5IWAL

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
124
structure length
124
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule keywords 30S ribosomal protein S2
molecule tags Translation
total genus 20
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5iwaL00
3K0XA 4GLVB 1I5FA 5C4JH 1XNRQ 4GN4B 4JC0A 1IBLL 1BBUA 4DV4Q 3H15A 2V1CC 3Q8DA 4DR7Q 1JJGA 1L1OA 2BA1A 4R4QA 5JJLA 2HT1A 3CAMA 1SE8A 2UUAQ 4ALPA 1HNXQ 1PYSB 4A3BH 3JAMc 1JB7A 1JJ2A 1XMQL 5K36G 1PH9A 3K80C 5HY6A 4A3JG 1FJGQ 2HIXA 3TS2A 4NXNQ 1A0IA 2ZJPA 3G48A 4LNQA 1NE3A 2I5LX 2EXDA 1EYGA 1SR3A 4JBWA 1XNRL 5C4XH 1EQRA 1LM0A 4BY7G 4QIWE 4DR7L 1KHIA 3KF8B 3FKIG 2VUMG 4DV2Q 3S2DH 1QVCA 5IYCG 5IYBG 2HHHQ 3S14H 2UUAL 1I94Q 2OCEA 1HNXL 3I4MG 1GM5A 5IT9c 2JA5G 2PI2E 4IPDA 3HOZH 1FGUA 1K8AC 5FLMG 5GAHC 1U5KA 3H0GG 2Z6KC 3KYHC 4IJLA 1VQ7A 3STBC 1FJGL 4A3GG 1J6QA 3HKSA 4NXNL 2QA4A 4GOPB 5M5XH 4AH6A 3CPFA 3J80i 1RIPA 1FVIA 2Y0SG 3EN2A 4P75A 1KRSA 5IYDH 1EIYB 4LF9Q 3M4PA 4YHHQ 1BKBA 3JC66 4L5TA 2LXJA 4GOPC 3RNUA 2OTLA 3HOUG 1A62A 2HHHL 1N9WA 4IPHA 1Q46A 1BVSA 2AWOA 1VQ6A 2RHQB 1Q86C 1HR0Q 1I94L 4JI7L 1SMXA 4DNIA 4UPAA 5M3MH 2R92H 2KHJA 1A63A 3NEMA 2D62A 2FXQA 3F8TA 4DR2L 4J15A 4HJ8A 4POFA 1M90C 1GO3E 3U4ZA 1D7QA 1CKNB 3U50C 3CXCA 1X3GA 1QUQB 4TVAB 4WJ3M 4HIDA 1X65A 2AHOB 4PZ6A 4YHHL 3CCSA 4JI5Q 1SRUA 2ALYB 4LUOA 1KRTA 1EQQA 3G4SA 3AEVA 2E2JH 3M4OH 2UXDL 3NBHB 4PG3A 4OWXB 1HR0L 1Q8KA 1K0RA 1C9OA 3S15H 2K5NA 5AJ3Q 2R6GA 2I5MX 5GADC 3HOVH 3HOWG 3A0JA 1BBWA 2Q2UA 4DKAC 1NJIC 4WJ4A 4QL5A 2N8NA 3W5OA 1SFOH 2GN5A 3K7UC 2MQHA 3I7FA 1N34Q 3CCLA 3G71A 4JI5L 4OWWB 1DGSA 1PH6A 3D0FA 1E22A 1YZ6A 2UUCL 4FDBA 3PF5A 3HOYG 1TWFH 2L15A 3MXNB 3F2DA 1ASYA 1X3EA 4IPCA 5BR8Q 5AJ3L 3OW2A 2RCNA 1YITA 2NVQH 3MEFA 5FJ8H 1HZCA 4B3SQ 4DPGA 4YWKA 4GNXB 1PYBA 1WYDA 3AQQA 3PUYA 2N49A 1VQ4A 1OTCA 1V43A 3A5UA 2VS1A 1N33Q 1N34L 1E7ZA 4GNXC 3K81C 2R93G 2NN6I 4B3RQ 2JE6I 5ELNA 3CCUA 1X56A 2H5XA 1VQAA 2OQ0A 4P73A 1L0WA 1AE2A 3S1QH 1Y1VH 4DUYQ 4B3MQ 2JA7H 5BR8L 3KJOA 1K9MC 1IBKQ 1MJCA 1TWHH 3S1NH 4DV1L 4B3SL 2I0QA 1YNXA 2OQKA 1YHAA 2VW9A 1HZ9A 1VQ9A 4R4OA 2LSSA 1KC8C 1HZBA 2Q2TA 4LF6Q 4A3LG 4IFDJ 1AH9A 2N3SA 2JA6G 4OO1G 2KENA 4P72A 2ES2A 3CC4A 4OWTB 4B3RL 3KFUA 1G51A 4BA2I 4APVA 2VQEQ 2F52A 1Q82C 3HFZB 1HJPA 1N8RC 3OTOQ 1WCMG 4DUYL 4HJAA 4B3ML 1B8AA 1GD7A 3NENA 5IP7G 3CPWA 4L5RC 2K5VA 4NXMQ 2NZOA 3TS0A 1UWVA 1UE6A 1CKNA 1OXTA 2AKWB 2AMCB 2PQAB 4BXXG 4A3MG 2WB1G 3J81j 4A3EH 1PH4A 1NBWA 3DLLA 4LF6L 5M3FG 4JBJA 4H02A 5GAGC 3EIVA 4UP7A 1Y1WG 1E1OA 4O0AA 4AYBE 3S1MH 2RF4A 1X3FA 4DV3Q 4A3IG 4A3FG 5C0XI 3L2PA 1HNWL 2NVTH 2ASBA 2VQEL 1XPRA 1XMOL 2K4KA 3S1RH 3OTOL 3RLFA 2JA7G 1T9HA 4DV7Q 1PH5A 3PGZA 3GTMH 4A75A 3CMAA 2IT1A 4JYAQ 3FHWA 4Y52H 2PMZE 4DV4L 1S40A 3AFQA 5FLXc 4A93H 2K75A 4IO9A 3KDFA 2OWOA 4DV3L 3ICEA 3CC7A 1XNQQ 5C3EG 5GQOA 1VQBA 2DUDA 4A4IA 3BU2A 3J81i 1VQHA 2DGYA 2WAQG 2ZJRA 1AE3A 3GTQH 1HZAA 2JEBI 5IP9H 4DV7L 4DK6C 4DV6Q 2UXCQ 4JYAL 1U0LA 5M5YH 4BY1H 3RLOA 2MFIA 1B7YB 2HQLA 2YTVA 3EBEA 2R7ZH 3I55A 4A3DH 1VQJA 4EQ5A 3KJPA 1K3RA 1KAWA 4GN3B 4X65Q 4DV2L 3T1HQ 3KF6B 4HIOA 1E1TA 3GTPH 4A3CH 4X64Q 3HOXH 1CSQA 2EQSA 3GDEA 3GO5A 1VS0A 4LFBQ 4A3BG 4Y7NH 2NN6G 4IFDI 5C44H 2F3IA 1TWCH 2R7DA 3E9IA 4HJ9A 3I4NH 5GAEC 2KBNA 3G6EA 4DV6L 1EFWA 4BBSH 4K0KQ 2UXCL 2Z0SA 1PA6A 5C4XG 1UE5A 2CKZB 2QEXA 3CF5A 3PO2H 2A1AA 4LF9L 4POGA 4X65L 1YHBA 5H1SE 5GROA 2F4VQ 3RZOH 1OXXK 4X64L 1G6PA 1IYJB 4LFBL 3GTGH 3CP0A 4R1JA 4KI0A 4A3KH 3D31A 1VQIA 2PQAA 1UEBA 1PV4A 2E8GA 3GTKH 3HOZG 1K73C 2Y0SE 4K0KL 4BY1G 2IX1A 1HR0W 4UY8C 1XJVA 4QGUA 4JOIC 3TEHB 4DAMA 3UDGA 1XPUA 2R92G 2R7ZG 1I6HH 1C0AA 1KQSA 5IYDG 1PHJA 1WI5A 1I50H 1IBMQ 3PO3H 2YYZA 2UXBQ 1P16A 3M4QA 3S24A 1VQFA 3TQYA 2F4VL 4ME3A 2CFMA 1LTLA 2ATWA 1TWAH 2ZTCA 3J81c 3E9HA 4RMFA 5M3MG 4PZ7A 1L1OB 1SROA 2C35B 3IRBA 5JEAG 5C0XG 1R9TH 1KIXA 2UU9Q 1EUJA 4BBSG 4JI0Q 4LF4Q 5JEAJ 3H3VI 3HKZG 1Q1EA 1YBYA 1L1OC 2WP8J 1MJEA 3PO2G 3ZJYC 3ERSX 4DAYB 4TQUS 1UE7A 1J5EQ 1O7IA 3CCMA 1EOVA 2Z6KA 2XTIA 2EIFA 1IBML 2A8VA 2QGQA 2UXBL 4DUZQ 4NPSA 5IY0A 3S17H 2VZAA 4DR4Q 3M85A 1Q12A 2GVAA 2VL6A 4LW1A 3RR5A 1VQMA 1PH7A 4GS3A 5IWAQ 4GOPA 3HOVG 1IXRA 4BBRH 2KHIA 3F2CA 2JA8H 3K8AA 4JI0L 4LF4L 1WOCA 4IPGA 4YWMA 1A8VA 4AIMA 1TXYA 4R4CA 4JI8Q 4X62Q 4QJFA 3UDXA 4C2MH 1VQLA 1MKHA 1J5EL 1N33L 2ZM6Q 3PUXA 4IJHA 3UDFA 4IOCA 3CCJA 4X66Q 3CCRA 4DUZL 1EWIA 4GKJQ 1N32Q 4DR5Q 2UUBQ 5LMNW 4JI4Q 1G291 1X54A 4B3TQ 3UE0A 5EAYA 3B6YA 4GLAC 1TWGH 4QY7A 3I56A 1RL2A 2JA9A 2HIVA 2PNHA 4P71A 5FJ8G 3CW2C 1IBKL 1PH1A 1QUQA 1Y14B 3T1YQ 3NELA 4R4TA 1W2BA 2Q2IA 2YU9H 3RLNA 4A3JH 1VQEA 4JI8L 4X62L 4IOAA 1KXLA 2BH8A 3BZCA 2ZM6L 3AFPA 1B70B 3LGJA 2JJQA 3PUZA 2MO0A 4OONA 3PV0A 4X66L 3CCQA 3H3VH 4JOIA 4JBMA 4BY7H 2CWAA 3FKIH 2UUBL 4JI4L 3CD6A 1N32L 2B63H 2KCMA 4LWCA 5IYCH 5IYBH 4B3TL 1Y1VG 2K5HA 3S16H 2CCZA 5IE8A 4NXML 1YIJA 1VQOA 4YY3Q 3I4MH 3GD7A 1M1KC 1IZ6A 4XIGS 2YV5A 2ZTEA 2PI2A 1LUZA 3F2BA 1Z9FA 1NTGA 5FLMH 3H0GH 4PMWA 4A76A 4A3GH 1VQ8A 1HH2P 3KOJA 2IY5B 4KHZA 1ASZA 3PCOB 4YWLA 3RN2A 1XTDA 4P74A 2IX0A 3HOUH 4YCWA 2E5LQ 2Q2HA 5LMUQ 4GNXA 1XPOA 2WB1E 2E2HH 4HIKA 1E24A 4YY3L 4O2DA 4HIMA 5M5WH 1X6OA 3PSIA 1PFSA 4AQYQ 1IL2A 1P8LA 1NMFA 4A3EG 3FP9A 1Q81C 2CQOA 4LF7Q 3I4OA 1I3QH 1EIFA 1HNZQ 4C3IH 4X6AH 1XNQL 1VQ5A 2YTXA 1Q7YC 2B63G 4QQBX 4LUZA 2ZJQA 4DR1Q 2E5LL 4UP9A 2JK8A 1GKHA 5LMUL 3OYYA 4XTCS 3CCVA 4NB3A 4JI7Q 3ULLA 4L5SA 5JJIA 1CKMA 4DR3Q 4AQYL 3HOWH 3K7AH 3TREA 3M7NA 4LF7L 4DR2Q 4MZ9A 4OO1I 2VY3A 4JI1Q 2XGTA 2NVXH 1HNZL 1SN8A 4A93G 3AYHB 3KLWA 4GN5A 4MNOA 3J7ZC 3T1HL 2WAQE 4PZ8A 2AWNA 2N78A 4R4IA 2IHFA 3E0EA 2E2IH 2RHSB 1NY4A 3CCEA 4BA1I 1X9NA 2JEAI 4DR1L 1S3OA 1VQDA 1WJJA 2D0OA 4JCVE 5IP9G 2IHEA 1QZHA 3UDIA 4JI2Q 3CMEA 4LFAQ 1VQKA 1LYLA 1YHQA 4LF5Q 3HOYH 3TRZA 4YCUA 5JJKA 4DR3L 2VQFQ 1OXSC 1W3SA 2MO1A 3ULJA 4JG2A 4JI1L 4A3DG 1V1QA 1PVOA 4KLKA 4JBKA 1PH8A 3GTOH 1JE5A 3UE1A 3W1GA 4A3CG 3HOXG 4DR6Q 2R93H 4RG1A 4GLXA 4LFCQ 1MIUA 2A19A 2UUCQ 4OX9Q 3BJUA 2K50A 5DLQE 5C44G 4JI2L 1JJCB 1CSPA 4LF5L 4LFAL 3I4NG 1FL0A 2VNUD 2ID0A 3F1ZA 1WFQA 1CUKA 2VQFL 4DV0Q 5C0XJ 1UE1A 2CWPA 1N36Q 4LUVA 2LXKA 1VQGA 3A5ZB 3L7ZC 1NMGA 3U58A 3M9BA 2NVYH 4A3LH 4HJ7A 4YCVA 3S2HH 2KCTA 2YTYA 2JA6H 2R7FA 4DR6L 1Z47A 2BH2A 4LFCL 1L2FA 5E7NA 4A3KG 4GKJL 1YEZA 1YVCA 1JMCA 4OXPA 4OX9L 2GVBA 1OXUA 3KDFB 3JAMi 2UU9L 3RZDH 2ZTDA 1KD1C 1WCMH 5IP7H 4DV0L 1YJNA 1YJWA 4EX5A 4LF8Q 4MTNA 4DV1Q 1K8GA 3KF6A 3PIPA 3L0OA 4A3MH 1N36L 4BXXH 3ULPA 4L5QA 3U4VA 3J80c 1VQNA 5LMNQ 3PO3G 1JT8A 1E3PA 5M3FH 2B3GA 1KL9A 1V9PA 3ER0A 1QZGA 1Y1WH 4JV5Q 2UXDQ 4HJ5A 4A3IH 2BA0A 3W1BA 4DR4L 4A3FH 4GKKQ 1Q1BA 4JI3Q 3WWVA 1QVFA 4KHPQ 2D0PA 3CQZH 5ELOA 3J7A5 5IWAL 3M3YH 4AYBG 3HKZE 4DV5Q 5HGQA 2MNAA 3PF4A 4JI6Q 3SGIA 4IFDG 4LF8L 4UP8A 3GTJH 3BZKA 3RN5A 1YJ9A 3STBD 3I2ZA 3CC2A 5LMNL 2WFWA 1IBLQ 1H95A 1VCIA 5J3BA 1YI2A 1CKOA 3VDYA 1X55A 3GTLH 4DR5L 2VUMH 2K14A 1SLJA 3A74A 3PIOA 4JV5L 4DK3C 4KHPL 4C3JH 1HNWQ 3PUVA 4JI3L 4GKKL 5C3EH 1GVPA 1PH2A 1OXVA 4BBRG 1XMOQ 1D8LA 4DV5L 1PH3A 2JA8G 2JA5H 2K52A 4C3HH 1C7YA 1XMQQ 4JI6L 1K83H 3T1YL 1S72A 1VQCA 3PUWA 2I5HA 2OTJA 2NZHA 3DM3A 2B29A 1QVGA 2JQOA 1VQPA
chains in the Genus database with same CATH superfamily
4DV4Q 3H15A 1TQOA 3Q8DA 1IYUA 1L1OA 1KNAA 4G7ZC 1HNXQ 1PYSB 4A3BH 2NN6H 1JJ2A 1XMQL 5HY6A 4HSVA 4A3JG 4KJOA 3TS2A 2ZJPA 4LNQA 1WTPA 1NE3A 1PRTF 4U68A 1SR3A 3EFXD 4BY7G 4QIWE 2B2WC 2DY7A 3NSWA 3S2DH 3FKIG 4DV2Q 2E2DC 1SMYD 1LT5D 2HHHQ 2EYJA 3VR2A 1HNXL 1LLRD 3I4MG 1GM5A 3S15B 3K5MA 4I7ZC 2L1BA 4IURA 3KYHC 3H0GG 2Z6KC 2LKVA 5IODA 1J6QA 3HKSA 4GOPB 1SFOB 4AH6A 3CPFA 3I91A 1T5XD 5CV8A 3LWUA 2V4DA 5IYDH 1EIYB 1DJRD 1LV9A 1BKBA 1ENAA 3JC66 3OMGA 4L5TA 3HOUG 2HHHL 1Q46A 1BVSA 1I4RA 1QNKA 1Q86C 4JI7L 3H94A 1SMXA 4DNIA 1TS3A 2NVQB 1A63A 2KHJA 2CW0C 1S5FD 1F9RA 3DWPA 5E4XA 1HRJA 1M90C 2F0PA 1EEID 4C3IG 4FF2A 4ZKCB 1CKNB 4TVAB 2HDLA 4WJ3M 2AHOB 4PZ6A 1KRTA 2ALYB 1H9KA 2E2JH 1DOKA 4EGVA 1SE3A 1ZYRD 3M3YB 1C9OA 2K5NA 1WVLA 2OT2A 2JA7B 2ZT9C 3IAYA 2Q2UA 2JXMB 4DKAC 1UNSA 4QL5A 2N8NA 3W5OA 1LTSD 2GN5A 2QF7A 4L8JA 3I7FA 3NQIA 1SMYC 1RJTA 4OWWB 4FYDA 4NW2A 3DEOA 5E1FA 3PF5A 2SEBD 3A55A 4KN4C 1TWFH 2F0GA 3MXNB 3F2DA 2HQEA 2CH4A 1WTOA 3A8JE 4DPGA 4CJ1B 3PUYA 1VQ4A 2DY8A 3E6ZX 1DZ1A 1VF5C 1N33Q 1KDAA 1D1IA 2NN6I 2NVTB 1MHWC 1KDCA 1F9PA 3E5SA 1Y1VH 4B3MQ 3UI2A 2B8FA 1MJCA 2I0QA 1YNXA 3A8KE 2RBMA 1GUSA 4RGTA 3J80E 4R4OA 4V190 2Q2TA 4IFDJ 1O78A 3VYSA 2N3SA 1J9OA 2ES2A 4OWTB 1ZYRC 4WJWA 3NPPA 3M4YA 1CK1A 1U4PA 4B3ML 4N9PA 4IUVA 3TS0A 1UWVA 1OXTA 1FNVA 2WB1G 4A3EH 5C5LA 4JBJA 3Q24A 4A3DB 4UP7A 1Y1WG 1E1OA 1PZID 4A3FG 3L2PA 5ELBA 5IGFA 4CJ2C 2F0LA 1XPRA 3D3RA 4PMCA 3NQTA 3RLFA 1T9HA 5DNFA 1PH5A 4A75A 1NAPA 5IGEA 3CMAA 3I4NB 1XXGA 3IL8A 2WKCA 3FHWA 2A69D 1HFGA 4Y52H 3NTHA 3AFQA 2F1MA 4A93H 1HQRD 1IYVA 4C3JG 3CC7A 4ILWA 2FMCA 5GQOA 2QDBA 4A4IA 5A2QE 2DGYA 4H13C 2ZJRA 5KGUA 3GTQH 1XWEA 2JEBI 2F3VA 2FINB 4DK6C 1EYDA 1B7YB 2IPKD 3HP3A 4F7XA 3KJPA 1D1KA 2XRQD 1ZEQX 1KAWA 5DM63 1E1TA 1A3VA 3GTPH 4X64Q 1VS0A 1EY8A 2K28A 4Y7NH 1H9SA 4IFDI 2R7DA 4XQQA 4AYBB 4BBSH 4K0KQ 1ESRA 1PA6A 5C4XG 1X3PA 2Z9HA 3PO2H 2NTSA 1GHKA 3RZOH 4X64L 3I73A 4KI0A 3E0JA 3HOZG 1UEBA 1ET6A 1MGSA 2A68D 4K0KL 2A69C 1SE2A 2XIWA 1XPUA 4IUTA 1I50H 3H91A 1IBMQ 2YYZA 1P16A 3M4QA 3TQYA 3D8GA 2JN4A 3E9HA 1STEA 4RMFA 3DXJC 1L1OB 2C35B 1SYEA 3HG9A 4BBSG 2Z8LA 3C3LA 4JI0Q 3H3VI 3HKZG 3MXGA 1Q1EA 1YBYA 2K5QA 2WP8J 4EVOA 1PZKD 3PO2G 4RH6A 1UE7A 1LTAD 2Z6KA 1IBML 1RTOA 1QWYA 2QGQA 4DUZQ 2FMMA 1Q8IA 4DR4Q 2DN8A 1Q12A 1VQMA 5JJZA 4HMJA 3BDLA 1WD0A 3K8AA 4CBVA 1ET9A 1WTVA 4JI0L 4O1NA 1WOCA 3I72A 4YWMA 4AIMA 4X62Q 1S5CD 4A93B 1JICA 1R4QB 1ESFA 4IJHA 4MHEA 4IOCA 4DUZL 4GKJQ 1NR4A 4DR5Q 1HA5A 5FK9C 2F0UA 2KVMA 3GTQB 4X3UA 3I56A 2A68C 1EIGA 4KKSA 3NELA 3OHXC 4OEMB 2YU9H 4X62L 4IOAA 4ZUIA 1KXLA 3BZCA 1B70B 3CCQA 4GKJL 1V1PB 3GTPB 2O5IC 3CD6A 5IYCH 5IYBH 4KKUA 1CZGA 2Q8RE 1M1KC 1IZ6A 2PI2A 2F0VA 1NTGA 2QEJC 1VQ8A 1Z7TA 4XYOA 3KOJA 1Y8OB 2IY5B 1E0BA 4F8MA 1ASZA 1XTDA 2E5LQ 4QF4A 4O2DA 1WTHA 1HPCA 1A15A 3NTIA 4AQYQ 5J22A 4IUPA 2CQOA 1I3QH 4EQNA 1HNZQ 5CV6A 3DEPA 1XNQL 2Z1CA 1VQ5A 4XQJA 4QQBX 2K01A 2R93B 2ZJQA 2E5LL 4L5SA 4R8IA 1PRTD 3J7AF 3HOWH 4AQYL 5BN5A 3K7AH 3TREA 1LT3D 4LMQD 1QILA 1JCKB 1FGBD 2NVXH 1HNZL 1SN8A 3H6MA 3J7ZC 4H44C 4WRDA 4R4IA 2E2IH 2JA6B 1DOLA 1NY4A 1STBA 1X9NA 2JEAI 4RFBA 1S3OA 2FJ2A 4JCVE 5IP9G 2F3WA 2IHEA 3UDIA 3CMEA 1QZHA 4LFAQ 1VQKA 1YHQA 3HOYH 3D6CA 5JJKA 2VQFQ 5C4HA 4JG2A 4A3MB 3MFGA 2KEDA 1PVOA 1PH8A 3VYUA 3QWNA 3GTOH 3SEBA 1JE5A 3UE1A 3W1GA 3PIP3 4RG1A 4LFCQ 4JVZA 5COYA 1RDPD 3FMCA 1EQVA 2K50A 4QB4A 1EY9A 1CSPA 2CQAA 4LFAL 1XX8A 4I65A 2ID0A 2VNUD 1CZWA 3I70A 1CUKA 2VQFL 3T53B 2N55A 1UE1A 5I2YA 2YU9B 2CWPA 2EXZA 4LUVA 1SYDA 4R8NA 4DGZA 1NMGA 2NVYH 1JE4A 4A3LH 3GTLB 4ZK9B 2BH2A 4LFCL 1L2FA 1TY2A 4A3KG 4J1MA 1YEZA 4OXPA 2O2LD 2GVBA 1PRTC 2UU9L 5CV5A 2WAQB 2JA5B 4C3HB 3A56A 1WCMH 1KD1C 1YJNA 1YJWA 4DV1Q 3PIPA 4BXXH 3L0OA 1EZ6A 1VQNA 3PO3G 5M3FH 3ER0A 1HHVA 4HJ5A 4A3IH 2BA0A 3W1BA 1GJXA 3CQZH 3DMUA 1FD7D 4OIKA 3P7JA 1MI2A 3G6JB 4ULLA 1I3QB 1YJ9A 2K7VA 3I2ZA 5G3LF 1RTNA 4O42A 4XQNA 1YI2A 2VUMH 1FNWA 4K5VA 1SSOA 2HD3A 1HNWQ 1F9QA 5C3EH 4G57A 1GUOA 1F2LA 1GVPA 3BVMA 3NUCA 3A7LA 1PH3A 1B53A 3HOWB 1K83H 3K7AB 1VQCA 2I5HA 1LTTD 3R2TA 2NVXB 3SVMA 4GN4B 2EVBA 3HEJA 5KNDA 1JJGA 3CAMA 2UUAQ 3SR1A 3JAMc 2A74C 3ERQA 5M3MB 2R92B 2K5DA 5K36G 1PH9A 4DAVA 1JQYD 2HIXA 1PFBA 4NXNQ 1A0IA 2ICIA 2EXDA 1EYGA 4FNFA 4Q5VA 4NP5A 1EQRA 2QKIC 3DHQA 1KHIA 2VUMG 1F9SA 4DA2A 4K6DA 1QVCA 4G4KA 3I3CA 3M4OB 2UUAL 1I94Q 1L0YB 1GXDC 2F0HA 5IT9c 2DJGC 4C1NK 1NSNS 1FGUA 5FLMG 2M9VA 4A3GG 4NXNL 2QA4A 4IUNA 1FVIA 1V8QA 1KRSA 4LF9Q 4YHHQ 1TIID 2X69A 1DONA 2OTLA 4IPHA 2AWOA 1VQ6A 1NCVA 3R3OA 1HR0Q 1I94L 1EZ8A 5C0XH 2D62A 5AFWA 3N52A 3VR3A 1IHZA 1SNDA 3U4ZA 3X3MA 1D7QA 5M3FB 2BDOA 4HIDA 3CCSA 4YHHL 1G6ZA 1SJHD 3G4SA 3TN2A 3S1QB 1HR0L 1AW7A 1K0RA 3S15H 1MD2D 5EJWA 2R6GA 5D14A 1CT1D 2I5MX 3A0JA 1BBWA 4R9WA 4M1UB 3S1NB 1X3QA 2F0FA 3NP8A 1SFOH 3VYTA 3KBXA 1H9MA 4FXKC 4IN3A 5C3EB 4FDBA 4CDFC 2ZXOA 1YITA 3BYTB 2NVQH 3MEFA 5FJ8H 4B3SQ 2JP1A 3AB9A 3C1FA 4DAPA 4IQZA 3A5UA 3O13A 2RCFA 4KK7A 1GUNA 2NTTA 3VYRA 1DCZA 3MXPA 4FF4A 4B3RQ 1W6JA 2JE6I 1X56A 1VQAA 3I90A 2OQ0A 1EL0A 4ZCKA 2JA7H 5BN4A 1IBKQ 1TWHH 3DWAA 4B3SL 2OQKA 1HZ9A 1KC8C 1HZBA 1AH9A 4OO1G 2KENA 3HRZC 2MUYA 3F2UA 4B3RL 2LS01 2RA4A 4BA2I 4APVA 2RDFA 1N8RC 3OTOQ 2M00A 4NXMQ 4ODGA 5IP7G 2L0CA 2NZOA 2AKWB 4BY1B 2A5HA 5I9OA 3J81j 3U9OA 3SK4A 5GAGC 2RF4A 2C9OA 5C0XI 1A2TA 2P5ZX 2NVTH 1K28A 1OO9B 2F0SA 2K4KA 2XVSA 3S1RH 1XMOL 3OTOL 2JA7G 2TSSA 3PGZA 3ND9A 5D65A 1K3BC 2KQ3A 1JB3A 3VR4A 2PMZE 4DV4L 5FLXc 2K75A 3J7AV 2DUDA 4HCEA 5JVH3 3JAME 1HZAA 2XN9C 4H0LC 3RLOA 2F0QA 2HQLA 1I6HB 2YTVA 4ZAIA 1QB5D 3T13A 5DM73 4A3DH 1VQJA 4EQ5A 2A6HD 4DV2L 3T1HQ 3MHBA 1EYCA 1E2ZA 5KNCA 3HOXH 3GDEA 4LFBQ 1XTCD 4A3BG 5IGDA 2I07B 5IT9E 2NN6G 4ID6A 5C44H 1HUMA 3I4NH 2KBNA 3G6EA 2HCIA 2DJFC 4QUFA 5EKIA 4KMUC 5EBCA 2G9HD 3D4WA 2X6LA 3QR8A 4POGA 2QDLA 5H1SE 2N88A 5DAUA 1SNMA 3J80L 1B2TA 4LFBL 1VQIA 2PQAA 3GTKH 1T5EA 4BBRB 2Y0SE 1TWHB 2L4NA 1XJVA 3TMEA 1G8ZD 1HTLD 1KQSA 1TT2A 5IYDG 1C0AA 5JPMC 3R8BA 1CI3M 2EYOA 5CR3A 4KY6A 3MVVA 1VQFA 4ME3A 1FNUA 4KHVA 2ATWA 2F0DA 2ZTCA 3J81c 4HN7A 4KTAA 3PQIA 3T56B 1SROA 3C2PA 1KIXA 3X3NA 2LY7A 4LF4Q 1H9JA 4IFDH 1IW7D 4XXEA 5A35A 1A3TA 2A6HC 4TQUS 2MHVA 2PO4A 3I8ZA 4KV6A 2XTIA 1B44D 3GV3A 2WINB 4BY7B 3P75A 3CKIB 3CRKC 2B63B 1PH7A 3A8IE 3S1RB 2WV6D 1H9RA 1E2WA 4J6HA 1IXRA 3OMCA 3I4MB 4DFAA 2KHIA 4KD4A 2JA8H 1UUPA 2EOTA 2BOSA 2PZUA 5EGTA 4LF4L 5A2QL 4IPGA 1A8VA 4QJFA 4C2MH 1N33L 3UDFA 4RHSA 3MZ5A 3CCRA 1N32Q 3HOUB 4XT3B 1G291 1X54A 3UE0A 1LTBD 4GLAC 1RL2A 4P71A 5M5WB 3T1YQ 2M2LA 4OELB 1VQEA 5ELFA 4FP5D 4C3IB 2F0MA 2MO0A 3H3VH 3PV0A 4JOIA 3HZXA 3AMUA 2CWAA 3HOXB 1N32L 1Y1VG 3S16H 5C44B 1VQOA 1JWUD 4XIGS 5G3LD 1LUZA 3Q22A 1IW7C 1HQMC 2B2UA 5NUCA 1ICFB 2AQ3B 4K2LA 3TZDA 3RN2A 2RSNA 4QCLA 2RSOA 4ABNA 2E76C 2LMCB 1CTMA 1JWMD 1CM9A 3IKJA 3GTKB 2E2HH 1I4QA 3URYA 1NMFA 4A3EG 3QIAA 3K5LA 1EIFA 5FLXE 1BDOA 4X6AH 5CV9A 3D6WA 2KEEA 2FHTA 4RA8A 1CHPD 2YTXA 3KLSA 1Q7YC 4LAAA 4RKBA 4UP9A 2RKSA 2L55A 4NB3A 3FDTA 2IWHA 5JJIA 3V96A 1CKMA 4DR3Q 2EPBA 3J81L 4DR2Q 4RCOA 4RGOS 1HTPA 3TP7A 4A93G 1CA5A 2LFNA 3AYHB 4GN5A 4PZ8A 4CKCA 2IHFA 3TP5A 3WOFA 2RHSB 3NHHA 5LL6X 2K05A 3CCEA 2WACA 3V05A 5KYLA 2B2YA 3RZDB 1KDBA 2JA8B 1AZPA 1DXMA 5CMDA 4DR3L 1OXSC 1I4HA 2MO1A 1EQTA 2IX3A 1EIHA 1EU4A 2WB1B 4C2MB 1V1QA 4K8IA 2CHBD 4KLKA 3LX0A 1TY0A 3SK6A 1S5ED 2R93H 1MIUA 1X32A 4A3FB 2UUCQ 1JJCB 2SNMA 1LTID 1F2MA 3W3AA 1KAAA 1WFQA 2PNRC 1D2BA 3GTJB 3L7ZC 3M9BA 4HJ7A 4YCVA 2KCTA 4C1NI 1PRTB 2JA6H 1LT6D 5E7NA 4C3JB 3J81E 3S16B 1HXYD 3E3XA 4G7HC 3JAMi 4WFN3 2ZTDA 1EWCA 3PIO3 3MEHA 4A3MH 3ULPA 2EJGC 3U4VA 1JT8A 4CGYB 2J0TD 2MGSA 2B3GA 2AQ1B 1V9PA 4IUUA 2UXDQ 4DR4L 3U9SA 3WWVA 3S9WA 1QVFA 2D0PA 3J7A5 2E2HB 1EY7A 5FO9B 2F0KA 4FF3A 5HGQA 2MNAA 2EYLA 1B4OA 2KCCA 3EQLC 3FPPA 3RN5A 5CORA 3KUPA 3CC2A 5LL6S 2WFWA 1IBLQ 5C4XB 1VCIA 5J3BA 1CKOA 1X55A 3GTLH 1M8AA 4DR5L 1SLJA 3PIOA 2UXDL 3EROA 3MC0B 1OXVA 1STGA 2JA5H 4C3HH 3HOZB 1VMCA 1S5DD 3PUWA 2NZHA 3DM3A 2BCOA 3K0XA 4GLVB 5C4JH 1XNRQ 4JC0A 1IBLL 1BBUA 4LJZC 2V1CC 3G7LA 4DR7Q 2BA1A 4R4QA 4EQOA 3KLSX 4ALPA 1B50A 5C3WA 5ELDA 1JB7A 1TKWB 4ZLTF 3K80C 1EEFD 1FJGQ 2XSCA 4KD3A 3R93A 3G48A 1ICWA 3HKZB 2EY5A 4ZKBB 1XNRL 2B8GA 2NZ1D 2Z4HA 4DR7L 3TSSA 2EJFC 5IYBG 5IYCG 3S14H 1KABA 5I9PA 1B3AA 5JAVA 4C56C 2JA5G 3QB3A 1IKMA 4IPDA 3GP7A 1RCVD 1K8AC 5GAHC 1U5KA 2K33A 4IJLA 1LTRD 1FJGL 3RMHA 1TR5A 5T1IA 1G2TA 5M5XH 3J80i 1RIPA 2Y0SG 3EN2A 4P75A 3K57A 4CHTB 2LXJA 5KIXA 3RNUA 1FR3A 1BBXC 2RHQB 3MXUA 5M3MH 5JEAH 2R92H 3OOCA 4HJ8A 4POFA 1SBBB 1Z6HA 3U50C 3CXCA 3ND8A 5IGCA 1X65A 4JI5Q 4LUOA 2CH4W 2NBFA 4JW0A 3M4OH 4OWXB 2EE1A 1WTXA 4K6LA 1K0SA 5GADC 3HOVH 3HOWG 3NXWA 1PTOF 1NJIC 4UAIA 2EDGA 2D2CC 1WTQA 4GZYC 4N8X1 3CCLA 3G71A 4JI5L 4BWGB 3D0FA 1YZ6A 5EKLA 1PLFA 1BCPD 3HOYG 2K5WA 2SOBA 1Y69U 4CKBA 5BR8Q 2F03A 2RCNA 2F0WA 2RQXA 2IJ0A 4HMIA 1ONLA 1PYBA 1O7LA 1CFMA 2IL8A 5C4JB 2N49A 2PPBC 1V43A 2VS1A 1D5XC 1E7ZA 2VB2X 4GNXC 1HA6A 3CCUA 2X6GA 2SDFA 3S1QH 1L0WA 1AE2A 1K8MA 2K1BA 4DUYQ 2F0EA 3GTMB 5BR8L 5BN3A 1K9MC 3TDQA 3S1NH 1H9SB 4DV1L 1VQ9A 2LSSA 4A3LG 2F0TA 1A6XA 1ILPA 3EVQA 1SYCA 2A73B 2E75C 3S14B 4B08A 1W6KA 1G51A 3SK5A 2F52A 1Q82C 1HCZA 1HJPA 4DUYL 1WCMG 5IGGA 2EZVA 1B8AA 4ME5A 2K5VA 1UE6A 1CKNA 4BXXG 5M5YB 5M5XB 2JSOA 1PH4A 3DLLA 2R7ZB 5M3FG 2F0IA 3GQBA 3EIVA 2VB3X 2CVRA 4AYBE 3PMFA 4A3IG 1X3FA 3L9AX 3M7GA 4DV3Q 1BCPC 1HNWL 2ASBA 4IUQA 3QJYA 4FXDA 4DV7Q 4RGMA 2IT1A 4JYAQ 2AUKA 5CV4A 2KUMA 1S40A 1EFID 3KDFA 4DV3L 3ICEA 5C3EG 4MIUA 1VQBA 3BU2A 3J81i 1ZKOA 4A3KB 4U673 3I4LA 1AE3A 3K0YA 2MP1A 2EY6A 2HCCA 4DV7L 4S3SA 1D5MC 3HOVB 2SNSA 2ZXPA 4JYAL 4BY1H 1BNZA 3N6RA 3EBEA 1AP0A 1RODA 4HIOA 1QOHA 4FVMA 1M4VA 4A3CH 2EQSA 3GO5A 1PYWD 3KBGA 3E9IA 1TWCH 4HJ9A 2WIIB 1EFWA 1UE5A 2CKZB 2QEXA 2A1AA 4LF9L 1TS4A 1CA6A 1YHBA 3OWEB 1OXXK 3P20A 1G6PA 3S17B 1IYJB 4R1JA 2E8GA 4HTHA 3J7YW 4BY1G 2IX1A 4ZQ3A 4JOIC 5CC4A 1I6HH 1NR2A 2AUJD 1PHJA 2HUGA 4PV1C 2UXBQ 3S24A 3OW7A 3W2DA 1MBYA 2CFMA 1LTLA 2B2UC 5C0XG 2FFKB 5D3DA 3GV6A 4I7AA 1NNXA 1DD2A 3BDOA 3KF8A 4Z9CB 4OHJA 1MJEA 3ERSX 1J5EQ 1JOOA 3CCMA 2EIFA 2UXBL 1HUNA 2G9DA 2NB0A 5I6WA 4NPSA 5EBDA 2VZAA 3M85A 4LW1A 2VL6A 3RR5A 5FO8B 5IWAQ 4BBRH 3T16A 3F2CA 1RHPA 3MTSA 4A3GB 3JAML 1TXYA 4R4CA 4JI8Q 3UDXA 1VQLA 4KKTA 1J5EL 1D6EC 4FF1A 2ZM6Q 3PUXA 4RWSC 4X66Q 3K59A 1EWIA 2JYOA 4NDXA 2F0JA 4N9TA 3B6YA 4QY7A 3OWFA 1B3QA 5FJ8G 2HIVA 2PNHA 1IBKL 3CW2C 1PH1A 1QUQA 1Y14B 3ZYYX 1W2BA 1ML0D 3RLNA 4A3JH 5IT9L 2O5JC 4JI8L 3TP6A 5M9OA 2ZM6L 2AQ2B 2B2YC 3AFPA 3FPUB 3LGJA 3NBHA 2JJQA 2L12A 5C5MA 4X66L 1QNUA 4BY7H 3FKIH 2B63H 2KCMA 2D9UA 2PW5A 4DK0A 4TSSA 2CCZA 5IE8A 4NXML 1TWCB 4YY3Q 3RUZA 2NYZD 3GD7A 3I4MH 2YV5A 1I6VC 4PNYA 2K03A 3H0GH 4PMWA 4A76A 5KEEA 3OIPA 1KLUD 1PTOB 2C5CA 2F4IA 4KHZA 1EYAA 4YWLA 1A2UA 2B39A 3OSOA 2IX0A 3HOUH 1SYBA 4M8AA 4YCWA 2Q2HA 5LMUQ 4GNXA 1XPOA 2B2VC 4HIKA 4YY3L 5C6AA 5M5WH 3PSIA 1PFSA 1PXUA 1IL2A 1LACA 2K6AA 1STYA 5IIFA 2J7ZA 4C3IH 1YNJC 4V0BA 4NKLA 2B63G 4DR1Q 1TS2A 2JK8A 5LMUL 1C48A 1TU2B 3FEWX 4JI7Q 3ULLA 3VA5A 1VF7A 4CJ0B 3QOJA 3TP8A 5E4WC 4OO1I 2VY3A 4JI1Q 2L5TA 2PYKA 1IKLA 3T1HL 2WAQE 2N78A 3E0EA 4L63B 2IW3A 4BA1I 1EY5A 2NUCA 4DR1L 1ENCA 1EWHA 1VQDA 4OGQC 4LF5Q 1PMRA 1G91A 1LYLA 4KY5A 4YCUA 1BCPF 3KLRA 4XT1B 2ICEC 1GOZA 4K2KA 4F87A 4JI1L 1V1PA 4A3DG 1Y8NB 4JBKA 5E3FA 2XWJB 3QOLA 3HOXG 1E2VA 2B2TC 2MPMA 2NWGA 5C4ZA 1B9NA 3A7AB 4OX9Q 5C44G 4LF5L 3I4NG 1U4LA 1FL0A 4QMGA 1GHJA 4DV0Q 3D4RA 3V2TA 4A3JB 2XNAC 3A5ZB 3S2HH 4NMZA 4B9XA 3A54A 3FKIB 4MN3A 1GUTA 3IFDA 4KY7A 3FVQA 1PTOD 5FO7B 4OX9L 4CDCC 1OXUA 3KDFB 5ELEA 3RZDH 4WORA 2QW7A 3WDNA 1I4GA 4DV0L 5C3XA 4RKLA 4EX5A 4LF8Q 3H0GB 4MTNA 1K8GA 3KF6A 1SYGA 4L5QA 1KL9A 5HGTA 2DNCA 1NUCA 1QZGA 1U4MA 2J4XA 1Y1WH 1STNA 4A3FH 4GKKQ 2VXWA 4JI3Q 1O80A 5ELOA 4UDUC 4JPBW 5FLXL 1RF2D 4N8FA 4AYBG 4CDDC 4A3BB 4DV5Q 5FOBB 1TVXA 3PF4A 1G2SA 3SGIA 4IFDG 4LF8L 3GTJH 3BZKA 3STBD 3H09A 3EJIA 2PCFB 4ZUJA 3S2DB 3KK7A 3DM1A 5EPJA 5T1GA 4C3JH 3PUVA 4JI3L 4GKKL 1SNOA 1Q3LA 2E74C 2RVLA 1D8LA 4DV5L 2JA8G 1F2ZA 2K52A 1C7YA 3T1YL 1S72A 2EJMA 2JQOA 4TKOB 1F77A 1I5FA 1SDFA 5EQ0A 3C1EA 1JR0D 2F0OA 5JJLA 1PTOC 2HT1A 3ONAB 1SE8A 4DAYA 4UHVA 3MAQA 2I5LX 4JBWA 5KYIA 4OIJA 3CRLC 1LM0A 4ZRZA 5C4XH 3KF8B 4G7OC 2E2JB 5DEHA 1SYFA 5IOCA 2OCEA 1UAPA 4DK1A 2PI2E 4X3TA 1DOMA 2L11A 3D4DA 3HOZH 4CKEA 1VQ7A 3STBC 3NE5B 3S2HB 1CQFA 3M4PA 4GOPC 5J1ZA 1A62A 1N9WA 1STAA 4DXGA 1PZJD 1TWFB 4UPAA 3NEMA 5I6YA 2FXQA 3F8TA 4DR2L 4J15A 1SE4A 1GO3E 1WTWA 4B9WA 2Z6BA 2EYFA 4KN7C 1X3GA 1QUQB 3HGBA 4TRDA 1Y1WB 1SNCA 1SRUA 1EQQA 3AEVA 3NBHB 4K5XA 4PG3A 3C46A 1Q8KA 1Y1VB 1LTGD 1EOTA 3CU7A 5AJ3Q 2H1EA 1BXTA 2DNEA 3OIQA 3BS1A 4WJ4A 1KLGD 2B2VA 3K7UC 3MWYW 5JOBA 2MQHA 3T4AC 1N34Q 2D5DA 1DGSA 1PH6A 2KHSA 1MSHA 4L6TB 1E22A 1D5ZC 2UUCL 1CHQD 2L15A 1B9MA 1ZXTA 2B2WA 5EKKA 1ASYA 1X3EA 4IPCA 5AJ3L 3OW2A 3BG3A 1TS5A 3WOEA 4HCSA 1HZCA 4YWKA 4GNXB 1WYDA 2TMPA 3AQQA 1UEAB 4A3EB 2I46A 1OTCA 5IGBA 1N34L 3K81C 2R93G 2KA7A 5ELNA 2H5XA 4P73A 5LHY1 4HSPA 1AN8A 3KJOA 1Q90A 3K5NA 3VA7A 1AFPA 2VW9A 1YHAA 1QE6A 2ENBA 3LNNA 4IZ8A 5TSSA 4LF6Q 2JA6G 4P72A 1C8CA 3CC4A 3KFUA 2QILA 2VQEQ 3HFZB 1O7YA 1SEBD 4HJAA 4L5RC 2B2TA 3NENA 1GD7A 3CPWA 1JC7A 1JORA 2AMCB 2EYHA 2PQAB 4A3MG 1BCPB 1NBWA 1SJED 4LF6L 3P1HA 4H02A 4O0AA 3S1MH 2EY2A 2VQEL 1LO5D 4Y7NB 4X3KA 3GTMH 4BBSB 1PFMA 2Q8TA 2G5DA 3SE0A 3OPOA 3PO2B 4IO9A 2OWOA 2QCPX 1XNQQ 3RZOB 1HFNA 1VQHA 1GUWA 2WAQG 1QG7A 4C3HG 5IP9H 5JVG3 3T51B 4DV6Q 2UXCQ 2Q8IB 1U0LA 5M5YH 2MFIA 1SNQA 2KCNA 4ZYSA 2R7ZH 3I55A 1QJOA 3NWSA 1SXTA 1I50B 1K3RA 4X65Q 4GN3B 5CBEE 3KF6B 1CSQA 5ELCA 2F3IA 3DWQA 3LWEA 5GAEC 4DV6L 2UXCL 4CDEC 2PW7A 2Z0SA 1SAPA 4H7BA 4YIJA 2F0NA 1BQQT 3CF5A 4FO2A 2EYPA 4X65L 3Q0AA 1SNPA 5GROA 2F4VQ 2OXPA 3NTKA 2O4XA 1I4PA 1U4RA 3GTGH 3CP0A 2PMZB 4A3KH 4DXFA 3D31A 4QIWB 1PV4A 3HS0C 1K73C 4FXGC 1JOQA 1HR0W 4UY8C 2Z4IA 1C4QA 1BUVT 3TEHB 4DAMA 5KRUA 4QGUA 3UDGA 2R7ZG 1STHA 1XYIA 1WI5A 3PO3H 4LK1C 1RD9D 3MFYA 1I4XA 2F4VL 1K8OA 1TWAH 1YNND 1JWSD 2OF1A 5M3MG 4PZ7A 3IRBA 5JEAG 2R92G 2UU9Q 1R9TH 1PFNA 1EUJA 4JK1C 5JEAJ 5D3IB 1L1OC 4DF7A 4RGNA 3ZJYC 4DAYB 2GA4B 1R4PB 1O7IA 4J8QA 1EOVA 2A8VA 3S1MB 2L9HA 5CV7A 5JPNC 2PZWA 3DUZA 2XRSD 3CHBD 4DNRB 1QCBD 5IY0A 3S17H 2GVAA 4GS3A 2K32A 4GOPA 3HOVG 3H3VC 3TZUA 1S4ZA 4BS9A 2BE5D 3RD4A 5I4DA 1MKHA 3BVGA 4HEDA 2HDMA 2Y0SB 3CCJA 1AEXA 4QUCA 3L3OC 4HAEA 2UUBQ 5LMNW 4JI4Q 4B3TQ 5EAYA 1TWGH 3ITPA 2JA9A 5EPLA 1J8IA 1O7ZA 1LABA 5K36H 2A6ED 4MTKA 4R4TA 4RHRA 3Q23A 3BYYB 2Q2IA 1IL8A 3BZDB 1L0XB 2BH8A 3IFTA 1BOSA 5I2XA 3PUZA 4OONA 1DYQA 4JBMA 1YNNC 2UUBL 4JI4L 4LWCA 4X3SA 4B3TL 4F88A 2K5HA 1YIJA 2ZTEA 3F2BA 1Z9FA 5FLMH 4A3GH 5CBAE 3QO2A 1HH2P 3AU7A 1GUGA 3SXHA 5K5PA 5FKAC 3PCOB 2E2IB 3K6OA 3MXNA 4KJNA 1ILQA 4P74A 3GTGB 2K04A 5EPKA 2WB1E 2XWBB 4EQPA 1E24A 3HOYB 4RAUC 4HIMA 1EY0A 1X6OA 3NWTA 5F2DA 2BE5C 1P8LA 2ZXRA 3SDZA 3FP9A 3QG1A 2R3ZA 1Q81C 4LF7Q 3I4OA 1BO0A 1MSGA 3TBIB 1EU3A 3PO3B 3GTOB 4XDXA 1U9RA 1BR9A 4LUZA 1TWAB 1GKHA 4XYQA 2PQEA 3OYYA 4XTCS 4OL7A 4PQXA 3CCVA 1R9TB 2WKDA 5KNBA 2A6EC 3M7NA 3FRPB 4LF7L 4MZ9A 2XGTA 1PTOH 2KOLA 3KLWA 2NVYB 3Q6SA 4MNOA 3R2IA 2AWNA 4DNTB 1CQVA 1VMPA 1EY6A 4DN4M 1S5BD 5HURA 1WJJA 2D0OA 1AZQA 1II3A 3TRZA 4JI2Q 3SHLA 3EA6A 5L37A 1WCMB 1W3SA 3ULJA 5CYUA 2H4OA 1Y8PB 4A3CG 4DR6Q 3VR6A 4A3IB 4GLXA 2EY1A 2A19A 3NBIA 1TWGB 3CQZB 3BJUA 5DLQE 1BF4A 1VDZA 4JI2L 3MA2B 3F1ZA 2RDGA 1B1ZA 3NK9A 5C0XJ 3SK8A 1EY4A 1F2YA 4E6IA 1FYCA 1N36Q 2LXKA 1VQGA 3U58A 2YTYA 2BDNA 1KNEA 4OO1H 2R7FA 2VUMB 4DR6L 1Z47A 4K14A 1YVCA 1JMCA 1WTRA 4IALA 1LT4D 1RKNA 5IP7H 3K58A 1K83B 1V1OA 1N36L 1ENFA 3J80c 5CGKA 5ISRA 5LMNQ 1E3PA 2OEOA 1YNJD 4K5WA 4DU9A 3BDCA 4JV5Q 2RDHA 4KHPQ 1Q1BA 4K8JA 4P2CB 4Q0FA 5IWAL 3M3YH 3HKZE 2MJ8A 4JI6Q 3BVZA 4PMBA 1PDQA 1DM0B 2EYMA 4UP8A 1WD1A 5LMNL 4HR7B 1H95A 2R61A 1A3UA 3VDYA 2K14A 3A74A 4JV5L 2KECA 4DK3C 4KHPL 2KJXA 1PH2A 5J39A 4BBRG 1XMOQ 3K5OA 3VR5A 1XMQQ 4JI6L 2PZTA 4RCNA 2OTJA 1JOKA 2B29A 2CW0D 1KTKA 1QVGA 1VQPA
chains in the Genus database with same CATH topology
3K0XA 4GLVB 1I5FA 5C4JH 1XNRQ 4GN4B 4JC0A 1IBLL 1BBUA 4DV4Q 3H15A 2V1CC 3Q8DA 4DR7Q 1JJGA 1L1OA 2BA1A 4R4QA 5JJLA 2HT1A 3CAMA 1SE8A 2UUAQ 4ALPA 1HNXQ 1PYSB 4A3BH 3JAMc 1JB7A 1JJ2A 1XMQL 5K36G 1PH9A 3K80C 5HY6A 4A3JG 1FJGQ 2HIXA 3TS2A 4NXNQ 1A0IA 2ZJPA 3G48A 4LNQA 1NE3A 2I5LX 2EXDA 1EYGA 1SR3A 4JBWA 1XNRL 5C4XH 1EQRA 1LM0A 4BY7G 4QIWE 4DR7L 1KHIA 3KF8B 3FKIG 2VUMG 4DV2Q 3S2DH 1QVCA 5IYCG 5IYBG 2HHHQ 3S14H 2UUAL 1I94Q 2OCEA 1HNXL 3I4MG 1GM5A 5IT9c 2JA5G 2PI2E 4IPDA 3HOZH 1FGUA 1K8AC 5FLMG 5GAHC 1U5KA 3H0GG 2Z6KC 3KYHC 4IJLA 1VQ7A 3STBC 1FJGL 4A3GG 1J6QA 3HKSA 4NXNL 2QA4A 4GOPB 5M5XH 4AH6A 3CPFA 3J80i 1RIPA 1FVIA 2Y0SG 3EN2A 4P75A 1KRSA 5IYDH 1EIYB 4LF9Q 3M4PA 4YHHQ 1BKBA 3JC66 4L5TA 2LXJA 4GOPC 3RNUA 2OTLA 3HOUG 1A62A 2HHHL 1N9WA 4IPHA 1Q46A 1BVSA 2AWOA 1VQ6A 2RHQB 1Q86C 1HR0Q 1I94L 4JI7L 1SMXA 4DNIA 4UPAA 5M3MH 2R92H 2KHJA 1A63A 3NEMA 2D62A 2FXQA 3F8TA 4DR2L 4J15A 4HJ8A 4POFA 1M90C 1GO3E 3U4ZA 1D7QA 1CKNB 3U50C 3CXCA 1X3GA 1QUQB 4TVAB 4WJ3M 4HIDA 1X65A 2AHOB 4PZ6A 4YHHL 3CCSA 4JI5Q 1SRUA 2ALYB 4LUOA 1KRTA 1EQQA 3G4SA 3AEVA 2E2JH 3M4OH 2UXDL 3NBHB 4PG3A 4OWXB 1HR0L 1Q8KA 1K0RA 1C9OA 3S15H 2K5NA 5AJ3Q 2R6GA 2I5MX 5GADC 3HOVH 3HOWG 3A0JA 1BBWA 2Q2UA 4DKAC 1NJIC 4WJ4A 4QL5A 2N8NA 3W5OA 1SFOH 2GN5A 3K7UC 2MQHA 3I7FA 1N34Q 3CCLA 3G71A 4JI5L 4OWWB 1DGSA 1PH6A 3D0FA 1E22A 1YZ6A 2UUCL 4FDBA 3PF5A 3HOYG 1TWFH 2L15A 3MXNB 3F2DA 1ASYA 1X3EA 4IPCA 5BR8Q 5AJ3L 3OW2A 2RCNA 1YITA 2NVQH 3MEFA 5FJ8H 1HZCA 4B3SQ 4DPGA 4YWKA 4GNXB 1PYBA 1WYDA 3AQQA 3PUYA 2N49A 1VQ4A 1OTCA 1V43A 3A5UA 2VS1A 1N33Q 1N34L 1E7ZA 4GNXC 3K81C 2R93G 2NN6I 4B3RQ 2JE6I 5ELNA 3CCUA 1X56A 2H5XA 1VQAA 2OQ0A 4P73A 1L0WA 1AE2A 3S1QH 1Y1VH 4DUYQ 4B3MQ 2JA7H 5BR8L 3KJOA 1K9MC 1IBKQ 1MJCA 1TWHH 3S1NH 4DV1L 4B3SL 2I0QA 1YNXA 2OQKA 1YHAA 2VW9A 1HZ9A 1VQ9A 4R4OA 2LSSA 1KC8C 1HZBA 2Q2TA 4LF6Q 4A3LG 4IFDJ 1AH9A 2N3SA 2JA6G 4OO1G 2KENA 4P72A 2ES2A 3CC4A 4OWTB 4B3RL 3KFUA 1G51A 4BA2I 4APVA 2VQEQ 2F52A 1Q82C 3HFZB 1HJPA 1N8RC 3OTOQ 1WCMG 4DUYL 4HJAA 4B3ML 1B8AA 1GD7A 3NENA 5IP7G 3CPWA 4L5RC 2K5VA 4NXMQ 2NZOA 3TS0A 1UWVA 1UE6A 1CKNA 1OXTA 2AKWB 2AMCB 2PQAB 4BXXG 4A3MG 2WB1G 3J81j 4A3EH 1PH4A 1NBWA 3DLLA 4LF6L 5M3FG 4JBJA 4H02A 5GAGC 3EIVA 4UP7A 1Y1WG 1E1OA 4O0AA 4AYBE 3S1MH 2RF4A 1X3FA 4DV3Q 4A3IG 4A3FG 5C0XI 3L2PA 1HNWL 2NVTH 2ASBA 2VQEL 1XPRA 1XMOL 2K4KA 3S1RH 3OTOL 3RLFA 2JA7G 1T9HA 4DV7Q 1PH5A 3PGZA 3GTMH 4A75A 3CMAA 2IT1A 4JYAQ 3FHWA 4Y52H 2PMZE 4DV4L 1S40A 3AFQA 5FLXc 4A93H 2K75A 4IO9A 3KDFA 2OWOA 4DV3L 3ICEA 3CC7A 1XNQQ 5C3EG 5GQOA 1VQBA 2DUDA 4A4IA 3BU2A 3J81i 1VQHA 2DGYA 2WAQG 2ZJRA 1AE3A 3GTQH 1HZAA 2JEBI 5IP9H 4DV7L 4DK6C 4DV6Q 2UXCQ 4JYAL 1U0LA 5M5YH 4BY1H 3RLOA 2MFIA 1B7YB 2HQLA 2YTVA 3EBEA 2R7ZH 3I55A 4A3DH 1VQJA 4EQ5A 3KJPA 1K3RA 1KAWA 4GN3B 4X65Q 4DV2L 3T1HQ 3KF6B 4HIOA 1E1TA 3GTPH 4A3CH 4X64Q 3HOXH 1CSQA 2EQSA 3GDEA 3GO5A 1VS0A 4LFBQ 4A3BG 4Y7NH 2NN6G 4IFDI 5C44H 2F3IA 1TWCH 2R7DA 3E9IA 4HJ9A 3I4NH 5GAEC 2KBNA 3G6EA 4DV6L 1EFWA 4BBSH 4K0KQ 2UXCL 2Z0SA 1PA6A 5C4XG 1UE5A 2CKZB 2QEXA 3CF5A 3PO2H 2A1AA 4LF9L 4POGA 4X65L 1YHBA 5H1SE 5GROA 2F4VQ 3RZOH 1OXXK 4X64L 1G6PA 1IYJB 4LFBL 3GTGH 3CP0A 4R1JA 4KI0A 4A3KH 3D31A 1VQIA 2PQAA 1UEBA 1PV4A 2E8GA 3GTKH 3HOZG 1K73C 2Y0SE 4K0KL 4BY1G 2IX1A 1HR0W 4UY8C 1XJVA 4QGUA 4JOIC 3TEHB 4DAMA 3UDGA 1XPUA 2R92G 2R7ZG 1I6HH 1C0AA 1KQSA 5IYDG 1PHJA 1WI5A 1I50H 1IBMQ 3PO3H 2YYZA 2UXBQ 1P16A 3M4QA 3S24A 1VQFA 3TQYA 2F4VL 4ME3A 2CFMA 1LTLA 2ATWA 1TWAH 2ZTCA 3J81c 3E9HA 4RMFA 5M3MG 4PZ7A 1L1OB 1SROA 2C35B 3IRBA 5JEAG 5C0XG 1R9TH 1KIXA 2UU9Q 1EUJA 4BBSG 4JI0Q 4LF4Q 5JEAJ 3H3VI 3HKZG 1Q1EA 1YBYA 1L1OC 2WP8J 1MJEA 3PO2G 3ZJYC 3ERSX 4DAYB 4TQUS 1UE7A 1J5EQ 1O7IA 3CCMA 1EOVA 2Z6KA 2XTIA 2EIFA 1IBML 2A8VA 2QGQA 2UXBL 4DUZQ 4NPSA 5IY0A 3S17H 2VZAA 4DR4Q 3M85A 1Q12A 2GVAA 2VL6A 4LW1A 3RR5A 1VQMA 1PH7A 4GS3A 5IWAQ 4GOPA 3HOVG 1IXRA 4BBRH 2KHIA 3F2CA 2JA8H 3K8AA 4JI0L 4LF4L 1WOCA 4IPGA 4YWMA 1A8VA 4AIMA 1TXYA 4R4CA 4JI8Q 4X62Q 4QJFA 3UDXA 4C2MH 1VQLA 1MKHA 1J5EL 1N33L 2ZM6Q 3PUXA 4IJHA 3UDFA 4IOCA 3CCJA 4X66Q 3CCRA 4DUZL 1EWIA 4GKJQ 1N32Q 4DR5Q 2UUBQ 5LMNW 4JI4Q 1G291 1X54A 4B3TQ 3UE0A 5EAYA 3B6YA 4GLAC 1TWGH 4QY7A 3I56A 1RL2A 2JA9A 2HIVA 2PNHA 4P71A 5FJ8G 3CW2C 1IBKL 1PH1A 1QUQA 1Y14B 3T1YQ 3NELA 4R4TA 1W2BA 2Q2IA 2YU9H 3RLNA 4A3JH 1VQEA 4JI8L 4X62L 4IOAA 1KXLA 2BH8A 3BZCA 2ZM6L 3AFPA 1B70B 3LGJA 2JJQA 3PUZA 2MO0A 4OONA 3PV0A 4X66L 3CCQA 3H3VH 4JOIA 4JBMA 4BY7H 2CWAA 3FKIH 2UUBL 4JI4L 3CD6A 1N32L 2B63H 2KCMA 4LWCA 5IYCH 5IYBH 4B3TL 1Y1VG 2K5HA 3S16H 2CCZA 5IE8A 4NXML 1YIJA 1VQOA 4YY3Q 3I4MH 3GD7A 1M1KC 1IZ6A 4XIGS 2YV5A 2ZTEA 2PI2A 1LUZA 3F2BA 1Z9FA 1NTGA 5FLMH 3H0GH 4PMWA 4A76A 4A3GH 1VQ8A 1HH2P 3KOJA 2IY5B 4KHZA 1ASZA 3PCOB 4YWLA 3RN2A 1XTDA 4P74A 2IX0A 3HOUH 4YCWA 2E5LQ 2Q2HA 5LMUQ 4GNXA 1XPOA 2WB1E 2E2HH 4HIKA 1E24A 4YY3L 4O2DA 4HIMA 5M5WH 1X6OA 3PSIA 1PFSA 4AQYQ 1IL2A 1P8LA 1NMFA 4A3EG 3FP9A 1Q81C 2CQOA 4LF7Q 3I4OA 1I3QH 1EIFA 1HNZQ 4C3IH 4X6AH 1XNQL 1VQ5A 2YTXA 1Q7YC 2B63G 4QQBX 4LUZA 2ZJQA 4DR1Q 2E5LL 4UP9A 2JK8A 1GKHA 5LMUL 3OYYA 4XTCS 3CCVA 4NB3A 4JI7Q 3ULLA 4L5SA 5JJIA 1CKMA 4DR3Q 4AQYL 3HOWH 3K7AH 3TREA 3M7NA 4LF7L 4DR2Q 4MZ9A 4OO1I 2VY3A 4JI1Q 2XGTA 2NVXH 1HNZL 1SN8A 4A93G 3AYHB 3KLWA 4GN5A 4MNOA 3J7ZC 3T1HL 2WAQE 4PZ8A 2AWNA 2N78A 4R4IA 2IHFA 3E0EA 2E2IH 2RHSB 1NY4A 3CCEA 4BA1I 1X9NA 2JEAI 4DR1L 1S3OA 1VQDA 1WJJA 2D0OA 4JCVE 5IP9G 2IHEA 1QZHA 3UDIA 4JI2Q 3CMEA 4LFAQ 1VQKA 1LYLA 1YHQA 4LF5Q 3HOYH 3TRZA 4YCUA 5JJKA 4DR3L 2VQFQ 1OXSC 1W3SA 2MO1A 3ULJA 4JG2A 4JI1L 4A3DG 1V1QA 1PVOA 4KLKA 4JBKA 1PH8A 3GTOH 1JE5A 3UE1A 3W1GA 4A3CG 3HOXG 4DR6Q 2R93H 4RG1A 4GLXA 4LFCQ 1MIUA 2A19A 2UUCQ 4OX9Q 3BJUA 2K50A 5DLQE 5C44G 4JI2L 1JJCB 1CSPA 4LF5L 4LFAL 3I4NG 1FL0A 2VNUD 2ID0A 3F1ZA 1WFQA 1CUKA 2VQFL 4DV0Q 5C0XJ 1UE1A 2CWPA 1N36Q 4LUVA 2LXKA 1VQGA 3A5ZB 3L7ZC 1NMGA 3U58A 3M9BA 2NVYH 4A3LH 4HJ7A 4YCVA 3S2HH 2KCTA 2YTYA 2JA6H 2R7FA 4DR6L 1Z47A 2BH2A 4LFCL 1L2FA 5E7NA 4A3KG 4GKJL 1YEZA 1YVCA 1JMCA 4OXPA 4OX9L 2GVBA 1OXUA 3KDFB 3JAMi 2UU9L 3RZDH 2ZTDA 1KD1C 1WCMH 5IP7H 4DV0L 1YJNA 1YJWA 4EX5A 4LF8Q 4MTNA 4DV1Q 1K8GA 3KF6A 3PIPA 3L0OA 4A3MH 1N36L 4BXXH 3ULPA 4L5QA 3U4VA 3J80c 1VQNA 5LMNQ 3PO3G 1JT8A 1E3PA 5M3FH 2B3GA 1KL9A 1V9PA 3ER0A 1QZGA 1Y1WH 4JV5Q 2UXDQ 4HJ5A 4A3IH 2BA0A 3W1BA 4DR4L 4A3FH 4GKKQ 1Q1BA 4JI3Q 3WWVA 1QVFA 4KHPQ 2D0PA 3CQZH 5ELOA 3J7A5 5IWAL 3M3YH 4AYBG 3HKZE 4DV5Q 5HGQA 2MNAA 3PF4A 4JI6Q 3SGIA 4IFDG 4LF8L 4UP8A 3GTJH 3BZKA 3RN5A 1YJ9A 3STBD 3I2ZA 3CC2A 5LMNL 2WFWA 1IBLQ 1H95A 1VCIA 5J3BA 1YI2A 1CKOA 3VDYA 1X55A 3GTLH 4DR5L 2VUMH 2K14A 1SLJA 3A74A 3PIOA 4JV5L 4DK3C 4KHPL 4C3JH 1HNWQ 3PUVA 4JI3L 4GKKL 5C3EH 1GVPA 1PH2A 1OXVA 4BBRG 1XMOQ 1D8LA 4DV5L 1PH3A 2JA8G 2JA5H 2K52A 4C3HH 1C7YA 1XMQQ 4JI6L 1K83H 3T1YL 1S72A 1VQCA 3PUWA 2I5HA 2OTJA 2NZHA 3DM3A 2B29A 1QVGA 2JQOA 1VQPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K0X A;  4GLV B;  1I5F A;  5C4J H;  1XNR Q;  4GN4 B;  4JC0 A;  1IBL L;  1BBU A;  4DV4 Q;  3H15 A;  2V1C C;  3Q8D A;  4DR7 Q;  1JJG A;  1L1O A;  2BA1 A;  4R4Q A;  5JJL A;  2HT1 A;  3CAM A;  1SE8 A;  2UUA Q;  4ALP A;  1HNX Q;  1PYS B;  4A3B H;  3JAM c;  1JB7 A;  1JJ2 A;  1XMQ L;  5K36 G;  1PH9 A;  3K80 C;  5HY6 A;  4A3J G;  1FJG Q;  2HIX A;  3TS2 A;  4NXN Q;  1A0I A;  2ZJP A;  3G48 A;  4LNQ A;  1NE3 A;  2I5L X;  2EXD A;  1EYG A;  1SR3 A;  4JBW A;  1XNR L;  5C4X H;  1EQR A;  1LM0 A;  4BY7 G;  4QIW E;  4DR7 L;  1KHI A;  3KF8 B;  3FKI G;  2VUM G;  4DV2 Q;  3S2D H;  1QVC A;  5IYC G;  5IYB G;  2HHH Q;  3S14 H;  2UUA L;  1I94 Q;  2OCE A;  1HNX L;  3I4M G;  1GM5 A;  5IT9 c;  2JA5 G;  2PI2 E;  4IPD A;  3HOZ H;  1FGU A;  1K8A C;  5FLM G;  5GAH C;  1U5K A;  3H0G G;  2Z6K C;  3KYH C;  4IJL A;  1VQ7 A;  3STB C;  1FJG L;  4A3G G;  1J6Q A;  3HKS A;  4NXN L;  2QA4 A;  4GOP B;  5M5X H;  4AH6 A;  3CPF A;  3J80 i;  1RIP A;  1FVI A;  2Y0S G;  3EN2 A;  4P75 A;  1KRS A;  5IYD H;  1EIY B;  4LF9 Q;  3M4P A;  4YHH Q;  1BKB A;  3JC6 6;  4L5T A;  2LXJ A;  4GOP C;  3RNU A;  2OTL A;  3HOU G;  1A62 A;  2HHH L;  1N9W A;  4IPH A;  1Q46 A;  1BVS A;  2AWO A;  1VQ6 A;  2RHQ B;  1Q86 C;  1HR0 Q;  1I94 L;  4JI7 L;  1SMX A;  4DNI A;  4UPA A;  5M3M H;  2R92 H;  2KHJ A;  1A63 A;  3NEM A;  2D62 A;  2FXQ A;  3F8T A;  4DR2 L;  4J15 A;  4HJ8 A;  4POF A;  1M90 C;  1GO3 E;  3U4Z A;  1D7Q A;  1CKN B;  3U50 C;  3CXC A;  1X3G A;  1QUQ B;  4TVA B;  4WJ3 M;  4HID A;  1X65 A;  2AHO B;  4PZ6 A;  4YHH L;  3CCS A;  4JI5 Q;  1SRU A;  2ALY B;  4LUO A;  1KRT A;  1EQQ A;  3G4S A;  3AEV A;  2E2J H;  3M4O H;  2UXD L;  3NBH B;  4PG3 A;  4OWX B;  1HR0 L;  1Q8K A;  1K0R A;  1C9O A;  3S15 H;  2K5N A;  5AJ3 Q;  2R6G A;  2I5M X;  5GAD C;  3HOV H;  3HOW G;  3A0J A;  1BBW A;  2Q2U A;  4DKA C;  1NJI C;  4WJ4 A;  4QL5 A;  2N8N A;  3W5O A;  1SFO H;  2GN5 A;  3K7U C;  2MQH A;  3I7F A;  1N34 Q;  3CCL A;  3G71 A;  4JI5 L;  4OWW B;  1DGS A;  1PH6 A;  3D0F A;  1E22 A;  1YZ6 A;  2UUC L;  4FDB A;  3PF5 A;  3HOY G;  1TWF H;  2L15 A;  3MXN B;  3F2D A;  1ASY A;  1X3E A;  4IPC A;  5BR8 Q;  5AJ3 L;  3OW2 A;  2RCN A;  1YIT A;  2NVQ H;  3MEF A;  5FJ8 H;  1HZC A;  4B3S Q;  4DPG A;  4YWK A;  4GNX B;  1PYB A;  1WYD A;  3AQQ A;  3PUY A;  2N49 A;  1VQ4 A;  1OTC A;  1V43 A;  3A5U A;  2VS1 A;  1N33 Q;  1N34 L;  1E7Z A;  4GNX C;  3K81 C;  2R93 G;  2NN6 I;  4B3R Q;  2JE6 I;  5ELN A;  3CCU A;  1X56 A;  2H5X A;  1VQA A;  2OQ0 A;  4P73 A;  1L0W A;  1AE2 A;  3S1Q H;  1Y1V H;  4DUY Q;  4B3M Q;  2JA7 H;  5BR8 L;  3KJO A;  1K9M C;  1IBK Q;  1MJC A;  1TWH H;  3S1N H;  4DV1 L;  4B3S L;  2I0Q A;  1YNX A;  2OQK A;  1YHA A;  2VW9 A;  1HZ9 A;  1VQ9 A;  4R4O A;  2LSS A;  1KC8 C;  1HZB A;  2Q2T A;  4LF6 Q;  4A3L G;  4IFD J;  1AH9 A;  2N3S A;  2JA6 G;  4OO1 G;  2KEN A;  4P72 A;  2ES2 A;  3CC4 A;  4OWT B;  4B3R L;  3KFU A;  1G51 A;  4BA2 I;  4APV A;  2VQE Q;  2F52 A;  1Q82 C;  3HFZ B;  1HJP A;  1N8R C;  3OTO Q;  1WCM G;  4DUY L;  4HJA A;  4B3M L;  1B8A A;  1GD7 A;  3NEN A;  5IP7 G;  3CPW A;  4L5R C;  2K5V A;  4NXM Q;  2NZO A;  3TS0 A;  1UWV A;  1UE6 A;  1CKN A;  1OXT A;  2AKW B;  2AMC B;  2PQA B;  4BXX G;  4A3M G;  2WB1 G;  3J81 j;  4A3E H;  1PH4 A;  1NBW A;  3DLL A;  4LF6 L;  5M3F G;  4JBJ A;  4H02 A;  5GAG C;  3EIV A;  4UP7 A;  1Y1W G;  1E1O A;  4O0A A;  4AYB E;  3S1M H;  2RF4 A;  1X3F A;  4DV3 Q;  4A3I G;  4A3F G;  5C0X I;  3L2P A;  1HNW L;  2NVT H;  2ASB A;  2VQE L;  1XPR A;  1XMO L;  2K4K A;  3S1R H;  3OTO L;  3RLF A;  2JA7 G;  1T9H A;  4DV7 Q;  1PH5 A;  3PGZ A;  3GTM H;  4A75 A;  3CMA A;  2IT1 A;  4JYA Q;  3FHW A;  4Y52 H;  2PMZ E;  4DV4 L;  1S40 A;  3AFQ A;  5FLX c;  4A93 H;  2K75 A;  4IO9 A;  3KDF A;  2OWO A;  4DV3 L;  3ICE A;  3CC7 A;  1XNQ Q;  5C3E G;  5GQO A;  1VQB A;  2DUD A;  4A4I A;  3BU2 A;  3J81 i;  1VQH A;  2DGY A;  2WAQ G;  2ZJR A;  1AE3 A;  3GTQ H;  1HZA A;  2JEB I;  5IP9 H;  4DV7 L;  4DK6 C;  4DV6 Q;  2UXC Q;  4JYA L;  1U0L A;  5M5Y H;  4BY1 H;  3RLO A;  2MFI A;  1B7Y B;  2HQL A;  2YTV A;  3EBE A;  2R7Z H;  3I55 A;  4A3D H;  1VQJ A;  4EQ5 A;  3KJP A;  1K3R A;  1KAW A;  4GN3 B;  4X65 Q;  4DV2 L;  3T1H Q;  3KF6 B;  4HIO A;  1E1T A;  3GTP H;  4A3C H;  4X64 Q;  3HOX H;  1CSQ A;  2EQS A;  3GDE A;  3GO5 A;  1VS0 A;  4LFB Q;  4A3B G;  4Y7N H;  2NN6 G;  4IFD I;  5C44 H;  2F3I A;  1TWC H;  2R7D A;  3E9I A;  4HJ9 A;  3I4N H;  5GAE C;  2KBN A;  3G6E A;  4DV6 L;  1EFW A;  4BBS H;  4K0K Q;  2UXC L;  2Z0S A;  1PA6 A;  5C4X G;  1UE5 A;  2CKZ B;  2QEX A;  3CF5 A;  3PO2 H;  2A1A A;  4LF9 L;  4POG A;  4X65 L;  1YHB A;  5H1S E;  5GRO A;  2F4V Q;  3RZO H;  1OXX K;  4X64 L;  1G6P A;  1IYJ B;  4LFB L;  3GTG H;  3CP0 A;  4R1J A;  4KI0 A;  4A3K H;  3D31 A;  1VQI A;  2PQA A;  1UEB A;  1PV4 A;  2E8G A;  3GTK H;  3HOZ G;  1K73 C;  2Y0S E;  4K0K L;  4BY1 G;  2IX1 A;  1HR0 W;  4UY8 C;  1XJV A;  4QGU A;  4JOI C;  3TEH B;  4DAM A;  3UDG A;  1XPU A;  2R92 G;  2R7Z G;  1I6H H;  1C0A A;  1KQS A;  5IYD G;  1PHJ A;  1WI5 A;  1I50 H;  1IBM Q;  3PO3 H;  2YYZ A;  2UXB Q;  1P16 A;  3M4Q A;  3S24 A;  1VQF A;  3TQY A;  2F4V L;  4ME3 A;  2CFM A;  1LTL A;  2ATW A;  1TWA H;  2ZTC A;  3J81 c;  3E9H A;  4RMF A;  5M3M G;  4PZ7 A;  1L1O B;  1SRO A;  2C35 B;  3IRB A;  5JEA G;  5C0X G;  1R9T H;  1KIX A;  2UU9 Q;  1EUJ A;  4BBS G;  4JI0 Q;  4LF4 Q;  5JEA J;  3H3V I;  3HKZ G;  1Q1E A;  1YBY A;  1L1O C;  2WP8 J;  1MJE A;  3PO2 G;  3ZJY C;  3ERS X;  4DAY B;  4TQU S;  1UE7 A;  1J5E Q;  1O7I A;  3CCM A;  1EOV A;  2Z6K A;  2XTI A;  2EIF A;  1IBM L;  2A8V A;  2QGQ A;  2UXB L;  4DUZ Q;  4NPS A;  5IY0 A;  3S17 H;  2VZA A;  4DR4 Q;  3M85 A;  1Q12 A;  2GVA A;  2VL6 A;  4LW1 A;  3RR5 A;  1VQM A;  1PH7 A;  4GS3 A;  5IWA Q;  4GOP A;  3HOV G;  1IXR A;  4BBR H;  2KHI A;  3F2C A;  2JA8 H;  3K8A A;  4JI0 L;  4LF4 L;  1WOC A;  4IPG A;  4YWM A;  1A8V A;  4AIM A;  1TXY A;  4R4C A;  4JI8 Q;  4X62 Q;  4QJF A;  3UDX A;  4C2M H;  1VQL A;  1MKH A;  1J5E L;  1N33 L;  2ZM6 Q;  3PUX A;  4IJH A;  3UDF A;  4IOC A;  3CCJ A;  4X66 Q;  3CCR A;  4DUZ L;  1EWI A;  4GKJ Q;  1N32 Q;  4DR5 Q;  2UUB Q;  5LMN W;  4JI4 Q;  1G29 1;  1X54 A;  4B3T Q;  3UE0 A;  5EAY A;  3B6Y A;  4GLA C;  1TWG H;  4QY7 A;  3I56 A;  1RL2 A;  2JA9 A;  2HIV A;  2PNH A;  4P71 A;  5FJ8 G;  3CW2 C;  1IBK L;  1PH1 A;  1QUQ A;  1Y14 B;  3T1Y Q;  3NEL A;  4R4T A;  1W2B A;  2Q2I A;  2YU9 H;  3RLN A;  4A3J H;  1VQE A;  4JI8 L;  4X62 L;  4IOA A;  1KXL A;  2BH8 A;  3BZC A;  2ZM6 L;  3AFP A;  1B70 B;  3LGJ A;  2JJQ A;  3PUZ A;  2MO0 A;  4OON A;  3PV0 A;  4X66 L;  3CCQ A;  3H3V H;  4JOI A;  4JBM A;  4BY7 H;  2CWA A;  3FKI H;  2UUB L;  4JI4 L;  3CD6 A;  1N32 L;  2B63 H;  2KCM A;  4LWC A;  5IYC H;  5IYB H;  4B3T L;  1Y1V G;  2K5H A;  3S16 H;  2CCZ A;  5IE8 A;  4NXM L;  1YIJ A;  1VQO A;  4YY3 Q;  3I4M H;  3GD7 A;  1M1K C;  1IZ6 A;  4XIG S;  2YV5 A;  2ZTE A;  2PI2 A;  1LUZ A;  3F2B A;  1Z9F A;  1NTG A;  5FLM H;  3H0G H;  4PMW A;  4A76 A;  4A3G H;  1VQ8 A;  1HH2 P;  3KOJ A;  2IY5 B;  4KHZ A;  1ASZ A;  3PCO B;  4YWL A;  3RN2 A;  1XTD A;  4P74 A;  2IX0 A;  3HOU H;  4YCW A;  2E5L Q;  2Q2H A;  5LMU Q;  4GNX A;  1XPO A;  2WB1 E;  2E2H H;  4HIK A;  1E24 A;  4YY3 L;  4O2D A;  4HIM A;  5M5W H;  1X6O A;  3PSI A;  1PFS A;  4AQY Q;  1IL2 A;  1P8L A;  1NMF A;  4A3E G;  3FP9 A;  1Q81 C;  2CQO A;  4LF7 Q;  3I4O A;  1I3Q H;  1EIF A;  1HNZ Q;  4C3I H;  4X6A H;  1XNQ L;  1VQ5 A;  2YTX A;  1Q7Y C;  2B63 G;  4QQB X;  4LUZ A;  2ZJQ A;  4DR1 Q;  2E5L L;  4UP9 A;  2JK8 A;  1GKH A;  5LMU L;  3OYY A;  4XTC S;  3CCV A;  4NB3 A;  4JI7 Q;  3ULL A;  4L5S A;  5JJI A;  1CKM A;  4DR3 Q;  4AQY L;  3HOW H;  3K7A H;  3TRE A;  3M7N A;  4LF7 L;  4DR2 Q;  4MZ9 A;  4OO1 I;  2VY3 A;  4JI1 Q;  2XGT A;  2NVX H;  1HNZ L;  1SN8 A;  4A93 G;  3AYH B;  3KLW A;  4GN5 A;  4MNO A;  3J7Z C;  3T1H L;  2WAQ E;  4PZ8 A;  2AWN A;  2N78 A;  4R4I A;  2IHF A;  3E0E A;  2E2I H;  2RHS B;  1NY4 A;  3CCE A;  4BA1 I;  1X9N A;  2JEA I;  4DR1 L;  1S3O A;  1VQD A;  1WJJ A;  2D0O A;  4JCV E;  5IP9 G;  2IHE A;  1QZH A;  3UDI A;  4JI2 Q;  3CME A;  4LFA Q;  1VQK A;  1LYL A;  1YHQ A;  4LF5 Q;  3HOY H;  3TRZ A;  4YCU A;  5JJK A;  4DR3 L;  2VQF Q;  1OXS C;  1W3S A;  2MO1 A;  3ULJ A;  4JG2 A;  4JI1 L;  4A3D G;  1V1Q A;  1PVO A;  4KLK A;  4JBK A;  1PH8 A;  3GTO H;  1JE5 A;  3UE1 A;  3W1G A;  4A3C G;  3HOX G;  4DR6 Q;  2R93 H;  4RG1 A;  4GLX A;  4LFC Q;  1MIU A;  2A19 A;  2UUC Q;  4OX9 Q;  3BJU A;  2K50 A;  5DLQ E;  5C44 G;  4JI2 L;  1JJC B;  1CSP A;  4LF5 L;  4LFA L;  3I4N G;  1FL0 A;  2VNU D;  2ID0 A;  3F1Z A;  1WFQ A;  1CUK A;  2VQF L;  4DV0 Q;  5C0X J;  1UE1 A;  2CWP A;  1N36 Q;  4LUV A;  2LXK A;  1VQG A;  3A5Z B;  3L7Z C;  1NMG A;  3U58 A;  3M9B A;  2NVY H;  4A3L H;  4HJ7 A;  4YCV A;  3S2H H;  2KCT A;  2YTY A;  2JA6 H;  2R7F A;  4DR6 L;  1Z47 A;  2BH2 A;  4LFC L;  1L2F A;  5E7N A;  4A3K G;  4GKJ L;  1YEZ A;  1YVC A;  1JMC A;  4OXP A;  4OX9 L;  2GVB A;  1OXU A;  3KDF B;  3JAM i;  2UU9 L;  3RZD H;  2ZTD A;  1KD1 C;  1WCM H;  5IP7 H;  4DV0 L;  1YJN A;  1YJW A;  4EX5 A;  4LF8 Q;  4MTN A;  4DV1 Q;  1K8G A;  3KF6 A;  3PIP A;  3L0O A;  4A3M H;  1N36 L;  4BXX H;  3ULP A;  4L5Q A;  3U4V A;  3J80 c;  1VQN A;  5LMN Q;  3PO3 G;  1JT8 A;  1E3P A;  5M3F H;  2B3G A;  1KL9 A;  1V9P A;  3ER0 A;  1QZG A;  1Y1W H;  4JV5 Q;  2UXD Q;  4HJ5 A;  4A3I H;  2BA0 A;  3W1B A;  4DR4 L;  4A3F H;  4GKK Q;  1Q1B A;  4JI3 Q;  3WWV A;  1QVF A;  4KHP Q;  2D0P A;  3CQZ H;  5ELO A;  3J7A 5;  5IWA L;  3M3Y H;  4AYB G;  3HKZ E;  4DV5 Q;  5HGQ A;  2MNA A;  3PF4 A;  4JI6 Q;  3SGI A;  4IFD G;  4LF8 L;  4UP8 A;  3GTJ H;  3BZK A;  3RN5 A;  1YJ9 A;  3STB D;  3I2Z A;  3CC2 A;  5LMN L;  2WFW A;  1IBL Q;  1H95 A;  1VCI A;  5J3B A;  1YI2 A;  1CKO A;  3VDY A;  1X55 A;  3GTL H;  4DR5 L;  2VUM H;  2K14 A;  1SLJ A;  3A74 A;  3PIO A;  4JV5 L;  4DK3 C;  4KHP L;  4C3J H;  1HNW Q;  3PUV A;  4JI3 L;  4GKK L;  5C3E H;  1GVP A;  1PH2 A;  1OXV A;  4BBR G;  1XMO Q;  1D8L A;  4DV5 L;  1PH3 A;  2JA8 G;  2JA5 H;  2K52 A;  4C3H H;  1C7Y A;  1XMQ Q;  4JI6 L;  1K83 H;  3T1Y L;  1S72 A;  1VQC A;  3PUW A;  2I5H A;  2OTJ A;  2NZH A;  3DM3 A;  2B29 A;  1QVG A;  2JQO A;  1VQP A; 
#chains in the Genus database with same CATH topology
 4DV4 Q;  3H15 A;  1TQO A;  3Q8D A;  1IYU A;  1L1O A;  1KNA A;  4G7Z C;  1HNX Q;  1PYS B;  4A3B H;  2NN6 H;  1JJ2 A;  1XMQ L;  5HY6 A;  4HSV A;  4A3J G;  4KJO A;  3TS2 A;  2ZJP A;  4LNQ A;  1WTP A;  1NE3 A;  1PRT F;  4U68 A;  1SR3 A;  3EFX D;  4BY7 G;  4QIW E;  2B2W C;  2DY7 A;  3NSW A;  3S2D H;  3FKI G;  4DV2 Q;  2E2D C;  1SMY D;  1LT5 D;  2HHH Q;  2EYJ A;  3VR2 A;  1HNX L;  1LLR D;  3I4M G;  1GM5 A;  3S15 B;  3K5M A;  4I7Z C;  2L1B A;  4IUR A;  3KYH C;  3H0G G;  2Z6K C;  2LKV A;  5IOD A;  1J6Q A;  3HKS A;  4GOP B;  1SFO B;  4AH6 A;  3CPF A;  3I91 A;  1T5X D;  5CV8 A;  3LWU A;  2V4D A;  5IYD H;  1EIY B;  1DJR D;  1LV9 A;  1BKB A;  1ENA A;  3JC6 6;  3OMG A;  4L5T A;  3HOU G;  2HHH L;  1Q46 A;  1BVS A;  1I4R A;  1QNK A;  1Q86 C;  4JI7 L;  3H94 A;  1SMX A;  4DNI A;  1TS3 A;  2NVQ B;  1A63 A;  2KHJ A;  2CW0 C;  1S5F D;  1F9R A;  3DWP A;  5E4X A;  1HRJ A;  1M90 C;  2F0P A;  1EEI D;  4C3I G;  4FF2 A;  4ZKC B;  1CKN B;  4TVA B;  2HDL A;  4WJ3 M;  2AHO B;  4PZ6 A;  1KRT A;  2ALY B;  1H9K A;  2E2J H;  1DOK A;  4EGV A;  1SE3 A;  1ZYR D;  3M3Y B;  1C9O A;  2K5N A;  1WVL A;  2OT2 A;  2JA7 B;  2ZT9 C;  3IAY A;  2Q2U A;  2JXM B;  4DKA C;  1UNS A;  4QL5 A;  2N8N A;  3W5O A;  1LTS D;  2GN5 A;  2QF7 A;  4L8J A;  3I7F A;  3NQI A;  1SMY C;  1RJT A;  4OWW B;  4FYD A;  4NW2 A;  3DEO A;  5E1F A;  3PF5 A;  2SEB D;  3A55 A;  4KN4 C;  1TWF H;  2F0G A;  3MXN B;  3F2D A;  2HQE A;  2CH4 A;  1WTO A;  3A8J E;  4DPG A;  4CJ1 B;  3PUY A;  1VQ4 A;  2DY8 A;  3E6Z X;  1DZ1 A;  1VF5 C;  1N33 Q;  1KDA A;  1D1I A;  2NN6 I;  2NVT B;  1MHW C;  1KDC A;  1F9P A;  3E5S A;  1Y1V H;  4B3M Q;  3UI2 A;  2B8F A;  1MJC A;  2I0Q A;  1YNX A;  3A8K E;  2RBM A;  1GUS A;  4RGT A;  3J80 E;  4R4O A;  4V19 0;  2Q2T A;  4IFD J;  1O78 A;  3VYS A;  2N3S A;  1J9O A;  2ES2 A;  4OWT B;  1ZYR C;  4WJW A;  3NPP A;  3M4Y A;  1CK1 A;  1U4P A;  4B3M L;  4N9P A;  4IUV A;  3TS0 A;  1UWV A;  1OXT A;  1FNV A;  2WB1 G;  4A3E H;  5C5L A;  4JBJ A;  3Q24 A;  4A3D B;  4UP7 A;  1Y1W G;  1E1O A;  1PZI D;  4A3F G;  3L2P A;  5ELB A;  5IGF A;  4CJ2 C;  2F0L A;  1XPR A;  3D3R A;  4PMC A;  3NQT A;  3RLF A;  1T9H A;  5DNF A;  1PH5 A;  4A75 A;  1NAP A;  5IGE A;  3CMA A;  3I4N B;  1XXG A;  3IL8 A;  2WKC A;  3FHW A;  2A69 D;  1HFG A;  4Y52 H;  3NTH A;  3AFQ A;  2F1M A;  4A93 H;  1HQR D;  1IYV A;  4C3J G;  3CC7 A;  4ILW A;  2FMC A;  5GQO A;  2QDB A;  4A4I A;  5A2Q E;  2DGY A;  4H13 C;  2ZJR A;  5KGU A;  3GTQ H;  1XWE A;  2JEB I;  2F3V A;  2FIN B;  4DK6 C;  1EYD A;  1B7Y B;  2IPK D;  3HP3 A;  4F7X A;  3KJP A;  1D1K A;  2XRQ D;  1ZEQ X;  1KAW A;  5DM6 3;  1E1T A;  1A3V A;  3GTP H;  4X64 Q;  1VS0 A;  1EY8 A;  2K28 A;  4Y7N H;  1H9S A;  4IFD I;  2R7D A;  4XQQ A;  4AYB B;  4BBS H;  4K0K Q;  1ESR A;  1PA6 A;  5C4X G;  1X3P A;  2Z9H A;  3PO2 H;  2NTS A;  1GHK A;  3RZO H;  4X64 L;  3I73 A;  4KI0 A;  3E0J A;  3HOZ G;  1UEB A;  1ET6 A;  1MGS A;  2A68 D;  4K0K L;  2A69 C;  1SE2 A;  2XIW A;  1XPU A;  4IUT A;  1I50 H;  3H91 A;  1IBM Q;  2YYZ A;  1P16 A;  3M4Q A;  3TQY A;  3D8G A;  2JN4 A;  3E9H A;  1STE A;  4RMF A;  3DXJ C;  1L1O B;  2C35 B;  1SYE A;  3HG9 A;  4BBS G;  2Z8L A;  3C3L A;  4JI0 Q;  3H3V I;  3HKZ G;  3MXG A;  1Q1E A;  1YBY A;  2K5Q A;  2WP8 J;  4EVO A;  1PZK D;  3PO2 G;  4RH6 A;  1UE7 A;  1LTA D;  2Z6K A;  1IBM L;  1RTO A;  1QWY A;  2QGQ A;  4DUZ Q;  2FMM A;  1Q8I A;  4DR4 Q;  2DN8 A;  1Q12 A;  1VQM A;  5JJZ A;  4HMJ A;  3BDL A;  1WD0 A;  3K8A A;  4CBV A;  1ET9 A;  1WTV A;  4JI0 L;  4O1N A;  1WOC A;  3I72 A;  4YWM A;  4AIM A;  4X62 Q;  1S5C D;  4A93 B;  1JIC A;  1R4Q B;  1ESF A;  4IJH A;  4MHE A;  4IOC A;  4DUZ L;  4GKJ Q;  1NR4 A;  4DR5 Q;  1HA5 A;  5FK9 C;  2F0U A;  2KVM A;  3GTQ B;  4X3U A;  3I56 A;  2A68 C;  1EIG A;  4KKS A;  3NEL A;  3OHX C;  4OEM B;  2YU9 H;  4X62 L;  4IOA A;  4ZUI A;  1KXL A;  3BZC A;  1B70 B;  3CCQ A;  4GKJ L;  1V1P B;  3GTP B;  2O5I C;  3CD6 A;  5IYC H;  5IYB H;  4KKU A;  1CZG A;  2Q8R E;  1M1K C;  1IZ6 A;  2PI2 A;  2F0V A;  1NTG A;  2QEJ C;  1VQ8 A;  1Z7T A;  4XYO A;  3KOJ A;  1Y8O B;  2IY5 B;  1E0B A;  4F8M A;  1ASZ A;  1XTD A;  2E5L Q;  4QF4 A;  4O2D A;  1WTH A;  1HPC A;  1A15 A;  3NTI A;  4AQY Q;  5J22 A;  4IUP A;  2CQO A;  1I3Q H;  4EQN A;  1HNZ Q;  5CV6 A;  3DEP A;  1XNQ L;  2Z1C A;  1VQ5 A;  4XQJ A;  4QQB X;  2K01 A;  2R93 B;  2ZJQ A;  2E5L L;  4L5S A;  4R8I A;  1PRT D;  3J7A F;  3HOW H;  4AQY L;  5BN5 A;  3K7A H;  3TRE A;  1LT3 D;  4LMQ D;  1QIL A;  1JCK B;  1FGB D;  2NVX H;  1HNZ L;  1SN8 A;  3H6M A;  3J7Z C;  4H44 C;  4WRD A;  4R4I A;  2E2I H;  2JA6 B;  1DOL A;  1NY4 A;  1STB A;  1X9N A;  2JEA I;  4RFB A;  1S3O A;  2FJ2 A;  4JCV E;  5IP9 G;  2F3W A;  2IHE A;  3UDI A;  3CME A;  1QZH A;  4LFA Q;  1VQK A;  1YHQ A;  3HOY H;  3D6C A;  5JJK A;  2VQF Q;  5C4H A;  4JG2 A;  4A3M B;  3MFG A;  2KED A;  1PVO A;  1PH8 A;  3VYU A;  3QWN A;  3GTO H;  3SEB A;  1JE5 A;  3UE1 A;  3W1G A;  3PIP 3;  4RG1 A;  4LFC Q;  4JVZ A;  5COY A;  1RDP D;  3FMC A;  1EQV A;  2K50 A;  4QB4 A;  1EY9 A;  1CSP A;  2CQA A;  4LFA L;  1XX8 A;  4I65 A;  2ID0 A;  2VNU D;  1CZW A;  3I70 A;  1CUK A;  2VQF L;  3T53 B;  2N55 A;  1UE1 A;  5I2Y A;  2YU9 B;  2CWP A;  2EXZ A;  4LUV A;  1SYD A;  4R8N A;  4DGZ A;  1NMG A;  2NVY H;  1JE4 A;  4A3L H;  3GTL B;  4ZK9 B;  2BH2 A;  4LFC L;  1L2F A;  1TY2 A;  4A3K G;  4J1M A;  1YEZ A;  4OXP A;  2O2L D;  2GVB A;  1PRT C;  2UU9 L;  5CV5 A;  2WAQ B;  2JA5 B;  4C3H B;  3A56 A;  1WCM H;  1KD1 C;  1YJN A;  1YJW A;  4DV1 Q;  3PIP A;  4BXX H;  3L0O A;  1EZ6 A;  1VQN A;  3PO3 G;  5M3F H;  3ER0 A;  1HHV A;  4HJ5 A;  4A3I H;  2BA0 A;  3W1B A;  1GJX A;  3CQZ H;  3DMU A;  1FD7 D;  4OIK A;  3P7J A;  1MI2 A;  3G6J B;  4ULL A;  1I3Q B;  1YJ9 A;  2K7V A;  3I2Z A;  5G3L F;  1RTN A;  4O42 A;  4XQN A;  1YI2 A;  2VUM H;  1FNW A;  4K5V A;  1SSO A;  2HD3 A;  1HNW Q;  1F9Q A;  5C3E H;  4G57 A;  1GUO A;  1F2L A;  1GVP A;  3BVM A;  3NUC A;  3A7L A;  1PH3 A;  1B53 A;  3HOW B;  1K83 H;  3K7A B;  1VQC A;  2I5H A;  1LTT D;  3R2T A;  2NVX B;  3SVM A;  4GN4 B;  2EVB A;  3HEJ A;  5KND A;  1JJG A;  3CAM A;  2UUA Q;  3SR1 A;  3JAM c;  2A74 C;  3ERQ A;  5M3M B;  2R92 B;  2K5D A;  5K36 G;  1PH9 A;  4DAV A;  1JQY D;  2HIX A;  1PFB A;  4NXN Q;  1A0I A;  2ICI A;  2EXD A;  1EYG A;  4FNF A;  4Q5V A;  4NP5 A;  1EQR A;  2QKI C;  3DHQ A;  1KHI A;  2VUM G;  1F9S A;  4DA2 A;  4K6D A;  1QVC A;  4G4K A;  3I3C A;  3M4O B;  2UUA L;  1I94 Q;  1L0Y B;  1GXD C;  2F0H A;  5IT9 c;  2DJG C;  4C1N K;  1NSN S;  1FGU A;  5FLM G;  2M9V A;  4A3G G;  4NXN L;  2QA4 A;  4IUN A;  1FVI A;  1V8Q A;  1KRS A;  4LF9 Q;  4YHH Q;  1TII D;  2X69 A;  1DON A;  2OTL A;  4IPH A;  2AWO A;  1VQ6 A;  1NCV A;  3R3O A;  1HR0 Q;  1I94 L;  1EZ8 A;  5C0X H;  2D62 A;  5AFW A;  3N52 A;  3VR3 A;  1IHZ A;  1SND A;  3U4Z A;  3X3M A;  1D7Q A;  5M3F B;  2BDO A;  4HID A;  3CCS A;  4YHH L;  1G6Z A;  1SJH D;  3G4S A;  3TN2 A;  3S1Q B;  1HR0 L;  1AW7 A;  1K0R A;  3S15 H;  1MD2 D;  5EJW A;  2R6G A;  5D14 A;  1CT1 D;  2I5M X;  3A0J A;  1BBW A;  4R9W A;  4M1U B;  3S1N B;  1X3Q A;  2F0F A;  3NP8 A;  1SFO H;  3VYT A;  3KBX A;  1H9M A;  4FXK C;  4IN3 A;  5C3E B;  4FDB A;  4CDF C;  2ZXO A;  1YIT A;  3BYT B;  2NVQ H;  3MEF A;  5FJ8 H;  4B3S Q;  2JP1 A;  3AB9 A;  3C1F A;  4DAP A;  4IQZ A;  3A5U A;  3O13 A;  2RCF A;  4KK7 A;  1GUN A;  2NTT A;  3VYR A;  1DCZ A;  3MXP A;  4FF4 A;  4B3R Q;  1W6J A;  2JE6 I;  1X56 A;  1VQA A;  3I90 A;  2OQ0 A;  1EL0 A;  4ZCK A;  2JA7 H;  5BN4 A;  1IBK Q;  1TWH H;  3DWA A;  4B3S L;  2OQK A;  1HZ9 A;  1KC8 C;  1HZB A;  1AH9 A;  4OO1 G;  2KEN A;  3HRZ C;  2MUY A;  3F2U A;  4B3R L;  2LS0 1;  2RA4 A;  4BA2 I;  4APV A;  2RDF A;  1N8R C;  3OTO Q;  2M00 A;  4NXM Q;  4ODG A;  5IP7 G;  2L0C A;  2NZO A;  2AKW B;  4BY1 B;  2A5H A;  5I9O A;  3J81 j;  3U9O A;  3SK4 A;  5GAG C;  2RF4 A;  2C9O A;  5C0X I;  1A2T A;  2P5Z X;  2NVT H;  1K28 A;  1OO9 B;  2F0S A;  2K4K A;  2XVS A;  3S1R H;  1XMO L;  3OTO L;  2JA7 G;  2TSS A;  3PGZ A;  3ND9 A;  5D65 A;  1K3B C;  2KQ3 A;  1JB3 A;  3VR4 A;  2PMZ E;  4DV4 L;  5FLX c;  2K75 A;  3J7A V;  2DUD A;  4HCE A;  5JVH 3;  3JAM E;  1HZA A;  2XN9 C;  4H0L C;  3RLO A;  2F0Q A;  2HQL A;  1I6H B;  2YTV A;  4ZAI A;  1QB5 D;  3T13 A;  5DM7 3;  4A3D H;  1VQJ A;  4EQ5 A;  2A6H D;  4DV2 L;  3T1H Q;  3MHB A;  1EYC A;  1E2Z A;  5KNC A;  3HOX H;  3GDE A;  4LFB Q;  1XTC D;  4A3B G;  5IGD A;  2I07 B;  5IT9 E;  2NN6 G;  4ID6 A;  5C44 H;  1HUM A;  3I4N H;  2KBN A;  3G6E A;  2HCI A;  2DJF C;  4QUF A;  5EKI A;  4KMU C;  5EBC A;  2G9H D;  3D4W A;  2X6L A;  3QR8 A;  4POG A;  2QDL A;  5H1S E;  2N88 A;  5DAU A;  1SNM A;  3J80 L;  1B2T A;  4LFB L;  1VQI A;  2PQA A;  3GTK H;  1T5E A;  4BBR B;  2Y0S E;  1TWH B;  2L4N A;  1XJV A;  3TME A;  1G8Z D;  1HTL D;  1KQS A;  1TT2 A;  5IYD G;  1C0A A;  5JPM C;  3R8B A;  1CI3 M;  2EYO A;  5CR3 A;  4KY6 A;  3MVV A;  1VQF A;  4ME3 A;  1FNU A;  4KHV A;  2ATW A;  2F0D A;  2ZTC A;  3J81 c;  4HN7 A;  4KTA A;  3PQI A;  3T56 B;  1SRO A;  3C2P A;  1KIX A;  3X3N A;  2LY7 A;  4LF4 Q;  1H9J A;  4IFD H;  1IW7 D;  4XXE A;  5A35 A;  1A3T A;  2A6H C;  4TQU S;  2MHV A;  2PO4 A;  3I8Z A;  4KV6 A;  2XTI A;  1B44 D;  3GV3 A;  2WIN B;  4BY7 B;  3P75 A;  3CKI B;  3CRK C;  2B63 B;  1PH7 A;  3A8I E;  3S1R B;  2WV6 D;  1H9R A;  1E2W A;  4J6H A;  1IXR A;  3OMC A;  3I4M B;  4DFA A;  2KHI A;  4KD4 A;  2JA8 H;  1UUP A;  2EOT A;  2BOS A;  2PZU A;  5EGT A;  4LF4 L;  5A2Q L;  4IPG A;  1A8V A;  4QJF A;  4C2M H;  1N33 L;  3UDF A;  4RHS A;  3MZ5 A;  3CCR A;  1N32 Q;  3HOU B;  4XT3 B;  1G29 1;  1X54 A;  3UE0 A;  1LTB D;  4GLA C;  1RL2 A;  4P71 A;  5M5W B;  3T1Y Q;  2M2L A;  4OEL B;  1VQE A;  5ELF A;  4FP5 D;  4C3I B;  2F0M A;  2MO0 A;  3H3V H;  3PV0 A;  4JOI A;  3HZX A;  3AMU A;  2CWA A;  3HOX B;  1N32 L;  1Y1V G;  3S16 H;  5C44 B;  1VQO A;  1JWU D;  4XIG S;  5G3L D;  1LUZ A;  3Q22 A;  1IW7 C;  1HQM C;  2B2U A;  5NUC A;  1ICF B;  2AQ3 B;  4K2L A;  3TZD A;  3RN2 A;  2RSN A;  4QCL A;  2RSO A;  4ABN A;  2E76 C;  2LMC B;  1CTM A;  1JWM D;  1CM9 A;  3IKJ A;  3GTK B;  2E2H H;  1I4Q A;  3URY A;  1NMF A;  4A3E G;  3QIA A;  3K5L A;  1EIF A;  5FLX E;  1BDO A;  4X6A H;  5CV9 A;  3D6W A;  2KEE A;  2FHT A;  4RA8 A;  1CHP D;  2YTX A;  3KLS A;  1Q7Y C;  4LAA A;  4RKB A;  4UP9 A;  2RKS A;  2L55 A;  4NB3 A;  3FDT A;  2IWH A;  5JJI A;  3V96 A;  1CKM A;  4DR3 Q;  2EPB A;  3J81 L;  4DR2 Q;  4RCO A;  4RGO S;  1HTP A;  3TP7 A;  4A93 G;  1CA5 A;  2LFN A;  3AYH B;  4GN5 A;  4PZ8 A;  4CKC A;  2IHF A;  3TP5 A;  3WOF A;  2RHS B;  3NHH A;  5LL6 X;  2K05 A;  3CCE A;  2WAC A;  3V05 A;  5KYL A;  2B2Y A;  3RZD B;  1KDB A;  2JA8 B;  1AZP A;  1DXM A;  5CMD A;  4DR3 L;  1OXS C;  1I4H A;  2MO1 A;  1EQT A;  2IX3 A;  1EIH A;  1EU4 A;  2WB1 B;  4C2M B;  1V1Q A;  4K8I A;  2CHB D;  4KLK A;  3LX0 A;  1TY0 A;  3SK6 A;  1S5E D;  2R93 H;  1MIU A;  1X32 A;  4A3F B;  2UUC Q;  1JJC B;  2SNM A;  1LTI D;  1F2M A;  3W3A A;  1KAA A;  1WFQ A;  2PNR C;  1D2B A;  3GTJ B;  3L7Z C;  3M9B A;  4HJ7 A;  4YCV A;  2KCT A;  4C1N I;  1PRT B;  2JA6 H;  1LT6 D;  5E7N A;  4C3J B;  3J81 E;  3S16 B;  1HXY D;  3E3X A;  4G7H C;  3JAM i;  4WFN 3;  2ZTD A;  1EWC A;  3PIO 3;  3MEH A;  4A3M H;  3ULP A;  2EJG C;  3U4V A;  1JT8 A;  4CGY B;  2J0T D;  2MGS A;  2B3G A;  2AQ1 B;  1V9P A;  4IUU A;  2UXD Q;  4DR4 L;  3U9S A;  3WWV A;  3S9W A;  1QVF A;  2D0P A;  3J7A 5;  2E2H B;  1EY7 A;  5FO9 B;  2F0K A;  4FF3 A;  5HGQ A;  2MNA A;  2EYL A;  1B4O A;  2KCC A;  3EQL C;  3FPP A;  3RN5 A;  5COR A;  3KUP A;  3CC2 A;  5LL6 S;  2WFW A;  1IBL Q;  5C4X B;  1VCI A;  5J3B A;  1CKO A;  1X55 A;  3GTL H;  1M8A A;  4DR5 L;  1SLJ A;  3PIO A;  2UXD L;  3ERO A;  3MC0 B;  1OXV A;  1STG A;  2JA5 H;  4C3H H;  3HOZ B;  1VMC A;  1S5D D;  3PUW A;  2NZH A;  3DM3 A;  2BCO A;  3K0X A;  4GLV B;  5C4J H;  1XNR Q;  4JC0 A;  1IBL L;  1BBU A;  4LJZ C;  2V1C C;  3G7L A;  4DR7 Q;  2BA1 A;  4R4Q A;  4EQO A;  3KLS X;  4ALP A;  1B50 A;  5C3W A;  5ELD A;  1JB7 A;  1TKW B;  4ZLT F;  3K80 C;  1EEF D;  1FJG Q;  2XSC A;  4KD3 A;  3R93 A;  3G48 A;  1ICW A;  3HKZ B;  2EY5 A;  4ZKB B;  1XNR L;  2B8G A;  2NZ1 D;  2Z4H A;  4DR7 L;  3TSS A;  2EJF C;  5IYB G;  5IYC G;  3S14 H;  1KAB A;  5I9P A;  1B3A A;  5JAV A;  4C56 C;  2JA5 G;  3QB3 A;  1IKM A;  4IPD A;  3GP7 A;  1RCV D;  1K8A C;  5GAH C;  1U5K A;  2K33 A;  4IJL A;  1LTR D;  1FJG L;  3RMH A;  1TR5 A;  5T1I A;  1G2T A;  5M5X H;  3J80 i;  1RIP A;  2Y0S G;  3EN2 A;  4P75 A;  3K57 A;  4CHT B;  2LXJ A;  5KIX A;  3RNU A;  1FR3 A;  1BBX C;  2RHQ B;  3MXU A;  5M3M H;  5JEA H;  2R92 H;  3OOC A;  4HJ8 A;  4POF A;  1SBB B;  1Z6H A;  3U50 C;  3CXC A;  3ND8 A;  5IGC A;  1X65 A;  4JI5 Q;  4LUO A;  2CH4 W;  2NBF A;  4JW0 A;  3M4O H;  4OWX B;  2EE1 A;  1WTX A;  4K6L A;  1K0S A;  5GAD C;  3HOV H;  3HOW G;  3NXW A;  1PTO F;  1NJI C;  4UAI A;  2EDG A;  2D2C C;  1WTQ A;  4GZY C;  4N8X 1;  3CCL A;  3G71 A;  4JI5 L;  4BWG B;  3D0F A;  1YZ6 A;  5EKL A;  1PLF A;  1BCP D;  3HOY G;  2K5W A;  2SOB A;  1Y69 U;  4CKB A;  5BR8 Q;  2F03 A;  2RCN A;  2F0W A;  2RQX A;  2IJ0 A;  4HMI A;  1ONL A;  1PYB A;  1O7L A;  1CFM A;  2IL8 A;  5C4J B;  2N49 A;  2PPB C;  1V43 A;  2VS1 A;  1D5X C;  1E7Z A;  2VB2 X;  4GNX C;  1HA6 A;  3CCU A;  2X6G A;  2SDF A;  3S1Q H;  1L0W A;  1AE2 A;  1K8M A;  2K1B A;  4DUY Q;  2F0E A;  3GTM B;  5BR8 L;  5BN3 A;  1K9M C;  3TDQ A;  3S1N H;  1H9S B;  4DV1 L;  1VQ9 A;  2LSS A;  4A3L G;  2F0T A;  1A6X A;  1ILP A;  3EVQ A;  1SYC A;  2A73 B;  2E75 C;  3S14 B;  4B08 A;  1W6K A;  1G51 A;  3SK5 A;  2F52 A;  1Q82 C;  1HCZ A;  1HJP A;  4DUY L;  1WCM G;  5IGG A;  2EZV A;  1B8A A;  4ME5 A;  2K5V A;  1UE6 A;  1CKN A;  4BXX G;  5M5Y B;  5M5X B;  2JSO A;  1PH4 A;  3DLL A;  2R7Z B;  5M3F G;  2F0I A;  3GQB A;  3EIV A;  2VB3 X;  2CVR A;  4AYB E;  3PMF A;  4A3I G;  1X3F A;  3L9A X;  3M7G A;  4DV3 Q;  1BCP C;  1HNW L;  2ASB A;  4IUQ A;  3QJY A;  4FXD A;  4DV7 Q;  4RGM A;  2IT1 A;  4JYA Q;  2AUK A;  5CV4 A;  2KUM A;  1S40 A;  1EFI D;  3KDF A;  4DV3 L;  3ICE A;  5C3E G;  4MIU A;  1VQB A;  3BU2 A;  3J81 i;  1ZKO A;  4A3K B;  4U67 3;  3I4L A;  1AE3 A;  3K0Y A;  2MP1 A;  2EY6 A;  2HCC A;  4DV7 L;  4S3S A;  1D5M C;  3HOV B;  2SNS A;  2ZXP A;  4JYA L;  4BY1 H;  1BNZ A;  3N6R A;  3EBE A;  1AP0 A;  1ROD A;  4HIO A;  1QOH A;  4FVM A;  1M4V A;  4A3C H;  2EQS A;  3GO5 A;  1PYW D;  3KBG A;  3E9I A;  1TWC H;  4HJ9 A;  2WII B;  1EFW A;  1UE5 A;  2CKZ B;  2QEX A;  2A1A A;  4LF9 L;  1TS4 A;  1CA6 A;  1YHB A;  3OWE B;  1OXX K;  3P20 A;  1G6P A;  3S17 B;  1IYJ B;  4R1J A;  2E8G A;  4HTH A;  3J7Y W;  4BY1 G;  2IX1 A;  4ZQ3 A;  4JOI C;  5CC4 A;  1I6H H;  1NR2 A;  2AUJ D;  1PHJ A;  2HUG A;  4PV1 C;  2UXB Q;  3S24 A;  3OW7 A;  3W2D A;  1MBY A;  2CFM A;  1LTL A;  2B2U C;  5C0X G;  2FFK B;  5D3D A;  3GV6 A;  4I7A A;  1NNX A;  1DD2 A;  3BDO A;  3KF8 A;  4Z9C B;  4OHJ A;  1MJE A;  3ERS X;  1J5E Q;  1JOO A;  3CCM A;  2EIF A;  2UXB L;  1HUN A;  2G9D A;  2NB0 A;  5I6W A;  4NPS A;  5EBD A;  2VZA A;  3M85 A;  4LW1 A;  2VL6 A;  3RR5 A;  5FO8 B;  5IWA Q;  4BBR H;  3T16 A;  3F2C A;  1RHP A;  3MTS A;  4A3G B;  3JAM L;  1TXY A;  4R4C A;  4JI8 Q;  3UDX A;  1VQL A;  4KKT A;  1J5E L;  1D6E C;  4FF1 A;  2ZM6 Q;  3PUX A;  4RWS C;  4X66 Q;  3K59 A;  1EWI A;  2JYO A;  4NDX A;  2F0J A;  4N9T A;  3B6Y A;  4QY7 A;  3OWF A;  1B3Q A;  5FJ8 G;  2HIV A;  2PNH A;  1IBK L;  3CW2 C;  1PH1 A;  1QUQ A;  1Y14 B;  3ZYY X;  1W2B A;  1ML0 D;  3RLN A;  4A3J H;  5IT9 L;  2O5J C;  4JI8 L;  3TP6 A;  5M9O A;  2ZM6 L;  2AQ2 B;  2B2Y C;  3AFP A;  3FPU B;  3LGJ A;  3NBH A;  2JJQ A;  2L12 A;  5C5M A;  4X66 L;  1QNU A;  4BY7 H;  3FKI H;  2B63 H;  2KCM A;  2D9U A;  2PW5 A;  4DK0 A;  4TSS A;  2CCZ A;  5IE8 A;  4NXM L;  1TWC B;  4YY3 Q;  3RUZ A;  2NYZ D;  3GD7 A;  3I4M H;  2YV5 A;  1I6V C;  4PNY A;  2K03 A;  3H0G H;  4PMW A;  4A76 A;  5KEE A;  3OIP A;  1KLU D;  1PTO B;  2C5C A;  2F4I A;  4KHZ A;  1EYA A;  4YWL A;  1A2U A;  2B39 A;  3OSO A;  2IX0 A;  3HOU H;  1SYB A;  4M8A A;  4YCW A;  2Q2H A;  5LMU Q;  4GNX A;  1XPO A;  2B2V C;  4HIK A;  4YY3 L;  5C6A A;  5M5W H;  3PSI A;  1PFS A;  1PXU A;  1IL2 A;  1LAC A;  2K6A A;  1STY A;  5IIF A;  2J7Z A;  4C3I H;  1YNJ C;  4V0B A;  4NKL A;  2B63 G;  4DR1 Q;  1TS2 A;  2JK8 A;  5LMU L;  1C48 A;  1TU2 B;  3FEW X;  4JI7 Q;  3ULL A;  3VA5 A;  1VF7 A;  4CJ0 B;  3QOJ A;  3TP8 A;  5E4W C;  4OO1 I;  2VY3 A;  4JI1 Q;  2L5T A;  2PYK A;  1IKL A;  3T1H L;  2WAQ E;  2N78 A;  3E0E A;  4L63 B;  2IW3 A;  4BA1 I;  1EY5 A;  2NUC A;  4DR1 L;  1ENC A;  1EWH A;  1VQD A;  4OGQ C;  4LF5 Q;  1PMR A;  1G91 A;  1LYL A;  4KY5 A;  4YCU A;  1BCP F;  3KLR A;  4XT1 B;  2ICE C;  1GOZ A;  4K2K A;  4F87 A;  4JI1 L;  1V1P A;  4A3D G;  1Y8N B;  4JBK A;  5E3F A;  2XWJ B;  3QOL A;  3HOX G;  1E2V A;  2B2T C;  2MPM A;  2NWG A;  5C4Z A;  1B9N A;  3A7A B;  4OX9 Q;  5C44 G;  4LF5 L;  3I4N G;  1U4L A;  1FL0 A;  4QMG A;  1GHJ A;  4DV0 Q;  3D4R A;  3V2T A;  4A3J B;  2XNA C;  3A5Z B;  3S2H H;  4NMZ A;  4B9X A;  3A54 A;  3FKI B;  4MN3 A;  1GUT A;  3IFD A;  4KY7 A;  3FVQ A;  1PTO D;  5FO7 B;  4OX9 L;  4CDC C;  1OXU A;  3KDF B;  5ELE A;  3RZD H;  4WOR A;  2QW7 A;  3WDN A;  1I4G A;  4DV0 L;  5C3X A;  4RKL A;  4EX5 A;  4LF8 Q;  3H0G B;  4MTN A;  1K8G A;  3KF6 A;  1SYG A;  4L5Q A;  1KL9 A;  5HGT A;  2DNC A;  1NUC A;  1QZG A;  1U4M A;  2J4X A;  1Y1W H;  1STN A;  4A3F H;  4GKK Q;  2VXW A;  4JI3 Q;  1O80 A;  5ELO A;  4UDU C;  4JPB W;  5FLX L;  1RF2 D;  4N8F A;  4AYB G;  4CDD C;  4A3B B;  4DV5 Q;  5FOB B;  1TVX A;  3PF4 A;  1G2S A;  3SGI A;  4IFD G;  4LF8 L;  3GTJ H;  3BZK A;  3STB D;  3H09 A;  3EJI A;  2PCF B;  4ZUJ A;  3S2D B;  3KK7 A;  3DM1 A;  5EPJ A;  5T1G A;  4C3J H;  3PUV A;  4JI3 L;  4GKK L;  1SNO A;  1Q3L A;  2E74 C;  2RVL A;  1D8L A;  4DV5 L;  2JA8 G;  1F2Z A;  2K52 A;  1C7Y A;  3T1Y L;  1S72 A;  2EJM A;  2JQO A;  4TKO B;  1F77 A;  1I5F A;  1SDF A;  5EQ0 A;  3C1E A;  1JR0 D;  2F0O A;  5JJL A;  1PTO C;  2HT1 A;  3ONA B;  1SE8 A;  4DAY A;  4UHV A;  3MAQ A;  2I5L X;  4JBW A;  5KYI A;  4OIJ A;  3CRL C;  1LM0 A;  4ZRZ A;  5C4X H;  3KF8 B;  4G7O C;  2E2J B;  5DEH A;  1SYF A;  5IOC A;  2OCE A;  1UAP A;  4DK1 A;  2PI2 E;  4X3T A;  1DOM A;  2L11 A;  3D4D A;  3HOZ H;  4CKE A;  1VQ7 A;  3STB C;  3NE5 B;  3S2H B;  1CQF A;  3M4P A;  4GOP C;  5J1Z A;  1A62 A;  1N9W A;  1STA A;  4DXG A;  1PZJ D;  1TWF B;  4UPA A;  3NEM A;  5I6Y A;  2FXQ A;  3F8T A;  4DR2 L;  4J15 A;  1SE4 A;  1GO3 E;  1WTW A;  4B9W A;  2Z6B A;  2EYF A;  4KN7 C;  1X3G A;  1QUQ B;  3HGB A;  4TRD A;  1Y1W B;  1SNC A;  1SRU A;  1EQQ A;  3AEV A;  3NBH B;  4K5X A;  4PG3 A;  3C46 A;  1Q8K A;  1Y1V B;  1LTG D;  1EOT A;  3CU7 A;  5AJ3 Q;  2H1E A;  1BXT A;  2DNE A;  3OIQ A;  3BS1 A;  4WJ4 A;  1KLG D;  2B2V A;  3K7U C;  3MWY W;  5JOB A;  2MQH A;  3T4A C;  1N34 Q;  2D5D A;  1DGS A;  1PH6 A;  2KHS A;  1MSH A;  4L6T B;  1E22 A;  1D5Z C;  2UUC L;  1CHQ D;  2L15 A;  1B9M A;  1ZXT A;  2B2W A;  5EKK A;  1ASY A;  1X3E A;  4IPC A;  5AJ3 L;  3OW2 A;  3BG3 A;  1TS5 A;  3WOE A;  4HCS A;  1HZC A;  4YWK A;  4GNX B;  1WYD A;  2TMP A;  3AQQ A;  1UEA B;  4A3E B;  2I46 A;  1OTC A;  5IGB A;  1N34 L;  3K81 C;  2R93 G;  2KA7 A;  5ELN A;  2H5X A;  4P73 A;  5LHY 1;  4HSP A;  1AN8 A;  3KJO A;  1Q90 A;  3K5N A;  3VA7 A;  1AFP A;  2VW9 A;  1YHA A;  1QE6 A;  2ENB A;  3LNN A;  4IZ8 A;  5TSS A;  4LF6 Q;  2JA6 G;  4P72 A;  1C8C A;  3CC4 A;  3KFU A;  2QIL A;  2VQE Q;  3HFZ B;  1O7Y A;  1SEB D;  4HJA A;  4L5R C;  2B2T A;  3NEN A;  1GD7 A;  3CPW A;  1JC7 A;  1JOR A;  2AMC B;  2EYH A;  2PQA B;  4A3M G;  1BCP B;  1NBW A;  1SJE D;  4LF6 L;  3P1H A;  4H02 A;  4O0A A;  3S1M H;  2EY2 A;  2VQE L;  1LO5 D;  4Y7N B;  4X3K A;  3GTM H;  4BBS B;  1PFM A;  2Q8T A;  2G5D A;  3SE0 A;  3OPO A;  3PO2 B;  4IO9 A;  2OWO A;  2QCP X;  1XNQ Q;  3RZO B;  1HFN A;  1VQH A;  1GUW A;  2WAQ G;  1QG7 A;  4C3H G;  5IP9 H;  5JVG 3;  3T51 B;  4DV6 Q;  2UXC Q;  2Q8I B;  1U0L A;  5M5Y H;  2MFI A;  1SNQ A;  2KCN A;  4ZYS A;  2R7Z H;  3I55 A;  1QJO A;  3NWS A;  1SXT A;  1I50 B;  1K3R A;  4X65 Q;  4GN3 B;  5CBE E;  3KF6 B;  1CSQ A;  5ELC A;  2F3I A;  3DWQ A;  3LWE A;  5GAE C;  4DV6 L;  2UXC L;  4CDE C;  2PW7 A;  2Z0S A;  1SAP A;  4H7B A;  4YIJ A;  2F0N A;  1BQQ T;  3CF5 A;  4FO2 A;  2EYP A;  4X65 L;  3Q0A A;  1SNP A;  5GRO A;  2F4V Q;  2OXP A;  3NTK A;  2O4X A;  1I4P A;  1U4R A;  3GTG H;  3CP0 A;  2PMZ B;  4A3K H;  4DXF A;  3D31 A;  4QIW B;  1PV4 A;  3HS0 C;  1K73 C;  4FXG C;  1JOQ A;  1HR0 W;  4UY8 C;  2Z4I A;  1C4Q A;  1BUV T;  3TEH B;  4DAM A;  5KRU A;  4QGU A;  3UDG A;  2R7Z G;  1STH A;  1XYI A;  1WI5 A;  3PO3 H;  4LK1 C;  1RD9 D;  3MFY A;  1I4X A;  2F4V L;  1K8O A;  1TWA H;  1YNN D;  1JWS D;  2OF1 A;  5M3M G;  4PZ7 A;  3IRB A;  5JEA G;  2R92 G;  2UU9 Q;  1R9T H;  1PFN A;  1EUJ A;  4JK1 C;  5JEA J;  5D3I B;  1L1O C;  4DF7 A;  4RGN A;  3ZJY C;  4DAY B;  2GA4 B;  1R4P B;  1O7I A;  4J8Q A;  1EOV A;  2A8V A;  3S1M B;  2L9H A;  5CV7 A;  5JPN C;  2PZW A;  3DUZ A;  2XRS D;  3CHB D;  4DNR B;  1QCB D;  5IY0 A;  3S17 H;  2GVA A;  4GS3 A;  2K32 A;  4GOP A;  3HOV G;  3H3V C;  3TZU A;  1S4Z A;  4BS9 A;  2BE5 D;  3RD4 A;  5I4D A;  1MKH A;  3BVG A;  4HED A;  2HDM A;  2Y0S B;  3CCJ A;  1AEX A;  4QUC A;  3L3O C;  4HAE A;  2UUB Q;  5LMN W;  4JI4 Q;  4B3T Q;  5EAY A;  1TWG H;  3ITP A;  2JA9 A;  5EPL A;  1J8I A;  1O7Z A;  1LAB A;  5K36 H;  2A6E D;  4MTK A;  4R4T A;  4RHR A;  3Q23 A;  3BYY B;  2Q2I A;  1IL8 A;  3BZD B;  1L0X B;  2BH8 A;  3IFT A;  1BOS A;  5I2X A;  3PUZ A;  4OON A;  1DYQ A;  4JBM A;  1YNN C;  2UUB L;  4JI4 L;  4LWC A;  4X3S A;  4B3T L;  4F88 A;  2K5H A;  1YIJ A;  2ZTE A;  3F2B A;  1Z9F A;  5FLM H;  4A3G H;  5CBA E;  3QO2 A;  1HH2 P;  3AU7 A;  1GUG A;  3SXH A;  5K5P A;  5FKA C;  3PCO B;  2E2I B;  3K6O A;  3MXN A;  4KJN A;  1ILQ A;  4P74 A;  3GTG B;  2K04 A;  5EPK A;  2WB1 E;  2XWB B;  4EQP A;  1E24 A;  3HOY B;  4RAU C;  4HIM A;  1EY0 A;  1X6O A;  3NWT A;  5F2D A;  2BE5 C;  1P8L A;  2ZXR A;  3SDZ A;  3FP9 A;  3QG1 A;  2R3Z A;  1Q81 C;  4LF7 Q;  3I4O A;  1BO0 A;  1MSG A;  3TBI B;  1EU3 A;  3PO3 B;  3GTO B;  4XDX A;  1U9R A;  1BR9 A;  4LUZ A;  1TWA B;  1GKH A;  4XYQ A;  2PQE A;  3OYY A;  4XTC S;  4OL7 A;  4PQX A;  3CCV A;  1R9T B;  2WKD A;  5KNB A;  2A6E C;  3M7N A;  3FRP B;  4LF7 L;  4MZ9 A;  2XGT A;  1PTO H;  2KOL A;  3KLW A;  2NVY B;  3Q6S A;  4MNO A;  3R2I A;  2AWN A;  4DNT B;  1CQV A;  1VMP A;  1EY6 A;  4DN4 M;  1S5B D;  5HUR A;  1WJJ A;  2D0O A;  1AZQ A;  1II3 A;  3TRZ A;  4JI2 Q;  3SHL A;  3EA6 A;  5L37 A;  1WCM B;  1W3S A;  3ULJ A;  5CYU A;  2H4O A;  1Y8P B;  4A3C G;  4DR6 Q;  3VR6 A;  4A3I B;  4GLX A;  2EY1 A;  2A19 A;  3NBI A;  1TWG B;  3CQZ B;  3BJU A;  5DLQ E;  1BF4 A;  1VDZ A;  4JI2 L;  3MA2 B;  3F1Z A;  2RDG A;  1B1Z A;  3NK9 A;  5C0X J;  3SK8 A;  1EY4 A;  1F2Y A;  4E6I A;  1FYC A;  1N36 Q;  2LXK A;  1VQG A;  3U58 A;  2YTY A;  2BDN A;  1KNE A;  4OO1 H;  2R7F A;  2VUM B;  4DR6 L;  1Z47 A;  4K14 A;  1YVC A;  1JMC A;  1WTR A;  4IAL A;  1LT4 D;  1RKN A;  5IP7 H;  3K58 A;  1K83 B;  1V1O A;  1N36 L;  1ENF A;  3J80 c;  5CGK A;  5ISR A;  5LMN Q;  1E3P A;  2OEO A;  1YNJ D;  4K5W A;  4DU9 A;  3BDC A;  4JV5 Q;  2RDH A;  4KHP Q;  1Q1B A;  4K8J A;  4P2C B;  4Q0F A;  5IWA L;  3M3Y H;  3HKZ E;  2MJ8 A;  4JI6 Q;  3BVZ A;  4PMB A;  1PDQ A;  1DM0 B;  2EYM A;  4UP8 A;  1WD1 A;  5LMN L;  4HR7 B;  1H95 A;  2R61 A;  1A3U A;  3VDY A;  2K14 A;  3A74 A;  4JV5 L;  2KEC A;  4DK3 C;  4KHP L;  2KJX A;  1PH2 A;  5J39 A;  4BBR G;  1XMO Q;  3K5O A;  3VR5 A;  1XMQ Q;  4JI6 L;  2PZT A;  4RCN A;  2OTJ A;  1JOK A;  2B29 A;  2CW0 D;  1KTK A;  1QVG A;  1VQP A; 
#chains in the Genus database with same CATH homology
 3K0X A;  4GLV B;  1I5F A;  5C4J H;  1XNR Q;  4GN4 B;  4JC0 A;  1IBL L;  1BBU A;  4DV4 Q;  3H15 A;  2V1C C;  3Q8D A;  4DR7 Q;  1JJG A;  1L1O A;  2BA1 A;  4R4Q A;  5JJL A;  2HT1 A;  3CAM A;  1SE8 A;  2UUA Q;  4ALP A;  1HNX Q;  1PYS B;  4A3B H;  3JAM c;  1JB7 A;  1JJ2 A;  1XMQ L;  5K36 G;  1PH9 A;  3K80 C;  5HY6 A;  4A3J G;  1FJG Q;  2HIX A;  3TS2 A;  4NXN Q;  1A0I A;  2ZJP A;  3G48 A;  4LNQ A;  1NE3 A;  2I5L X;  2EXD A;  1EYG A;  1SR3 A;  4JBW A;  1XNR L;  5C4X H;  1EQR A;  1LM0 A;  4BY7 G;  4QIW E;  4DR7 L;  1KHI A;  3KF8 B;  3FKI G;  2VUM G;  4DV2 Q;  3S2D H;  1QVC A;  5IYC G;  5IYB G;  2HHH Q;  3S14 H;  2UUA L;  1I94 Q;  2OCE A;  1HNX L;  3I4M G;  1GM5 A;  5IT9 c;  2JA5 G;  2PI2 E;  4IPD A;  3HOZ H;  1FGU A;  1K8A C;  5FLM G;  5GAH C;  1U5K A;  3H0G G;  2Z6K C;  3KYH C;  4IJL A;  1VQ7 A;  3STB C;  1FJG L;  4A3G G;  1J6Q A;  3HKS A;  4NXN L;  2QA4 A;  4GOP B;  5M5X H;  4AH6 A;  3CPF A;  3J80 i;  1RIP A;  1FVI A;  2Y0S G;  3EN2 A;  4P75 A;  1KRS A;  5IYD H;  1EIY B;  4LF9 Q;  3M4P A;  4YHH Q;  1BKB A;  3JC6 6;  4L5T A;  2LXJ A;  4GOP C;  3RNU A;  2OTL A;  3HOU G;  1A62 A;  2HHH L;  1N9W A;  4IPH A;  1Q46 A;  1BVS A;  2AWO A;  1VQ6 A;  2RHQ B;  1Q86 C;  1HR0 Q;  1I94 L;  4JI7 L;  1SMX A;  4DNI A;  4UPA A;  5M3M H;  2R92 H;  2KHJ A;  1A63 A;  3NEM A;  2D62 A;  2FXQ A;  3F8T A;  4DR2 L;  4J15 A;  4HJ8 A;  4POF A;  1M90 C;  1GO3 E;  3U4Z A;  1D7Q A;  1CKN B;  3U50 C;  3CXC A;  1X3G A;  1QUQ B;  4TVA B;  4WJ3 M;  4HID A;  1X65 A;  2AHO B;  4PZ6 A;  4YHH L;  3CCS A;  4JI5 Q;  1SRU A;  2ALY B;  4LUO A;  1KRT A;  1EQQ A;  3G4S A;  3AEV A;  2E2J H;  3M4O H;  2UXD L;  3NBH B;  4PG3 A;  4OWX B;  1HR0 L;  1Q8K A;  1K0R A;  1C9O A;  3S15 H;  2K5N A;  5AJ3 Q;  2R6G A;  2I5M X;  5GAD C;  3HOV H;  3HOW G;  3A0J A;  1BBW A;  2Q2U A;  4DKA C;  1NJI C;  4WJ4 A;  4QL5 A;  2N8N A;  3W5O A;  1SFO H;  2GN5 A;  3K7U C;  2MQH A;  3I7F A;  1N34 Q;  3CCL A;  3G71 A;  4JI5 L;  4OWW B;  1DGS A;  1PH6 A;  3D0F A;  1E22 A;  1YZ6 A;  2UUC L;  4FDB A;  3PF5 A;  3HOY G;  1TWF H;  2L15 A;  3MXN B;  3F2D A;  1ASY A;  1X3E A;  4IPC A;  5BR8 Q;  5AJ3 L;  3OW2 A;  2RCN A;  1YIT A;  2NVQ H;  3MEF A;  5FJ8 H;  1HZC A;  4B3S Q;  4DPG A;  4YWK A;  4GNX B;  1PYB A;  1WYD A;  3AQQ A;  3PUY A;  2N49 A;  1VQ4 A;  1OTC A;  1V43 A;  3A5U A;  2VS1 A;  1N33 Q;  1N34 L;  1E7Z A;  4GNX C;  3K81 C;  2R93 G;  2NN6 I;  4B3R Q;  2JE6 I;  5ELN A;  3CCU A;  1X56 A;  2H5X A;  1VQA A;  2OQ0 A;  4P73 A;  1L0W A;  1AE2 A;  3S1Q H;  1Y1V H;  4DUY Q;  4B3M Q;  2JA7 H;  5BR8 L;  3KJO A;  1K9M C;  1IBK Q;  1MJC A;  1TWH H;  3S1N H;  4DV1 L;  4B3S L;  2I0Q A;  1YNX A;  2OQK A;  1YHA A;  2VW9 A;  1HZ9 A;  1VQ9 A;  4R4O A;  2LSS A;  1KC8 C;  1HZB A;  2Q2T A;  4LF6 Q;  4A3L G;  4IFD J;  1AH9 A;  2N3S A;  2JA6 G;  4OO1 G;  2KEN A;  4P72 A;  2ES2 A;  3CC4 A;  4OWT B;  4B3R L;  3KFU A;  1G51 A;  4BA2 I;  4APV A;  2VQE Q;  2F52 A;  1Q82 C;  3HFZ B;  1HJP A;  1N8R C;  3OTO Q;  1WCM G;  4DUY L;  4HJA A;  4B3M L;  1B8A A;  1GD7 A;  3NEN A;  5IP7 G;  3CPW A;  4L5R C;  2K5V A;  4NXM Q;  2NZO A;  3TS0 A;  1UWV A;  1UE6 A;  1CKN A;  1OXT A;  2AKW B;  2AMC B;  2PQA B;  4BXX G;  4A3M G;  2WB1 G;  3J81 j;  4A3E H;  1PH4 A;  1NBW A;  3DLL A;  4LF6 L;  5M3F G;  4JBJ A;  4H02 A;  5GAG C;  3EIV A;  4UP7 A;  1Y1W G;  1E1O A;  4O0A A;  4AYB E;  3S1M H;  2RF4 A;  1X3F A;  4DV3 Q;  4A3I G;  4A3F G;  5C0X I;  3L2P A;  1HNW L;  2NVT H;  2ASB A;  2VQE L;  1XPR A;  1XMO L;  2K4K A;  3S1R H;  3OTO L;  3RLF A;  2JA7 G;  1T9H A;  4DV7 Q;  1PH5 A;  3PGZ A;  3GTM H;  4A75 A;  3CMA A;  2IT1 A;  4JYA Q;  3FHW A;  4Y52 H;  2PMZ E;  4DV4 L;  1S40 A;  3AFQ A;  5FLX c;  4A93 H;  2K75 A;  4IO9 A;  3KDF A;  2OWO A;  4DV3 L;  3ICE A;  3CC7 A;  1XNQ Q;  5C3E G;  5GQO A;  1VQB A;  2DUD A;  4A4I A;  3BU2 A;  3J81 i;  1VQH A;  2DGY A;  2WAQ G;  2ZJR A;  1AE3 A;  3GTQ H;  1HZA A;  2JEB I;  5IP9 H;  4DV7 L;  4DK6 C;  4DV6 Q;  2UXC Q;  4JYA L;  1U0L A;  5M5Y H;  4BY1 H;  3RLO A;  2MFI A;  1B7Y B;  2HQL A;  2YTV A;  3EBE A;  2R7Z H;  3I55 A;  4A3D H;  1VQJ A;  4EQ5 A;  3KJP A;  1K3R A;  1KAW A;  4GN3 B;  4X65 Q;  4DV2 L;  3T1H Q;  3KF6 B;  4HIO A;  1E1T A;  3GTP H;  4A3C H;  4X64 Q;  3HOX H;  1CSQ A;  2EQS A;  3GDE A;  3GO5 A;  1VS0 A;  4LFB Q;  4A3B G;  4Y7N H;  2NN6 G;  4IFD I;  5C44 H;  2F3I A;  1TWC H;  2R7D A;  3E9I A;  4HJ9 A;  3I4N H;  5GAE C;  2KBN A;  3G6E A;  4DV6 L;  1EFW A;  4BBS H;  4K0K Q;  2UXC L;  2Z0S A;  1PA6 A;  5C4X G;  1UE5 A;  2CKZ B;  2QEX A;  3CF5 A;  3PO2 H;  2A1A A;  4LF9 L;  4POG A;  4X65 L;  1YHB A;  5H1S E;  5GRO A;  2F4V Q;  3RZO H;  1OXX K;  4X64 L;  1G6P A;  1IYJ B;  4LFB L;  3GTG H;  3CP0 A;  4R1J A;  4KI0 A;  4A3K H;  3D31 A;  1VQI A;  2PQA A;  1UEB A;  1PV4 A;  2E8G A;  3GTK H;  3HOZ G;  1K73 C;  2Y0S E;  4K0K L;  4BY1 G;  2IX1 A;  1HR0 W;  4UY8 C;  1XJV A;  4QGU A;  4JOI C;  3TEH B;  4DAM A;  3UDG A;  1XPU A;  2R92 G;  2R7Z G;  1I6H H;  1C0A A;  1KQS A;  5IYD G;  1PHJ A;  1WI5 A;  1I50 H;  1IBM Q;  3PO3 H;  2YYZ A;  2UXB Q;  1P16 A;  3M4Q A;  3S24 A;  1VQF A;  3TQY A;  2F4V L;  4ME3 A;  2CFM A;  1LTL A;  2ATW A;  1TWA H;  2ZTC A;  3J81 c;  3E9H A;  4RMF A;  5M3M G;  4PZ7 A;  1L1O B;  1SRO A;  2C35 B;  3IRB A;  5JEA G;  5C0X G;  1R9T H;  1KIX A;  2UU9 Q;  1EUJ A;  4BBS G;  4JI0 Q;  4LF4 Q;  5JEA J;  3H3V I;  3HKZ G;  1Q1E A;  1YBY A;  1L1O C;  2WP8 J;  1MJE A;  3PO2 G;  3ZJY C;  3ERS X;  4DAY B;  4TQU S;  1UE7 A;  1J5E Q;  1O7I A;  3CCM A;  1EOV A;  2Z6K A;  2XTI A;  2EIF A;  1IBM L;  2A8V A;  2QGQ A;  2UXB L;  4DUZ Q;  4NPS A;  5IY0 A;  3S17 H;  2VZA A;  4DR4 Q;  3M85 A;  1Q12 A;  2GVA A;  2VL6 A;  4LW1 A;  3RR5 A;  1VQM A;  1PH7 A;  4GS3 A;  5IWA Q;  4GOP A;  3HOV G;  1IXR A;  4BBR H;  2KHI A;  3F2C A;  2JA8 H;  3K8A A;  4JI0 L;  4LF4 L;  1WOC A;  4IPG A;  4YWM A;  1A8V A;  4AIM A;  1TXY A;  4R4C A;  4JI8 Q;  4X62 Q;  4QJF A;  3UDX A;  4C2M H;  1VQL A;  1MKH A;  1J5E L;  1N33 L;  2ZM6 Q;  3PUX A;  4IJH A;  3UDF A;  4IOC A;  3CCJ A;  4X66 Q;  3CCR A;  4DUZ L;  1EWI A;  4GKJ Q;  1N32 Q;  4DR5 Q;  2UUB Q;  5LMN W;  4JI4 Q;  1G29 1;  1X54 A;  4B3T Q;  3UE0 A;  5EAY A;  3B6Y A;  4GLA C;  1TWG H;  4QY7 A;  3I56 A;  1RL2 A;  2JA9 A;  2HIV A;  2PNH A;  4P71 A;  5FJ8 G;  3CW2 C;  1IBK L;  1PH1 A;  1QUQ A;  1Y14 B;  3T1Y Q;  3NEL A;  4R4T A;  1W2B A;  2Q2I A;  2YU9 H;  3RLN A;  4A3J H;  1VQE A;  4JI8 L;  4X62 L;  4IOA A;  1KXL A;  2BH8 A;  3BZC A;  2ZM6 L;  3AFP A;  1B70 B;  3LGJ A;  2JJQ A;  3PUZ A;  2MO0 A;  4OON A;  3PV0 A;  4X66 L;  3CCQ A;  3H3V H;  4JOI A;  4JBM A;  4BY7 H;  2CWA A;  3FKI H;  2UUB L;  4JI4 L;  3CD6 A;  1N32 L;  2B63 H;  2KCM A;  4LWC A;  5IYC H;  5IYB H;  4B3T L;  1Y1V G;  2K5H A;  3S16 H;  2CCZ A;  5IE8 A;  4NXM L;  1YIJ A;  1VQO A;  4YY3 Q;  3I4M H;  3GD7 A;  1M1K C;  1IZ6 A;  4XIG S;  2YV5 A;  2ZTE A;  2PI2 A;  1LUZ A;  3F2B A;  1Z9F A;  1NTG A;  5FLM H;  3H0G H;  4PMW A;  4A76 A;  4A3G H;  1VQ8 A;  1HH2 P;  3KOJ A;  2IY5 B;  4KHZ A;  1ASZ A;  3PCO B;  4YWL A;  3RN2 A;  1XTD A;  4P74 A;  2IX0 A;  3HOU H;  4YCW A;  2E5L Q;  2Q2H A;  5LMU Q;  4GNX A;  1XPO A;  2WB1 E;  2E2H H;  4HIK A;  1E24 A;  4YY3 L;  4O2D A;  4HIM A;  5M5W H;  1X6O A;  3PSI A;  1PFS A;  4AQY Q;  1IL2 A;  1P8L A;  1NMF A;  4A3E G;  3FP9 A;  1Q81 C;  2CQO A;  4LF7 Q;  3I4O A;  1I3Q H;  1EIF A;  1HNZ Q;  4C3I H;  4X6A H;  1XNQ L;  1VQ5 A;  2YTX A;  1Q7Y C;  2B63 G;  4QQB X;  4LUZ A;  2ZJQ A;  4DR1 Q;  2E5L L;  4UP9 A;  2JK8 A;  1GKH A;  5LMU L;  3OYY A;  4XTC S;  3CCV A;  4NB3 A;  4JI7 Q;  3ULL A;  4L5S A;  5JJI A;  1CKM A;  4DR3 Q;  4AQY L;  3HOW H;  3K7A H;  3TRE A;  3M7N A;  4LF7 L;  4DR2 Q;  4MZ9 A;  4OO1 I;  2VY3 A;  4JI1 Q;  2XGT A;  2NVX H;  1HNZ L;  1SN8 A;  4A93 G;  3AYH B;  3KLW A;  4GN5 A;  4MNO A;  3J7Z C;  3T1H L;  2WAQ E;  4PZ8 A;  2AWN A;  2N78 A;  4R4I A;  2IHF A;  3E0E A;  2E2I H;  2RHS B;  1NY4 A;  3CCE A;  4BA1 I;  1X9N A;  2JEA I;  4DR1 L;  1S3O A;  1VQD A;  1WJJ A;  2D0O A;  4JCV E;  5IP9 G;  2IHE A;  1QZH A;  3UDI A;  4JI2 Q;  3CME A;  4LFA Q;  1VQK A;  1LYL A;  1YHQ A;  4LF5 Q;  3HOY H;  3TRZ A;  4YCU A;  5JJK A;  4DR3 L;  2VQF Q;  1OXS C;  1W3S A;  2MO1 A;  3ULJ A;  4JG2 A;  4JI1 L;  4A3D G;  1V1Q A;  1PVO A;  4KLK A;  4JBK A;  1PH8 A;  3GTO H;  1JE5 A;  3UE1 A;  3W1G A;  4A3C G;  3HOX G;  4DR6 Q;  2R93 H;  4RG1 A;  4GLX A;  4LFC Q;  1MIU A;  2A19 A;  2UUC Q;  4OX9 Q;  3BJU A;  2K50 A;  5DLQ E;  5C44 G;  4JI2 L;  1JJC B;  1CSP A;  4LF5 L;  4LFA L;  3I4N G;  1FL0 A;  2VNU D;  2ID0 A;  3F1Z A;  1WFQ A;  1CUK A;  2VQF L;  4DV0 Q;  5C0X J;  1UE1 A;  2CWP A;  1N36 Q;  4LUV A;  2LXK A;  1VQG A;  3A5Z B;  3L7Z C;  1NMG A;  3U58 A;  3M9B A;  2NVY H;  4A3L H;  4HJ7 A;  4YCV A;  3S2H H;  2KCT A;  2YTY A;  2JA6 H;  2R7F A;  4DR6 L;  1Z47 A;  2BH2 A;  4LFC L;  1L2F A;  5E7N A;  4A3K G;  4GKJ L;  1YEZ A;  1YVC A;  1JMC A;  4OXP A;  4OX9 L;  2GVB A;  1OXU A;  3KDF B;  3JAM i;  2UU9 L;  3RZD H;  2ZTD A;  1KD1 C;  1WCM H;  5IP7 H;  4DV0 L;  1YJN A;  1YJW A;  4EX5 A;  4LF8 Q;  4MTN A;  4DV1 Q;  1K8G A;  3KF6 A;  3PIP A;  3L0O A;  4A3M H;  1N36 L;  4BXX H;  3ULP A;  4L5Q A;  3U4V A;  3J80 c;  1VQN A;  5LMN Q;  3PO3 G;  1JT8 A;  1E3P A;  5M3F H;  2B3G A;  1KL9 A;  1V9P A;  3ER0 A;  1QZG A;  1Y1W H;  4JV5 Q;  2UXD Q;  4HJ5 A;  4A3I H;  2BA0 A;  3W1B A;  4DR4 L;  4A3F H;  4GKK Q;  1Q1B A;  4JI3 Q;  3WWV A;  1QVF A;  4KHP Q;  2D0P A;  3CQZ H;  5ELO A;  3J7A 5;  5IWA L;  3M3Y H;  4AYB G;  3HKZ E;  4DV5 Q;  5HGQ A;  2MNA A;  3PF4 A;  4JI6 Q;  3SGI A;  4IFD G;  4LF8 L;  4UP8 A;  3GTJ H;  3BZK A;  3RN5 A;  1YJ9 A;  3STB D;  3I2Z A;  3CC2 A;  5LMN L;  2WFW A;  1IBL Q;  1H95 A;  1VCI A;  5J3B A;  1YI2 A;  1CKO A;  3VDY A;  1X55 A;  3GTL H;  4DR5 L;  2VUM H;  2K14 A;  1SLJ A;  3A74 A;  3PIO A;  4JV5 L;  4DK3 C;  4KHP L;  4C3J H;  1HNW Q;  3PUV A;  4JI3 L;  4GKK L;  5C3E H;  1GVP A;  1PH2 A;  1OXV A;  4BBR G;  1XMO Q;  1D8L A;  4DV5 L;  1PH3 A;  2JA8 G;  2JA5 H;  2K52 A;  4C3H H;  1C7Y A;  1XMQ Q;  4JI6 L;  1K83 H;  3T1Y L;  1S72 A;  1VQC A;  3PUW A;  2I5H A;  2OTJ A;  2NZH A;  3DM3 A;  2B29 A;  1QVG A;  2JQO A;  1VQP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...