5IWAO

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S2
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5iwaO00
4YHHO 1N34O 1XEQA 4JV5O 4LF7O 1I94O 1IBKO 4LF9O 1AB3A 1DK1A 4DR1O 4OPHA 4JI6O 3J7AU 2HHHO 2JRIA 5LMNO 1J5EO 1A32A 1XMOO 1G1XB 4DV4O 1FJGO 4OX9O 1HNXO 1XMQO 1IBMO 2E5LO 5H5NA 5BXZA 1HNWO 4GKKO 4GKJO 5BR8O 2ZKOA 5LL6Y 4DV7O 1XNRO 4B3RO 4DR7O 1R1BA 4NXMO 4JI8O 1NS1A 2UXBO 1N33O 4JI3O 2DJVA 2N74A 3T1HO 1KUQA 1YZBA 4LFCO 4DR2O 2VQFO 2UUAO 5FLXN 2Z0AA 4JYAO 4LFAO 1X59A 5LMUO 4NXNO 4YY3O 5A2QN 4JI0O 3J81N 4DV3O 2UXDO 3RT3C 1R6TA 4DR5O 4X64O 4JI4O 4LF8O 5IWAO 1HR0O 1FKAO 3OTOO 2UU9O 1F7YA 4JI5O 4DR3O 1HNZO 4X66O 5IT9N 4DV0O 4DV5O 5BY1A 1AILA 2ZM6O 3F5TA 4B3SO 4DV2O 2DOSA 4DR4O 4JI2O 3SDLA 1D2DA 4K0KO 2LW7A 2FKXA 1N36O 2AGAA 4DV6O 4DUYO 1N32O 4B3TO 4DUZO 4DV1O 4OPAA 4DR6O 4LF5O 3JAMN 2UUCO 3O65A 4A5UB 3J80N 4LF6O 4LF4O 4X65O 4B3MO 4AQYO 2UXCO 3M8AA 2VQEO 4X62O 3R66A 2F4VO 4LFBO 4JI7O 1XNQO 4KHPO 1FYJA 1IBLO 3T1YO 4JI1O 2UUBO
chains in the Genus database with same CATH superfamily
2HJFC 1S3JA 3UKMA 2YC0A 4JI0B 1PL0A 3E35A 1GN2A 1US6A 2DWEC 1AB3A 3OEHG 4J7JA 4MVOA 4J80A 1XI1A 1JA8A 2E76B 1PPJH 1V9PA 4WFGA 4PJ0Z 4DV5B 1JMKC 1MNGA 1CXZB 1H2NA 2UXCB 3AG7A 1VF7A 1BL8A 3CB2A 3A2FA 4NTXA 3M99B 1XNRO 2JEXA 2Q6AA 1M93A 1L0LH 2BOBC 2IJJA 4HNAB 2DJVA 3D3IA 4RO2A 4LWSA 2Y0IA 1RPRA 4DV1B 2ZD9A 4O2BB 1S5JA 3LUTB 2GUZB 3CCJV 4FLXA 2MW2B 1Y67A 4Z2WA 5J2UB 3A0BZ 1FAFA 3AK2A 1NT2B 4AHCA 4X1KA 1YVWA 3G67A 3CC7V 1OCCC 3CSXA 2W0XA 4DV0O 4JAUA 4FLVA 5B3SB 2Q5ZA 4IL6Z 4DV2O 5ITZA 3TGUH 3CJHA 4J7KA 1JFFB 1VQ7V 3SDLA 4TUYA 1I5YA 1FFXB 4JYCA 1Z5VA 2LW7A 3IC7A 2VQFB 4DK1A 3FX7A 1KBHA 1N32O 5JCOA 5CB4A 3HKDB 1IVSA 1K92A 3OR7C 3CCVV 2ETNA 1M9NA 2VRZA 2Q68A 3JD3A 3SYQA 4FLUA 1OJHA 3PN1A 3JD4A 5L3EA 1B6QA 2UUBO 2YIDA 3K5OA 2L6LA 3ZEDA 2NN4A 1W59A 2EIMB 1N34O 2EX3A 5HFLA 1VEWA 3SJCC 4NVPA 1RM1B 4CBCA 4MTGA 2JRIA 1J5EO 3WFVA 4DV4O 3JAKB 5J9PC 1HNXO 1JVMA 4X66B 1WB8A 3L74H 4I55A 3ETGA 3CHXA 2ZE7A 2EBOA 3JSLA 4E2LA 3CP1A 4DV7O 1QLEC 1SQVH 4ZHQB 3W7WA 1N33O 3RW0A 1KUQA 1DLBA 3E22B 4JTDB 4OXSA 3ABMB 3P32A 2QM4A 1IBKB 3F5WC 2MK3A 1PKXA 4LF6B 3A0HZ 4I5SA 1QCEA 1VQ8V 2ITCC 2HVJC 5KHGA 5KAFZ 1IURA 4GX1A 1V55B 2KG7B 2HVKC 1E1RG 1YXBA 1G8MA 2UU9O 2KKWA 4LR3A 3VBBA 5IY5B 3OW2U 1P4RA 3HR0A 3AK3A 3ABTA 2QKAA 2RQ6A 3C3TA 4JGSA 3MDSA 4DR4O 2IH1C 3T1HB 3IAYA 1F23A 4GT1A 4X1YB 4WCEV 2QA4V 2OTLV 4DUYO 1K9MW 4P30A 3CCLV 1SF9A 1SQXH 4L8JA 3K5NA 5LA6A 3C3SA 4I4TA 4JYBA 2X7RB 5J2TB 4I9WA 2VQEO 2RNBA 3E8BA 4NXMB 3CCMV 3BEHA 5D5QA 5EIBC 4PA6A 2PI4A 3HKCA 3AK1A 5EYPB 1XEQA 2GSMB 3P30A 3MHSC 3CCRV 4BIZA 4J9YB 3JASA 4L87A 4K8XA 2DE0X 2E75B 4DW0A 3IC9A 1M90W 4OX9O 1JPXA 4YJ3B 4YIOA 2EJRA 1HNWO 5L3BA 1MA1A 5JVDB 2Q0AA 1WB7A 4HAMA 1IXBA 2JGDA 2Q9LA 2CTWA 1JX9A 2QWPB 2QSAA 1Z5WA 2JS5A 4FVMA 2F95B 1Q3EA 5KUKA 3ABLB 4JZ2A 3J81N 4TQDA 1MZFA 3K3WA 1RPOA 3FKSG 3GWOA 4NR1A 5IYBO 1IBLB 4JI5O 5EZYB 3CD6V 2EIMC 1L1FA 1QNMA 5IYCO 1BHAA 4W4KA 2Z5UA 2X6AA 3N2KB 2EILC 3BPZA 3OGIB 1ZUQA 2M7WA 1RSOB 1YTFB 1D2DA 1NTZH 1KP3A 4DR2B 4BW5A 2WA4A 5KA6A 1NTKH 2Y4UA 1FXHA 2XNDG 2HG5C 1XMOB 1SA0B 4DV6O 1P49A 4B3TO 3H9VA 2ZE8A 3UCSC 2DWDC 1R73A 2AZ2A 1I0HA 2Q4PA 1AR4A 2PGGA 3ZMTA 4KHPO 4I7ZB 3TCUA 2YUAA 3Q4HA 1WNSA 1BGYH 4YHHO 5F2VO 1QU7A 1V55C 5JCOC 1ORQC 2LO1A 1PL4A 3ZN1A 1M5IA 3E83A 3JYCA 1FJGO 4DR3B 1OCRB 2YS8A 2QM8A 3QO7A 2YI9A 1SZXA 4QPKA 4PDVA 4EFEA 3HKEB 3IFXA 5LL6Y 5H9CA 3IJ4A 3AG2C 2FYUH 4LBEC 4DR7O 3T1YB 3BABA 3LSUA 2Z0AA 4O4JA 5B1BC 3SPCA 3AG4C 1K5QA 3ZIAG 2QGNA 4F6RA 3ABKC 3OMNB 4U3JA 4UV9A 3K5MA 1R6TA 4O4IA 5KHHA 4LF8O 4UFZA 2PYLA 2WLLA 4HYOA 1U97A 4UV8A 4LFBB 4TV8B 4CS4A 5B5EZ 2X6CA 4NTYA 4DXWA 4K8ZA 2BSKB 4FLWA 2PI5A 5CA1B 2K1EA 3GVMA 2N04A 4QE9A 3THOA 2UXNA 2ZXWB 4MVQA 1YHQV 4TOIA 2A3QA 5LGNA 3ZRSA 1TVKB 3JCUZ 3L70H 4CC6A 5IE9A 1WPBA 5E79Z 2AGAA 1VARA 1YJWV 2XAHA 2LJ2A 4D7SA 4LF5O 5KLVH 1H38A 3D3QA 4MT8A 1KECA 4X62O 1TUEB 4MVRA 4HBNA 1Q8IA 2F4VO 2JIZG 1M4UA 3UO3A 1SQPH 4ZKIA 2UUAB 1FYJA 4DV2B 1OCOB 3SYOA 1AROP 4FM1A 2NR5A 4DYLA 2WLJA 4IT5A 1QR9A 2WLIA 4IIJA 5HFMA 3J7AU 4YJ2B 3OUSA 3L75H 4QNHB 4PD4F 3ASNB 4JPRA 4PI0A 3EVKA 2V4DA 2ZM6B 1DF5A 4UCOA 1IZ3A 5FNVB 3H1LH 1K5SA 1MOFA 4K0KB 2ADQB 2R9AA 1S0VA 3QG5A 4XDLA 1N36B 1AI5A 4QPJA 4DUZB 1X59A 1AR1B 4X65B 4B3MB 3B8NA 4UCSA 5C8YB 4JI4O 4GX0A 3ZHQA 2YEVA 4DV4B 1FKAO 3OTOO 4XDJA 2Y48A 2ZIMA 3G6EV 2JJ2G 3ZHRA 4IYIA 3I56V 1HNZO 4DV7B 5CA0B 5LHHA 1J95A 2IH3C 1PP9H 1CPYA 1N33B 4WFAV 1I94B 3ASOC 2HP8A 2YIBD 3ZMUA 2A0LA 4RWUA 5L3DA 1FXKB 5IYDO 3RWRD 4R8CA 4CZZA 2OT5A 2UUCO 4GKKB 3FB6C 3G80A 3CXCU 1Z2GA 4H0LB 3K5LA 1NJIW 2ZNIA 3A8TA 4HNAA 1VQ5V 3ZCCA 5LXTB 3BFRA 1GAXA 2YIAA 3F7YC 3VQYA 4KFMA 1VQOV 2K9PA 4O2BA 4DR4B 2GUZA 1VQ9V 4O4HB 5J2UA 3LSSA 3B77A 4X64B 5IWAB 1DK1A 1R3LC 3D36C 5EBWC 3HKBB 3SPGA 1G1XB 1W0JG 1XMQO 1Q86W 3RYFB 3CRCA 2JJ1G 5KAIZ 5BXZA 4GKJO 2VQEB 3RVZA 4EFBA 5BR8O 4CS2A 3CS5A 1JFFA 2JGUA 2YICA 1FFXA 4UB8Z 2G38A 5BMVB 1LUVA 3ZHSA 3S3WA 4B3RO 5IJ9A 2WAMA 1AI6A 1ZAUA 3ETQA 2N74A 1SKVA 2GTSA 5LHGA 3K58A 4CH4A 1BHBA 5FLXN 4JYYA 4PA7A 4TQFA 4JYAO 4YXWG 1GM7A 3HKDA 4X20B 1FXVA 2GBOA 2KQXA 3BA8A 5CBHA 3DTUB 1T5EA 1HNWB 4BWAA 5CBGA 1OCZC 3VQXA 4FM2A 3F5TA 1E79G 4JI2O 1VP7A 1ZL8B 3T1CA 4JI6B 5DEDA 5LMNB 3JAKA 4H44B 1SESA 4FZ1A 3T4ZA 5LP6B 3CWBH 1WP7A 4DW1A 4RUFA 2IJKA 4LCUC 3L71H 4ZHQA 1ENVA 2A7WA 2IBZH 3ZMSA 4JI5B 4FLYA 1IDSA 3E22A 1V54B 1Y6XA 3JALB 1GN3A 4D7TA 1FPOA 1R3KC 3X2QB 4J42A 2XOKG 1THZA 4J10A 2ZDIA 3W7TA 1I7FA 2Y69B 1XREA 3ZHUA 2KG7A 1S76D 5L3FA 4DR1O 1NR1A 2CAZC 3DXRB 3N2GB 3E89A 1Q7YW 1A32A 2BE3A 1GTOA 4DO2A 4UCVA 4RQFA 3CCQV 3FB5C 1JR9A 1IBMO 2B5UA 1QLNA 3SPIA 2FMLA 3UQ8A 1KMIZ 2A06H 1XBLA 2HLDG 2CDYA 1K33A 3K06A 1M56B 5JJEB 3G71V 4PI2A 1PNLA 2QWQB 4X1YA 3M7MX 4JI3O 4YHHB 1YEWA 1VF6C 4CS3A 4LNUB 4GYCB 1Q82W 5J2TA 3B8MA 2NLJC 4P2ZA 4YY3O 3RYIB 2XTAA 2UXDO 4DV3O 1AJNA 2A9HA 4JTAB 2W6JG 2QR4A 2KSDA 4LH6A 4KP4A 1JJ2U 1FFTB 2JS3A 4UCUA 4JI7B 2OTJV 2HEPA 3E2EA 4Q6GA 5KUMA 5EYPA 3I5DA 2DQ0A 3BY6A 5EBMC 2DYRC 2Z3YA 1G4YB 4JI1B 2LFRA 2V7QG 3G6BA 4DR7B 1NI8A 1XUQA 4QIWF 1YTFD 4X9QA 4MTXA 2QJ1A 1N4CA 4X1KB 1K8AW 1Y4MA 5B1AC 4YJ3A 5H6RA 2EIJC 1VQPV 1NZ6A 4OPAA 3VQVA 4LF8B 4WF9V 1TAEA 5EC1C 4J41A 5JVDA 4U3FH 1DTOA 1LNQA 4TUYB 1VQ4V 4AQYO 3P3PA 2QWOB 3G4SV 2V1DA 1SQFA 1JOYA 1KYOF 3ZRVA 3JD2A 4TV9B 1XOUA 4NXNB 4B7KA 4JV5O 4LF7O 3SJQC 1H8EG 2CTQA 2LGWA 3SJBC 4UXNA 4PHZA 5EZYA 3K08A 3CCSV 1QHTA 3FAVB 3UT5B 3N2KA 5IJ0A 2F23A 4X1IA 4CC5A 1RSOA 3RYHA 4X62B 1BCCH 1F51A 1Y74A 1I5XA 4PDLA 3OMIB 1URFA 4PA9A 4FK5C 2OCCB 2WLMA 4MTFA 2R72A 2XAGA 2UXBO 4QJFB 1DF4A 2XAFA 2P67A 1XILA 3ZMVA 2W6IG 1H2SB 4N21A 1PD3A 3JATB 3FB7C 4JI0O 5B3SC 1AI7A 4UUJC 2Q7HA 4LC1A 3BCCH 2CTPA 5DN6G 1Q6IA 2QE7G 2B1IA 5LHIA 4DV5O 5BY1A 3WB2A 2Y69C 3ETEA 3B4SA 4JTCB 5KMGA 3FFQA 1MSWD 1EZJA 3CCUV 5JJNB 3UO2A 3OT7A 3C90A 2ZE6A 3L73H 1ZSPA 2YXYA 2CTRA 2O57A 3AG3B 1O9HA 4DV1O 2Y0PA 1NR7A 2E5LB 3HKEA 3J80N 3T4DA 3CRMA 3WG7B 1GH6A 3KKYA 2GTAA 2OWOA 3FD9A 1VQ6V 2WPDG 3FYIB 3TXSA 3TETA 1RM1C 4BIUA 2XAQA 2YXLA 4LFCB 4U7NA 3TJTA 1HP8A 2EINB 4XDKA 1BZKA 1AP5A 1L8DA 1VQKV 4GLXA 4TV8A 4IHJB 3D36A 2R9IA 2PZSA 3LDEA 2BSKA 1O9GA 5CA1A 5C93A 4BAYA 3ABMC 4C7UA 3RFRA 5IYZB 1ROPA 3EXAA 3WB1A 1FD9A 4DRXB 4I9QA 5DECA 4U7OA 3OTFA 2ZDIC 1TVKA 3JD0A 5JH7B 2DYSB 4WBNB 2Q0OC 1Q81W 3ZN0A 3AG1B 4UCTA 4F6EA 5IY5C 1RP3B 1GRJA 3SPJA 4PELA 1WJZA 4LF4B 1ZX3A 1S72V 4FZ0A 1Y76B 1NU1H 5TISZ 3ZRXA 2ZINA 2R70A 4QE7A 1XNQB 5LYJB 4GKJB 1PNMA 3RGBA 1N0NA 4X66O 2ARHA 4B3RB 3HB3B 3DC5A 3QTCA 3JARB 3RVYA 4MTOA 3SPHA 1YCIA 1SQGA 3OR6C 4YJ2A 1R3JC 3CMAV 1Q43A 2P5OA 4JAVA 2XAJA 4A5UB 4B7EA 4LF6O 3OE7G 5FNVA 2LQTA 2EIKB 3K9SA 1QVFU 3K9AA 1XNRB 3M8AA 3VQWA 1M57B 1D5NA 3W7XA 4QGPA 4CH3A 3K57A 2FL4A 3U11A 4JI2B 4O2AB 1BQ0A 5C8YA 2WA3A 4B08A 4FFBB 2WLHA 2ATKC 1X4TA 1U96A 4DV0B 5CA0A 5H5NA 2CH7B 1H8HG 3ABLC 2ZKOA 3P3NA 4LP8A 1ZTEA 4NXMO 4MW8A 3L9DA 1FXKA 3N27A 1SQQH 1N32B 2ZQMA 3CX5F 1VF6A 1GM9A 5LOVB 3BVOA 5LMUO 4J9ZB 4H33A 4JF3A 4O4LB 1NKDA 2PYJA 4PDRA 3F7VC 4NKGB 1SQBH 1VMGA 5BZBA 5LXTA 1HDJA 5KX5B 2HKOA 3S3XA 2UUBB 1BT8A 4O4HA 4B3SO 5GTHZ 1N34B 5CMUA 3DSQA 3QVNA 1H2MA 5KA5A 2WLKA 4E4EA 3HKBA 2VWJA 3CXHF 4GUNA 2H3OA 2QKCA 1J5EB 3FB8C 4YY3B 2YSUB 3KG2A 1OCCB 1HNXB 4DV3B 3BHPA 4Q20A 1M1KW 5BMVA 5B66Z 3QO5A 5EIBD 2BTOA 3DGEA 4I50B 2GDSA 1NBMG 2ADPA 3AG1C 3ZRWB 4Z1VA 4NB5A 5GONB 5JQGB 2CK3G 2CGNA 2F43G 1IBLO 4X20A 1S77D 1OCRC 1WA8B 4FFKA 2VS0A 1NTMH 3JAWB 1R3IC 3WB0A 1EN5A 3AEIA 4OPHA 3APQA 2UU9B 4MW3A 1NH2D 2D3OW 3RYCB 4HZ3A 4X89A 1XMOO 2VWKA 4IYHA 4WFBV 5FPOA 2RCVA 4AQYB 2ZR2A 4MSWC 1PV0A 3SYPA 2JVDA 1ZL8A 3SYAA 2RMKB 1VF5B 3DC6A 4JI8O 4ZBMA 1VQNV 1W0KG 3HPLC 1P7BA 4DUYB 5LP6A 5H2FZ 4G28B 5IDJA 4LFAO 3K0DA 3ZHTA 3JD1A 3LDCA 2ITDC 3RT3C 4DR5O 2ZXWC 1QLEB 3ZX6A 3IGAC 1GM8A 3JSNA 3JALA 2C2AA 1F7YA 2YIBA 4DR3O 2PF4E 2ODMA 2JEUA 2BTQB 2E3CA 2YEVB 3B09A 3DXRA 3N2GA 4CH5A 4D6TH 4K35A 2ZE5A 3OMAB 3APOA 3E8GA 1Q6UA 4OX9B 1SS3A 4DR6O 2A79B 1AI4A 1BE3H 3O65A 1YSCA 1OCOC 4OGQB 3LDDA 4I0XB 5FL7G 1K4DC 2QEXV 3R66A 1KU9A 4LFBO 4EB6B 2HJDA 4ZI7B 2P4KA 4LNUA 4X88A 3ASNC 2LP7A 1TGOA 2AHZA 1N0JA 2LGQA 3RYIA 5KHJA 2ZCEA 4G27B 1EN6A 1XHZA 3BRCA 2WSSG 2Q73A 4PDMA 2F66C 1SRYA 3CMEV 1TUBB 3OAAG 4MVMA 4JASA 1K3EA 2IJHA 4PA4A 2GHYA 1MZEA 2HHHO 4FPPA 1AVMA 2KB1A 2YI8A 5L3CA 1KP2A 4CH6A 4XBFA 1B04A 4R6ZA 3GWKC 3K03A 4K3AA 5EBLC 4NTWA 4ZOLB 3BAAA 1YZBA 4DV6B 2UUAO 3LNMB 4UVCA 3CRAA 4GZRB 4B3TB 1NH2B 1YI2V 2FTKA 2EJ7A 4GCZA 2RDCA 4P9PA 4UVBA 1NQTA 5IJ9B 2DMXA 4BW9A 4J7ZA 1D5AA 2B9ZA 4KHPB 3H1IH 4TSFG 4TV9A 1FXKC 1SC5B 2H94A 2ZM6O 3LSQA 3H01A 4H13B 5K1XA 4K0KO 2HR3A 2DN9A 1N36O 3FAVA 3UT5A 4BR6A 1FJGB 3CRQA 4LWSB 4DUZO 3E8HA 1GMGA 2EILB 3CYOA 2XT9A 4X65O 4B3MO 1XL4A 3ML0A 5LGTA 3JCZA 1LUWA 3OFNG 4UB6Z 3STLC 3JATA 2XUMA 1NVPD 1ZLZA 1I94O 4LF9O 1MABG 5ITZB 3CJHB 3MD0A 4IGGA 4BIOA 3WU2Z 1B06A 3ZMZA 4FM0A 3MAQA 4WFHA 4GKKO 5H6QA 4WFFA 1YDXA 5CB4B 3I55V 1OZ0A 1VQMV 2IW5A 1R1BA 2QTOA 2IU0A 1WAZA 1KD1W 3QF7A 3OUFA 1S5LZ 2GV9A 3ZJZA 1KKCA 4LF5B 4RQEA 1KQSU 1E1QG 1XDCA 3B40A 1UJWB 4JZGA 3AG2B 2AHYA 5FPRA 4X64O 2F1MA 5IWAO 1HR0O 3H1JH 5CN0A 2P4VA 3SYCA 2F4VB 3SR2C 3U10A 5B1BB 3K0GA 2CUGA 2HFEC 3AG4B 5IT9N 1SA0A 4G2KA 5LP6C 3ABKB 1QQCA 1MSDA 1R6NA 4I55B 3CE2A 4FLTA 2DOSA 4GX5A 1K4CC 1YIJV 3OGCC 4RUEA 2FKXA 4IHJA 4MVSA 3CRRA 5B1OA 4ZIBA 5LMUB 1V54C 2AZ0A 1OHHG 3X2QC 2ZT9B 2UXXA 2F93B 5IYZA 1W2BU 4DRXA 1JQ0A 5EK0A 2P7TC 2QWNB 4AILC 3RBZA 1LR1A 2OIGA 5JH7A 2UXCO 4WBNA 1MMMA 4EEQA 5KHIA 2OIEA 4B3SB 1CEZA 1EBOA 3GB7C 1Y76A 4JI4B 1GKFA 2D2CB 1SZTA 2OCHA 5JJJB 3OTOB 4JI6O 4KL1A 1M56C 2DW4A 3NR7A 3ETDA 5LYJA 2L35A 3CPWU 5LMNO 5LGUA 1HNZB 4TT3G 2X6BA 3JARA 4J11A 2CGOA 4PA3A 5LBQA 3W7UA 3CC4V 1VIBA 5LA6B 2JK5C 4I4TB 1K97A 5A9GA 3UM7A 4ABMA 1NVPB 2QM7A 1NS1A 5L3GA 1F4NA 2B1GA 4LH7A 4Z1MG 2N05A 5IJ0B 2VQFO 2EULA 4X1IB 4FJCC 2UUCB 3HKCB 3RYHB 3CCEV 1JCHA 1Y74B 3SJAC 1L0NH 2E74B 1YF2A 1AR5A 3CC2V 4EKWA 3D8CA 3JASB 1H2LA 4R50A 1F4MA 3L72H 1WLEA 3STZC 1EM1A 5AG2A 5D5PA 2LW1A 4O2AA 1AILA 2RN9A 3O9OA 3CEIA 2CE4A 4JI8B 4FFBA 1KB9F 4MVZA 5GTIZ 4MVUA 4LFAB 2ZR3A 2JGDB 4YIPA 5GW7A 1P7GA 1SETA 5KMGB 1XMQB 2OYQA 5CA3A 2CH7A 2AXTZ 2PUSA 2X0LA 1DGSA 4DR5B 1B3QA 3ABUA 2H8PC 5BR8B 4GX2A 1BSMA 3ASOB 3TK1A 1QBZA 1XHXA 2NNUA 1IXMA 2Q8VA 1AJPA 1CP9A 4JI7O 3EHBB 1I08A 4R7CA 2WWWA 3ICXA 5LOVA 2Y4TA 4JYAB 4JI1O 4UVAA 4O4LA 3KCXA 1Q5OA 3K04A 2BCCH 3ZBHA 1KC8W 1IBKO 3LNNA 1R6KA 2OCCC 4DR6B 3E86A 5KX5A 4N23A 3NXSA 1FS0G 2QKSA 1MG1A 1Q6HA 1HWYA 4AI8A 3U0ZA 1IX9A 5E1AC 2YXHA 4ICGA 1H2KA 4FIPC 3RN4A 1BMFG 3T1HO 5CBFA 2QDOA 3SGIA 2P22C 3Q4HB 4NXNO 5A2QN 4I50A 2M6YA 4JAAA 2HHHB 3ZRWA 2P06A 1Y66A 1WPXA 2P6JA 5EC2C 5GONA 5JQGA 3H1KH 1COWG 3T2MA 1RFYA 2JDIG 1K73W 1YJNV 3TXQA 3AG3C 3E8FA 1WA8A 4F4LA 5K1PA 3JAWA 1XQ8A 3WG7C 1GO3F 4DR1B 3RYCA 2ZIOA 5B1NA 1GN4A 4W4LA 1OCZB 1BS3A 4X8AA 1OV9A 2Q7GA 4H37A 3PJSK 1IBMB 4PV1B 4O4JB 1BQZA 2EINC 2P90A 4P9OA 4WFEA 1HW7A 4KUMA 1QR8A 4UCRA 4F6RB 4U3JB 2R9RB 1Q90D 4O4IB 2AW9A 2Q7EA 2WLLB 2W0FC 4JI3B 3KZIZ 1XL6A 4FMTA 1UFIA 3RYFA 2QTSA 1ZWIC 2UXDB 3A0RA 2WLNA 4RAIA 3H1HH 2QWRB 1SERA 1K34A 3FYEB 2DYSC 1G6UA 1YITV 1PM9A 2BOCC 2ILMA 4DK0A 1GN6A 3R65A 1GK9A 1WP8A 2Q67A 1UPGA 2BTQA 3OEEG 5JWPA 2E5LO 1YJ9V 2XASA 3MHHC 4FLZA 3ZHVA 3KCYA 3BA9A 4LFCO 4DR2O 5KHKA 4LF9B 3K59A 4I0XA 2DQ3A 2RJZA 2XHBA 4MS2A 3EFFK 3W7SA 1AP6A 1PNKA 3B2EE 2WLIB 1QVGU 2FB5A 4EB6A 4ASUG 4ZI7A 4IIJB 1EN4A 1KKDA 1WN7A 1N8RW 1H2GA 4KXRA 2Q69A 1EZVH 2IJIA 1EFRG 1TUBA 2EZPA 4JV5B 4LF7B 2EIKC 3OD4A 2PY5A 3ZS8C 1M57C 2LFSA 2DYRB 5DM6V 4TWKA 3JAMN 1VQLV 1P84F 1TA8A 1HR0B 1S5HC 1AJQA 4LF4O 3OM3B 2IM9A 2PTMA 2IU3A 4NYKA 1JJOA 4ZOLA 3VOUA 2UXBB 3K79A 1K7DA 3QNEA 1XNQO 5B1AB 2YDEA 2EZOA 2EIJB 2ZNJA 3QO8A 3T1YO
chains in the Genus database with same CATH topology
4YHHO 1N34O 1XEQA 4JV5O 4LF7O 1I94O 1IBKO 4LF9O 1AB3A 1DK1A 4DR1O 4OPHA 4JI6O 3J7AU 2HHHO 2JRIA 5LMNO 1J5EO 1A32A 1XMOO 1G1XB 4DV4O 1FJGO 4OX9O 1HNXO 1XMQO 1IBMO 2E5LO 5H5NA 5BXZA 1HNWO 4GKKO 4GKJO 5BR8O 2ZKOA 5LL6Y 4DV7O 1XNRO 4B3RO 4DR7O 1R1BA 4NXMO 4JI8O 1NS1A 2UXBO 1N33O 4JI3O 2DJVA 2N74A 3T1HO 1KUQA 1YZBA 4LFCO 4DR2O 2VQFO 2UUAO 5FLXN 2Z0AA 4JYAO 4LFAO 1X59A 5LMUO 4NXNO 4YY3O 5A2QN 4JI0O 3J81N 4DV3O 2UXDO 3RT3C 1R6TA 4DR5O 4X64O 4JI4O 4LF8O 5IWAO 1HR0O 1FKAO 3OTOO 2UU9O 1F7YA 4JI5O 4DR3O 1HNZO 4X66O 5IT9N 4DV0O 4DV5O 5BY1A 1AILA 2ZM6O 3F5TA 4B3SO 4DV2O 2DOSA 4DR4O 4JI2O 3SDLA 1D2DA 4K0KO 2LW7A 2FKXA 1N36O 2AGAA 4DV6O 4DUYO 1N32O 4B3TO 4DUZO 4DV1O 4OPAA 4DR6O 4LF5O 3JAMN 2UUCO 3O65A 4A5UB 3J80N 4LF6O 4LF4O 4X65O 4B3MO 4AQYO 2UXCO 3M8AA 2VQEO 4X62O 3R66A 2F4VO 4LFBO 4JI7O 1XNQO 4KHPO 1FYJA 1IBLO 3T1YO 4JI1O 2UUBO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH O;  1N34 O;  1XEQ A;  4JV5 O;  4LF7 O;  1I94 O;  1IBK O;  4LF9 O;  1AB3 A;  1DK1 A;  4DR1 O;  4OPH A;  4JI6 O;  3J7A U;  2HHH O;  2JRI A;  5LMN O;  1J5E O;  1A32 A;  1XMO O;  1G1X B;  4DV4 O;  1FJG O;  4OX9 O;  1HNX O;  1XMQ O;  1IBM O;  2E5L O;  5H5N A;  5BXZ A;  1HNW O;  4GKK O;  4GKJ O;  5BR8 O;  2ZKO A;  5LL6 Y;  4DV7 O;  1XNR O;  4B3R O;  4DR7 O;  1R1B A;  4NXM O;  4JI8 O;  1NS1 A;  2UXB O;  1N33 O;  4JI3 O;  2DJV A;  2N74 A;  3T1H O;  1KUQ A;  1YZB A;  4LFC O;  4DR2 O;  2VQF O;  2UUA O;  5FLX N;  2Z0A A;  4JYA O;  4LFA O;  1X59 A;  5LMU O;  4NXN O;  4YY3 O;  5A2Q N;  4JI0 O;  3J81 N;  4DV3 O;  2UXD O;  3RT3 C;  1R6T A;  4DR5 O;  4X64 O;  4JI4 O;  4LF8 O;  5IWA O;  1HR0 O;  1FKA O;  3OTO O;  2UU9 O;  1F7Y A;  4JI5 O;  4DR3 O;  1HNZ O;  4X66 O;  5IT9 N;  4DV0 O;  4DV5 O;  5BY1 A;  1AIL A;  2ZM6 O;  3F5T A;  4B3S O;  4DV2 O;  2DOS A;  4DR4 O;  4JI2 O;  3SDL A;  1D2D A;  4K0K O;  2LW7 A;  2FKX A;  1N36 O;  2AGA A;  4DV6 O;  4DUY O;  1N32 O;  4B3T O;  4DUZ O;  4DV1 O;  4OPA A;  4DR6 O;  4LF5 O;  3JAM N;  2UUC O;  3O65 A;  4A5U B;  3J80 N;  4LF6 O;  4LF4 O;  4X65 O;  4B3M O;  4AQY O;  2UXC O;  3M8A A;  2VQE O;  4X62 O;  3R66 A;  2F4V O;  4LFB O;  4JI7 O;  1XNQ O;  4KHP O;  1FYJ A;  1IBL O;  3T1Y O;  4JI1 O;  2UUB O; 
#chains in the Genus database with same CATH topology
 2HJF C;  1S3J A;  3UKM A;  2YC0 A;  4JI0 B;  1PL0 A;  3E35 A;  1GN2 A;  1US6 A;  2DWE C;  1AB3 A;  3OEH G;  4J7J A;  4MVO A;  4J80 A;  1XI1 A;  1JA8 A;  2E76 B;  1PPJ H;  1V9P A;  4WFG A;  4PJ0 Z;  4DV5 B;  1JMK C;  1MNG A;  1CXZ B;  1H2N A;  2UXC B;  3AG7 A;  1VF7 A;  1BL8 A;  3CB2 A;  3A2F A;  4NTX A;  3M99 B;  1XNR O;  2JEX A;  2Q6A A;  1M93 A;  1L0L H;  2BOB C;  2IJJ A;  4HNA B;  2DJV A;  3D3I A;  4RO2 A;  4LWS A;  2Y0I A;  1RPR A;  4DV1 B;  2ZD9 A;  4O2B B;  1S5J A;  3LUT B;  2GUZ B;  3CCJ V;  4FLX A;  2MW2 B;  1Y67 A;  4Z2W A;  5J2U B;  3A0B Z;  1FAF A;  3AK2 A;  1NT2 B;  4AHC A;  4X1K A;  1YVW A;  3G67 A;  3CC7 V;  1OCC C;  3CSX A;  2W0X A;  4DV0 O;  4JAU A;  4FLV A;  5B3S B;  2Q5Z A;  4IL6 Z;  4DV2 O;  5ITZ A;  3TGU H;  3CJH A;  4J7K A;  1JFF B;  1VQ7 V;  3SDL A;  4TUY A;  1I5Y A;  1FFX B;  4JYC A;  1Z5V A;  2LW7 A;  3IC7 A;  2VQF B;  4DK1 A;  3FX7 A;  1KBH A;  1N32 O;  5JCO A;  5CB4 A;  3HKD B;  1IVS A;  1K92 A;  3OR7 C;  3CCV V;  2ETN A;  1M9N A;  2VRZ A;  2Q68 A;  3JD3 A;  3SYQ A;  4FLU A;  1OJH A;  3PN1 A;  3JD4 A;  5L3E A;  1B6Q A;  2UUB O;  2YID A;  3K5O A;  2L6L A;  3ZED A;  2NN4 A;  1W59 A;  2EIM B;  1N34 O;  2EX3 A;  5HFL A;  1VEW A;  3SJC C;  4NVP A;  1RM1 B;  4CBC A;  4MTG A;  2JRI A;  1J5E O;  3WFV A;  4DV4 O;  3JAK B;  5J9P C;  1HNX O;  1JVM A;  4X66 B;  1WB8 A;  3L74 H;  4I55 A;  3ETG A;  3CHX A;  2ZE7 A;  2EBO A;  3JSL A;  4E2L A;  3CP1 A;  4DV7 O;  1QLE C;  1SQV H;  4ZHQ B;  3W7W A;  1N33 O;  3RW0 A;  1KUQ A;  1DLB A;  3E22 B;  4JTD B;  4OXS A;  3ABM B;  3P32 A;  2QM4 A;  1IBK B;  3F5W C;  2MK3 A;  1PKX A;  4LF6 B;  3A0H Z;  4I5S A;  1QCE A;  1VQ8 V;  2ITC C;  2HVJ C;  5KHG A;  5KAF Z;  1IUR A;  4GX1 A;  1V55 B;  2KG7 B;  2HVK C;  1E1R G;  1YXB A;  1G8M A;  2UU9 O;  2KKW A;  4LR3 A;  3VBB A;  5IY5 B;  3OW2 U;  1P4R A;  3HR0 A;  3AK3 A;  3ABT A;  2QKA A;  2RQ6 A;  3C3T A;  4JGS A;  3MDS A;  4DR4 O;  2IH1 C;  3T1H B;  3IAY A;  1F23 A;  4GT1 A;  4X1Y B;  4WCE V;  2QA4 V;  2OTL V;  4DUY O;  1K9M W;  4P30 A;  3CCL V;  1SF9 A;  1SQX H;  4L8J A;  3K5N A;  5LA6 A;  3C3S A;  4I4T A;  4JYB A;  2X7R B;  5J2T B;  4I9W A;  2VQE O;  2RNB A;  3E8B A;  4NXM B;  3CCM V;  3BEH A;  5D5Q A;  5EIB C;  4PA6 A;  2PI4 A;  3HKC A;  3AK1 A;  5EYP B;  1XEQ A;  2GSM B;  3P30 A;  3MHS C;  3CCR V;  4BIZ A;  4J9Y B;  3JAS A;  4L87 A;  4K8X A;  2DE0 X;  2E75 B;  4DW0 A;  3IC9 A;  1M90 W;  4OX9 O;  1JPX A;  4YJ3 B;  4YIO A;  2EJR A;  1HNW O;  5L3B A;  1MA1 A;  5JVD B;  2Q0A A;  1WB7 A;  4HAM A;  1IXB A;  2JGD A;  2Q9L A;  2CTW A;  1JX9 A;  2QWP B;  2QSA A;  1Z5W A;  2JS5 A;  4FVM A;  2F95 B;  1Q3E A;  5KUK A;  3ABL B;  4JZ2 A;  3J81 N;  4TQD A;  1MZF A;  3K3W A;  1RPO A;  3FKS G;  3GWO A;  4NR1 A;  5IYB O;  1IBL B;  4JI5 O;  5EZY B;  3CD6 V;  2EIM C;  1L1F A;  1QNM A;  5IYC O;  1BHA A;  4W4K A;  2Z5U A;  2X6A A;  3N2K B;  2EIL C;  3BPZ A;  3OGI B;  1ZUQ A;  2M7W A;  1RSO B;  1YTF B;  1D2D A;  1NTZ H;  1KP3 A;  4DR2 B;  4BW5 A;  2WA4 A;  5KA6 A;  1NTK H;  2Y4U A;  1FXH A;  2XND G;  2HG5 C;  1XMO B;  1SA0 B;  4DV6 O;  1P49 A;  4B3T O;  3H9V A;  2ZE8 A;  3UCS C;  2DWD C;  1R73 A;  2AZ2 A;  1I0H A;  2Q4P A;  1AR4 A;  2PGG A;  3ZMT A;  4KHP O;  4I7Z B;  3TCU A;  2YUA A;  3Q4H A;  1WNS A;  1BGY H;  4YHH O;  5F2V O;  1QU7 A;  1V55 C;  5JCO C;  1ORQ C;  2LO1 A;  1PL4 A;  3ZN1 A;  1M5I A;  3E83 A;  3JYC A;  1FJG O;  4DR3 B;  1OCR B;  2YS8 A;  2QM8 A;  3QO7 A;  2YI9 A;  1SZX A;  4QPK A;  4PDV A;  4EFE A;  3HKE B;  3IFX A;  5LL6 Y;  5H9C A;  3IJ4 A;  3AG2 C;  2FYU H;  4LBE C;  4DR7 O;  3T1Y B;  3BAB A;  3LSU A;  2Z0A A;  4O4J A;  5B1B C;  3SPC A;  3AG4 C;  1K5Q A;  3ZIA G;  2QGN A;  4F6R A;  3ABK C;  3OMN B;  4U3J A;  4UV9 A;  3K5M A;  1R6T A;  4O4I A;  5KHH A;  4LF8 O;  4UFZ A;  2PYL A;  2WLL A;  4HYO A;  1U97 A;  4UV8 A;  4LFB B;  4TV8 B;  4CS4 A;  5B5E Z;  2X6C A;  4NTY A;  4DXW A;  4K8Z A;  2BSK B;  4FLW A;  2PI5 A;  5CA1 B;  2K1E A;  3GVM A;  2N04 A;  4QE9 A;  3THO A;  2UXN A;  2ZXW B;  4MVQ A;  1YHQ V;  4TOI A;  2A3Q A;  5LGN A;  3ZRS A;  1TVK B;  3JCU Z;  3L70 H;  4CC6 A;  5IE9 A;  1WPB A;  5E79 Z;  2AGA A;  1VAR A;  1YJW V;  2XAH A;  2LJ2 A;  4D7S A;  4LF5 O;  5KLV H;  1H38 A;  3D3Q A;  4MT8 A;  1KEC A;  4X62 O;  1TUE B;  4MVR A;  4HBN A;  1Q8I A;  2F4V O;  2JIZ G;  1M4U A;  3UO3 A;  1SQP H;  4ZKI A;  2UUA B;  1FYJ A;  4DV2 B;  1OCO B;  3SYO A;  1ARO P;  4FM1 A;  2NR5 A;  4DYL A;  2WLJ A;  4IT5 A;  1QR9 A;  2WLI A;  4IIJ A;  5HFM A;  3J7A U;  4YJ2 B;  3OUS A;  3L75 H;  4QNH B;  4PD4 F;  3ASN B;  4JPR A;  4PI0 A;  3EVK A;  2V4D A;  2ZM6 B;  1DF5 A;  4UCO A;  1IZ3 A;  5FNV B;  3H1L H;  1K5S A;  1MOF A;  4K0K B;  2ADQ B;  2R9A A;  1S0V A;  3QG5 A;  4XDL A;  1N36 B;  1AI5 A;  4QPJ A;  4DUZ B;  1X59 A;  1AR1 B;  4X65 B;  4B3M B;  3B8N A;  4UCS A;  5C8Y B;  4JI4 O;  4GX0 A;  3ZHQ A;  2YEV A;  4DV4 B;  1FKA O;  3OTO O;  4XDJ A;  2Y48 A;  2ZIM A;  3G6E V;  2JJ2 G;  3ZHR A;  4IYI A;  3I56 V;  1HNZ O;  4DV7 B;  5CA0 B;  5LHH A;  1J95 A;  2IH3 C;  1PP9 H;  1CPY A;  1N33 B;  4WFA V;  1I94 B;  3ASO C;  2HP8 A;  2YIB D;  3ZMU A;  2A0L A;  4RWU A;  5L3D A;  1FXK B;  5IYD O;  3RWR D;  4R8C A;  4CZZ A;  2OT5 A;  2UUC O;  4GKK B;  3FB6 C;  3G80 A;  3CXC U;  1Z2G A;  4H0L B;  3K5L A;  1NJI W;  2ZNI A;  3A8T A;  4HNA A;  1VQ5 V;  3ZCC A;  5LXT B;  3BFR A;  1GAX A;  2YIA A;  3F7Y C;  3VQY A;  4KFM A;  1VQO V;  2K9P A;  4O2B A;  4DR4 B;  2GUZ A;  1VQ9 V;  4O4H B;  5J2U A;  3LSS A;  3B77 A;  4X64 B;  5IWA B;  1DK1 A;  1R3L C;  3D36 C;  5EBW C;  3HKB B;  3SPG A;  1G1X B;  1W0J G;  1XMQ O;  1Q86 W;  3RYF B;  3CRC A;  2JJ1 G;  5KAI Z;  5BXZ A;  4GKJ O;  2VQE B;  3RVZ A;  4EFB A;  5BR8 O;  4CS2 A;  3CS5 A;  1JFF A;  2JGU A;  2YIC A;  1FFX A;  4UB8 Z;  2G38 A;  5BMV B;  1LUV A;  3ZHS A;  3S3W A;  4B3R O;  5IJ9 A;  2WAM A;  1AI6 A;  1ZAU A;  3ETQ A;  2N74 A;  1SKV A;  2GTS A;  5LHG A;  3K58 A;  4CH4 A;  1BHB A;  5FLX N;  4JYY A;  4PA7 A;  4TQF A;  4JYA O;  4YXW G;  1GM7 A;  3HKD A;  4X20 B;  1FXV A;  2GBO A;  2KQX A;  3BA8 A;  5CBH A;  3DTU B;  1T5E A;  1HNW B;  4BWA A;  5CBG A;  1OCZ C;  3VQX A;  4FM2 A;  3F5T A;  1E79 G;  4JI2 O;  1VP7 A;  1ZL8 B;  3T1C A;  4JI6 B;  5DED A;  5LMN B;  3JAK A;  4H44 B;  1SES A;  4FZ1 A;  3T4Z A;  5LP6 B;  3CWB H;  1WP7 A;  4DW1 A;  4RUF A;  2IJK A;  4LCU C;  3L71 H;  4ZHQ A;  1ENV A;  2A7W A;  2IBZ H;  3ZMS A;  4JI5 B;  4FLY A;  1IDS A;  3E22 A;  1V54 B;  1Y6X A;  3JAL B;  1GN3 A;  4D7T A;  1FPO A;  1R3K C;  3X2Q B;  4J42 A;  2XOK G;  1THZ A;  4J10 A;  2ZDI A;  3W7T A;  1I7F A;  2Y69 B;  1XRE A;  3ZHU A;  2KG7 A;  1S76 D;  5L3F A;  4DR1 O;  1NR1 A;  2CAZ C;  3DXR B;  3N2G B;  3E89 A;  1Q7Y W;  1A32 A;  2BE3 A;  1GTO A;  4DO2 A;  4UCV A;  4RQF A;  3CCQ V;  3FB5 C;  1JR9 A;  1IBM O;  2B5U A;  1QLN A;  3SPI A;  2FML A;  3UQ8 A;  1KMI Z;  2A06 H;  1XBL A;  2HLD G;  2CDY A;  1K33 A;  3K06 A;  1M56 B;  5JJE B;  3G71 V;  4PI2 A;  1PNL A;  2QWQ B;  4X1Y A;  3M7M X;  4JI3 O;  4YHH B;  1YEW A;  1VF6 C;  4CS3 A;  4LNU B;  4GYC B;  1Q82 W;  5J2T A;  3B8M A;  2NLJ C;  4P2Z A;  4YY3 O;  3RYI B;  2XTA A;  2UXD O;  4DV3 O;  1AJN A;  2A9H A;  4JTA B;  2W6J G;  2QR4 A;  2KSD A;  4LH6 A;  4KP4 A;  1JJ2 U;  1FFT B;  2JS3 A;  4UCU A;  4JI7 B;  2OTJ V;  2HEP A;  3E2E A;  4Q6G A;  5KUM A;  5EYP A;  3I5D A;  2DQ0 A;  3BY6 A;  5EBM C;  2DYR C;  2Z3Y A;  1G4Y B;  4JI1 B;  2LFR A;  2V7Q G;  3G6B A;  4DR7 B;  1NI8 A;  1XUQ A;  4QIW F;  1YTF D;  4X9Q A;  4MTX A;  2QJ1 A;  1N4C A;  4X1K B;  1K8A W;  1Y4M A;  5B1A C;  4YJ3 A;  5H6R A;  2EIJ C;  1VQP V;  1NZ6 A;  4OPA A;  3VQV A;  4LF8 B;  4WF9 V;  1TAE A;  5EC1 C;  4J41 A;  5JVD A;  4U3F H;  1DTO A;  1LNQ A;  4TUY B;  1VQ4 V;  4AQY O;  3P3P A;  2QWO B;  3G4S V;  2V1D A;  1SQF A;  1JOY A;  1KYO F;  3ZRV A;  3JD2 A;  4TV9 B;  1XOU A;  4NXN B;  4B7K A;  4JV5 O;  4LF7 O;  3SJQ C;  1H8E G;  2CTQ A;  2LGW A;  3SJB C;  4UXN A;  4PHZ A;  5EZY A;  3K08 A;  3CCS V;  1QHT A;  3FAV B;  3UT5 B;  3N2K A;  5IJ0 A;  2F23 A;  4X1I A;  4CC5 A;  1RSO A;  3RYH A;  4X62 B;  1BCC H;  1F51 A;  1Y74 A;  1I5X A;  4PDL A;  3OMI B;  1URF A;  4PA9 A;  4FK5 C;  2OCC B;  2WLM A;  4MTF A;  2R72 A;  2XAG A;  2UXB O;  4QJF B;  1DF4 A;  2XAF A;  2P67 A;  1XIL A;  3ZMV A;  2W6I G;  1H2S B;  4N21 A;  1PD3 A;  3JAT B;  3FB7 C;  4JI0 O;  5B3S C;  1AI7 A;  4UUJ C;  2Q7H A;  4LC1 A;  3BCC H;  2CTP A;  5DN6 G;  1Q6I A;  2QE7 G;  2B1I A;  5LHI A;  4DV5 O;  5BY1 A;  3WB2 A;  2Y69 C;  3ETE A;  3B4S A;  4JTC B;  5KMG A;  3FFQ A;  1MSW D;  1EZJ A;  3CCU V;  5JJN B;  3UO2 A;  3OT7 A;  3C90 A;  2ZE6 A;  3L73 H;  1ZSP A;  2YXY A;  2CTR A;  2O57 A;  3AG3 B;  1O9H A;  4DV1 O;  2Y0P A;  1NR7 A;  2E5L B;  3HKE A;  3J80 N;  3T4D A;  3CRM A;  3WG7 B;  1GH6 A;  3KKY A;  2GTA A;  2OWO A;  3FD9 A;  1VQ6 V;  2WPD G;  3FYI B;  3TXS A;  3TET A;  1RM1 C;  4BIU A;  2XAQ A;  2YXL A;  4LFC B;  4U7N A;  3TJT A;  1HP8 A;  2EIN B;  4XDK A;  1BZK A;  1AP5 A;  1L8D A;  1VQK V;  4GLX A;  4TV8 A;  4IHJ B;  3D36 A;  2R9I A;  2PZS A;  3LDE A;  2BSK A;  1O9G A;  5CA1 A;  5C93 A;  4BAY A;  3ABM C;  4C7U A;  3RFR A;  5IYZ B;  1ROP A;  3EXA A;  3WB1 A;  1FD9 A;  4DRX B;  4I9Q A;  5DEC A;  4U7O A;  3OTF A;  2ZDI C;  1TVK A;  3JD0 A;  5JH7 B;  2DYS B;  4WBN B;  2Q0O C;  1Q81 W;  3ZN0 A;  3AG1 B;  4UCT A;  4F6E A;  5IY5 C;  1RP3 B;  1GRJ A;  3SPJ A;  4PEL A;  1WJZ A;  4LF4 B;  1ZX3 A;  1S72 V;  4FZ0 A;  1Y76 B;  1NU1 H;  5TIS Z;  3ZRX A;  2ZIN A;  2R70 A;  4QE7 A;  1XNQ B;  5LYJ B;  4GKJ B;  1PNM A;  3RGB A;  1N0N A;  4X66 O;  2ARH A;  4B3R B;  3HB3 B;  3DC5 A;  3QTC A;  3JAR B;  3RVY A;  4MTO A;  3SPH A;  1YCI A;  1SQG A;  3OR6 C;  4YJ2 A;  1R3J C;  3CMA V;  1Q43 A;  2P5O A;  4JAV A;  2XAJ A;  4A5U B;  4B7E A;  4LF6 O;  3OE7 G;  5FNV A;  2LQT A;  2EIK B;  3K9S A;  1QVF U;  3K9A A;  1XNR B;  3M8A A;  3VQW A;  1M57 B;  1D5N A;  3W7X A;  4QGP A;  4CH3 A;  3K57 A;  2FL4 A;  3U11 A;  4JI2 B;  4O2A B;  1BQ0 A;  5C8Y A;  2WA3 A;  4B08 A;  4FFB B;  2WLH A;  2ATK C;  1X4T A;  1U96 A;  4DV0 B;  5CA0 A;  5H5N A;  2CH7 B;  1H8H G;  3ABL C;  2ZKO A;  3P3N A;  4LP8 A;  1ZTE A;  4NXM O;  4MW8 A;  3L9D A;  1FXK A;  3N27 A;  1SQQ H;  1N32 B;  2ZQM A;  3CX5 F;  1VF6 A;  1GM9 A;  5LOV B;  3BVO A;  5LMU O;  4J9Z B;  4H33 A;  4JF3 A;  4O4L B;  1NKD A;  2PYJ A;  4PDR A;  3F7V C;  4NKG B;  1SQB H;  1VMG A;  5BZB A;  5LXT A;  1HDJ A;  5KX5 B;  2HKO A;  3S3X A;  2UUB B;  1BT8 A;  4O4H A;  4B3S O;  5GTH Z;  1N34 B;  5CMU A;  3DSQ A;  3QVN A;  1H2M A;  5KA5 A;  2WLK A;  4E4E A;  3HKB A;  2VWJ A;  3CXH F;  4GUN A;  2H3O A;  2QKC A;  1J5E B;  3FB8 C;  4YY3 B;  2YSU B;  3KG2 A;  1OCC B;  1HNX B;  4DV3 B;  3BHP A;  4Q20 A;  1M1K W;  5BMV A;  5B66 Z;  3QO5 A;  5EIB D;  2BTO A;  3DGE A;  4I50 B;  2GDS A;  1NBM G;  2ADP A;  3AG1 C;  3ZRW B;  4Z1V A;  4NB5 A;  5GON B;  5JQG B;  2CK3 G;  2CGN A;  2F43 G;  1IBL O;  4X20 A;  1S77 D;  1OCR C;  1WA8 B;  4FFK A;  2VS0 A;  1NTM H;  3JAW B;  1R3I C;  3WB0 A;  1EN5 A;  3AEI A;  4OPH A;  3APQ A;  2UU9 B;  4MW3 A;  1NH2 D;  2D3O W;  3RYC B;  4HZ3 A;  4X89 A;  1XMO O;  2VWK A;  4IYH A;  4WFB V;  5FPO A;  2RCV A;  4AQY B;  2ZR2 A;  4MSW C;  1PV0 A;  3SYP A;  2JVD A;  1ZL8 A;  3SYA A;  2RMK B;  1VF5 B;  3DC6 A;  4JI8 O;  4ZBM A;  1VQN V;  1W0K G;  3HPL C;  1P7B A;  4DUY B;  5LP6 A;  5H2F Z;  4G28 B;  5IDJ A;  4LFA O;  3K0D A;  3ZHT A;  3JD1 A;  3LDC A;  2ITD C;  3RT3 C;  4DR5 O;  2ZXW C;  1QLE B;  3ZX6 A;  3IGA C;  1GM8 A;  3JSN A;  3JAL A;  2C2A A;  1F7Y A;  2YIB A;  4DR3 O;  2PF4 E;  2ODM A;  2JEU A;  2BTQ B;  2E3C A;  2YEV B;  3B09 A;  3DXR A;  3N2G A;  4CH5 A;  4D6T H;  4K35 A;  2ZE5 A;  3OMA B;  3APO A;  3E8G A;  1Q6U A;  4OX9 B;  1SS3 A;  4DR6 O;  2A79 B;  1AI4 A;  1BE3 H;  3O65 A;  1YSC A;  1OCO C;  4OGQ B;  3LDD A;  4I0X B;  5FL7 G;  1K4D C;  2QEX V;  3R66 A;  1KU9 A;  4LFB O;  4EB6 B;  2HJD A;  4ZI7 B;  2P4K A;  4LNU A;  4X88 A;  3ASN C;  2LP7 A;  1TGO A;  2AHZ A;  1N0J A;  2LGQ A;  3RYI A;  5KHJ A;  2ZCE A;  4G27 B;  1EN6 A;  1XHZ A;  3BRC A;  2WSS G;  2Q73 A;  4PDM A;  2F66 C;  1SRY A;  3CME V;  1TUB B;  3OAA G;  4MVM A;  4JAS A;  1K3E A;  2IJH A;  4PA4 A;  2GHY A;  1MZE A;  2HHH O;  4FPP A;  1AVM A;  2KB1 A;  2YI8 A;  5L3C A;  1KP2 A;  4CH6 A;  4XBF A;  1B04 A;  4R6Z A;  3GWK C;  3K03 A;  4K3A A;  5EBL C;  4NTW A;  4ZOL B;  3BAA A;  1YZB A;  4DV6 B;  2UUA O;  3LNM B;  4UVC A;  3CRA A;  4GZR B;  4B3T B;  1NH2 B;  1YI2 V;  2FTK A;  2EJ7 A;  4GCZ A;  2RDC A;  4P9P A;  4UVB A;  1NQT A;  5IJ9 B;  2DMX A;  4BW9 A;  4J7Z A;  1D5A A;  2B9Z A;  4KHP B;  3H1I H;  4TSF G;  4TV9 A;  1FXK C;  1SC5 B;  2H94 A;  2ZM6 O;  3LSQ A;  3H01 A;  4H13 B;  5K1X A;  4K0K O;  2HR3 A;  2DN9 A;  1N36 O;  3FAV A;  3UT5 A;  4BR6 A;  1FJG B;  3CRQ A;  4LWS B;  4DUZ O;  3E8H A;  1GMG A;  2EIL B;  3CYO A;  2XT9 A;  4X65 O;  4B3M O;  1XL4 A;  3ML0 A;  5LGT A;  3JCZ A;  1LUW A;  3OFN G;  4UB6 Z;  3STL C;  3JAT A;  2XUM A;  1NVP D;  1ZLZ A;  1I94 O;  4LF9 O;  1MAB G;  5ITZ B;  3CJH B;  3MD0 A;  4IGG A;  4BIO A;  3WU2 Z;  1B06 A;  3ZMZ A;  4FM0 A;  3MAQ A;  4WFH A;  4GKK O;  5H6Q A;  4WFF A;  1YDX A;  5CB4 B;  3I55 V;  1OZ0 A;  1VQM V;  2IW5 A;  1R1B A;  2QTO A;  2IU0 A;  1WAZ A;  1KD1 W;  3QF7 A;  3OUF A;  1S5L Z;  2GV9 A;  3ZJZ A;  1KKC A;  4LF5 B;  4RQE A;  1KQS U;  1E1Q G;  1XDC A;  3B40 A;  1UJW B;  4JZG A;  3AG2 B;  2AHY A;  5FPR A;  4X64 O;  2F1M A;  5IWA O;  1HR0 O;  3H1J H;  5CN0 A;  2P4V A;  3SYC A;  2F4V B;  3SR2 C;  3U10 A;  5B1B B;  3K0G A;  2CUG A;  2HFE C;  3AG4 B;  5IT9 N;  1SA0 A;  4G2K A;  5LP6 C;  3ABK B;  1QQC A;  1MSD A;  1R6N A;  4I55 B;  3CE2 A;  4FLT A;  2DOS A;  4GX5 A;  1K4C C;  1YIJ V;  3OGC C;  4RUE A;  2FKX A;  4IHJ A;  4MVS A;  3CRR A;  5B1O A;  4ZIB A;  5LMU B;  1V54 C;  2AZ0 A;  1OHH G;  3X2Q C;  2ZT9 B;  2UXX A;  2F93 B;  5IYZ A;  1W2B U;  4DRX A;  1JQ0 A;  5EK0 A;  2P7T C;  2QWN B;  4AIL C;  3RBZ A;  1LR1 A;  2OIG A;  5JH7 A;  2UXC O;  4WBN A;  1MMM A;  4EEQ A;  5KHI A;  2OIE A;  4B3S B;  1CEZ A;  1EBO A;  3GB7 C;  1Y76 A;  4JI4 B;  1GKF A;  2D2C B;  1SZT A;  2OCH A;  5JJJ B;  3OTO B;  4JI6 O;  4KL1 A;  1M56 C;  2DW4 A;  3NR7 A;  3ETD A;  5LYJ A;  2L35 A;  3CPW U;  5LMN O;  5LGU A;  1HNZ B;  4TT3 G;  2X6B A;  3JAR A;  4J11 A;  2CGO A;  4PA3 A;  5LBQ A;  3W7U A;  3CC4 V;  1VIB A;  5LA6 B;  2JK5 C;  4I4T B;  1K97 A;  5A9G A;  3UM7 A;  4ABM A;  1NVP B;  2QM7 A;  1NS1 A;  5L3G A;  1F4N A;  2B1G A;  4LH7 A;  4Z1M G;  2N05 A;  5IJ0 B;  2VQF O;  2EUL A;  4X1I B;  4FJC C;  2UUC B;  3HKC B;  3RYH B;  3CCE V;  1JCH A;  1Y74 B;  3SJA C;  1L0N H;  2E74 B;  1YF2 A;  1AR5 A;  3CC2 V;  4EKW A;  3D8C A;  3JAS B;  1H2L A;  4R50 A;  1F4M A;  3L72 H;  1WLE A;  3STZ C;  1EM1 A;  5AG2 A;  5D5P A;  2LW1 A;  4O2A A;  1AIL A;  2RN9 A;  3O9O A;  3CEI A;  2CE4 A;  4JI8 B;  4FFB A;  1KB9 F;  4MVZ A;  5GTI Z;  4MVU A;  4LFA B;  2ZR3 A;  2JGD B;  4YIP A;  5GW7 A;  1P7G A;  1SET A;  5KMG B;  1XMQ B;  2OYQ A;  5CA3 A;  2CH7 A;  2AXT Z;  2PUS A;  2X0L A;  1DGS A;  4DR5 B;  1B3Q A;  3ABU A;  2H8P C;  5BR8 B;  4GX2 A;  1BSM A;  3ASO B;  3TK1 A;  1QBZ A;  1XHX A;  2NNU A;  1IXM A;  2Q8V A;  1AJP A;  1CP9 A;  4JI7 O;  3EHB B;  1I08 A;  4R7C A;  2WWW A;  3ICX A;  5LOV A;  2Y4T A;  4JYA B;  4JI1 O;  4UVA A;  4O4L A;  3KCX A;  1Q5O A;  3K04 A;  2BCC H;  3ZBH A;  1KC8 W;  1IBK O;  3LNN A;  1R6K A;  2OCC C;  4DR6 B;  3E86 A;  5KX5 A;  4N23 A;  3NXS A;  1FS0 G;  2QKS A;  1MG1 A;  1Q6H A;  1HWY A;  4AI8 A;  3U0Z A;  1IX9 A;  5E1A C;  2YXH A;  4ICG A;  1H2K A;  4FIP C;  3RN4 A;  1BMF G;  3T1H O;  5CBF A;  2QDO A;  3SGI A;  2P22 C;  3Q4H B;  4NXN O;  5A2Q N;  4I50 A;  2M6Y A;  4JAA A;  2HHH B;  3ZRW A;  2P06 A;  1Y66 A;  1WPX A;  2P6J A;  5EC2 C;  5GON A;  5JQG A;  3H1K H;  1COW G;  3T2M A;  1RFY A;  2JDI G;  1K73 W;  1YJN V;  3TXQ A;  3AG3 C;  3E8F A;  1WA8 A;  4F4L A;  5K1P A;  3JAW A;  1XQ8 A;  3WG7 C;  1GO3 F;  4DR1 B;  3RYC A;  2ZIO A;  5B1N A;  1GN4 A;  4W4L A;  1OCZ B;  1BS3 A;  4X8A A;  1OV9 A;  2Q7G A;  4H37 A;  3PJS K;  1IBM B;  4PV1 B;  4O4J B;  1BQZ A;  2EIN C;  2P90 A;  4P9O A;  4WFE A;  1HW7 A;  4KUM A;  1QR8 A;  4UCR A;  4F6R B;  4U3J B;  2R9R B;  1Q90 D;  4O4I B;  2AW9 A;  2Q7E A;  2WLL B;  2W0F C;  4JI3 B;  3KZI Z;  1XL6 A;  4FMT A;  1UFI A;  3RYF A;  2QTS A;  1ZWI C;  2UXD B;  3A0R A;  2WLN A;  4RAI A;  3H1H H;  2QWR B;  1SER A;  1K34 A;  3FYE B;  2DYS C;  1G6U A;  1YIT V;  1PM9 A;  2BOC C;  2ILM A;  4DK0 A;  1GN6 A;  3R65 A;  1GK9 A;  1WP8 A;  2Q67 A;  1UPG A;  2BTQ A;  3OEE G;  5JWP A;  2E5L O;  1YJ9 V;  2XAS A;  3MHH C;  4FLZ A;  3ZHV A;  3KCY A;  3BA9 A;  4LFC O;  4DR2 O;  5KHK A;  4LF9 B;  3K59 A;  4I0X A;  2DQ3 A;  2RJZ A;  2XHB A;  4MS2 A;  3EFF K;  3W7S A;  1AP6 A;  1PNK A;  3B2E E;  2WLI B;  1QVG U;  2FB5 A;  4EB6 A;  4ASU G;  4ZI7 A;  4IIJ B;  1EN4 A;  1KKD A;  1WN7 A;  1N8R W;  1H2G A;  4KXR A;  2Q69 A;  1EZV H;  2IJI A;  1EFR G;  1TUB A;  2EZP A;  4JV5 B;  4LF7 B;  2EIK C;  3OD4 A;  2PY5 A;  3ZS8 C;  1M57 C;  2LFS A;  2DYR B;  5DM6 V;  4TWK A;  3JAM N;  1VQL V;  1P84 F;  1TA8 A;  1HR0 B;  1S5H C;  1AJQ A;  4LF4 O;  3OM3 B;  2IM9 A;  2PTM A;  2IU3 A;  4NYK A;  1JJO A;  4ZOL A;  3VOU A;  2UXB B;  3K79 A;  1K7D A;  3QNE A;  1XNQ O;  5B1A B;  2YDE A;  2EZO A;  2EIJ B;  2ZNJ A;  3QO8 A;  3T1Y O; 
#chains in the Genus database with same CATH homology
 4YHH O;  1N34 O;  1XEQ A;  4JV5 O;  4LF7 O;  1I94 O;  1IBK O;  4LF9 O;  1AB3 A;  1DK1 A;  4DR1 O;  4OPH A;  4JI6 O;  3J7A U;  2HHH O;  2JRI A;  5LMN O;  1J5E O;  1A32 A;  1XMO O;  1G1X B;  4DV4 O;  1FJG O;  4OX9 O;  1HNX O;  1XMQ O;  1IBM O;  2E5L O;  5H5N A;  5BXZ A;  1HNW O;  4GKK O;  4GKJ O;  5BR8 O;  2ZKO A;  5LL6 Y;  4DV7 O;  1XNR O;  4B3R O;  4DR7 O;  1R1B A;  4NXM O;  4JI8 O;  1NS1 A;  2UXB O;  1N33 O;  4JI3 O;  2DJV A;  2N74 A;  3T1H O;  1KUQ A;  1YZB A;  4LFC O;  4DR2 O;  2VQF O;  2UUA O;  5FLX N;  2Z0A A;  4JYA O;  4LFA O;  1X59 A;  5LMU O;  4NXN O;  4YY3 O;  5A2Q N;  4JI0 O;  3J81 N;  4DV3 O;  2UXD O;  3RT3 C;  1R6T A;  4DR5 O;  4X64 O;  4JI4 O;  4LF8 O;  5IWA O;  1HR0 O;  1FKA O;  3OTO O;  2UU9 O;  1F7Y A;  4JI5 O;  4DR3 O;  1HNZ O;  4X66 O;  5IT9 N;  4DV0 O;  4DV5 O;  5BY1 A;  1AIL A;  2ZM6 O;  3F5T A;  4B3S O;  4DV2 O;  2DOS A;  4DR4 O;  4JI2 O;  3SDL A;  1D2D A;  4K0K O;  2LW7 A;  2FKX A;  1N36 O;  2AGA A;  4DV6 O;  4DUY O;  1N32 O;  4B3T O;  4DUZ O;  4DV1 O;  4OPA A;  4DR6 O;  4LF5 O;  3JAM N;  2UUC O;  3O65 A;  4A5U B;  3J80 N;  4LF6 O;  4LF4 O;  4X65 O;  4B3M O;  4AQY O;  2UXC O;  3M8A A;  2VQE O;  4X62 O;  3R66 A;  2F4V O;  4LFB O;  4JI7 O;  1XNQ O;  4KHP O;  1FYJ A;  1IBL O;  3T1Y O;  4JI1 O;  2UUB O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...