  4K6D A;  4PMC A;  3I2Z A;  1TS5 A;  2EYM A;  2RHS B;  4AH6 A;  1JJG A;  5BN3 A;  3PGZ A;  2ASB A;  4RGM A;  1YNN D;  1YNX A;  4A3B G;  5AFW A;  2HDL A;  4V0B A;  3VYU A;  5C4H A;  5JEA G;  5C0X G;  2R6G A;  2B2U C;  3HOX H;  1J8I A;  5KIX A;  4LFC L;  1VQF A;  1NR2 A;  3OIQ A;  3PSI A;  1SDF A;  4R9W A;  4XT3 B;  2P5Z X;  2PI2 E;  4WOR A;  2QKI C;  5M5Y B;  2X69 A;  3H3V I;  2F0V A;  5K36 G;  4NKL A;  1HR0 L;  4H44 C;  4UPA A;  3IFT A;  5IT9 L;  4B3T Q;  3M4O H;  2RHQ B;  1EY0 A;  3GTQ B;  1MSG A;  3B6Y A;  2VQF Q;  1BR9 A;  3FDT A;  3S1N B;  2EYL A;  1PFM A;  4R4T A;  1LTG D;  4V19 0;  5C3E G;  2B2V A;  1GXD C;  3Q22 A;  1AZQ A;  2Z4I A;  3OWE B;  3VR4 A;  2E2I B;  4NXN L;  3DWQ A;  2F0L A;  3KJP A;  3VDY A;  1IYJ B;  1MKH A;  1XNQ L;  1F9Q A;  1PH2 A;  3G4S A;  2O5I C;  1YNJ D;  1EUJ A;  2OQ0 A;  4CKC A;  1LTL A;  4GN3 B;  2DNE A;  1DOL A;  1VQB A;  2LXK A;  4L63 B;  3M4Y A;  4QB4 A;  5M9O A;  1HCZ A;  3DHQ A;  3OOC A;  1UEB A;  2NVX H;  1WTR A;  1O7L A;  1EY7 A;  4DR3 Q;  1EIH A;  1P16 A;  3MXN A;  1STE A;  1D5X C;  1PYB A;  4GN5 A;  1SEB D;  1V43 A;  4DAY A;  1VQ5 A;  1VQ6 A;  3GTP H;  2BDO A;  1Y1V H;  5KND A;  1KL9 A;  2FJ2 A;  1VQI A;  3K58 A;  1U9R A;  1I3Q H;  1Q86 C;  2E2H B;  2B8F A;  1KRT A;  1SYC A;  2J0T D;  4P73 A;  4J1M A;  5FKA C;  3CCV A;  2RSO A;  1EQT A;  3EFX D;  1FNU A;  2EOT A;  1CKM A;  4C2M H;  3SVM A;  1OXS C;  4DR6 L;  4IJH A;  1ILQ A;  1FL0 A;  3K7A H;  5D3D A;  3TP5 A;  4LFA L;  1Q1E A;  2RVL A;  5EPK A;  4I7Z C;  3T1H Q;  1OXT A;  1O80 A;  1X3G A;  2LMC B;  1VQP A;  2IX0 A;  3S17 B;  3VYS A;  3S2H B;  1F9S A;  4A3E H;  1CHQ D;  3HEJ A;  2V4D A;  3RMH A;  1CI3 M;  5C5M A;  1NE3 A;  1L0X B;  2VXW A;  3KUP A;  3I3C A;  3NTK A;  5C6A A;  5JAV A;  2UUB L;  2X6G A;  4MTK A;  2PCF B;  4NB3 A;  3OSO A;  1SE8 A;  1YJ9 A;  1NUC A;  1HZ9 A;  1TWF H;  4A3F B;  2R7Z H;  1IBL L;  2RA4 A;  4Z9C B;  2K33 A;  3A7A B;  1ZEQ X;  1CM9 A;  2JXM B;  3A5U A;  4JK1 C;  3W2D A;  2PNR C;  2KHS A;  1C8C A;  1PRT D;  3HOU B;  1BVS A;  3CPF A;  2EJG C;  1DD2 A;  5FK9 C;  2SEB D;  1P8L A;  5C4J H;  4DV6 L;  3D6C A;  3GTO B;  4WJ3 M;  5A2Q L;  2K5Q A;  5C3W A;  1CKN A;  2A5H A;  4L5T A;  4ALP A;  5JJI A;  4PG3 A;  4NDX A;  2EE1 A;  2JA5 H;  5JVG 3;  3HOY H;  1A15 A;  3LX0 A;  3RLF A;  2IW3 A;  4LMQ D;  1LM0 A;  3PIP 3;  3BJU A;  5KEE A;  4DV1 Q;  3HP3 A;  3U4V A;  2DY8 A;  4GZY C;  1B3A A;  1B9N A;  1B44 D;  2F0T A;  3H0G H;  3S9W A;  2CKZ B;  2UU9 Q;  1GOZ A;  3UE1 A;  4DV5 L;  5I9O A;  1EY5 A;  3U50 C;  4EQP A;  2XN9 C;  3GTP B;  1Y1V B;  4GKK Q;  1D5M C;  4DR2 L;  1DXM A;  1LAB A;  3KBX A;  3BZK A;  4RG1 A;  4ZCK A;  3X3N A;  1I50 H;  1QWY A;  1BCP C;  1VQ4 A;  3EVQ A;  4JI1 Q;  3M4P A;  4U68 A;  5ISR A;  1TS4 A;  2HQE A;  1SFO B;  1B4O A;  3K8A A;  3KDF A;  3CRL C;  4HCE A;  1PRT B;  3K7A B;  1CT1 D;  4HJ5 A;  4O0A A;  1PTO D;  3K5L A;  3VR3 A;  2B3G A;  3AB9 A;  3HOW B;  1M8A A;  1VS0 A;  4KHP L;  3NEM A;  5F2D A;  3CP0 A;  3UDF A;  2J4X A;  2L11 A;  4A3G H;  5DLQ E;  1JB3 A;  4X3S A;  1WI5 A;  3K81 C;  1X3Q A;  1N33 L;  1ILP A;  3E0J A;  3CC4 A;  4IUR A;  5IYD H;  5IGF A;  2EYP A;  5EPL A;  3T56 B;  4JYA L;  2QIL A;  4XYO A;  2IPK D;  1F2Y A;  1EWC A;  2WV6 D;  3F2B A;  1W6K A;  1GHJ A;  2YV5 A;  2R7Z B;  1PLF A;  3URY A;  2MP1 A;  1CA5 A;  1SN8 A;  1CFM A;  1CQF A;  1ONL A;  4R4C A;  4JCV E;  4A3F G;  4DV3 L;  4KY5 A;  5FO8 B;  1SNQ A;  3RLO A;  1RTO A;  1J6Q A;  1EIG A;  1I4G A;  1V1O A;  2XVS A;  4KK7 A;  3I90 A;  1X9N A;  3OMC A;  1GUN A;  3V96 A;  2K5V A;  1DCZ A;  1E7Z A;  3I8Z A;  1VQD A;  4CKB A;  1MSH A;  1EIY B;  2MHV A;  3HOU G;  1CK1 A;  1S4Z A;  2O2L D;  2IY5 B;  1HUN A;  1I4P A;  1LT6 D;  5CV6 A;  3CC7 A;  4ZK9 B;  1E2Z A;  1PTO B;  3RUZ A;  1PYS B;  3HOY B;  1IYV A;  1O78 A;  1LTS D;  3F2U A;  2ICE C;  4X64 Q;  4B3T L;  3LWU A;  1HTL D;  3FKI H;  4JBM A;  2ZTC A;  2VQF L;  3NP8 A;  1PFS A;  1LT3 D;  4AQY Q;  4LUO A;  3L2P A;  4ZKC B;  3H0G B;  2XRS D;  5DAU A;  1DJR D;  2VS1 A;  1AZP A;  1G51 A;  2BA0 A;  3ER0 A;  3PO2 B;  5DNF A;  2EXD A;  3H94 A;  2KUM A;  1JWM D;  3AQQ A;  4K14 A;  2EYH A;  4GLV B;  3W1G A;  4ID6 A;  5C5L A;  1S5B D;  3BDO A;  4JI8 Q;  2B2W A;  3I4M H;  1D2B A;  2KED A;  4IOC A;  1VDZ A;  1Y1V G;  2JA9 A;  5M5X B;  1WTX A;  1JT8 A;  1LYL A;  2BDN A;  3CCE A;  4DR3 L;  1SMY D;  5HUR A;  3V05 A;  2F0M A;  1CTM A;  3DEO A;  1VQ9 A;  3I91 A;  5IGG A;  2BE5 D;  1C48 A;  2O4X A;  1NMG A;  1SRU A;  3F2C A;  4FF3 A;  4A3D H;  2KVM A;  1VQJ A;  2O5J C;  4K2L A;  3J7Y W;  2F1M A;  3HOW G;  1H9K A;  3P1H A;  4ME3 A;  1FJG Q;  3S1R H;  2K4K A;  1B2T A;  1U4P A;  4LF9 Q;  3T1H L;  4ZAI A;  2EYO A;  3R8B A;  1KLG D;  4JBJ A;  3PCO B;  5IT9 c;  4K0K Q;  4UP7 A;  3J81 L;  1IKM A;  3WDN A;  1EY6 A;  2IJ0 A;  4WJW A;  4BY7 H;  1C4Q A;  1QE6 A;  2K32 A;  3OWF A;  4HTH A;  3M4Q A;  2JE6 I;  1EQQ A;  1Y1W H;  1JE4 A;  5IT9 E;  1XMO Q;  2F0D A;  1ENC A;  4IJL A;  1FGU A;  4APV A;  1ASY A;  3ULP A;  4HMI A;  2D5D A;  4LNQ A;  1QUQ B;  1DOM A;  2CWP A;  4LF4 Q;  2ZTD A;  1NAP A;  1PMR A;  2VQE Q;  4YHH Q;  5M3F H;  4B3S Q;  4B9X A;  4EVO A;  3PO3 B;  3RN2 A;  2K5N A;  2K5D A;  2ZXR A;  2K75 A;  3GV3 A;  4C3J G;  5GAH C;  5KRU A;  1XJV A;  3HOY G;  1SYB A;  3J80 i;  1VF7 A;  3IAY A;  4HSP A;  1L1O A;  4A3K H;  3DMU A;  1VCI A;  2HQL A;  1EZ8 A;  2ZXO A;  2AUJ D;  3H0G G;  4GKJ Q;  3PO2 G;  2I46 A;  1I4H A;  2QEX A;  3GTG H;  2ZXP A;  3S1Q H;  5JPN C;  4A3B H;  4K5V A;  5JEA H;  1H95 A;  5C0X H;  1V9P A;  4DV1 L;  1GUW A;  3ULJ A;  1BCP F;  2UU9 L;  2Z1C A;  1Q8K A;  2C35 B;  1B7Y B;  1EQR A;  2ID0 A;  4N9P A;  5K36 H;  3L9A X;  1CHP D;  4GKK L;  1V1Q A;  5M5W H;  1WCM B;  4OEM B;  2IL8 A;  4UP8 A;  5C3E H;  4JI1 L;  1E1O A;  1BNZ A;  2D62 A;  3P7J A;  3CHB D;  5EKL A;  4A3C G;  2SNM A;  1JWU D;  1VQE A;  3QIA A;  1C9O A;  2NTS A;  3N6R A;  2EJF C;  4X65 Q;  4Q5V A;  1S40 A;  5IYD G;  1JOO A;  1SNO A;  1EU3 A;  1IBK Q;  3A0J A;  1LTT D;  3WWV A;  1Y1W B;  2K50 A;  1EFI D;  1PH5 A;  5EBD A;  1KAB A;  1VQM A;  1OXU A;  4EGV A;  5J22 A;  1B8A A;  4XYQ A;  2WKC A;  2KCT A;  3TDQ A;  2WB1 E;  4DUY Q;  3I56 A;  2NVT H;  1L2F A;  3HFZ B;  3SR1 A;  1V1P A;  2BH2 A;  5A2Q E;  2B2V C;  1UWV A;  1NY4 A;  2NTT A;  2NWG A;  3DUZ A;  3P75 A;  5M3F B;  4QCL A;  4P2C B;  1TWG H;  5COR A;  3G6J B;  2ZM6 Q;  3J7A 5;  4DK0 A;  1H9S B;  2AHO B;  5EQ0 A;  2E2J H;  4WFN 3;  1EL0 A;  1B1Z A;  1F2L A;  5GAG C;  2HIV A;  1ROD A;  2K03 A;  1O7I A;  1ICW A;  3MTS A;  2PO4 A;  3PO3 G;  1JR0 D;  2WII B;  3MA2 B;  5LMN Q;  4IFD G;  2XNA C;  5L37 A;  1Y14 B;  4GOP B;  2KCM A;  1BKB A;  1PFN A;  2D9U A;  4QL5 A;  3MFG A;  4R4O A;  4X64 L;  2UXD Q;  4J6H A;  2A69 D;  2V1C C;  1H9J A;  2EY5 A;  4AQY L;  2R92 B;  2EY1 A;  4TRD A;  5I6W A;  1LTB D;  3D4D A;  2A6E D;  1Q8I A;  4O1N A;  3CCM A;  2EZV A;  3UDX A;  4DAP A;  1VQL A;  1VQ8 A;  5J3B A;  2UUC Q;  1WTP A;  3NTI A;  2L9H A;  3SDZ A;  4MN3 A;  1AP0 A;  4JI0 Q;  1DGS A;  1X55 A;  2BA1 A;  1ZYR D;  3QG1 A;  5ELC A;  2ZJR A;  3KF6 B;  1RF2 D;  1Q1B A;  2CH4 W;  4JI8 L;  2N8N A;  2I5L X;  2F0P A;  4POF A;  2EYF A;  5KYL A;  3GTQ H;  1SMX A;  3S1N H;  1WCM G;  1Q12 A;  3T53 B;  2MO0 A;  2B63 B;  2QF7 A;  3HS0 C;  3TS0 A;  4FO2 A;  4A4I A;  3J81 j;  3A74 A;  1YJW A;  4KI0 A;  2Q2T A;  5IGD A;  2A6H D;  5JJL A;  2M2L A;  1BBX C;  4IZ8 A;  2IX1 A;  2FHT A;  1NNX A;  2F0N A;  1JIC A;  4C3I H;  5FLX L;  1STB A;  1EY9 A;  1STG A;  2NVY H;  4WRD A;  5IGB A;  1R4Q B;  1TS3 A;  1A0I A;  1EEI D;  2KEN A;  4JOI A;  1KXL A;  4A3L G;  3NSW A;  1M4V A;  1YNJ C;  1FJG L;  2RDG A;  2NZO A;  4LF9 L;  1DOK A;  3CQZ B;  1F9P A;  1TY2 A;  2H4O A;  3CCS A;  1T5E A;  3RN5 A;  4Y52 H;  4X66 Q;  3W5O A;  4QGU A;  1TWH B;  1FNW A;  1RTN A;  4K0K L;  4DU9 A;  1X3F A;  1IXR A;  2OTJ A;  2IHF A;  1JOR A;  5BR8 Q;  2VB3 X;  5JJZ A;  2NB0 A;  3G71 A;  2DJF C;  5IYB H;  2E2H H;  5EJW A;  1EFW A;  3GTL H;  1TWG B;  2EDG A;  3AU7 A;  4DK6 C;  1I4X A;  1S5F D;  5IP7 G;  1XMO L;  2E2J B;  4NPS A;  1TWC H;  2WB1 B;  2CCZ A;  3HOV B;  5I4D A;  4LF4 L;  4CJ1 B;  3NTH A;  1RKN A;  2PPB C;  4G4K A;  2VQE L;  2H1E A;  5FJ8 G;  1X32 A;  4IPG A;  3H6M A;  1J5E Q;  4YHH L;  5CV8 A;  3S17 H;  4B3S L;  1TS2 A;  3I4L A;  4XQN A;  5G3L F;  4A3J G;  5IYC G;  3S2H H;  4DXG A;  3A5Z B;  2PQA A;  2XIW A;  3CD6 A;  2K6A A;  4R4Q A;  4A3F H;  1RCV D;  3BVG A;  2R92 G;  5LMU Q;  3PV0 A;  4R4I A;  1NJI C;  3JC6 6;  4GKJ L;  2WP8 J;  1BXT A;  1ICF B;  2JP1 A;  5EBC A;  4RHS A;  3HGB A;  1CSQ A;  1XTD A;  4ZUJ A;  4CHT B;  2KBN A;  1WJJ A;  4M8A A;  3SGI A;  3K0Y A;  3HOU H;  2G9D A;  2CH4 A;  2KCN A;  1PRT C;  3J81 c;  1WVL A;  4LF6 Q;  4JI3 Q;  4AYB E;  3GTO H;  4NXM Q;  1HHV A;  3ZYY X;  3STB D;  4KKS A;  1D1K A;  5D14 A;  2EJM A;  3H09 A;  2B63 G;  3J81 E;  4C3I B;  3I4O A;  1WFQ A;  1BOS A;  3U9O A;  2R7D A;  1QVF A;  2NVY B;  4F8M A;  4KD4 A;  2MPM A;  4G7O C;  4GLX A;  2Y0S E;  4L8J A;  3S1M H;  1D1I A;  4TVA B;  1AEX A;  3CW2 C;  1K8A C;  3PQI A;  1A3T A;  4EX5 A;  5IP9 H;  2JSO A;  1U4L A;  4OWW B;  4X65 L;  3CCL A;  4E6I A;  3BYT B;  3KF8 B;  3MHB A;  4DN4 M;  3D4R A;  1ZXT A;  1IBK L;  2F0U A;  3SHL A;  1F2Z A;  3H3V H;  4F88 A;  3GTL B;  1ET9 A;  3EBE A;  5I6Y A;  3S2D B;  5CBE E;  3K5M A;  1QJO A;  3TSS A;  1JC7 A;  1UE1 A;  4UDU C;  3TBI B;  4H0L C;  4X3K A;  1TWC B;  1CA6 A;  2VNU D;  1G29 1;  1SFO H;  1TQO A;  3KFU A;  4K5W A;  4GS3 A;  1G8Z D;  4DUY L;  4CJ2 C;  2WB1 G;  4FF1 A;  3HOW H;  3HOV G;  5ELE A;  5FO9 B;  1GUG A;  3A8I E;  2ZM6 L;  2F0E A;  3UDI A;  2E5L Q;  3HRZ C;  1PXU A;  4RAU C;  5EKI A;  1SE4 A;  5IGC A;  2RBM A;  4JPB W;  1LT4 D;  1JOQ A;  4A3M H;  4A3I B;  2L5T A;  2B2W C;  3PUX A;  5LMN L;  3JAM i;  3QO2 A;  3S24 A;  3GO5 A;  4C3H H;  3CMA A;  1EYD A;  2DGY A;  4ZKB B;  1IYU A;  2UXD L;  3ICE A;  3RR5 A;  1D5Z C;  1SJE D;  4YCV A;  2X6L A;  1R4P B;  4DPG A;  1VQN A;  3BZC A;  3BDC A;  4IPH A;  3FMC A;  4JC0 A;  4X3T A;  2UUC L;  1SSO A;  3Q6S A;  5KYI A;  4JI0 L;  4TSS A;  1SJH D;  2KHJ A;  3E5S A;  3ERO A;  2B29 A;  4C3J H;  4XIG S;  5GAD C;  4LF5 Q;  1PTO H;  4HAE A;  2D2C C;  4OL7 A;  3ZJY C;  5TSS A;  4B3M Q;  2XWB B;  3HKS A;  1LUZ A;  3ND9 A;  1CZG A;  4QY7 A;  1QCB D;  1HA6 A;  1WTV A;  4LWC A;  1S5E D;  4AYB B;  3S1M B;  4C3I G;  2PI2 A;  3KLR A;  3CXC A;  3CCJ A;  4DV7 Q;  3PO2 H;  1ENA A;  1VQH A;  1STA A;  2F4V Q;  5E4W C;  4OO1 G;  3HKZ G;  1KRS A;  4YCW A;  2Z8L A;  2VZA A;  4P72 A;  4JI6 Q;  3I7F A;  2Y0S B;  2QA4 A;  1G91 A;  5BN5 A;  3I55 A;  1STN A;  1HH2 P;  1DM0 B;  1PH3 A;  1MJC A;  5M5X H;  2AUK A;  5GAE C;  5IYB G;  1Q7Y C;  3E0E A;  4KKU A;  4IOA A;  1I94 Q;  4X66 L;  5LL6 S;  3PIO 3;  5I2Y A;  2EXZ A;  4BY1 B;  5BR8 L;  1L1O C;  1HFG A;  4FF2 A;  2F0F A;  4CKE A;  3F2D A;  2B8G A;  4A3C H;  1AN8 A;  1LTR D;  2ICI A;  3NXW A;  3OPO A;  5KNC A;  5M3M B;  2DUD A;  3OYY A;  5ELF A;  4OX9 Q;  4A3M B;  2L15 A;  2EQS A;  1PZJ D;  3D0F A;  2CW0 C;  3FEW X;  4C3H B;  3IRB A;  1J5E L;  2Z6B A;  1GD7 A;  4A3I G;  3E9I A;  3ERS X;  3FPP A;  1GUO A;  5C4X B;  2FIN B;  1LV9 A;  1HZC A;  3K5O A;  4FYD A;  1VQC A;  3BVM A;  3LWE A;  4A76 A;  4FNF A;  2NN6 G;  3PMF A;  2B2Y A;  1LTA D;  4I65 A;  1XPO A;  5LMU L;  4KY7 A;  3SK5 A;  2SDF A;  5FLX c;  1PRT F;  2TMP A;  1CZW A;  4C3J B;  3VA5 A;  3K6O A;  1N34 Q;  1NR4 A;  5FLX E;  4GLA C;  3PO3 H;  4OGQ C;  3PIO A;  4RA8 A;  2AMC B;  1FR3 A;  1KIX A;  3A7L A;  4IFD H;  4JBW A;  4A93 H;  1RJT A;  1TVX A;  1D6E C;  3TME A;  3R2I A;  1PFB A;  2OXP A;  2MO1 A;  2N55 A;  2F0I A;  4LF6 L;  3OMG A;  4JI3 L;  4NXM L;  2RSN A;  3VR6 A;  4AYB G;  1QIL A;  2VW9 A;  3A8K E;  3TZU A;  5IP9 G;  1A62 A;  1B53 A;  2NYZ D;  1I6V C;  2Y0S G;  2G5D A;  2AQ1 B;  2NZ1 D;  1EZ6 A;  1VQ7 A;  2MFI A;  4RGT A;  1UEA B;  3WOE A;  1AW7 A;  2F3W A;  4DR1 Q;  1NBW A;  4KD3 A;  3I4N H;  2ZJP A;  1HXY D;  2PW5 A;  4MTN A;  3HZX A;  1SNC A;  1BCP D;  2RKS A;  1JB7 A;  1WCM H;  5ELO A;  2F0K A;  4BBS H;  1N8R C;  1ESF A;  3AMU A;  5EPJ A;  5JEA J;  4L5R C;  5C0X J;  4BY1 G;  5C3X A;  4GNX B;  1WTH A;  3IKJ A;  1LLR D;  1X54 A;  4L5Q A;  2Q2H A;  4DAM A;  4DK3 C;  2YTX A;  2XTI A;  3T51 B;  5M3M G;  2K1B A;  1JOK A;  4FXG C;  2OWO A;  1WOC A;  2R61 A;  1W6J A;  4N8F A;  4DV4 Q;  4A3L H;  4A3M G;  2IWH A;  1Q46 A;  2E76 C;  3AFP A;  2A68 C;  3BVZ A;  1X3E A;  1B70 B;  2E5L L;  3X3M A;  4C3H G;  3PF5 A;  4CDE C;  3DWP A;  1D7Q A;  4G57 A;  5FO7 B;  4BWG B;  4OHJ A;  1II3 A;  4RGN A;  4LK1 C;  1QZG A;  5C4X G;  1K83 H;  2FFK B;  1F9R A;  1BBU A;  2YU9 H;  2JEA I;  5IP7 H;  1U4M A;  2QDL A;  5FOB B;  4YWM A;  4RGO S;  3LNN A;  3M3Y H;  2GN5 A;  1G2T A;  2KEC A;  1B3Q A;  1WTW A;  4HIO A;  1A3U A;  1RHP A;  4RFB A;  1C0A A;  4JI7 Q;  2WAQ E;  5NUC A;  1HR0 W;  4CJ0 B;  1E1T A;  2Q8T A;  1NCV A;  4A93 B;  1QUQ A;  1XX8 A;  5FJ8 H;  4EQO A;  1WYD A;  4IQZ A;  3NK9 A;  3MVV A;  4DAV A;  3C3L A;  2PMZ E;  4JOI C;  1KDA A;  1M1K C;  3KK7 A;  1BO0 A;  4PNY A;  4A3J H;  5IYC H;  3NBH B;  5C44 B;  1HNX Q;  3M85 A;  2JEB I;  4LF5 L;  1TU2 B;  2YTY A;  4B3M L;  1KAA A;  4IUT A;  1S5D D;  3TP8 A;  1IL8 A;  2RF4 A;  1F2M A;  3E3X A;  4DR4 Q;  5HGT A;  3DM1 A;  2R92 H;  1K8M A;  4TKO B;  2A69 C;  1TY0 A;  1UE7 A;  2KOL A;  1Z6H A;  4DV7 L;  2OQK A;  1U4R A;  2L55 A;  2ATW A;  2F4V L;  3NEL A;  1E24 A;  3UI2 A;  4JI6 L;  5C4Z A;  3I4N B;  5HGQ A;  1KD1 C;  1K9M C;  4BBS B;  4X62 Q;  1PHJ A;  5GQO A;  4RKL A;  1GM5 A;  3KOJ A;  3SK8 A;  1ZKO A;  1PH6 A;  5K5P A;  5T1G A;  1I94 L;  2E75 C;  4HMJ A;  4LJZ C;  2B63 H;  1SRO A;  4FDB A;  5H1S E;  5AJ3 Q;  3TRZ A;  3CC2 A;  4JI2 Q;  3FPU B;  3E9H A;  2EPB A;  3D8G A;  1A2U A;  1T5X D;  1GO3 E;  2YYZ A;  3T1Y Q;  3BG3 A;  4PZ8 A;  1XMQ Q;  3N52 A;  1PH1 A;  4OX9 L;  2MQH A;  1K83 B;  2K7V A;  3I72 A;  4DNR B;  1ENF A;  3CQZ H;  3VYR A;  1Y69 U;  2LSS A;  1LO5 D;  1QVG A;  1SE3 A;  4AIM A;  1JWS D;  1IW7 D;  4NW2 A;  2FMM A;  1V8Q A;  3A54 A;  2YU9 B;  1SND A;  1TWH H;  2D0O A;  4RMF A;  4B9W A;  4JBK A;  4KJN A;  4J15 A;  4Y7N H;  2I07 B;  5CC4 A;  3M3Y B;  4X6A H;  1YIJ A;  5E4X A;  3EA6 A;  2L0C A;  3VA7 A;  1TT2 A;  2JK8 A;  5IY0 A;  2IX3 A;  1MJE A;  1QVC A;  3HOV H;  3NWS A;  4JV5 Q;  2PW7 A;  4Q0F A;  5EAY A;  4A3J B;  4K6L A;  1SYF A;  3D31 A;  2A8V A;  4A93 G;  4OON A;  1B9M A;  3QOJ A;  4BXX G;  1LTI D;  2RCN A;  2JA8 B;  1H9S A;  4QF4 A;  2Q2I A;  1N34 L;  4I7A A;  2WAQ B;  3SK6 A;  3TEH B;  5D3I B;  2UXC Q;  1HZA A;  5IOC A;  5C44 G;  2PMZ B;  1HNZ Q;  1FD7 D;  3LGJ A;  3Q8D A;  2RQX A;  3D3R A;  1J9O A;  3A55 A;  5CV7 A;  4HN7 A;  4QJF A;  1A2T A;  1BDO A;  3M7G A;  4ODG A;  5G3L D;  4GOP A;  2A73 B;  3DEP A;  1A6X A;  2HT1 A;  1SR3 A;  1YNN C;  4MIU A;  2F03 A;  1KC8 C;  5IGE A;  2Q2U A;  1TII D;  1EY4 A;  2AWN A;  3MAQ A;  4QUF A;  2N78 A;  4OXP A;  4PMW A;  2LY7 A;  3I4N G;  1SE2 A;  4IUQ A;  4BBS G;  3ULL A;  4DR1 L;  2R7F A;  1SNM A;  1IHZ A;  3HKZ E;  3KF6 A;  3A8J E;  2HHH Q;  3G7L A;  5CV4 A;  2K14 A;  2BOS A;  1PVO A;  3STB C;  1RL2 A;  2F0W A;  2DJG C;  1VQG A;  5IE8 A;  1H9M A;  3J80 c;  2K5H A;  1SYE A;  3BYY B;  4OO1 H;  4CGY B;  1HQR D;  2F0J A;  3V2T A;  2N3S A;  3KBG A;  1IZ6 A;  4DA2 A;  1VQK A;  2B2T A;  3MXP A;  3J80 E;  4DF7 A;  5IWA Q;  1K3R A;  2F3I A;  1U5K A;  4DV4 L;  1Q90 A;  3KLW A;  2QEJ C;  4Y7N B;  2VUM H;  4QUC A;  4IN3 A;  2BCO A;  2XWJ B;  2Z6K C;  2CHB D;  3KLS A;  4BA1 I;  2F0G A;  5JOB A;  2L4N A;  3OHX C;  3S2D H;  1W2B A;  1SXT A;  3SE0 A;  3SXH A;  5IOD A;  1HPC A;  4RHR A;  4LUV A;  5E7N A;  2PQE A;  2KA7 A;  3C46 A;  2RDF A;  3JAM L;  1E2W A;  2NZH A;  4R1J A;  1JE5 A;  3GP7 A;  3CAM A;  2MJ8 A;  3AFQ A;  1MGS A;  1R9T B;  1JJ2 A;  4QQB X;  4HSV A;  3GTJ B;  1OO9 B;  4IPC A;  2UUA Q;  1G2S A;  4JI7 L;  2E8G A;  2JA8 G;  3T16 A;  1PYW D;  2WAQ G;  3BZD B;  4C1N I;  4PZ6 A;  2HCC A;  2WIN B;  4A3I H;  1N36 Q;  4U67 3;  1KQS A;  3ITP A;  3HOZ B;  1BQQ T;  3D6W A;  1HNX L;  1NTG A;  2NN6 H;  3KLS X;  3EJI A;  1HFN A;  2BH8 A;  2GVA A;  4R8I A;  1WD1 A;  4KHV A;  3UDG A;  2F4I A;  4DR4 L;  3TP7 A;  3H3V C;  4PZ7 A;  1FNV A;  4C1N K;  3QB3 A;  2HDM A;  1Z47 A;  4HID A;  4JI4 Q;  2K01 A;  1GUT A;  4BBR B;  4UY8 C;  2F0Q A;  5ELB A;  2GVB A;  3K5N A;  1I5F A;  1KAW A;  1PH7 A;  5ELN A; 
#chains in the Genus database with same CATH homology
 4YWK A;  4UP7 A;  5IYB G;  4OWX B;  1Q7Y C;  3E0E A;  2UUB Q;  4X62 L;  4BY7 H;  4IOA A;  3FKI G;  1I94 Q;  4X66 L;  3HOZ H;  3M4Q A;  1PV4 A;  3TQY A;  1T9H A;  4MNO A;  2JE6 I;  1PH8 A;  1EQQ A;  1Y1W H;  4DV2 Q;  5BR8 L;  1XMO Q;  1L1O C;  1IBL Q;  4IJL A;  1FGU A;  2AKW B;  1EYG A;  3EIV A;  4APV A;  1ASY A;  3ULP A;  3F2D A;  1A8V A;  1Q81 C;  5AJ3 L;  1BBW A;  3L0O A;  3CME A;  4LNQ A;  4A3C H;  1QUQ B;  2CWP A;  4LF4 Q;  1UE6 A;  2ZTD A;  4JI2 L;  4OO1 I;  2H5X A;  2DUD A;  3OYY A;  2VQE Q;  4OX9 Q;  3MXN B;  1HJP A;  4BBR H;  4YHH Q;  5M3F H;  2L15 A;  2EQS A;  1MIU A;  3D0F A;  4DAY B;  4DUZ L;  4HJA A;  3T1Y L;  4B3S Q;  3I4M G;  1XMQ L;  3RN2 A;  2K5N A;  4UP9 A;  2K75 A;  2WFW A;  3IRB A;  4DV6 Q;  1J5E L;  3OW2 A;  4JG2 A;  5GAH C;  1X65 A;  3PUY A;  1GD7 A;  4P74 A;  3GTL H;  1XJV A;  4A3I G;  2I5M X;  3HOY G;  3J80 i;  3E9I A;  3ERS X;  2KHI A;  1IBM L;  1L1O A;  2JQO A;  1HZC A;  5M5Y H;  4A3K H;  1K73 C;  2UXB Q;  1VCI A;  3PUV A;  4EQ5 A;  1E22 A;  1VQC A;  4LF7 Q;  4A76 A;  2HQL A;  4JI5 Q;  2NN6 G;  1YBY A;  2AWO A;  4BY1 H;  1N9W A;  4A3D G;  3H0G G;  4WJ4 A;  1X6O A;  4GKJ Q;  3PO2 G;  1XPO A;  2QEX A;  3GTG H;  4HJ9 A;  4XTC S;  5LMU L;  4DR5 L;  4A3B H;  3S1Q H;  1X56 A;  5FLX c;  1H95 A;  1V9P A;  1YHA A;  4DV1 L;  2E2I H;  3AEV A;  4DV5 Q;  3UE0 A;  5HY6 A;  5M3M H;  3ULJ A;  2EIF A;  1I6H H;  4HIK A;  2JJQ A;  1N32 Q;  3TS2 A;  2UU9 L;  3NEN A;  4JV5 L;  1Q8K A;  1N34 Q;  4DR2 Q;  2R93 G;  1G6P A;  2C35 B;  1B7Y B;  4GLA C;  1EQR A;  3PO3 H;  3PIO A;  2ID0 A;  2AMC B;  1KIX A;  1HNW L;  4JBW A;  4GKK L;  1QZH A;  4A93 H;  1YI2 A;  4YCU A;  2MO1 A;  4BY7 G;  1V1Q A;  5M5W H;  5IT9 c;  3H15 A;  2UXC L;  5C4X H;  1D8L A;  2N49 A;  4LF6 L;  3HOZ G;  4HJ7 A;  4JI3 L;  3FHW A;  4UP8 A;  5C3E H;  3U58 A;  1HNZ L;  2OTL A;  4NXM L;  3DLL A;  1RIP A;  4JI1 L;  1E1O A;  1Y1W G;  1PA6 A;  2D62 A;  3RZO H;  3BU2 A;  2LXJ A;  4AYB G;  2VW9 A;  2NN6 I;  4LUZ A;  4A3C G;  4P75 A;  1TXY A;  5IP9 G;  1Z9F A;  2Z0S A;  5FLM H;  1A62 A;  4KHP Q;  4YY3 L;  2JA6 G;  1VQE A;  4LFB Q;  1C9O A;  4KHZ A;  4DV0 Q;  1XNR Q;  2Z6K A;  4X65 Q;  1S40 A;  2Y0S G;  4P71 A;  4BBR G;  5M3F G;  1XPU A;  5IYD G;  1YJN A;  1VQ7 A;  1N33 Q;  1YHQ A;  2MFI A;  3K7U C;  3MEF A;  1M90 C;  4L5S A;  2JA7 H;  1IBK Q;  1CKN B;  2PQA B;  3A0J A;  4JYA Q;  1VQO A;  4DR1 Q;  3FP9 A;  1NBW A;  3WWV A;  3I4N H;  4GNX C;  2ZJP A;  4YWL A;  1YZ6 A;  2K50 A;  4MTN A;  3PUZ A;  1PH5 A;  1PH9 A;  1S3O A;  1OXV A;  4A3K G;  1JB7 A;  1WCM H;  5ELO A;  1A63 A;  1VQM A;  1OXU A;  4POG A;  4BBS H;  1N8R C;  4DV3 Q;  4B3R L;  1B8A A;  5JEA J;  4L5R C;  5C0X J;  2KCT A;  2HHH L;  4BY1 G;  2WB1 E;  3CCU A;  3I56 A;  4DUY Q;  2NVT H;  4GNX B;  1L2F A;  3I2Z A;  3HFZ B;  2BH2 A;  2RHS B;  4AH6 A;  1JJG A;  4L5Q A;  1X54 A;  3PGZ A;  2ASB A;  2Q2H A;  1UWV A;  1NY4 A;  4DR7 Q;  1YNX A;  1W3S A;  1SLJ A;  4A3B G;  3L7Z C;  4DAM A;  4DK3 C;  5JEA G;  2R6G A;  5C0X G;  1TWG H;  3HOX H;  2YTX A;  2XTI A;  2ZM6 Q;  3J7A 5;  3W1B A;  2PNH A;  2AHO B;  5M3M G;  2E2J H;  4LFC L;  1VQF A;  2OWO A;  1WOC A;  5GAG C;  3OTO Q;  4DV4 Q;  2HIV A;  2VUM G;  4IFD J;  4A3L H;  4A3M G;  1Q46 A;  3PSI A;  1O7I A;  3CCQ A;  1EIF A;  3AFP A;  1X3E A;  3RZD H;  3PO3 G;  1B70 B;  2PI2 E;  4MZ9 A;  2E5L L;  3KYH C;  5IWA L;  3PF5 A;  3H3V I;  5LMN Q;  5K36 G;  1KHI A;  1HR0 L;  4IFD G;  4UPA A;  1D7Q A;  4B3T Q;  1Y14 B;  3M4O H;  2RHQ B;  1PH4 A;  3KDF B;  3B6Y A;  2VQF Q;  4GOP B;  4LF8 Q;  2D0P A;  1QZG A;  5C4X G;  1K83 H;  2KCM A;  4R4T A;  1K8G A;  1BKB A;  4QL5 A;  3S16 H;  4R4O A;  4X64 L;  1BBU A;  5C3E G;  2UXD Q;  4HJ8 A;  3J7Z C;  2V1C C;  3F8T A;  2YU9 H;  4AQY L;  2JEA I;  4NXN L;  3DM3 A;  3KJP A;  5IP7 H;  3VDY A;  1IYJ B;  1MKH A;  4YWM A;  1XNQ L;  1PH2 A;  5FLM G;  3G4S A;  3GTK H;  3M3Y H;  2GN5 A;  3CCM A;  3UDX A;  1OTC A;  1EUJ A;  2OQ0 A;  1VQL A;  1VQ8 A;  1LTL A;  4GN3 B;  2VL6 A;  4HIO A;  5J3B A;  2UUC Q;  1VQB A;  2LXK A;  2QGQ A;  1C0A A;  4JI7 Q;  2WAQ E;  1HR0 W;  4JI0 Q;  1DGS A;  1X55 A;  1E1T A;  4O2D A;  2BA1 A;  3PUW A;  1QUQ A;  2JA7 G;  1UEB A;  5FJ8 H;  1FVI A;  1WYD A;  2NVX H;  2ZJR A;  3KF6 B;  1AH9 A;  1Q1B A;  2PMZ E;  4JOI C;  2UUA L;  4IPD A;  4JI8 L;  4DR3 Q;  1M1K C;  2N8N A;  5IYC H;  1P16 A;  2I5L X;  4A3J H;  2ZTE A;  3NBH B;  4POF A;  1PYB A;  4GN5 A;  1HNX Q;  1V43 A;  1VQ5 A;  3M85 A;  1VQ6 A;  3GTQ H;  3GTP H;  1SMX A;  2JEB I;  4IFD I;  1Y1V H;  4LF5 L;  3S1N H;  1WCM G;  1N36 L;  1KL9 A;  2YTY A;  1Q12 A;  4B3M L;  1VQI A;  1Q86 C;  4TQU S;  1I3Q H;  2RF4 A;  1KRT A;  2MO0 A;  4P73 A;  2A19 A;  3TS0 A;  3CCV A;  3M7N A;  4GN4 B;  4A4I A;  3A74 A;  3J81 j;  1YHB A;  3PIP A;  1YJW A;  2R92 H;  3GTM H;  4KI0 A;  2Q2T A;  4DR4 Q;  1UE7 A;  3K0X A;  1YIT A;  5JJL A;  1TWA H;  2IX1 A;  1CKM A;  4DV7 L;  2OQK A;  4C2M H;  3S15 H;  3CCR A;  1OXS C;  4DR6 L;  3HOX G;  4C3I H;  4IJH A;  1FL0 A;  3K7A H;  4LFA L;  2ATW A;  2F4V L;  1Q1E A;  2NVY H;  1E24 A;  3NEL A;  4IO9 A;  3T1H Q;  1A0I A;  4JOI A;  1OXT A;  1X3G A;  2KEN A;  4A3L G;  1KXL A;  4JI4 L;  4JI6 L;  1FJG L;  1VQP A;  2IX0 A;  2NZO A;  4LW1 A;  4LF9 L;  5HGQ A;  4BXX H;  1KD1 C;  1K9M C;  2YTV A;  3CCS A;  4A3E H;  4X62 Q;  1PHJ A;  1K0R A;  5GQO A;  3RN5 A;  4Y52 H;  4X66 Q;  3W5O A;  1GM5 A;  3KOJ A;  4QGU A;  1XPR A;  5C44 H;  1PH6 A;  1NE3 A;  4K0K L;  4H02 A;  1X3F A;  2UUB L;  1IXR A;  2OTJ A;  2IHF A;  5BR8 Q;  4NB3 A;  2HIX A;  3G71 A;  5IYB H;  1I94 L;  2E2H H;  1EFW A;  1YJ9 A;  1SE8 A;  2B63 H;  1HZ9 A;  1E3P A;  1SRO A;  1TWF H;  4DKA C;  4FDB A;  4DK6 C;  5H1S E;  5IP7 G;  2R7Z H;  5AJ3 Q;  4DV2 L;  1XMO L;  1IBL L;  3TRZ A;  4NPS A;  3CC2 A;  3JAM c;  1TWC H;  4JI2 Q;  3U4Z A;  3E9H A;  2CCZ A;  1GO3 E;  3A5U A;  2YYZ A;  4DUZ Q;  3T1Y Q;  4LF4 L;  2CQO A;  4PZ8 A;  2IT1 A;  1XMQ Q;  2VQE L;  5FJ8 G;  1BVS A;  4IPG A;  1PH1 A;  1J5E Q;  4OX9 L;  3CPF A;  4YHH L;  3S17 H;  2MQH A;  4B3S L;  3CQZ H;  2LSS A;  4A3J G;  5IYC G;  1QVG A;  4AIM A;  1P8L A;  3S2H H;  1IBM Q;  5C4J H;  2VY3 A;  4DV6 L;  3A5Z B;  4WJ3 M;  1TWH H;  2D0O A;  4RMF A;  4ALP A;  1CKN A;  2PQA A;  4L5T A;  4JBK A;  5JJI A;  2IHE A;  4J15 A;  4PG3 A;  4Y7N H;  3CD6 A;  1S72 A;  4R4Q A;  2JA5 H;  3HOY H;  2UXB L;  2CWA A;  4X6A H;  2I5H A;  3RLF A;  4LF7 L;  3M9B A;  4JI5 L;  4A3F H;  1YIJ A;  2R92 G;  1LM0 A;  5LMU Q;  4DR5 Q;  3BJU A;  3PV0 A;  4R4I A;  1NJI C;  4DV1 Q;  2A1A A;  3JC6 6;  3U4V A;  4GKJ L;  4GOP C;  2JK8 A;  2WP8 J;  5IY0 A;  4DNI A;  3H0G H;  1MJE A;  2CKZ B;  4GNX A;  1CSQ A;  1XTD A;  1QVC A;  2UU9 Q;  3HOV H;  2KBN A;  4JV5 Q;  5EAY A;  3UE1 A;  1WJJ A;  4DV5 L;  3SGI A;  4A75 A;  1UE5 A;  2K52 A;  3U50 C;  2A8V A;  3D31 A;  4A93 G;  3HOU H;  4OON A;  1N32 L;  2MNA A;  4BXX G;  3TRE A;  1Q82 C;  2RCN A;  1HNW Q;  4GKK Q;  5GRO A;  2Q2I A;  1N34 L;  4DR2 L;  3TEH B;  4BA2 I;  4A3E G;  1HZB A;  3S14 H;  3BZK A;  4RG1 A;  3J81 c;  1HZA A;  2UXC Q;  4LF6 Q;  2R93 H;  1I50 H;  5C44 G;  4JI3 Q;  1VQ4 A;  4AYB E;  3GTO H;  1HNZ Q;  4NXM Q;  3Q8D A;  3LGJ A;  4JI1 Q;  3M4P A;  3STB D;  4QJF A;  2B63 G;  3K8A A;  3KDF A;  3I4O A;  1L0W A;  1GKH A;  1WFQ A;  4GOP A;  2R7Z G;  1AE3 A;  2R7D A;  4HJ5 A;  1JMC A;  1QVF A;  4O0A A;  5C0X I;  4GLX A;  4YY3 Q;  2Y0S E;  1SR3 A;  2HT1 A;  2ZJQ A;  2B3G A;  1KC8 C;  2NVQ H;  1ASZ A;  2Q2U A;  3S1M H;  4TVA B;  3CW2 C;  1CKO A;  2AWN A;  1VS0 A;  1K8A C;  4KHP L;  3NEM A;  4LFB L;  3CP0 A;  3CF5 A;  4EX5 A;  3UDF A;  5IP9 H;  3KJO A;  4DV0 L;  2N78 A;  4OWW B;  1XNR L;  4X65 L;  4A3G H;  4OXP A;  3CCL A;  4PMW A;  2JA6 H;  3I4N G;  5DLQ E;  3KF8 B;  1L1O B;  1WI5 A;  3K81 C;  1N33 L;  2JA8 H;  1EWI A;  1NMF A;  3CC4 A;  1IBK L;  5IYD H;  4BBS G;  4JYA L;  3ULL A;  3GDE A;  4DR1 L;  3H3V H;  3CPW A;  2R7F A;  3F2B A;  2YV5 A;  3EBE A;  3HKZ E;  1YVC A;  3KF6 A;  4B3R Q;  1AE2 A;  1UE1 A;  1SN8 A;  2HHH Q;  2OCE A;  1VQA A;  2JA5 G;  4R4C A;  2K14 A;  2VNU D;  1G29 1;  1SFO H;  4JCV E;  1U0L A;  1PVO A;  4A3F G;  4DV3 L;  2CFM A;  3KFU A;  3STB C;  3RLO A;  1RL2 A;  4GS3 A;  4HIM A;  1VQG A;  1J6Q A;  5IE8 A;  4DUY L;  3J80 c;  2K5H A;  1X9N A;  1GVP A;  2WB1 G;  4LFC Q;  4DR7 L;  3HOW H;  2N3S A;  3HOV G;  1IZ6 A;  1VQK A;  2K5V A;  2ZM6 L;  3AYH B;  1E7Z A;  1VQD A;  3UDI A;  2E5L Q;  1EIY B;  5IWA Q;  1K3R A;  2F3I A;  1U5K A;  3OTO L;  4DV4 L;  3HOU G;  1HR0 Q;  2IY5 B;  3KLW A;  3CC7 A;  1C7Y A;  4OWT B;  2VUM H;  4A3M H;  4QIW E;  1PYS B;  3PUX A;  5LMN L;  2Z6K C;  3JAM i;  3S24 A;  4BA1 I;  3GO5 A;  4X64 Q;  4C3H H;  3CMA A;  4B3T L;  3FKI H;  3S2D H;  4JBM A;  1W2B A;  2ZTC A;  2VQF L;  4LF8 L;  2DGY A;  1PFS A;  3EN2 A;  1EOV A;  4AQY Q;  4NXN Q;  4LUO A;  4LUV A;  5E7N A;  3L2P A;  2ES2 A;  2UXD L;  3ICE A;  3RR5 A;  1XNQ Q;  2VS1 A;  1G51 A;  2BA0 A;  2FXQ A;  3ER0 A;  4YCV A;  3K80 C;  2EXD A;  4DPG A;  2NZH A;  1VQN A;  3BZC A;  4R1J A;  1JE5 A;  3AQQ A;  3CAM A;  3AFQ A;  1YEZ A;  4IPH A;  4GLV B;  3RNU A;  4JC0 A;  3W1G A;  1JJ2 A;  4QQB X;  2UUC L;  4A3G G;  4IPC A;  2I0Q A;  1OXX K;  2UUA Q;  4JI8 Q;  5LMN W;  3GD7 A;  4JI7 L;  4JI0 L;  3I4M H;  4IOC A;  1Y1V G;  2E8G A;  2JA9 A;  2KHJ A;  2JA8 G;  2B29 A;  2WAQ G;  4XIG S;  4C3J H;  5GAD C;  1LYL A;  3CCE A;  1JT8 A;  4LF5 Q;  4PZ6 A;  3ZJY C;  4DR3 L;  1N36 Q;  4A3I H;  4B3M Q;  1KQS A;  3G6E A;  1VQ9 A;  3HKS A;  1LUZ A;  4KLK A;  4QY7 A;  1HNX L;  1CUK A;  1NTG A;  1CSP A;  2BH8 A;  4LWC A;  1NMG A;  2GVA A;  1SRU A;  3F2C A;  2PI2 A;  3UDG A;  3CXC A;  4A3D H;  3CCJ A;  4DV7 Q;  3PO2 H;  2ALY B;  4DR6 Q;  1JJC B;  1IL2 A;  4DR4 L;  1VQH A;  1VQJ A;  4PZ7 A;  4LFA Q;  2F4V Q;  4OO1 G;  3F1Z A;  3HKZ G;  2F52 A;  1KRS A;  3HOW G;  4YCW A;  3J81 i;  3PF4 A;  1Z47 A;  2VZA A;  4P72 A;  4HID A;  4ME3 A;  3I7F A;  3G48 A;  4JI4 Q;  4JI6 Q;  1FJG Q;  3S1R H;  2K4K A;  1R9T H;  2QA4 A;  4LF9 Q;  4UY8 C;  3GTJ H;  3T1H L;  3I55 A;  2GVB A;  1HH2 P;  5JJK A;  1PH7 A;  1I5F A;  1KAW A;  4JBJ A;  1PH3 A;  1MJC A;  2XGT A;  3PCO B;  5M5X H;  5ELN A;  3RLN A;  5GAE C;  4K0K Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...