5IWAO

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
molecule keywords 30S ribosomal protein S2
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5iwaO00
4OPHA 3M8AA 2VQFO 4DR5O 2UUCO 3R66A 5A2QN 4DV2O 4JI4O 4AQYO 4X62O 1XNQO 1XNRO 2DOSA 1XEQA 4NXNO 5IWAO 2F4VO 2ZKOA 1FJGO 4JI5O 3SDLA 4JI2O 4OX9O 3F5TA 5BXZA 5IT9N 1IBKO 4LFCO 2N74A 5LMUO 4DV6O 1R6TA 3J7AU 4LF6O 3JAMN 4GKKO 4YHHO 4KHPO 1NS1A 4JI8O 5BR8O 3O65A 2DJVA 4LF5O 4DR7O 4JV5O 1D2DA 2VQEO 4A5UB 3J80N 3T1HO 4B3RO 1XMQO 4DR4O 4LF8O 1N33O 2UXCO 4DR1O 2E5LO 4X66O 4LFBO 1KUQA 4DV0O 5BY1A 2UUAO 3OTOO 1FYJA 4JI7O 2UU9O 1IBMO 5H5NA 2FKXA 2LW7A 4K0KO 1N34O 1HR0O 4DV1O 4GKJO 4DR6O 4X65O 1N32O 4JI6O 1HNXO 1F7YA 1A32A 4DV5O 1J5EO 1YZBA 3J81N 1HNZO 4JI0O 3T1YO 4DUZO 4JYAO 1AB3A 1N36O 1R1BA 2Z0AA 4B3TO 1AILA 4DV4O 1DK1A 4JI1O 2UXDO 2ZM6O 5LL6Y 4YY3O 1G1XB 4JI3O 1I94O 1FKAO 2JRIA 4NXMO 4DR3O 1IBLO 4LF9O 4LFAO 4DUYO 1XMOO 2UUBO 3RT3C 5FLXN 4DV3O 2AGAA 4DR2O 2UXBO 1X59A 4DV7O 5LMNO 4OPAA 4B3SO 1HNWO 4LF4O 4X64O 4B3MO 2HHHO 4LF7O
chains in the Genus database with same CATH superfamily
3M8AA 2YIAA 1BCCH 4LFCB 2XHBA 4G27B 5GONB 4ZHQB 4NXNO 2Q0OC 5IY5C 2EILC 4JI4B 1H2LA 5JWPA 5LMUO 4EB6A 2KQXA 2WLMA 1L1FA 4YJ3B 1PNKA 2YUAA 2X6BA 2B1GA 2NN4A 2EJRA 1O9HA 4IT5A 2NR5A 2A79B 1GTOA 2JS3A 1Y76A 1XMQO 4DR4O 4L87A 1YJ9V 3SGIA 3BA8A 1OCOB 2MW2B 1WN7A 1VQMV 1RM1C 2ARHA 1JVMA 4LWSB 1SRYA 2LW7A 1S76D 4I9QA 1MG1A 2UUAB 1YTFD 4RUEA 4MVSA 4DV5O 4W4LA 3P3PA 4JI0O 3JAKB 2DWDC 5ITZA 4B3TO 3SJAC 1HNXB 3OMIB 2E3CA 2RJZA 1Y66A 4F4LA 1V55C 3FB6C 1VQNV 2HG5C 5JQGA 3AG1B 1OCCC 2H94A 2WSSG 4IHJB 2AXTZ 2UXBO 1GM9A 1XREA 3LNMB 2UUCB 2ZE8A 1RFYA 2AZ0A 3DC6A 4LNUB 4B3SO 2GDSA 3D36C 4B3MO 3M7MX 2BSKA 2XOKG 4DR2B 5B1BC 3ZN1A 1SQGA 2LW1A 2R9AA 4WFHA 3CC4V 2R72A 2LGWA 1B06A 4X62O 2HJFC 2ITCC 3EFFK 4X9QA 2ZKOA 1Z5WA 2QM8A 3AG4B 4DRXB 4FM2A 1COWG 2ZXWB 1MSDA 2WLIA 4MVQA 5JH7A 1R6KA 3E22A 3ZCCA 3VQXA 5DN6G 4JYBA 4X1YB 4K8ZA 1F51A 1HP8A 2CTRA 4I4TA 1Y74A 4BW9A 1IZ3A 3HKEA 5HFMA 3GWKC 1FXHA 2EINC 2JVDA 5EYPA 2LO1A 4EFBA 3FB7C 5GTIZ 1N34O 1P49A 5JH7B 1N0JA 5CN0A 2QTSA 4CH4A 4K8XA 3GWOA 1AI5A 4TV9A 5HFLA 1QR8A 4B7EA 2JIZG 3JCZA 2UXXA 3VOUA 1UFIA 2EIKC 1N36O 2HLDG 2QKAA 5KAIZ 3A0BZ 3K59A 3UM7A 1QHTA 4YJ2A 1K92A 4N21A 1K4CC 2IJKA 5E1AC 2MK3A 1BE3H 5KHHA 1IDSA 4RUFA 3CRCA 2YS8A 3ABUA 4CC6A 1S5JA 2F23A 1BZKA 2XAGA 1YSCA 5AG2A 2HJDA 5FNVB 1P4RA 2E75B 4WFGA 4JI4O 3T4ZA 1EN5A 3VQWA 2F93B 1NR1A 1Q8IA 4IIJB 3G80A 2Q67A 1NVPB 2XAFA 1Q6UA 1QR9A 4ZOLA 3JD3A 2HR3A 2P90A 2HFEC 4WBNA 2CH7A 4PDVA 3RBZA 3QG5A 4FZ0A 3L70H 3JAMN 3JD4A 1JQ0A 2LP7A 3H01A 2IU3A 1ZSPA 2QDOA 4AILC 3G4SV 3ZX6A 4BR6A 3QO7A 5CBHA 2Q7GA 1FPOA 3K79A 4JASA 2A06H 1YEWA 4KP4A 2YC0A 3N2GB 1N33O 2WLKA 1KC8W 2N04A 1FXKB 1M57B 5LXTA 1XL6A 3RYIA 1JX9A 2E5LO 1AVMA 4CH6A 5KX5A 1QNMA 4UVAA 3B40A 4O2AA 1G6UA 1HNXO 1IBMB 1A32A 3X2QC 1XHXA 1GM8A 4U3JA 3K0GA 3RVZA 5IDJA 3K9AA 3OD4A 4JPRA 1S5HC 3OE7G 4KL1A 1AP6A 2VS0A 1VQ7V 1AR5A 1AROP 2ODMA 4CH3A 2UXBB 1H8HG 4GZRB 5CBFA 3H1IH 2IJIA 3ZHVA 1NTMH 3B8NA 3BRCA 4O4LA 3CC7V 1H38A 4B3MB 4H33A 4DV3O 2GUZB 1N0NA 1WB7A 4DR2O 2ZT9B 4R7CA 4KXRA 4AQYB 2PY5A 2R9IA 3CP1A 1WA8B 3K57A 4X64O 4FPPA 3ZRWA 1XHZA 2YXYA 4TV8B 4LBEC 5LOVA 2OCHA 2Y0IA 2CH7B 4LF6B 3SDLA 4GLXA 1KYOF 4BIOA 1M93A 3T1CA 3CPWU 1IBKO 3FX7A 5KHGA 1XNRB 2EIJB 1WLEA 4XDLA 1AJQA 3ZS8C 2YDEA 5KHJA 4JI2B 3FB5C 1M9NA 1ZLZA 5LOVB 2PYLA 1S0VA 1F4NA 4QE7A 3TGUH 4J41A 3EXAA 3TJTA 5BR8O 3NR7A 4TWKA 2UXCB 4UB6Z 3WFVA 3CRMA 1D2DA 3ZHUA 3QO8A 5BZBA 3QNEA 1AI6A 3OMNB 4WBNB 4UCTA 1N34B 3CSXA 2CE4A 3RYHB 2PZSA 2Y48A 3DTUB 2GTSA 3I55V 4O4LB 1PL0A 2P06A 4O4HB 4JI7O 2DYRB 3IC7A 2BTQA 5JJEB 5KUMA 1QLEB 2OT5A 3QVNA 2DW4A 4JI1B 2BSKB 3BPZA 3HKDB 5KA5A 2FMLA 4I0XA 4JAUA 4GKJB 4H37A 2WA4A 1Y76B 2CTWA 2OIGA 4X65B 1BQZA 4J80A 1P7BA 3RYFB 4RO2A 1TAEA 5IYZA 2GBOA 4YY3O 3APOA 3K5OA 1BQ0A 4MTGA 3E86A 5DEDA 1VQLV 3S3WA 3BY6A 3ZRXA 2Z3YA 3SPJA 5J2TA 2Y4TA 1K73W 5KA6A 5L3FA 5EBWC 3OAAG 1G4YB 2XUMA 3ETGA 3CRRA 1JCHA 4D6TH 1Q6HA 1I08A 4DW0A 5L3CA 4FFKA 1PL4A 3JARB 4LF4O 1L0NH 1CP9A 1VF5B 2X6AA 5CMUA 3FD9A 2CTPA 1H2KA 4DV2O 3CYOA 3SYOA 3I5DA 3L71H 3RYCB 3D3IA 3K5NA 4K35A 3ZRWB 3AG4C 3TXQA 2QE7G 2ATKC 4OX9O 1S5LZ 3GVMA 1QQCA 1FFXA 4EEQA 1AR4A 2RQ6A 5H6QA 2GV9A 2Q7HA 1Y4MA 5IY5B 1XOUA 1KKCA 3X2QB 4XDJA 3TK1A 5EIBD 2AW9A 3E22B 4CZZA 1N33B 5L3EA 1OCCB 3ZMTA 2RMKB 5FL7G 5TISZ 1MNGA 3JAWB 1DTOA 4X20B 4NTXA 3CWBH 4W4KA 1KUQA 5BY1A 3T1HB 3OTOO 1IBMO 3VQVA 2ZR3A 2NNUA 4UFZA 5ITZB 1Q7YW 1KBHA 2P67A 1UJWB 1QVFU 4O4HA 3K5LA 4QPJA 4WF9V 3LUTB 5J2UB 3IFXA 4TUYB 3ASNC 4I55A 5B66Z 3UCSC 4EFEA 1TGOA 4DW1A 3G6EV 4TT3G 1JR9A 3KCYA 1L0LH 4B08A 4BAYA 2N05A 3A2FA 5H2FZ 4QPKA 2ILMA 1BGYH 3ASNB 1TUBB 3AG3B 3ETQA 4X64B 2Y0PA 3G67A 4MW8A 2WLLB 2DYSC 5EBLC 4DO2A 1AJNA 1BHBA 2KG7B 3F7VC 1QCEA 1WJZA 3ETDA 1O9GA 2XT9A 2HHHO 4NXNB 5JVDA 2CGNA 4U7NA 4ZKIA 4DR5O 3GB7C 3MAQA 3R66A 3PN1A 4IGGA 1DLBA 1SETA 5H9CA 3RWRD 4JZ2A 1IBKB 1XNRO 2DOSA 1VQKV 1X4TA 1OCRB 1FJGO 2A9HA 4MT8A 5BR8B 4G2KA 5CA3A 4O2AB 3IAYA 4J9ZB 5DM6V 3CCSV 4H13B 4FLYA 2P4VA 5CA0B 1SA0B 4DR4B 2EIMC 5CA1A 4OXSA 1I5YA 4EB6B 4B3RO 1NTKH 1VARA 5B1BB 4FLVA 1M56B 1TUEB 2JS5A 2WAMA 5GONA 2UUAO 2WPDG 3OFNG 5L3BA 4DV5B 4FFBB 3E8BA 1V55B 3MDSA 4JI0B 3LDEA 4GKJO 2IJHA 1ZX3A 3JASA 2B5UA 3CEIA 3P30A 4I0XB 1K33A 2LJ2A 1SQVH 2O57A 2R70A 3J81N 4H44B 4YY3B 1FAFA 1Q6IA 2YXLA 2X7RB 3ETEA 3VBBA 5C93A 2Z0AA 2BTQB 4JTAB 1SQBH 1VF6A 2V4DA 5FPRA 2VWKA 3CE2A 1MZEA 1IURA 1KP2A 4LWSA 3CCUV 1FKAO 2DE0X 3ABKB 2P7TC 1DGSA 4LF9O 5KAFZ 1QVGU 5DECA 3T2MA 1NJIW 2UXDB 1HW7A 3BEHA 5B1OA 1HNWO 1MSWD 1RPRA 4J9YB 2ADQB 2FTKA 2XAJA 3K5MA 1WPXA 1OZ0A 2Q4PA 4MVUA 3CCVV 1SC5B 3ABTA 4RWUA 1V54B 4U3JB 1EN4A 4BWAA 2YEVB 3L73H 2BOBC 5BXZA 1Z2GA 4PA3A 2BTOA 1PKXA 3CCRV 3CCLV 1AR1B 1OV9A 1R6TA 4X8AA 3ZBHA 2OWOA 5JCOA 5D5PA 4DV6B 3OTFA 3E83A 2B9ZA 1PPJH 2B1IA 3DGEA 4X20A 2QM4A 3ZRVA 2QJ1A 4Z1VA 3CMAV 1VQ9V 3BVOA 4NR1A 1JA8A 3AK3A 3WG7C 3K03A 2AHZA 2DN9A 5FPOA 2VWJA 5IJ9A 4LF8B 5C8YA 2Q7EA 2JEXA 1GKFA 2JDIG 3ASOB 4DR1B 4PA7A 2ETNA 1N36B 4DV0B 2L35A 3HKCA 5K1XA 1IVSA 2EINB 1YVWA 1YZBA 4HBNA 3D8CA 4MSWC 2ADPA 1AB3A 3K58A 5C8YB 1NI8A 2QKSA 3S3XA 1DK1A 3BCCH 2ZIOA 5EK0A 1L8DA 3W7UA 1XUQA 1E1RG 5KX5B 5IYZB 2JRIA 2CAZC 4WFFA 4DUYO 2W0XA 3RT3C 5FLXN 2HHHB 4Q20A 3LSSA 1ENVA 3STZC 4JYCA 1IBLB 5KMGB 1T5EA 3HKCB 1F23A 4LFAB 4DRXA 3ZMSA 1FJGB 1W2BU 1OJHA 3SJBC 2XASA 4DV7B 3CD6V 3CXCU 1H2MA 5IWAO 1VQ5V 1GN6A 3K0DA 1E1QG 2XAQA 1CEZA 2VRZA 5KLVH 2ZE7A 3F7YC 1Y67A 1FXKA 3MHHC 4GX1A 4Z2WA 3CRAA 1GMGA 1G8MA 3UT5B 4YXWG 1FFTB 5LA6B 4XBFA 3UQ8A 2X6CA 3E35A 2DJVA 4PA9A 1KU9A 3JAWA 1Y74B 2OCCB 2VQEO 5EZYA 2EJ7A 3TXSA 4A5UB 3JALA 4CC5A 3STLC 4HYOA 4JAAA 5LGUA 4PDMA 1K9MW 3CX5F 2D2CB 4YIOA 4FLXA 5H5NA 4J10A 2QR4A 4LCUC 2JK5C 4K0KO 4MTXA 3N27A 4DR6O 3ZMVA 2WLNA 3QF7A 5LGTA 1Q3EA 5JVDB 1B04A 2DYRC 3K9SA 5EC1C 1AI7A 4P2ZA 3ASOC 5K1PA 1ZAUA 1JMKC 2Z5UA 1YXBA 2JJ1G 3ZN0A 1H2SB 2QKCA 1J5EB 4O2BA 2QM7A 1I94O 3B77A 1US6A 4JAVA 3D3QA 2FYUH 3ZRSA 1M4UA 1HNWB 5BMVB 1B6QA 4RQEA 1BT8A 3HKBA 3C3TA 4GT1A 1VEWA 3SYQA 5JQGB 1YIJV 4NXMB 4K3AA 1K5QA 5JJNB 5J2UA 1M90W 2E74B 3LSUA 2F1MA 4OPHA 3RYFA 1VF7A 2DWEC 1YJNV 3HKDA 4J7KA 4JI2O 3Q4HA 2EZPA 1R73A 2IU0A 4CS3A 1XNQB 2RDCA 2WLHA 1YJWV 3AG7A 4JGSA 1N4CA 3AG3C 1TA8A 4JV5O 1XDCA 4LNUA 1NZ6A 1ZUQA 4JI7B 1QLEC 2CK3G 4LF8O 4PI2A 1Q81W 4IHJA 4DR1O 3U10A 4Q6GA 2E76B 4LH7A 1FS0G 3UT5A 3C3SA 4GX0A 4X65O 4X66B 2W6IG 3JSLA 2YICA 1XI1A 1DF4A 4DV1B 1ZTEA 4DUZO 2WLLA 1SQXH 2P22C 4G28B 4QJFB 1R1BA 4HNAA 5LHIA 1URFA 4E4EA 1XILA 2C2AA 1SF9A 1CXZB 4CS2A 5LL6Y 4PJ0Z 4QE9A 4J11A 4O4IB 3JD2A 4F6RB 1WAZA 2JEUA 3ZJZA 1IBLO 3E2EA 1WP8A 4GX2A 2W0FC 4UUJC 4X1IA 2AGAA 1MMMA 4UCUA 1K97A 1SZTA 2ZM6B 1RM1B 4FM1A 2ITDC 2EILB 4DV7O 5CBGA 4KFMA 4PHZA 2Q5ZA 5IWAB 2ZIMA 5LP6B 3F5WC 3ML0A 1PP9H 2QWQB 3IC9A 3CMEV 2FB5A 3NXSA 1KKDA 1R3JC 1YI2V 4QGPA 1TVKB 1FFXB 3W7XA 1EN6A 4C7UA 5FNVA 1Y6XA 4UV8A 5IJ0B 1S3JA 1W0JG 3SJQC 3F5TA 3RYHA 1NR7A 4HZ3A 3W7TA 3LNNA 4ZI7A 1HWYA 1OCRC 2WWWA 1ZWIC 3CC2V 2YIDA 4I50B 4X1YA 2VQEB 1NS1A 4P9OA 3RYIB 1GN2A 4FLWA 3SPGA 5EC2C 2YI8A 4LF5O 4YJ2B 4DR7O 1H2NA 1QLNA 1KD1W 4GYCB 1W59A 2CUGA 3OTOB 3T1HO 2RN9A 4GX5A 3ZMZA 4K0KB 2FL4A 1BL8A 1VF6C 4O4IA 4N23A 1EZVH 1IX9A 5KHKA 3SPIA 1NT2B 4LP8A 3JAKA 4TV8A 5B3SB 5E79Z 2QSAA 4X89A 3CJHB 2BE3A 3DXRA 1M57C 2K9PA 1M5IA 1THZA 4JYAO 1I94B 1SERA 4JZGA 1GH6A 4UVBA 1U96A 4FLZA 4I4TB 4DV4O 2Y69C 3FAVB 4F6EA 1ROPA 3WB0A 3KKYA 4WFEA 1K7DA 3SJCC 3DC5A 1XMOO 4XDKA 2EX3A 1I5XA 3ABMB 3OM3B 4AHCA 4DR5B 4JI3B 3HPLC 4FVMA 4DR3B 5CB4A 2A7WA 1GAXA 5LGNA 2UUBB 3UO2A 3OUFA 1OCZB 2OCCC 1GM7A 3VQYA 1XNQO 2P6JA 4UCRA 2ZDIC 4HAMA 1VQ4V 3LDDA 3ZMUA 3RW0A 3FB8C 4X1KB 1R3KC 4CBCA 1K34A 1GRJA 3TCUA 3BHPA 4YHHO 2GTAA 3CCQV 2ZE6A 4U7OA 4B3RB 1HDJA 3H1LH 3O65A 3RGBA 4MTFA 4NTWA 5LA6A 2JGUA 1LUVA 1JFFA 2GSMB 1SESA 4Z1MG 1LR1A 2BOCC 3JATB 2CTQA 2PF4E 3OW2U 4BIUA 1BSMA 3JCUZ 4MVRA 2A0LA 5GTHZ 3EVKA 3ICXA 4YJ3A 4DUZB 3B4SA 1KECA 3KG2A 4LFBB 1RP3B 1WA8A 1R6NA 2XTAA 1GN3A 1HR0B 5B5EZ 3T1YO 1KP3A 3CS5A 1WB8A 3K3WA 3QO5A 4LF9B 3WB2A 2GHYA 2UXDO 3K04A 2QWPB 2WA3A 1UPGA 4PD4F 5IJ9B 4I50A 5IYDO 1V54C 2DQ3A 3ZHSA 2KG7A 1NKDA 4I9WA 3ZEDA 1JPXA 5LMNO 1E79G 1ZL8B 2CGOA 2IH3C 1QU7A 1KMIZ 2LGQA 4FK5C 1TUBA 1F4MA 2VQFO 3IJ4A 3W7SA 3AEIA 3CB2A 1XEQA 4JI5O 3N2GA 2OTLV 3L74H 4DV6O 5EZYB 4X1IB 3AG2B 2ZNJA 4LF5B 1KQSU 2HP8A 1P7GA 4UCOA 1SKVA 2LFSA 3E8FA 4TQDA 5BMVA 1W0KG 4UB8Z 5LMUB 5GW7A 1BMFG 1XBLA 1N8RW 5EIBC 5LHGA 5IYCO 4AI8A 3J80N 1GK9A 3JALB 4X1KA 2K1EA 2ZINA 2PUSA 4IYHA 1JOYA 2F43G 1P84F 2YIBD 4DV0O 4IIJA 1XMQB 4MW3A 1Q5OA 3ZHQA 1YCIA 2H3OA 3UKMA 3BA9A 3WG7B 1PNMA 3SPCA 4JYAB 1VP7A 3A0RA 4DXWA 1SQPH 3DXRB 4JI6O 4DV4B 1MABG 3B8MA 2UU9B 3AK2A 3JD1A 1Q82W 3RN4A 4DUYB 3OT7A 3ZHTA 1K4DC 2PYJA 3BFRA 1WPBA 4OGQB 4FM0A 3FAVA 1FXKC 4DR3O 4ZIBA 1R3IC 3BAAA 1K5SA 4O4JB 4B3TB 2YSUB 3THOA 2UUBO 4LFAO 3JSNA 2DQ0A 1VQ8V 4NVPA 2JGDB 4PELA 3CCMV 2D3OW 3Q4HB 5L3GA 3KZIZ 1NU1H 1OCOC 3WB1A 3DSQA 4LF7O 3OGIB 3P32A 3CXHF 2RCVA 5KUKA 3CCJV 2OIEA 4FLUA 4YHHB 2QTOA 3HKEB 3G71V 4X62B 2XNDG 3HKBB 2GUZA 3J7AU 4GKKO 4FZ1A 1K3EA 2PTMA 1RSOB 1RPOA 2EIJC 4QNHB 5LYJB 4KUMA 4NYKA 3QTCA 2QWNB 4PDLA 5CA0A 1Z5VA 2QWRB 2Q6AA 3AG1C 4JI8B 2BCCH 3KCXA 5L3DA 1YF2A 5IJ0A 1I7FA 4DR6B 5LYJA 2KB1A 2PGGA 2IH1C 3B2EE 4HNAB 2L6LA 4J7ZA 4NKGB 1H2GA 3SR2C 1YITV 3T1YB 1EFRG 3MHSC 1YTFB 1M1KW 1J5EO 2RNBA 3EHBB 2YEVA 1IXMA 2ZNIA 4TV9B 1WP7A 2WLJA 4ZBMA 2QGNA 1HNZB 4NXMO 1SZXA 3E8HA 1NVPD 2JGDA 4L8JA 3JD0A 2F95B 1PNLA 4NB5A 1PV0A 3RVYA 4P30A 4H0LB 1Q43A 4UVCA 3AK1A 1MZFA 1JJOA 1D5NA 1S72V 1VQOV 2ZQMA 3OEEG 2YI9A 2ZD9A 2ZXWC 5J9PC 4FIPC 2F4VO 4UCSA 4JTCB 4NTYA 4LR3A 3CCEV 3N2KB 2EIKB 1B3QA 4JV5B 2OYQA 3RYCA 4KHPO 2UXNA 3SYCA 3H1JH 1VQPV 2Q69A 5LP6A 1V9PA 3FFQA 1AI4A 2LFRA 4FJCC 5JCOC 2P5OA 3H1HH 3UO3A 3D36A 5IYBO 3CJHA 3BABA 3K08A 5F2VO 5LP6C 1OCZC 4O2BB 4X66O 4JI6B 4MVZA 4B7KA 2UU9O 4DK1A 3E89A 3O9OA 2YXHA 3U0ZA 4DV1O 1MOFA 1NH2B 4FLTA 4FFBA 1YHQV 1EBOA 2E5LB 1PD3A 4P9PA 2V1DA 1I0HA 5LXTB 3U11A 4J42A 1N32B 3K06A 2EBOA 3FKSG 1D5AA 2F66C 4UCVA 3SPHA 2AZ2A 2Q68A 2HVJC 4CH5A 5CA1B 2ZM6O 5B1AB 2HVKC 4WCEV 1XQ8A 4X88A 3AG2C 1NQTA 4QIWF 4TSFG 4MS2A 1SA0A 4BIZA 3CRQA 4LF7B 2ZDIA 2Q9LA 4ZI7B 2W6JG 4MVMA 5LHHA 4D7SA 5KHIA 4DV3B 4UXNA 5LBQA 1LNQA 4PV1B 3CHXA 2HEPA 1NBMG 5JJJB 1CPYA 1GN4A 5A2QN 4AQYO 2EIMB 4PA4A 4ABMA 5H6RA 4ICGA 1Q90D 3E8GA 4GKKB 4DYLA 2G38A 3JASB 4LFCO 2YIBA 1PM9A 2IBZH 4LF6O 1J95A 4DR7B 1XL4A 4IYIA 4WFBV 4JI8O 2DYSB 3A0HZ 2X0LA 4I7ZB 3ZIAG 4PA6A 1RSOA 4WFAV 4D7TA 3JATA 4RAIA 3M99B 3C90A 4LH6A 1ZL8A 4JYYA 2M6YA 4JF3A 1JFFB 1AJPA 2XAHA 2R9RB 5J2TB 3PJSK 2UXCO 4EKWA 5EBMC 3ABLB 1EZJA 4TUYA 4LC1A 3FYEB 4YIPA 1U97A 1SS3A 2KSDA 3ZHRA 1BS3A 5B1NA 2FKXA 2QWOB 3SYPA 2Y69B 3ABKC 2IJJA 3IGAC 4R8CA 2Q0AA 5EYPB 1VIBA 3OUSA 3L75H 1F7YA 1WNSA 1GO3F 1S77D 1FD9A 1HNZO 3LSQA 4DK0A 2QA4V 3HR0A 2LQTA 1XMOB 3OMAB 4JI1O 5A9GA 5IE9A 4JI3O 3P3NA 3OEHG 3JARA 4I5SA 3N2KA 1KB9F 1M56C 2ZR2A 2IW5A 3OR6C 1X59A 1VQ6V 1OHHG 1NH2D 4OPAA 4R6ZA 3OGCC 4JTDB 1DF5A 3A8TA 2F4VB 4ZHQA 1LUWA 4F6RA 4J7JA 2UUCO 1JJ2U 2P4KA 1TVKA 2Q73A 3W7WA 4B3SB 2EULA 5D5QA 4LF4B 2EZOA 3TETA 2DMXA 4I55B 3R65A 3SYAA 1K8AW 3I56V 4KHPB 4DV2B 3H9VA 4TOIA 5IT9N 3WU2Z 2N74A 4ZOLB 4IL6Z 1IXBA 2NLJC 1Q86W 3FYIB 4FMTA 3G6BA 4OX9B 3JYCA 4PI0A 3B09A 2KKWA 2Y4UA 4O4JA 2QEXV 3OR7C 4TQFA 3H1KH 2JJ2G 4GCZA 2Q8VA 1YDXA 5B3SC 4R50A 1BHAA 3HB3B 5CB4B 5KMGA 2AHYA 2PI4A 2H8PC 3T4DA 5B1AC 1MA1A 1ORQC 3APQA 4CS4A 1VMGA 4RQFA 4BW5A 3ABLC 1H8EG 4LFBO 1FXVA 4MVOA 1FYJA 3ABMC 2OTJV 2IM9A 1NTZH 2WLIB 3L72H 3MD0A 1HR0O 2CDYA 2HKOA 1QBZA 1EM1A 2ZE5A 1N32O 4UV9A 4ASUG 1AP5A 2A3QA 1AILA 3LDCA 1G1XB 1SQQH 5LMNB 2V7QG 4E2LA 3L9DA 3RFRA 2M7WA 2VQFB 4PDRA 4MTOA 1SQFA 4GUNA 2ZCEA 4U3FH 2PI5A 1R3LC 4JI5B
chains in the Genus database with same CATH topology
4OPHA 3M8AA 2VQFO 4DR5O 2UUCO 3R66A 5A2QN 4DV2O 4JI4O 4AQYO 4X62O 1XNQO 1XNRO 2DOSA 1XEQA 4NXNO 5IWAO 2F4VO 2ZKOA 1FJGO 4JI5O 3SDLA 4JI2O 4OX9O 3F5TA 5BXZA 5IT9N 1IBKO 4LFCO 2N74A 5LMUO 4DV6O 1R6TA 3J7AU 4LF6O 3JAMN 4GKKO 4YHHO 4KHPO 1NS1A 4JI8O 5BR8O 3O65A 2DJVA 4LF5O 4DR7O 4JV5O 1D2DA 2VQEO 4A5UB 3J80N 3T1HO 4B3RO 1XMQO 4DR4O 4LF8O 1N33O 2UXCO 4DR1O 2E5LO 4X66O 4LFBO 1KUQA 4DV0O 5BY1A 2UUAO 3OTOO 1FYJA 4JI7O 2UU9O 1IBMO 5H5NA 2FKXA 2LW7A 4K0KO 1N34O 1HR0O 4DV1O 4GKJO 4DR6O 4X65O 1N32O 4JI6O 1HNXO 1F7YA 1A32A 4DV5O 1J5EO 1YZBA 3J81N 1HNZO 4JI0O 3T1YO 4DUZO 4JYAO 1AB3A 1N36O 1R1BA 2Z0AA 4B3TO 1AILA 4DV4O 1DK1A 4JI1O 2UXDO 2ZM6O 5LL6Y 4YY3O 1G1XB 4JI3O 1I94O 1FKAO 2JRIA 4NXMO 4DR3O 1IBLO 4LF9O 4LFAO 4DUYO 1XMOO 2UUBO 3RT3C 5FLXN 4DV3O 2AGAA 4DR2O 2UXBO 1X59A 4DV7O 5LMNO 4OPAA 4B3SO 1HNWO 4LF4O 4X64O 4B3MO 2HHHO 4LF7O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPH A;  3M8A A;  2VQF O;  4DR5 O;  2UUC O;  3R66 A;  5A2Q N;  4DV2 O;  4JI4 O;  4AQY O;  4X62 O;  1XNQ O;  1XNR O;  2DOS A;  1XEQ A;  4NXN O;  5IWA O;  2F4V O;  2ZKO A;  1FJG O;  4JI5 O;  3SDL A;  4JI2 O;  4OX9 O;  3F5T A;  5BXZ A;  5IT9 N;  1IBK O;  4LFC O;  2N74 A;  5LMU O;  4DV6 O;  1R6T A;  3J7A U;  4LF6 O;  3JAM N;  4GKK O;  4YHH O;  4KHP O;  1NS1 A;  4JI8 O;  5BR8 O;  3O65 A;  2DJV A;  4LF5 O;  4DR7 O;  4JV5 O;  1D2D A;  2VQE O;  4A5U B;  3J80 N;  3T1H O;  4B3R O;  1XMQ O;  4DR4 O;  4LF8 O;  1N33 O;  2UXC O;  4DR1 O;  2E5L O;  4X66 O;  4LFB O;  1KUQ A;  4DV0 O;  5BY1 A;  2UUA O;  3OTO O;  1FYJ A;  4JI7 O;  2UU9 O;  1IBM O;  5H5N A;  2FKX A;  2LW7 A;  4K0K O;  1N34 O;  1HR0 O;  4DV1 O;  4GKJ O;  4DR6 O;  4X65 O;  1N32 O;  4JI6 O;  1HNX O;  1F7Y A;  1A32 A;  4DV5 O;  1J5E O;  1YZB A;  3J81 N;  1HNZ O;  4JI0 O;  3T1Y O;  4DUZ O;  4JYA O;  1AB3 A;  1N36 O;  1R1B A;  2Z0A A;  4B3T O;  1AIL A;  4DV4 O;  1DK1 A;  4JI1 O;  2UXD O;  2ZM6 O;  5LL6 Y;  4YY3 O;  1G1X B;  4JI3 O;  1I94 O;  1FKA O;  2JRI A;  4NXM O;  4DR3 O;  1IBL O;  4LF9 O;  4LFA O;  4DUY O;  1XMO O;  2UUB O;  3RT3 C;  5FLX N;  4DV3 O;  2AGA A;  4DR2 O;  2UXB O;  1X59 A;  4DV7 O;  5LMN O;  4OPA A;  4B3S O;  1HNW O;  4LF4 O;  4X64 O;  4B3M O;  2HHH O;  4LF7 O; 
#chains in the Genus database with same CATH topology
 3M8A A;  2YIA A;  1BCC H;  4LFC B;  2XHB A;  4G27 B;  5GON B;  4ZHQ B;  4NXN O;  2Q0O C;  5IY5 C;  2EIL C;  4JI4 B;  1H2L A;  5JWP A;  5LMU O;  4EB6 A;  2KQX A;  2WLM A;  1L1F A;  4YJ3 B;  1PNK A;  2YUA A;  2X6B A;  2B1G A;  2NN4 A;  2EJR A;  1O9H A;  4IT5 A;  2NR5 A;  2A79 B;  1GTO A;  2JS3 A;  1Y76 A;  1XMQ O;  4DR4 O;  4L87 A;  1YJ9 V;  3SGI A;  3BA8 A;  1OCO B;  2MW2 B;  1WN7 A;  1VQM V;  1RM1 C;  2ARH A;  1JVM A;  4LWS B;  1SRY A;  2LW7 A;  1S76 D;  4I9Q A;  1MG1 A;  2UUA B;  1YTF D;  4RUE A;  4MVS A;  4DV5 O;  4W4L A;  3P3P A;  4JI0 O;  3JAK B;  2DWD C;  5ITZ A;  4B3T O;  3SJA C;  1HNX B;  3OMI B;  2E3C A;  2RJZ A;  1Y66 A;  4F4L A;  1V55 C;  3FB6 C;  1VQN V;  2HG5 C;  5JQG A;  3AG1 B;  1OCC C;  2H94 A;  2WSS G;  4IHJ B;  2AXT Z;  2UXB O;  1GM9 A;  1XRE A;  3LNM B;  2UUC B;  2ZE8 A;  1RFY A;  2AZ0 A;  3DC6 A;  4LNU B;  4B3S O;  2GDS A;  3D36 C;  4B3M O;  3M7M X;  2BSK A;  2XOK G;  4DR2 B;  5B1B C;  3ZN1 A;  1SQG A;  2LW1 A;  2R9A A;  4WFH A;  3CC4 V;  2R72 A;  2LGW A;  1B06 A;  4X62 O;  2HJF C;  2ITC C;  3EFF K;  4X9Q A;  2ZKO A;  1Z5W A;  2QM8 A;  3AG4 B;  4DRX B;  4FM2 A;  1COW G;  2ZXW B;  1MSD A;  2WLI A;  4MVQ A;  5JH7 A;  1R6K A;  3E22 A;  3ZCC A;  3VQX A;  5DN6 G;  4JYB A;  4X1Y B;  4K8Z A;  1F51 A;  1HP8 A;  2CTR A;  4I4T A;  1Y74 A;  4BW9 A;  1IZ3 A;  3HKE A;  5HFM A;  3GWK C;  1FXH A;  2EIN C;  2JVD A;  5EYP A;  2LO1 A;  4EFB A;  3FB7 C;  5GTI Z;  1N34 O;  1P49 A;  5JH7 B;  1N0J A;  5CN0 A;  2QTS A;  4CH4 A;  4K8X A;  3GWO A;  1AI5 A;  4TV9 A;  5HFL A;  1QR8 A;  4B7E A;  2JIZ G;  3JCZ A;  2UXX A;  3VOU A;  1UFI A;  2EIK C;  1N36 O;  2HLD G;  2QKA A;  5KAI Z;  3A0B Z;  3K59 A;  3UM7 A;  1QHT A;  4YJ2 A;  1K92 A;  4N21 A;  1K4C C;  2IJK A;  5E1A C;  2MK3 A;  1BE3 H;  5KHH A;  1IDS A;  4RUF A;  3CRC A;  2YS8 A;  3ABU A;  4CC6 A;  1S5J A;  2F23 A;  1BZK A;  2XAG A;  1YSC A;  5AG2 A;  2HJD A;  5FNV B;  1P4R A;  2E75 B;  4WFG A;  4JI4 O;  3T4Z A;  1EN5 A;  3VQW A;  2F93 B;  1NR1 A;  1Q8I A;  4IIJ B;  3G80 A;  2Q67 A;  1NVP B;  2XAF A;  1Q6U A;  1QR9 A;  4ZOL A;  3JD3 A;  2HR3 A;  2P90 A;  2HFE C;  4WBN A;  2CH7 A;  4PDV A;  3RBZ A;  3QG5 A;  4FZ0 A;  3L70 H;  3JAM N;  3JD4 A;  1JQ0 A;  2LP7 A;  3H01 A;  2IU3 A;  1ZSP A;  2QDO A;  4AIL C;  3G4S V;  3ZX6 A;  4BR6 A;  3QO7 A;  5CBH A;  2Q7G A;  1FPO A;  3K79 A;  4JAS A;  2A06 H;  1YEW A;  4KP4 A;  2YC0 A;  3N2G B;  1N33 O;  2WLK A;  1KC8 W;  2N04 A;  1FXK B;  1M57 B;  5LXT A;  1XL6 A;  3RYI A;  1JX9 A;  2E5L O;  1AVM A;  4CH6 A;  5KX5 A;  1QNM A;  4UVA A;  3B40 A;  4O2A A;  1G6U A;  1HNX O;  1IBM B;  1A32 A;  3X2Q C;  1XHX A;  1GM8 A;  4U3J A;  3K0G A;  3RVZ A;  5IDJ A;  3K9A A;  3OD4 A;  4JPR A;  1S5H C;  3OE7 G;  4KL1 A;  1AP6 A;  2VS0 A;  1VQ7 V;  1AR5 A;  1ARO P;  2ODM A;  4CH3 A;  2UXB B;  1H8H G;  4GZR B;  5CBF A;  3H1I H;  2IJI A;  3ZHV A;  1NTM H;  3B8N A;  3BRC A;  4O4L A;  3CC7 V;  1H38 A;  4B3M B;  4H33 A;  4DV3 O;  2GUZ B;  1N0N A;  1WB7 A;  4DR2 O;  2ZT9 B;  4R7C A;  4KXR A;  4AQY B;  2PY5 A;  2R9I A;  3CP1 A;  1WA8 B;  3K57 A;  4X64 O;  4FPP A;  3ZRW A;  1XHZ A;  2YXY A;  4TV8 B;  4LBE C;  5LOV A;  2OCH A;  2Y0I A;  2CH7 B;  4LF6 B;  3SDL A;  4GLX A;  1KYO F;  4BIO A;  1M93 A;  3T1C A;  3CPW U;  1IBK O;  3FX7 A;  5KHG A;  1XNR B;  2EIJ B;  1WLE A;  4XDL A;  1AJQ A;  3ZS8 C;  2YDE A;  5KHJ A;  4JI2 B;  3FB5 C;  1M9N A;  1ZLZ A;  5LOV B;  2PYL A;  1S0V A;  1F4N A;  4QE7 A;  3TGU H;  4J41 A;  3EXA A;  3TJT A;  5BR8 O;  3NR7 A;  4TWK A;  2UXC B;  4UB6 Z;  3WFV A;  3CRM A;  1D2D A;  3ZHU A;  3QO8 A;  5BZB A;  3QNE A;  1AI6 A;  3OMN B;  4WBN B;  4UCT A;  1N34 B;  3CSX A;  2CE4 A;  3RYH B;  2PZS A;  2Y48 A;  3DTU B;  2GTS A;  3I55 V;  4O4L B;  1PL0 A;  2P06 A;  4O4H B;  4JI7 O;  2DYR B;  3IC7 A;  2BTQ A;  5JJE B;  5KUM A;  1QLE B;  2OT5 A;  3QVN A;  2DW4 A;  4JI1 B;  2BSK B;  3BPZ A;  3HKD B;  5KA5 A;  2FML A;  4I0X A;  4JAU A;  4GKJ B;  4H37 A;  2WA4 A;  1Y76 B;  2CTW A;  2OIG A;  4X65 B;  1BQZ A;  4J80 A;  1P7B A;  3RYF B;  4RO2 A;  1TAE A;  5IYZ A;  2GBO A;  4YY3 O;  3APO A;  3K5O A;  1BQ0 A;  4MTG A;  3E86 A;  5DED A;  1VQL V;  3S3W A;  3BY6 A;  3ZRX A;  2Z3Y A;  3SPJ A;  5J2T A;  2Y4T A;  1K73 W;  5KA6 A;  5L3F A;  5EBW C;  3OAA G;  1G4Y B;  2XUM A;  3ETG A;  3CRR A;  1JCH A;  4D6T H;  1Q6H A;  1I08 A;  4DW0 A;  5L3C A;  4FFK A;  1PL4 A;  3JAR B;  4LF4 O;  1L0N H;  1CP9 A;  1VF5 B;  2X6A A;  5CMU A;  3FD9 A;  2CTP A;  1H2K A;  4DV2 O;  3CYO A;  3SYO A;  3I5D A;  3L71 H;  3RYC B;  3D3I A;  3K5N A;  4K35 A;  3ZRW B;  3AG4 C;  3TXQ A;  2QE7 G;  2ATK C;  4OX9 O;  1S5L Z;  3GVM A;  1QQC A;  1FFX A;  4EEQ A;  1AR4 A;  2RQ6 A;  5H6Q A;  2GV9 A;  2Q7H A;  1Y4M A;  5IY5 B;  1XOU A;  1KKC A;  3X2Q B;  4XDJ A;  3TK1 A;  5EIB D;  2AW9 A;  3E22 B;  4CZZ A;  1N33 B;  5L3E A;  1OCC B;  3ZMT A;  2RMK B;  5FL7 G;  5TIS Z;  1MNG A;  3JAW B;  1DTO A;  4X20 B;  4NTX A;  3CWB H;  4W4K A;  1KUQ A;  5BY1 A;  3T1H B;  3OTO O;  1IBM O;  3VQV A;  2ZR3 A;  2NNU A;  4UFZ A;  5ITZ B;  1Q7Y W;  1KBH A;  2P67 A;  1UJW B;  1QVF U;  4O4H A;  3K5L A;  4QPJ A;  4WF9 V;  3LUT B;  5J2U B;  3IFX A;  4TUY B;  3ASN C;  4I55 A;  5B66 Z;  3UCS C;  4EFE A;  1TGO A;  4DW1 A;  3G6E V;  4TT3 G;  1JR9 A;  3KCY A;  1L0L H;  4B08 A;  4BAY A;  2N05 A;  3A2F A;  5H2F Z;  4QPK A;  2ILM A;  1BGY H;  3ASN B;  1TUB B;  3AG3 B;  3ETQ A;  4X64 B;  2Y0P A;  3G67 A;  4MW8 A;  2WLL B;  2DYS C;  5EBL C;  4DO2 A;  1AJN A;  1BHB A;  2KG7 B;  3F7V C;  1QCE A;  1WJZ A;  3ETD A;  1O9G A;  2XT9 A;  2HHH O;  4NXN B;  5JVD A;  2CGN A;  4U7N A;  4ZKI A;  4DR5 O;  3GB7 C;  3MAQ A;  3R66 A;  3PN1 A;  4IGG A;  1DLB A;  1SET A;  5H9C A;  3RWR D;  4JZ2 A;  1IBK B;  1XNR O;  2DOS A;  1VQK V;  1X4T A;  1OCR B;  1FJG O;  2A9H A;  4MT8 A;  5BR8 B;  4G2K A;  5CA3 A;  4O2A B;  3IAY A;  4J9Z B;  5DM6 V;  3CCS V;  4H13 B;  4FLY A;  2P4V A;  5CA0 B;  1SA0 B;  4DR4 B;  2EIM C;  5CA1 A;  4OXS A;  1I5Y A;  4EB6 B;  4B3R O;  1NTK H;  1VAR A;  5B1B B;  4FLV A;  1M56 B;  1TUE B;  2JS5 A;  2WAM A;  5GON A;  2UUA O;  2WPD G;  3OFN G;  5L3B A;  4DV5 B;  4FFB B;  3E8B A;  1V55 B;  3MDS A;  4JI0 B;  3LDE A;  4GKJ O;  2IJH A;  1ZX3 A;  3JAS A;  2B5U A;  3CEI A;  3P30 A;  4I0X B;  1K33 A;  2LJ2 A;  1SQV H;  2O57 A;  2R70 A;  3J81 N;  4H44 B;  4YY3 B;  1FAF A;  1Q6I A;  2YXL A;  2X7R B;  3ETE A;  3VBB A;  5C93 A;  2Z0A A;  2BTQ B;  4JTA B;  1SQB H;  1VF6 A;  2V4D A;  5FPR A;  2VWK A;  3CE2 A;  1MZE A;  1IUR A;  1KP2 A;  4LWS A;  3CCU V;  1FKA O;  2DE0 X;  3ABK B;  2P7T C;  1DGS A;  4LF9 O;  5KAF Z;  1QVG U;  5DEC A;  3T2M A;  1NJI W;  2UXD B;  1HW7 A;  3BEH A;  5B1O A;  1HNW O;  1MSW D;  1RPR A;  4J9Y B;  2ADQ B;  2FTK A;  2XAJ A;  3K5M A;  1WPX A;  1OZ0 A;  2Q4P A;  4MVU A;  3CCV V;  1SC5 B;  3ABT A;  4RWU A;  1V54 B;  4U3J B;  1EN4 A;  4BWA A;  2YEV B;  3L73 H;  2BOB C;  5BXZ A;  1Z2G A;  4PA3 A;  2BTO A;  1PKX A;  3CCR V;  3CCL V;  1AR1 B;  1OV9 A;  1R6T A;  4X8A A;  3ZBH A;  2OWO A;  5JCO A;  5D5P A;  4DV6 B;  3OTF A;  3E83 A;  2B9Z A;  1PPJ H;  2B1I A;  3DGE A;  4X20 A;  2QM4 A;  3ZRV A;  2QJ1 A;  4Z1V A;  3CMA V;  1VQ9 V;  3BVO A;  4NR1 A;  1JA8 A;  3AK3 A;  3WG7 C;  3K03 A;  2AHZ A;  2DN9 A;  5FPO A;  2VWJ A;  5IJ9 A;  4LF8 B;  5C8Y A;  2Q7E A;  2JEX A;  1GKF A;  2JDI G;  3ASO B;  4DR1 B;  4PA7 A;  2ETN A;  1N36 B;  4DV0 B;  2L35 A;  3HKC A;  5K1X A;  1IVS A;  2EIN B;  1YVW A;  1YZB A;  4HBN A;  3D8C A;  4MSW C;  2ADP A;  1AB3 A;  3K58 A;  5C8Y B;  1NI8 A;  2QKS A;  3S3X A;  1DK1 A;  3BCC H;  2ZIO A;  5EK0 A;  1L8D A;  3W7U A;  1XUQ A;  1E1R G;  5KX5 B;  5IYZ B;  2JRI A;  2CAZ C;  4WFF A;  4DUY O;  2W0X A;  3RT3 C;  5FLX N;  2HHH B;  4Q20 A;  3LSS A;  1ENV A;  3STZ C;  4JYC A;  1IBL B;  5KMG B;  1T5E A;  3HKC B;  1F23 A;  4LFA B;  4DRX A;  3ZMS A;  1FJG B;  1W2B U;  1OJH A;  3SJB C;  2XAS A;  4DV7 B;  3CD6 V;  3CXC U;  1H2M A;  5IWA O;  1VQ5 V;  1GN6 A;  3K0D A;  1E1Q G;  2XAQ A;  1CEZ A;  2VRZ A;  5KLV H;  2ZE7 A;  3F7Y C;  1Y67 A;  1FXK A;  3MHH C;  4GX1 A;  4Z2W A;  3CRA A;  1GMG A;  1G8M A;  3UT5 B;  4YXW G;  1FFT B;  5LA6 B;  4XBF A;  3UQ8 A;  2X6C A;  3E35 A;  2DJV A;  4PA9 A;  1KU9 A;  3JAW A;  1Y74 B;  2OCC B;  2VQE O;  5EZY A;  2EJ7 A;  3TXS A;  4A5U B;  3JAL A;  4CC5 A;  3STL C;  4HYO A;  4JAA A;  5LGU A;  4PDM A;  1K9M W;  3CX5 F;  2D2C B;  4YIO A;  4FLX A;  5H5N A;  4J10 A;  2QR4 A;  4LCU C;  2JK5 C;  4K0K O;  4MTX A;  3N27 A;  4DR6 O;  3ZMV A;  2WLN A;  3QF7 A;  5LGT A;  1Q3E A;  5JVD B;  1B04 A;  2DYR C;  3K9S A;  5EC1 C;  1AI7 A;  4P2Z A;  3ASO C;  5K1P A;  1ZAU A;  1JMK C;  2Z5U A;  1YXB A;  2JJ1 G;  3ZN0 A;  1H2S B;  2QKC A;  1J5E B;  4O2B A;  2QM7 A;  1I94 O;  3B77 A;  1US6 A;  4JAV A;  3D3Q A;  2FYU H;  3ZRS A;  1M4U A;  1HNW B;  5BMV B;  1B6Q A;  4RQE A;  1BT8 A;  3HKB A;  3C3T A;  4GT1 A;  1VEW A;  3SYQ A;  5JQG B;  1YIJ V;  4NXM B;  4K3A A;  1K5Q A;  5JJN B;  5J2U A;  1M90 W;  2E74 B;  3LSU A;  2F1M A;  4OPH A;  3RYF A;  1VF7 A;  2DWE C;  1YJN V;  3HKD A;  4J7K A;  4JI2 O;  3Q4H A;  2EZP A;  1R73 A;  2IU0 A;  4CS3 A;  1XNQ B;  2RDC A;  2WLH A;  1YJW V;  3AG7 A;  4JGS A;  1N4C A;  3AG3 C;  1TA8 A;  4JV5 O;  1XDC A;  4LNU A;  1NZ6 A;  1ZUQ A;  4JI7 B;  1QLE C;  2CK3 G;  4LF8 O;  4PI2 A;  1Q81 W;  4IHJ A;  4DR1 O;  3U10 A;  4Q6G A;  2E76 B;  4LH7 A;  1FS0 G;  3UT5 A;  3C3S A;  4GX0 A;  4X65 O;  4X66 B;  2W6I G;  3JSL A;  2YIC A;  1XI1 A;  1DF4 A;  4DV1 B;  1ZTE A;  4DUZ O;  2WLL A;  1SQX H;  2P22 C;  4G28 B;  4QJF B;  1R1B A;  4HNA A;  5LHI A;  1URF A;  4E4E A;  1XIL A;  2C2A A;  1SF9 A;  1CXZ B;  4CS2 A;  5LL6 Y;  4PJ0 Z;  4QE9 A;  4J11 A;  4O4I B;  3JD2 A;  4F6R B;  1WAZ A;  2JEU A;  3ZJZ A;  1IBL O;  3E2E A;  1WP8 A;  4GX2 A;  2W0F C;  4UUJ C;  4X1I A;  2AGA A;  1MMM A;  4UCU A;  1K97 A;  1SZT A;  2ZM6 B;  1RM1 B;  4FM1 A;  2ITD C;  2EIL B;  4DV7 O;  5CBG A;  4KFM A;  4PHZ A;  2Q5Z A;  5IWA B;  2ZIM A;  5LP6 B;  3F5W C;  3ML0 A;  1PP9 H;  2QWQ B;  3IC9 A;  3CME V;  2FB5 A;  3NXS A;  1KKD A;  1R3J C;  1YI2 V;  4QGP A;  1TVK B;  1FFX B;  3W7X A;  1EN6 A;  4C7U A;  5FNV A;  1Y6X A;  4UV8 A;  5IJ0 B;  1S3J A;  1W0J G;  3SJQ C;  3F5T A;  3RYH A;  1NR7 A;  4HZ3 A;  3W7T A;  3LNN A;  4ZI7 A;  1HWY A;  1OCR C;  2WWW A;  1ZWI C;  3CC2 V;  2YID A;  4I50 B;  4X1Y A;  2VQE B;  1NS1 A;  4P9O A;  3RYI B;  1GN2 A;  4FLW A;  3SPG A;  5EC2 C;  2YI8 A;  4LF5 O;  4YJ2 B;  4DR7 O;  1H2N A;  1QLN A;  1KD1 W;  4GYC B;  1W59 A;  2CUG A;  3OTO B;  3T1H O;  2RN9 A;  4GX5 A;  3ZMZ A;  4K0K B;  2FL4 A;  1BL8 A;  1VF6 C;  4O4I A;  4N23 A;  1EZV H;  1IX9 A;  5KHK A;  3SPI A;  1NT2 B;  4LP8 A;  3JAK A;  4TV8 A;  5B3S B;  5E79 Z;  2QSA A;  4X89 A;  3CJH B;  2BE3 A;  3DXR A;  1M57 C;  2K9P A;  1M5I A;  1THZ A;  4JYA O;  1I94 B;  1SER A;  4JZG A;  1GH6 A;  4UVB A;  1U96 A;  4FLZ A;  4I4T B;  4DV4 O;  2Y69 C;  3FAV B;  4F6E A;  1ROP A;  3WB0 A;  3KKY A;  4WFE A;  1K7D A;  3SJC C;  3DC5 A;  1XMO O;  4XDK A;  2EX3 A;  1I5X A;  3ABM B;  3OM3 B;  4AHC A;  4DR5 B;  4JI3 B;  3HPL C;  4FVM A;  4DR3 B;  5CB4 A;  2A7W A;  1GAX A;  5LGN A;  2UUB B;  3UO2 A;  3OUF A;  1OCZ B;  2OCC C;  1GM7 A;  3VQY A;  1XNQ O;  2P6J A;  4UCR A;  2ZDI C;  4HAM A;  1VQ4 V;  3LDD A;  3ZMU A;  3RW0 A;  3FB8 C;  4X1K B;  1R3K C;  4CBC A;  1K34 A;  1GRJ A;  3TCU A;  3BHP A;  4YHH O;  2GTA A;  3CCQ V;  2ZE6 A;  4U7O A;  4B3R B;  1HDJ A;  3H1L H;  3O65 A;  3RGB A;  4MTF A;  4NTW A;  5LA6 A;  2JGU A;  1LUV A;  1JFF A;  2GSM B;  1SES A;  4Z1M G;  1LR1 A;  2BOC C;  3JAT B;  2CTQ A;  2PF4 E;  3OW2 U;  4BIU A;  1BSM A;  3JCU Z;  4MVR A;  2A0L A;  5GTH Z;  3EVK A;  3ICX A;  4YJ3 A;  4DUZ B;  3B4S A;  1KEC A;  3KG2 A;  4LFB B;  1RP3 B;  1WA8 A;  1R6N A;  2XTA A;  1GN3 A;  1HR0 B;  5B5E Z;  3T1Y O;  1KP3 A;  3CS5 A;  1WB8 A;  3K3W A;  3QO5 A;  4LF9 B;  3WB2 A;  2GHY A;  2UXD O;  3K04 A;  2QWP B;  2WA3 A;  1UPG A;  4PD4 F;  5IJ9 B;  4I50 A;  5IYD O;  1V54 C;  2DQ3 A;  3ZHS A;  2KG7 A;  1NKD A;  4I9W A;  3ZED A;  1JPX A;  5LMN O;  1E79 G;  1ZL8 B;  2CGO A;  2IH3 C;  1QU7 A;  1KMI Z;  2LGQ A;  4FK5 C;  1TUB A;  1F4M A;  2VQF O;  3IJ4 A;  3W7S A;  3AEI A;  3CB2 A;  1XEQ A;  4JI5 O;  3N2G A;  2OTL V;  3L74 H;  4DV6 O;  5EZY B;  4X1I B;  3AG2 B;  2ZNJ A;  4LF5 B;  1KQS U;  2HP8 A;  1P7G A;  4UCO A;  1SKV A;  2LFS A;  3E8F A;  4TQD A;  5BMV A;  1W0K G;  4UB8 Z;  5LMU B;  5GW7 A;  1BMF G;  1XBL A;  1N8R W;  5EIB C;  5LHG A;  5IYC O;  4AI8 A;  3J80 N;  1GK9 A;  3JAL B;  4X1K A;  2K1E A;  2ZIN A;  2PUS A;  4IYH A;  1JOY A;  2F43 G;  1P84 F;  2YIB D;  4DV0 O;  4IIJ A;  1XMQ B;  4MW3 A;  1Q5O A;  3ZHQ A;  1YCI A;  2H3O A;  3UKM A;  3BA9 A;  3WG7 B;  1PNM A;  3SPC A;  4JYA B;  1VP7 A;  3A0R A;  4DXW A;  1SQP H;  3DXR B;  4JI6 O;  4DV4 B;  1MAB G;  3B8M A;  2UU9 B;  3AK2 A;  3JD1 A;  1Q82 W;  3RN4 A;  4DUY B;  3OT7 A;  3ZHT A;  1K4D C;  2PYJ A;  3BFR A;  1WPB A;  4OGQ B;  4FM0 A;  3FAV A;  1FXK C;  4DR3 O;  4ZIB A;  1R3I C;  3BAA A;  1K5S A;  4O4J B;  4B3T B;  2YSU B;  3THO A;  2UUB O;  4LFA O;  3JSN A;  2DQ0 A;  1VQ8 V;  4NVP A;  2JGD B;  4PEL A;  3CCM V;  2D3O W;  3Q4H B;  5L3G A;  3KZI Z;  1NU1 H;  1OCO C;  3WB1 A;  3DSQ A;  4LF7 O;  3OGI B;  3P32 A;  3CXH F;  2RCV A;  5KUK A;  3CCJ V;  2OIE A;  4FLU A;  4YHH B;  2QTO A;  3HKE B;  3G71 V;  4X62 B;  2XND G;  3HKB B;  2GUZ A;  3J7A U;  4GKK O;  4FZ1 A;  1K3E A;  2PTM A;  1RSO B;  1RPO A;  2EIJ C;  4QNH B;  5LYJ B;  4KUM A;  4NYK A;  3QTC A;  2QWN B;  4PDL A;  5CA0 A;  1Z5V A;  2QWR B;  2Q6A A;  3AG1 C;  4JI8 B;  2BCC H;  3KCX A;  5L3D A;  1YF2 A;  5IJ0 A;  1I7F A;  4DR6 B;  5LYJ A;  2KB1 A;  2PGG A;  2IH1 C;  3B2E E;  4HNA B;  2L6L A;  4J7Z A;  4NKG B;  1H2G A;  3SR2 C;  1YIT V;  3T1Y B;  1EFR G;  3MHS C;  1YTF B;  1M1K W;  1J5E O;  2RNB A;  3EHB B;  2YEV A;  1IXM A;  2ZNI A;  4TV9 B;  1WP7 A;  2WLJ A;  4ZBM A;  2QGN A;  1HNZ B;  4NXM O;  1SZX A;  3E8H A;  1NVP D;  2JGD A;  4L8J A;  3JD0 A;  2F95 B;  1PNL A;  4NB5 A;  1PV0 A;  3RVY A;  4P30 A;  4H0L B;  1Q43 A;  4UVC A;  3AK1 A;  1MZF A;  1JJO A;  1D5N A;  1S72 V;  1VQO V;  2ZQM A;  3OEE G;  2YI9 A;  2ZD9 A;  2ZXW C;  5J9P C;  4FIP C;  2F4V O;  4UCS A;  4JTC B;  4NTY A;  4LR3 A;  3CCE V;  3N2K B;  2EIK B;  1B3Q A;  4JV5 B;  2OYQ A;  3RYC A;  4KHP O;  2UXN A;  3SYC A;  3H1J H;  1VQP V;  2Q69 A;  5LP6 A;  1V9P A;  3FFQ A;  1AI4 A;  2LFR A;  4FJC C;  5JCO C;  2P5O A;  3H1H H;  3UO3 A;  3D36 A;  5IYB O;  3CJH A;  3BAB A;  3K08 A;  5F2V O;  5LP6 C;  1OCZ C;  4O2B B;  4X66 O;  4JI6 B;  4MVZ A;  4B7K A;  2UU9 O;  4DK1 A;  3E89 A;  3O9O A;  2YXH A;  3U0Z A;  4DV1 O;  1MOF A;  1NH2 B;  4FLT A;  4FFB A;  1YHQ V;  1EBO A;  2E5L B;  1PD3 A;  4P9P A;  2V1D A;  1I0H A;  5LXT B;  3U11 A;  4J42 A;  1N32 B;  3K06 A;  2EBO A;  3FKS G;  1D5A A;  2F66 C;  4UCV A;  3SPH A;  2AZ2 A;  2Q68 A;  2HVJ C;  4CH5 A;  5CA1 B;  2ZM6 O;  5B1A B;  2HVK C;  4WCE V;  1XQ8 A;  4X88 A;  3AG2 C;  1NQT A;  4QIW F;  4TSF G;  4MS2 A;  1SA0 A;  4BIZ A;  3CRQ A;  4LF7 B;  2ZDI A;  2Q9L A;  4ZI7 B;  2W6J G;  4MVM A;  5LHH A;  4D7S A;  5KHI A;  4DV3 B;  4UXN A;  5LBQ A;  1LNQ A;  4PV1 B;  3CHX A;  2HEP A;  1NBM G;  5JJJ B;  1CPY A;  1GN4 A;  5A2Q N;  4AQY O;  2EIM B;  4PA4 A;  4ABM A;  5H6R A;  4ICG A;  1Q90 D;  3E8G A;  4GKK B;  4DYL A;  2G38 A;  3JAS B;  4LFC O;  2YIB A;  1PM9 A;  2IBZ H;  4LF6 O;  1J95 A;  4DR7 B;  1XL4 A;  4IYI A;  4WFB V;  4JI8 O;  2DYS B;  3A0H Z;  2X0L A;  4I7Z B;  3ZIA G;  4PA6 A;  1RSO A;  4WFA V;  4D7T A;  3JAT A;  4RAI A;  3M99 B;  3C90 A;  4LH6 A;  1ZL8 A;  4JYY A;  2M6Y A;  4JF3 A;  1JFF B;  1AJP A;  2XAH A;  2R9R B;  5J2T B;  3PJS K;  2UXC O;  4EKW A;  5EBM C;  3ABL B;  1EZJ A;  4TUY A;  4LC1 A;  3FYE B;  4YIP A;  1U97 A;  1SS3 A;  2KSD A;  3ZHR A;  1BS3 A;  5B1N A;  2FKX A;  2QWO B;  3SYP A;  2Y69 B;  3ABK C;  2IJJ A;  3IGA C;  4R8C A;  2Q0A A;  5EYP B;  1VIB A;  3OUS A;  3L75 H;  1F7Y A;  1WNS A;  1GO3 F;  1S77 D;  1FD9 A;  1HNZ O;  3LSQ A;  4DK0 A;  2QA4 V;  3HR0 A;  2LQT A;  1XMO B;  3OMA B;  4JI1 O;  5A9G A;  5IE9 A;  4JI3 O;  3P3N A;  3OEH G;  3JAR A;  4I5S A;  3N2K A;  1KB9 F;  1M56 C;  2ZR2 A;  2IW5 A;  3OR6 C;  1X59 A;  1VQ6 V;  1OHH G;  1NH2 D;  4OPA A;  4R6Z A;  3OGC C;  4JTD B;  1DF5 A;  3A8T A;  2F4V B;  4ZHQ A;  1LUW A;  4F6R A;  4J7J A;  2UUC O;  1JJ2 U;  2P4K A;  1TVK A;  2Q73 A;  3W7W A;  4B3S B;  2EUL A;  5D5Q A;  4LF4 B;  2EZO A;  3TET A;  2DMX A;  4I55 B;  3R65 A;  3SYA A;  1K8A W;  3I56 V;  4KHP B;  4DV2 B;  3H9V A;  4TOI A;  5IT9 N;  3WU2 Z;  2N74 A;  4ZOL B;  4IL6 Z;  1IXB A;  2NLJ C;  1Q86 W;  3FYI B;  4FMT A;  3G6B A;  4OX9 B;  3JYC A;  4PI0 A;  3B09 A;  2KKW A;  2Y4U A;  4O4J A;  2QEX V;  3OR7 C;  4TQF A;  3H1K H;  2JJ2 G;  4GCZ A;  2Q8V A;  1YDX A;  5B3S C;  4R50 A;  1BHA A;  3HB3 B;  5CB4 B;  5KMG A;  2AHY A;  2PI4 A;  2H8P C;  3T4D A;  5B1A C;  1MA1 A;  1ORQ C;  3APQ A;  4CS4 A;  1VMG A;  4RQF A;  4BW5 A;  3ABL C;  1H8E G;  4LFB O;  1FXV A;  4MVO A;  1FYJ A;  3ABM C;  2OTJ V;  2IM9 A;  1NTZ H;  2WLI B;  3L72 H;  3MD0 A;  1HR0 O;  2CDY A;  2HKO A;  1QBZ A;  1EM1 A;  2ZE5 A;  1N32 O;  4UV9 A;  4ASU G;  1AP5 A;  2A3Q A;  1AIL A;  3LDC A;  1G1X B;  1SQQ H;  5LMN B;  2V7Q G;  4E2L A;  3L9D A;  3RFR A;  2M7W A;  2VQF B;  4PDR A;  4MTO A;  1SQF A;  4GUN A;  2ZCE A;  4U3F H;  2PI5 A;  1R3L C;  4JI5 B; 
#chains in the Genus database with same CATH homology
 4OPH A;  3M8A A;  2VQF O;  4DR5 O;  2UUC O;  3R66 A;  5A2Q N;  4DV2 O;  4JI4 O;  4AQY O;  4X62 O;  1XNQ O;  1XNR O;  2DOS A;  1XEQ A;  4NXN O;  5IWA O;  2F4V O;  2ZKO A;  1FJG O;  4JI5 O;  3SDL A;  4JI2 O;  4OX9 O;  3F5T A;  5BXZ A;  5IT9 N;  1IBK O;  4LFC O;  2N74 A;  5LMU O;  4DV6 O;  1R6T A;  3J7A U;  4LF6 O;  3JAM N;  4GKK O;  4YHH O;  4KHP O;  1NS1 A;  4JI8 O;  5BR8 O;  3O65 A;  2DJV A;  4LF5 O;  4DR7 O;  4JV5 O;  1D2D A;  2VQE O;  4A5U B;  3J80 N;  3T1H O;  4B3R O;  1XMQ O;  4DR4 O;  4LF8 O;  1N33 O;  2UXC O;  4DR1 O;  2E5L O;  4X66 O;  4LFB O;  1KUQ A;  4DV0 O;  5BY1 A;  2UUA O;  3OTO O;  1FYJ A;  4JI7 O;  2UU9 O;  1IBM O;  5H5N A;  2FKX A;  2LW7 A;  4K0K O;  1N34 O;  1HR0 O;  4DV1 O;  4GKJ O;  4DR6 O;  4X65 O;  1N32 O;  4JI6 O;  1HNX O;  1F7Y A;  1A32 A;  4DV5 O;  1J5E O;  1YZB A;  3J81 N;  1HNZ O;  4JI0 O;  3T1Y O;  4DUZ O;  4JYA O;  1AB3 A;  1N36 O;  1R1B A;  2Z0A A;  4B3T O;  1AIL A;  4DV4 O;  1DK1 A;  4JI1 O;  2UXD O;  2ZM6 O;  5LL6 Y;  4YY3 O;  1G1X B;  4JI3 O;  1I94 O;  1FKA O;  2JRI A;  4NXM O;  4DR3 O;  1IBL O;  4LF9 O;  4LFA O;  4DUY O;  1XMO O;  2UUB O;  3RT3 C;  5FLX N;  4DV3 O;  2AGA A;  4DR2 O;  2UXB O;  1X59 A;  4DV7 O;  5LMN O;  4OPA A;  4B3S O;  1HNW O;  4LF4 O;  4X64 O;  4B3M O;  2HHH O;  4LF7 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...