5IWAO

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S2
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5iwaO00
1IBMO 5LMUO 2UXDO 1N33O 2ZKOA 1IBLO 2F4VO 1AB3A 1N36O 4LFCO 5IWAO 4LF9O 4OX9O 4DV5O 1X59A 2UXCO 4LFAO 4JI4O 4JI5O 4DR7O 4DV6O 1XNQO 4AQYO 1R6TA 3O65A 4GKKO 3J80N 4GKJO 1HNZO 4B3TO 4DR1O 1FJGO 3F5TA 4DV1O 2UUAO 1N32O 4DV0O 5H5NA 4JYAO 4JI3O 2AGAA 5BY1A 4K0KO 3OTOO 4OPAA 4OPHA 4DR6O 5BR8O 1G1XB 4JI1O 1YZBA 1HNWO 4LF8O 2UUBO 2VQFO 4DR5O 5BXZA 3T1HO 2Z0AA 2FKXA 4DV3O 3T1YO 4X62O 4LF6O 1N34O 2ZM6O 3J7AU 2DJVA 4DV7O 4NXMO 4DV4O 5A2QN 2E5LO 2UUCO 1J5EO 2JRIA 1I94O 3RT3C 2UXBO 3JAMN 2N74A 3R66A 4A5UB 4DR4O 4X65O 4DUYO 4JI8O 4YY3O 5LMNO 1R1BA 4JI0O 1FYJA 2HHHO 1HNXO 1XNRO 1DK1A 4JV5O 1KUQA 2LW7A 1XMQO 4DR2O 2DOSA 1NS1A 4DR3O 5IT9N 1IBKO 4LF5O 1XMOO 4DV2O 2UU9O 2VQEO 4JI7O 5LL6Y 4LF4O 4KHPO 1AILA 4JI6O 1FKAO 1HR0O 5FLXN 4YHHO 4X66O 3SDLA 4X64O 4B3SO 1A32A 3J81N 4NXNO 4LF7O 4DUZO 3M8AA 1F7YA 4B3MO 1XEQA 4LFBO 4B3RO 1D2DA 4JI2O
chains in the Genus database with same CATH superfamily
4PELA 3IAYA 3AG1B 1Q6HA 3F5WC 5JQGB 1VEWA 4L87A 3K79A 4TOIA 5HFLA 2GTSA 2PTMA 5LYJA 2EBOA 4OX9O 4RO2A 4BIOA 3AG3C 4IGGA 4DV3B 3JARB 1YEWA 4DV6O 2QKCA 1FJGB 3W7UA 5LHGA 1K34A 3T4ZA 4TV8A 4DV0B 4DR1O 5AG2A 3K9SA 1ENVA 1P7GA 4WFHA 4K8XA 3ZCCA 3TGUH 1WA8B 3OEHG 1BHBA 4FFBB 3CCRV 3HKBB 3K03A 4UCRA 3JSLA 5LA6A 4DR6O 4U7OA 3UM7A 1LR1A 5B1OA 5JCOC 1SRYA 4KHPB 5J2TB 3ABMC 1L0LH 4FVMA 2OCCC 5BZBA 2M6YA 1WPBA 2VWKA 4LFBB 5C8YA 4X8AA 3K9AA 5KUMA 4UV9A 2EULA 3G67A 1KUQA 3P32A 1OCOC 2RQ6A 3A8TA 1AI4A 4J41A 5J2UA 3E22A 1XMOO 4ASUG 2AZ0A 2XTAA 3LSSA 1Y76A 2JEUA 4GKJB 3KZIZ 3IFXA 2HG5C 1AI5A 4TUYA 3CRRA 5EBWC 1QR8A 4B7EA 2F93B 2EIJC 4LF9B 1NKDA 2Y69C 1SC5B 1XQ8A 3X2QB 4BW9A 1AB3A 3MHHC 4LFCO 1PNKA 4HBNA 1J95A 5KAFZ 1OCRB 2R9IA 1E1RG 2W0FC 5CB4A 4JI4O 1BSMA 1W0KG 2KG7B 1VF6A 3K59A 1IURA 3B4SA 3L70H 4B3TO 2WLMA 1MOFA 2YI9A 4BAYA 1YTFB 3ZN1A 3JD3A 4DV1O 4GT1A 5H6RA 4I55A 2A3QA 3WG7C 1ZL8B 5BY1A 3TXSA 3ML0A 3AEIA 4X20A 2AXTZ 1VQKV 4P2ZA 2IU3A 1S5HC 1Q82W 3NR7A 4DRXA 3RYHB 1VQOV 1V55B 5CA0A 3JATA 5GONB 3AG4B 5CA1A 4DV3O 1RM1B 2LJ2A 4LNUB 4PDMA 1R3JC 4ZOLB 1SQXH 4E4EA 2IU0A 3A2FA 2GUZA 3LUTB 1VQ9V 1EN6A 5KAIZ 2BTOA 2IJIA 5KHKA 2BE3A 4LR3A 4GX1A 4J9ZB 2VRZA 2BTQA 2YXHA 3CRQA 4LH7A 4YHHB 2E74B 3HKEB 4X64B 1WN7A 3OR7C 4JASA 1PKXA 4AQYB 4KHPO 5E1AC 1Y74B 3OT7A 1FKAO 1HNZB 4JTDB 3K5OA 2YICA 4DW0A 3SYOA 5CBHA 2Y0IA 2YIDA 4YXWG 4HZ3A 4B3MO 4LP8A 2RDCA 4LFBO 4H37A 4O2BA 4PD4F 4FZ1A 2XASA 1H2LA 1FFXB 4PV1B 5JVDA 1Y4MA 2D3OW 4UCUA 3T1CA 5L3GA 4FLYA 2R9AA 2OTLV 4RQEA 3D3QA 4H13B 2MW2B 1EN5A 2E76B 1R6TA 1WPXA 4GKJO 2F23A 3DXRB 1QR9A 5BMVB 4UVBA 5L3DA 1V9PA 1YDXA 2JEXA 4U7NA 4NTYA 1GO3F 3SJBC 1BGYH 4FZ0A 1ZUQA 3SPHA 1KKDA 5GTIZ 2HFEC 4TT3G 5LOVB 4H33A 5F2VO 5BXZA 2KB1A 4KFMA 4UUJC 3J7AU 4J7KA 1AJPA 2WPDG 4DR4B 2DN9A 1NQTA 5FNVB 4DUYB 4DYLA 1MABG 1NTMH 5LXTB 3ABUA 3ZRWA 3RYFA 4FM2A 2B1IA 1X4TA 2CH7B 1NT2B 4JV5B 2RCVA 2WLLA 4Z2WA 4KP4A 1NU1H 3U11A 2V7QG 4LCUC 1H2SB 4YJ2B 3QTCA 1DK1A 1EZVH 3K5MA 2PUSA 1PPJH 4MW8A 1XMQO 1US6A 1RPOA 3WB2A 2N04A 1SESA 3RYIA 4AI8A 3A0BZ 2WLIA 2QWOB 4WFBV 4HNAA 2EJRA 3EVKA 1AJQA 2EINB 3D36A 4I5SA 4ZI7A 1MSDA 4F6RB 4FLVA 4CC5A 2ATKC 2WLNA 1G8MA 1I5XA 4JI1B 2GSMB 4MTGA 4LWSB 2Q0OC 1Q43A 4O4HB 1TGOA 2Q0AA 3JAWB 4JZ2A 4TWKA 3STLC 5IY5C 5B3SB 1XILA 4FK5C 1FAFA 1SQBH 5JJJB 4AQYO 3UT5B 1N0JA 2RN9A 3RYCB 3J80N 1HNZO 2D2CB 2A0LA 1K4DC 3CJHA 1IZ3A 2ZXWC 1MZFA 2JDIG 1BZKA 2WLJA 2IJJA 4X1KA 2QKSA 5LP6B 2JS3A 5LGNA 3LNMB 2A9HA 4X66B 2PYJA 1KKCA 3APQA 2OYQA 3PJSK 1FXVA 2AW9A 3N2KA 1QLNA 2E75B 3CRCA 1QNMA 4MTOA 3ABMB 2HHHO 1AVMA 5DN6G 2M7WA 1KP3A 2OCCB 3N2GB 2Y48A 2IBZH 1N36B 1RP3B 1IBKO 4BR6A 2PYLA 3KCXA 3CC7V 3H9VA 1PL4A 4XDLA 4LF4O 1GN3A 2YI8A 5FLXN 2WWWA 5L3BA 1LNQA 5B1BC 1OCOB 1WJZA 1K5QA 1VIBA 3L71H 1GTOA 1KC8W 3OAAG 2ZQMA 5IJ9A 1VP7A 3OW2U 4I4TB 4G2KA 4CS3A 5CBFA 3CEIA 2WLKA 4MVRA 1WAZA 2RNBA 2EIJB 3OMIB 1M4UA 3PN1A 5JJEB 1JX9A 4J10A 3F5TA 2EIMC 3W7SA 3CCEV 3JARA 2H8PC 5A9GA 1PP9H 4H44B 5GW7A 4Z1VA 4O2AA 2XAFA 4OPAA 4TSFG 3HPLC 3OD4A 2Q6AA 2YSUB 3VBBA 4JI1O 3LSQA 4LF5B 4MTFA 3VQWA 1GM7A 5B1AC 1S5LZ 3HKBA 3WG7B 1RSOA 3MD0A 1JMKC 1K8AW 1TVKA 4X1IB 5EC1C 4WFGA 5KHIA 3JD1A 3SPJA 3ASOC 3R66A 5J2TA 1VF6C 3G71V 1D5NA 1EZJA 1BE3H 3CC2V 1CEZA 1XMOB 4FLTA 3RN4A 3IGAC 1NBMG 5B1NA 4DR3O 3JAKB 2UXCB 1TUEB 1I08A 3RVZA 4CH6A 1SQVH 2Y4TA 1FFTB 4R50A 1VQ6V 2XAQA 4X66O 1MMMA 3FAVB 2PGGA 2ZE5A 1XBLA 1KD1W 4AILC 5K1PA 4JYAB 4LFCB 2K1EA 5CBGA 2BSKB 2PY5A 2NN4A 1N36O 4LF8B 1WB8A 1BMFG 1NZ6A 2DE0X 1F51A 5C93A 4X62B 2ZM6B 2Q67A 3CD6V 5HFMA 4B08A 2XT9A 1YSCA 2YEVA 1NR1A 3THOA 2CTWA 2KG7A 3OTFA 5LMNB 1EN4A 3JCUZ 1GN2A 1IXBA 3GWKC 4J9YB 4U3FH 1LUWA 2ZIMA 2YDEA 3CE2A 1HP8A 4OXSA 2C2AA 4P9OA 2OIEA 3CCJV 3B40A 1ZL8A 2FKXA 4D7SA 2P90A 4XDKA 2CGOA 3A0HZ 2EZOA 1ZLZA 3RYHA 4LF7B 4NKGB 1SZTA 5IE9A 5K1XA 5IJ0B 4LNUA 3U10A 3BA8A 4RQFA 3STZC 1KQSU 4PJ0Z 4PA7A 4QNHB 2QA4V 4X1YB 3D8CA 4WFFA 2P4VA 3ASNC 4FMTA 4LF5O 1GAXA 2XHBA 1PD3A 1YF2A 1S5JA 2CGNA 1M1KW 3P3NA 2HJDA 3RGBA 3CCMV 1OCZB 4B3MB 4JTCB 4YIOA 4UB6Z 3SDLA 4EKWA 3HKEA 4CH3A 2P06A 2LFRA 1YJ9V 3ZHUA 1EBOA 4PA9A 2ZNIA 4HAMA 3EXAA 1D2DA 4UB8Z 2JK5C 1GRJA 3ETDA 3QG5A 2HJFC 2QM7A 1COWG 3FB6C 4NYKA 1H2GA 1TUBB 3BRCA 1MSWD 2UXCO 2X7RB 2FYUH 4NXMB 3G6BA 1FD9A 4IIJB 5LHHA 3VOUA 2H94A 4MT8A 1YJNV 4MSWC 5IY5B 4QPKA 1QLEC 1Z5WA 2L6LA 2IW5A 3D36C 1S3JA 5JH7B 3Q4HB 4DXWA 4JYAO 3K08A 1XNRB 2K9PA 2F95B 4MVMA 4GX0A 3CMAV 2CE4A 2ZD9A 1AJNA 4LF8O 1Q8IA 4MW3A 2ZIOA 1XUQA 5CN0A 3OEEG 4CBCA 4X62O 1I7FA 2FTKA 2JJ1G 2ZE6A 2ZM6O 2BCCH 4YJ3B 1VF5B 4FPPA 4AHCA 5LOVA 3SYCA 3JALB 2X6AA 3CCQV 1N0NA 4B3RB 1VF7A 1XMQB 1NVPD 5LMNO 4I50A 4UVCA 5EK0A 3ZMUA 1Q3EA 2HR3A 1WLEA 5LYJB 4GX5A 2QE7G 5ITZA 5IWAB 5B5EZ 2E3CA 1CPYA 4IYHA 4YJ2A 1L0NH 1JPXA 3HKDA 3JYCA 3OM3B 4TV8B 2Q9LA 1AILA 4GKKB 4PI0A 3IJ4A 4PA6A 2ITDC 3L73H 1A32A 4MTXA 4LF7O 1F7YA 1NR7A 4FFKA 4GCZA 1YI2V 5LA6B 3CS5A 3JCZA 3OTOB 4IHJA 4WFEA 4O4IA 4QE9A 3ZHTA 3SGIA 3CCLV 1TA8A 2Q7EA 3RBZA 1K33A 3ZRSA 5B1BB 2B9ZA 3B8MA 3GVMA 1PV0A 2UUBB 2PF4E 5EYPB 3ZHSA 1OHHG 3ZBHA 1SA0A 3BFRA 5EC2C 1LUVA 1XHXA 4LWSA 2NNUA 3JAWA 4G27B 1QBZA 2XAHA 2EX3A 3K0DA 5C8YB 1JVMA 4F6EA 4E2LA 2ODMA 4WBNB 3UT5A 4TV9A 3C3SA 1P49A 5J2UB 1DF5A 5BR8O 3E22B 1H8HG 1H2NA 1H8EG 2EIMB 2UU9B 2EIKB 4WF9V 3E35A 4KXRA 4WFAV 1XL6A 4LF6O 1BQZA 4XBFA 2EILC 4NXMO 1R3IC 1PNMA 2NR5A 1I5YA 4TUYB 2HHHB 5LP6A 3AG1C 3ZX6A 3QO5A 4MVUA 5B1AB 1M90W 2AHZA 2Q5ZA 1S76D 1JJOA 1YCIA 1R1BA 1R6NA 1IBKB 1XNRO 1NH2D 2IH1C 2JGDB 2F4VB 2LW7A 1WNSA 3A0RA 4ZIBA 3CP1A 5CB4B 5KA5A 4J42A 4OGQB 4LF4B 3ASOB 3CYOA 3N2GA 4MVZA 4JAUA 4CH5A 1Y67A 2A79B 2ZDIA 4PHZA 3OFNG 4I55B 4CS2A 3B2EE 1W0JG 5L3CA 3QO8A 1XEQA 4X20B 1IX9A 4B3RO 1G6UA 2GBOA 1XDCA 1W2BU 2LGQA 1GK9A 1SS3A 2FB5A 1N33O 2ZKOA 4ZHQB 5CA0B 5IWAO 3BA9A 3E8HA 5CA1B 1IXMA 1JA8A 2F43G 1SQGA 4PA3A 4K8ZA 1SF9A 5B66Z 4CZZA 3AK3A 3L74H 4GKKO 4Z1MG 1Q6IA 3UKMA 3G80A 2Q8VA 3WFVA 1VQ8V 4X65B 1E79G 1AR1B 4I0XA 1VQ5V 1HNXB 2AGAA 3OTOO 4RUEA 3ZHQA 2GTAA 1I0HA 1AR4A 5DM6V 4MVOA 2UUBO 1WP8A 4CH4A 1FXKA 3OMAB 2Z0AA 4JI7B 4PI2A 1TAEA 1F4MA 3JASB 3AG3B 1B06A 4NR1A 5EBMC 4K35A 3RT3C 2O57A 4GZRB 3TETA 4O2BB 2NLJC 3ABLC 1VQPV 4DR3B 4X1IA 1K9MW 1YHQV 4UCSA 1KU9A 1WP7A 1PM9A 1OJHA 4JAAA 4QGPA 4UFZA 3FYIB 4TQFA 5IYZB 1URFA 2UU9O 1XNQB 3E89A 1HR0O 3IC7A 5EIBC 3QNEA 3MDSA 3JAKA 2YS8A 1M9NA 3TCUA 3ASNB 5CA3A 2VWJA 2GV9A 1V54C 4K0KB 4EB6B 1T5EA 3ICXA 5KMGA 1B04A 2QM4A 3FAVA 2PZSA 3D3IA 2LGWA 2F4VO 1GH6A 3BVOA 1JFFA 1JJ2U 3K57A 1UPGA 4JTAB 4JI5O 2X6CA 2WA4A 2DYSC 3HKCA 3ZRWB 1BQ0A 3H1KH 3SYAA 1DGSA 2WLLB 4DK1A 1PNLA 1K92A 2ZR2A 1AP5A 2QGNA 3E8GA 2ZCEA 2CDYA 4O4JA 3SYQA 5D5QA 5H5NA 4JI3O 3RFRA 3E86A 4N23A 3RYIB 3BAAA 2WLIB 1KP2A 4EFEA 5JQGA 3CXCU 3RVYA 1DLBA 3L9DA 1QLEB 2ZT9B 3K0GA 1FPOA 2Y69B 2CUGA 4JI6B 3FYEB 3OE7G 3ZRXA 2JJ2G 1VQLV 1ZWIC 1HWYA 3BCCH 2QWPB 4X65O 5H2FZ 1M93A 4YY3O 3UQ8A 1IBMB 1QCEA 4JI0O 5LMUB 2UXDB 1HNXO 3R65A 1WA8A 5EZYB 2EZPA 4FFBA 2DYRC 3AG2C 2RJZA 5IJ0A 3F7YC 2P67A 2FMLA 4LFAB 4UCOA 3S3XA 3P30A 4JI7O 4JYBA 4X88A 2ZE7A 1MG1A 4DO2A 2KSDA 3E8FA 4JGSA 2YC0A 1IVSA 3O9OA 3CJHB 2ZNJA 3E8BA 4EFBA 2CAZC 2ADQB 4UCVA 1YTFD 2AZ2A 1WB7A 1EFRG 4X1KB 1Y6XA 2Q7GA 5J9PC 4X9QA 1X59A 4X89A 4G28B 3T1YB 1N4CA 1XNQO 2Y4UA 4DV7B 3SYPA 2LW1A 2DMXA 1SKVA 2KKWA 2E5LB 2UUCB 2HLDG 3WB0A 2ZR3A 3B8NA 1P7BA 3SJAC 2CTQA 2ZE8A 3LDEA 4J11A 4QE7A 3G6EV 1N32O 1R3KC 2YUAA 5CMUA 4D6TH 4K0KO 4IIJA 4OPHA 4DR2B 4GYCB 2Q73A 3DSQA 1G1XB 1F23A 1YZBA 2EINC 1JCHA 4CC6A 2VQFO 5JH7A 1VQ4V 2W6IG 2V1DA 3CCUV 3JD2A 2OCHA 3UO3A 4FLWA 5L3EA 1ZX3A 1K4CC 2QEXV 3U0ZA 1Q90D 3JSNA 4U3JB 2OTJV 1KBHA 4FM0A 2YIAA 4YJ3A 4L8JA 3BABA 4ZKIA 3E83A 1VQNV 2CK3G 4O4LB 3CRAA 1Q5OA 3KKYA 4DV5B 3ABKC 3F7VC 4PA4A 1SQPH 2DWEC 1ORQC 4DR7B 3K3WA 3JD0A 3EHBB 1SQQH 1OV9A 3JD4A 4LC1A 4FIPC 4JI6O 4FLUA 1O9GA 4W4LA 5GONA 4BWAA 3APOA 2PI5A 4GUNA 4YIPA 2HVJC 4FLXA 2A06H 3IC9A 4ZOLA 1QU7A 4O2AB 3VQYA 1DTOA 2XAJA 1IBMO 1G4YB 5LMUO 2UXDO 5LP6C 4FM1A 3DC6A 1IBLO 1P84F 2QWQB 1Q81W 1QVGU 2ILMA 5IYBO 1Z2GA 1HW7A 4DR5B 3H1HH 3T1HB 1RSOB 3ZMVA 2CTPA 2WA3A 3UO2A 2P4KA 4LFAO 1TVKB 1M56C 3TK1A 2DQ0A 5IDJA 2QWRB 5EYPA 1Y74A 4UCTA 2XUMA 3ETQA 4QJFB 3TXQA 1YJWV 1E1QG 5BR8B 2ZDIC 1EM1A 3LDDA 3OUSA 3ZMSA 5KX5B 5FPOA 4F4LA 4JAVA 1HNWO 4LF6B 1GN6A 4WBNA 1FFXA 2WLHA 4J7JA 4DV2B 2VQEB 1SERA 3T1YO 5D5PA 4LH6A 3CB2A 4DV7O 2MK3A 3FX7A 2VS0A 2E5LO 2UUCO 4Q20A 1J5EO 3BY6A 3JAMN 3DXRA 5FPRA 5BMVA 2R70A 3OUFA 5LBQA 4ABMA 4QIWF 1NJIW 2G38A 2Z3YA 1R3LC 4DR2O 1Q6UA 1K3EA 1MZEA 1NI8A 2ZXWB 4J80A 5IYCO 3CMEV 2QSAA 3ABLB 2JGDA 3FKSG 3T2MA 3AG7A 2UXXA 2YEVB 1XOUA 1FXKC 4Q6GA 3SR2C 2CTRA 3L72H 5FNVA 3WU2Z 1N33B 2LP7A 1NTZH 1BL8A 3ABTA 5LXTA 4TQDA 2YXYA 2LQTA 1MNGA 2CH7A 2ITCC 2GDSA 1L1FA 1M57C 2QM8A 4FLZA 1Q86W 4K3AA 3GB7C 4DV5O 1K97A 4DR7O 1V54B 4ZHQA 5KHJA 4J7ZA 2IJHA 5DEDA 2Y0PA 1FJGO 4JI8B 4DV0O 1L8DA 1R73A 2DYSB 4F6RA 2EJ7A 4I9WA 1H38A 1ZTEA 4CS4A 4R6ZA 1QHTA 4PDVA 5JJNB 2ARHA 3FB5C 3QO7A 3QVNA 1ZSPA 4DR5O 3T1HO 1OCCC 4I9QA 3LSUA 1THZA 4O4HA 4D7TA 4MVSA 3CPWU 3OMNB 3OR6C 2LFSA 1XHZA 1YITV 3CWBH 3SJQC 3RYCA 2ADPA 2HKOA 4DUZB 3ZN0A 2IM9A 3W7WA 4PDLA 2HP8A 3LDCA 1IDSA 4NTWA 4ZBMA 1Y66A 3OGCC 3JASA 3B77A 1GMGA 2X6BA 2Z5UA 2YXLA 1Y76B 2P6JA 3DC5A 4WCEV 1Q7YW 2DOSA 1YXBA 1OZ0A 4FJCC 5IT9N 5KA6A 2JIZG 1HR0B 4RWUA 5EBLC 4I7ZB 3EFFK 4DV2O 3ZIAG 2VQEO 4R8CA 2AHYA 4W4KA 2P5OA 2DYRB 1YVWA 1QQCA 3J81N 3AG2B 3ETEA 5IYZA 2GHYA 2L35A 1BS3A 2QTOA 1FS0G 2ZINA 3L75H 5JCOA 4NTXA 4C7UA 3ZJZA 2Q7HA 5KHGA 2QR4A 3H1LH 4JI5B 1KB9F 2FL4A 2ETNA 2JVDA 1P4RA 4LF9O 4EB6A 1N34B 1VARA 4XDJA 1GN4A 2BOCC 1I94B 4JI3B 2UXBB 3VQVA 2HEPA 4I50B 3LNNA 1JQ0A 2W6JG 4DRXB 3VQXA 5ITZB 3JATB 3HB3B 3GWOA 1MA1A 1N8RW 4I4TA 1VQMV 3HKDB 2IJKA 1AI7A 1OCZC 1HDJA 1AI6A 1VMGA 2GUZB 4UVAA 3K58A 4KL1A 5JWPA 3KCYA 2DJVA 1K7DA 4YY3B 5A2QN 1SETA 3CCSV 4JI0B 4H0LB 1KMIZ 1SQFA 4JYYA 3K5NA 4QPJA 3CRMA 4IHJB 2BTQB 1ZAUA 4O4IB 4EEQA 4JI2B 4JI8O 2QTSA 3K06A 4BIUA 3BEHA 4MS2A 1UFIA 3CHXA 2QWNB 2XOKG 1NS1A 5H9CA 2RMKB 1KYOF 2H3OA 1O9HA 1SA0B 2HVKC 3DGEA 1D5AA 4JYCA 3H1IH 2QKAA 2DWDC 5EZYA 4YHHO 4IT5A 1Z5VA 2V4DA 3X2QC 2A7WA 3OGIB 3RW0A 4X64O 1W59A 1K73W 2B5UA 2R72A 4TV9B 5JVDB 3B09A 1NVPB 2UUAB 3ABKB 3N27A 1OCRC 4DW1A 4DUZO 1H2KA 1FXHA 2QJ1A 3WB1A 3FB8C 3CX5F 2BOBC 3CCVV 3H1JH 3ETGA 1H2MA 4JF3A 4GLXA 3TJTA 3ZHVA 5L3FA 1U96A 2YIBD 4JPRA 4DV4B 1AROP 1N32B 3FB7C 1V55C 1XL4A 2KQXA 3AG4C 1RM1C 1M56B 3AK1A 3ZHRA 1CXZB 2VQFB 3C90A 1K5SA 1UJWB 3ZRVA 1QVFU 4JZGA 4IYIA 4R7CA 2BSKA 2P7TC 1S77D 4B7KA 1BT8A 3RYFB 5GTHZ 1N34O 3H01A 2UXNA 2X0LA 4BW5A 4B3SB 1VQ7V 1I94O 4NXNB 2XAGA 3HR0A 5LGUA 2UXBO 1XREA 2N74A 4A5UB 3W7XA 1KECA 4DR4O 4DUYO 2F66C 2Q68A 2Q4PA 1U97A 4JV5O 2R9RB 1B3QA 4UV8A 4HNAB 1GKFA 5KHHA 3S3WA 4OX9B 4ZI7B 3I5DA 4U3JA 2IH3C 3K5LA 3ZMTA 5FL7G 3CC4V 2LO1A 1CP9A 4DV6B 3M99B 3KG2A 3UCSC 5LL6Y 2JS5A 1RFYA 3SPCA 5LHIA 2YIBA 4O4LA 1ROPA 2B1GA 4DR1B 4I0XB 2DW4A 4PDRA 3K04A 3FD9A 1IBLB 1NH2B 4NVPA 4JI2O 4RUFA 1NTKH 5KLVH 4DR6B 3SJCC 2EIKC 1FXKB 3G4SV 1R6KA 1DF4A 4MVQA 4X1YA 2QDOA 2Q69A 3NXSA 4P9PA 3O65A 1AP6A 3BPZA 1M57B 3ZEDA 2OIGA 3ZS8C 3RWRD 2OT5A 5KUKA 1GM8A 3C3TA 4N21A 2UUAO 1YIJV 5DECA 1BCCH 3ZMZA 1HNWB 4HYOA 3I56V 4RAIA 1SZXA 4GX2A 3N2KB 1B6QA 3SPGA 5KX5A 2XNDG 3W7TA 1J5EB 4KUMA 5EIBD 4BIZA 3FFQA 1TUBA 3BHPA 2W0XA 3T4DA 5E79Z 1F4NA 2JGUA 2OWOA 1S0VA 1JR9A 4DV4O 3QF7A 2JRIA 3DTUB 3SPIA 5LGTA 2DQ3A 2P22C 5KMGB 2N05A 1OCCB 5H6QA 3MAQA 1FYJA 3E2EA 1JFFB 3Q4HA 4DK0A 3AK2A 4IL6Z 1XI1A 3CXHF 2WAMA 3HKCB 1BHAA 5IYDO 4JI4B 1S72V 4P30A 4LBEC 1AR5A 4NB5A 5IJ9B 2F1MA 2WSSG 2PI4A 1JOYA 3M7MX 4B3TB 4ICGA 3CSXA 1PL0A 4B3SO 1GM9A 4O4JB 3MHSC 4UXNA 3P3PA 4DV1B 5B3SC 4NXNO 3M8AA 2EILB 3I55V 1M5IA 5TISZ 3JALA 1RPRA
chains in the Genus database with same CATH topology
1IBMO 5LMUO 2UXDO 1N33O 2ZKOA 1IBLO 2F4VO 1AB3A 1N36O 4LFCO 5IWAO 4LF9O 4OX9O 4DV5O 1X59A 2UXCO 4LFAO 4JI4O 4JI5O 4DR7O 4DV6O 1XNQO 4AQYO 1R6TA 3O65A 4GKKO 3J80N 4GKJO 1HNZO 4B3TO 4DR1O 1FJGO 3F5TA 4DV1O 2UUAO 1N32O 4DV0O 5H5NA 4JYAO 4JI3O 2AGAA 5BY1A 4K0KO 3OTOO 4OPAA 4OPHA 4DR6O 5BR8O 1G1XB 4JI1O 1YZBA 1HNWO 4LF8O 2UUBO 2VQFO 4DR5O 5BXZA 3T1HO 2Z0AA 2FKXA 4DV3O 3T1YO 4X62O 4LF6O 1N34O 2ZM6O 3J7AU 2DJVA 4DV7O 4NXMO 4DV4O 5A2QN 2E5LO 2UUCO 1J5EO 2JRIA 1I94O 3RT3C 2UXBO 3JAMN 2N74A 3R66A 4A5UB 4DR4O 4X65O 4DUYO 4JI8O 4YY3O 5LMNO 1R1BA 4JI0O 1FYJA 2HHHO 1HNXO 1XNRO 1DK1A 4JV5O 1KUQA 2LW7A 1XMQO 4DR2O 2DOSA 1NS1A 4DR3O 5IT9N 1IBKO 4LF5O 1XMOO 4DV2O 2UU9O 2VQEO 4JI7O 5LL6Y 4LF4O 4KHPO 1AILA 4JI6O 1FKAO 1HR0O 5FLXN 4YHHO 4X66O 3SDLA 4X64O 4B3SO 1A32A 3J81N 4NXNO 4LF7O 4DUZO 3M8AA 1F7YA 4B3MO 1XEQA 4LFBO 4B3RO 1D2DA 4JI2O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM O;  5LMU O;  2UXD O;  1N33 O;  2ZKO A;  1IBL O;  2F4V O;  1AB3 A;  1N36 O;  4LFC O;  5IWA O;  4LF9 O;  4OX9 O;  4DV5 O;  1X59 A;  2UXC O;  4LFA O;  4JI4 O;  4JI5 O;  4DR7 O;  4DV6 O;  1XNQ O;  4AQY O;  1R6T A;  3O65 A;  4GKK O;  3J80 N;  4GKJ O;  1HNZ O;  4B3T O;  4DR1 O;  1FJG O;  3F5T A;  4DV1 O;  2UUA O;  1N32 O;  4DV0 O;  5H5N A;  4JYA O;  4JI3 O;  2AGA A;  5BY1 A;  4K0K O;  3OTO O;  4OPA A;  4OPH A;  4DR6 O;  5BR8 O;  1G1X B;  4JI1 O;  1YZB A;  1HNW O;  4LF8 O;  2UUB O;  2VQF O;  4DR5 O;  5BXZ A;  3T1H O;  2Z0A A;  2FKX A;  4DV3 O;  3T1Y O;  4X62 O;  4LF6 O;  1N34 O;  2ZM6 O;  3J7A U;  2DJV A;  4DV7 O;  4NXM O;  4DV4 O;  5A2Q N;  2E5L O;  2UUC O;  1J5E O;  2JRI A;  1I94 O;  3RT3 C;  2UXB O;  3JAM N;  2N74 A;  3R66 A;  4A5U B;  4DR4 O;  4X65 O;  4DUY O;  4JI8 O;  4YY3 O;  5LMN O;  1R1B A;  4JI0 O;  1FYJ A;  2HHH O;  1HNX O;  1XNR O;  1DK1 A;  4JV5 O;  1KUQ A;  2LW7 A;  1XMQ O;  4DR2 O;  2DOS A;  1NS1 A;  4DR3 O;  5IT9 N;  1IBK O;  4LF5 O;  1XMO O;  4DV2 O;  2UU9 O;  2VQE O;  4JI7 O;  5LL6 Y;  4LF4 O;  4KHP O;  1AIL A;  4JI6 O;  1FKA O;  1HR0 O;  5FLX N;  4YHH O;  4X66 O;  3SDL A;  4X64 O;  4B3S O;  1A32 A;  3J81 N;  4NXN O;  4LF7 O;  4DUZ O;  3M8A A;  1F7Y A;  4B3M O;  1XEQ A;  4LFB O;  4B3R O;  1D2D A;  4JI2 O; 
#chains in the Genus database with same CATH topology
 4PEL A;  3IAY A;  3AG1 B;  1Q6H A;  3F5W C;  5JQG B;  1VEW A;  4L87 A;  3K79 A;  4TOI A;  5HFL A;  2GTS A;  2PTM A;  5LYJ A;  2EBO A;  4OX9 O;  4RO2 A;  4BIO A;  3AG3 C;  4IGG A;  4DV3 B;  3JAR B;  1YEW A;  4DV6 O;  2QKC A;  1FJG B;  3W7U A;  5LHG A;  1K34 A;  3T4Z A;  4TV8 A;  4DV0 B;  4DR1 O;  5AG2 A;  3K9S A;  1ENV A;  1P7G A;  4WFH A;  4K8X A;  3ZCC A;  3TGU H;  1WA8 B;  3OEH G;  1BHB A;  4FFB B;  3CCR V;  3HKB B;  3K03 A;  4UCR A;  3JSL A;  5LA6 A;  4DR6 O;  4U7O A;  3UM7 A;  1LR1 A;  5B1O A;  5JCO C;  1SRY A;  4KHP B;  5J2T B;  3ABM C;  1L0L H;  4FVM A;  2OCC C;  5BZB A;  2M6Y A;  1WPB A;  2VWK A;  4LFB B;  5C8Y A;  4X8A A;  3K9A A;  5KUM A;  4UV9 A;  2EUL A;  3G67 A;  1KUQ A;  3P32 A;  1OCO C;  2RQ6 A;  3A8T A;  1AI4 A;  4J41 A;  5J2U A;  3E22 A;  1XMO O;  4ASU G;  2AZ0 A;  2XTA A;  3LSS A;  1Y76 A;  2JEU A;  4GKJ B;  3KZI Z;  3IFX A;  2HG5 C;  1AI5 A;  4TUY A;  3CRR A;  5EBW C;  1QR8 A;  4B7E A;  2F93 B;  2EIJ C;  4LF9 B;  1NKD A;  2Y69 C;  1SC5 B;  1XQ8 A;  3X2Q B;  4BW9 A;  1AB3 A;  3MHH C;  4LFC O;  1PNK A;  4HBN A;  1J95 A;  5KAF Z;  1OCR B;  2R9I A;  1E1R G;  2W0F C;  5CB4 A;  4JI4 O;  1BSM A;  1W0K G;  2KG7 B;  1VF6 A;  3K59 A;  1IUR A;  3B4S A;  3L70 H;  4B3T O;  2WLM A;  1MOF A;  2YI9 A;  4BAY A;  1YTF B;  3ZN1 A;  3JD3 A;  4DV1 O;  4GT1 A;  5H6R A;  4I55 A;  2A3Q A;  3WG7 C;  1ZL8 B;  5BY1 A;  3TXS A;  3ML0 A;  3AEI A;  4X20 A;  2AXT Z;  1VQK V;  4P2Z A;  2IU3 A;  1S5H C;  1Q82 W;  3NR7 A;  4DRX A;  3RYH B;  1VQO V;  1V55 B;  5CA0 A;  3JAT A;  5GON B;  3AG4 B;  5CA1 A;  4DV3 O;  1RM1 B;  2LJ2 A;  4LNU B;  4PDM A;  1R3J C;  4ZOL B;  1SQX H;  4E4E A;  2IU0 A;  3A2F A;  2GUZ A;  3LUT B;  1VQ9 V;  1EN6 A;  5KAI Z;  2BTO A;  2IJI A;  5KHK A;  2BE3 A;  4LR3 A;  4GX1 A;  4J9Z B;  2VRZ A;  2BTQ A;  2YXH A;  3CRQ A;  4LH7 A;  4YHH B;  2E74 B;  3HKE B;  4X64 B;  1WN7 A;  3OR7 C;  4JAS A;  1PKX A;  4AQY B;  4KHP O;  5E1A C;  1Y74 B;  3OT7 A;  1FKA O;  1HNZ B;  4JTD B;  3K5O A;  2YIC A;  4DW0 A;  3SYO A;  5CBH A;  2Y0I A;  2YID A;  4YXW G;  4HZ3 A;  4B3M O;  4LP8 A;  2RDC A;  4LFB O;  4H37 A;  4O2B A;  4PD4 F;  4FZ1 A;  2XAS A;  1H2L A;  1FFX B;  4PV1 B;  5JVD A;  1Y4M A;  2D3O W;  4UCU A;  3T1C A;  5L3G A;  4FLY A;  2R9A A;  2OTL V;  4RQE A;  3D3Q A;  4H13 B;  2MW2 B;  1EN5 A;  2E76 B;  1R6T A;  1WPX A;  4GKJ O;  2F23 A;  3DXR B;  1QR9 A;  5BMV B;  4UVB A;  5L3D A;  1V9P A;  1YDX A;  2JEX A;  4U7N A;  4NTY A;  1GO3 F;  3SJB C;  1BGY H;  4FZ0 A;  1ZUQ A;  3SPH A;  1KKD A;  5GTI Z;  2HFE C;  4TT3 G;  5LOV B;  4H33 A;  5F2V O;  5BXZ A;  2KB1 A;  4KFM A;  4UUJ C;  3J7A U;  4J7K A;  1AJP A;  2WPD G;  4DR4 B;  2DN9 A;  1NQT A;  5FNV B;  4DUY B;  4DYL A;  1MAB G;  1NTM H;  5LXT B;  3ABU A;  3ZRW A;  3RYF A;  4FM2 A;  2B1I A;  1X4T A;  2CH7 B;  1NT2 B;  4JV5 B;  2RCV A;  2WLL A;  4Z2W A;  4KP4 A;  1NU1 H;  3U11 A;  2V7Q G;  4LCU C;  1H2S B;  4YJ2 B;  3QTC A;  1DK1 A;  1EZV H;  3K5M A;  2PUS A;  1PPJ H;  4MW8 A;  1XMQ O;  1US6 A;  1RPO A;  3WB2 A;  2N04 A;  1SES A;  3RYI A;  4AI8 A;  3A0B Z;  2WLI A;  2QWO B;  4WFB V;  4HNA A;  2EJR A;  3EVK A;  1AJQ A;  2EIN B;  3D36 A;  4I5S A;  4ZI7 A;  1MSD A;  4F6R B;  4FLV A;  4CC5 A;  2ATK C;  2WLN A;  1G8M A;  1I5X A;  4JI1 B;  2GSM B;  4MTG A;  4LWS B;  2Q0O C;  1Q43 A;  4O4H B;  1TGO A;  2Q0A A;  3JAW B;  4JZ2 A;  4TWK A;  3STL C;  5IY5 C;  5B3S B;  1XIL A;  4FK5 C;  1FAF A;  1SQB H;  5JJJ B;  4AQY O;  3UT5 B;  1N0J A;  2RN9 A;  3RYC B;  3J80 N;  1HNZ O;  2D2C B;  2A0L A;  1K4D C;  3CJH A;  1IZ3 A;  2ZXW C;  1MZF A;  2JDI G;  1BZK A;  2WLJ A;  2IJJ A;  4X1K A;  2QKS A;  5LP6 B;  2JS3 A;  5LGN A;  3LNM B;  2A9H A;  4X66 B;  2PYJ A;  1KKC A;  3APQ A;  2OYQ A;  3PJS K;  1FXV A;  2AW9 A;  3N2K A;  1QLN A;  2E75 B;  3CRC A;  1QNM A;  4MTO A;  3ABM B;  2HHH O;  1AVM A;  5DN6 G;  2M7W A;  1KP3 A;  2OCC B;  3N2G B;  2Y48 A;  2IBZ H;  1N36 B;  1RP3 B;  1IBK O;  4BR6 A;  2PYL A;  3KCX A;  3CC7 V;  3H9V A;  1PL4 A;  4XDL A;  4LF4 O;  1GN3 A;  2YI8 A;  5FLX N;  2WWW A;  5L3B A;  1LNQ A;  5B1B C;  1OCO B;  1WJZ A;  1K5Q A;  1VIB A;  3L71 H;  1GTO A;  1KC8 W;  3OAA G;  2ZQM A;  5IJ9 A;  1VP7 A;  3OW2 U;  4I4T B;  4G2K A;  4CS3 A;  5CBF A;  3CEI A;  2WLK A;  4MVR A;  1WAZ A;  2RNB A;  2EIJ B;  3OMI B;  1M4U A;  3PN1 A;  5JJE B;  1JX9 A;  4J10 A;  3F5T A;  2EIM C;  3W7S A;  3CCE V;  3JAR A;  2H8P C;  5A9G A;  1PP9 H;  4H44 B;  5GW7 A;  4Z1V A;  4O2A A;  2XAF A;  4OPA A;  4TSF G;  3HPL C;  3OD4 A;  2Q6A A;  2YSU B;  3VBB A;  4JI1 O;  3LSQ A;  4LF5 B;  4MTF A;  3VQW A;  1GM7 A;  5B1A C;  1S5L Z;  3HKB A;  3WG7 B;  1RSO A;  3MD0 A;  1JMK C;  1K8A W;  1TVK A;  4X1I B;  5EC1 C;  4WFG A;  5KHI A;  3JD1 A;  3SPJ A;  3ASO C;  3R66 A;  5J2T A;  1VF6 C;  3G71 V;  1D5N A;  1EZJ A;  1BE3 H;  3CC2 V;  1CEZ A;  1XMO B;  4FLT A;  3RN4 A;  3IGA C;  1NBM G;  5B1N A;  4DR3 O;  3JAK B;  2UXC B;  1TUE B;  1I08 A;  3RVZ A;  4CH6 A;  1SQV H;  2Y4T A;  1FFT B;  4R50 A;  1VQ6 V;  2XAQ A;  4X66 O;  1MMM A;  3FAV B;  2PGG A;  2ZE5 A;  1XBL A;  1KD1 W;  4AIL C;  5K1P A;  4JYA B;  4LFC B;  2K1E A;  5CBG A;  2BSK B;  2PY5 A;  2NN4 A;  1N36 O;  4LF8 B;  1WB8 A;  1BMF G;  1NZ6 A;  2DE0 X;  1F51 A;  5C93 A;  4X62 B;  2ZM6 B;  2Q67 A;  3CD6 V;  5HFM A;  4B08 A;  2XT9 A;  1YSC A;  2YEV A;  1NR1 A;  3THO A;  2CTW A;  2KG7 A;  3OTF A;  5LMN B;  1EN4 A;  3JCU Z;  1GN2 A;  1IXB A;  3GWK C;  4J9Y B;  4U3F H;  1LUW A;  2ZIM A;  2YDE A;  3CE2 A;  1HP8 A;  4OXS A;  2C2A A;  4P9O A;  2OIE A;  3CCJ V;  3B40 A;  1ZL8 A;  2FKX A;  4D7S A;  2P90 A;  4XDK A;  2CGO A;  3A0H Z;  2EZO A;  1ZLZ A;  3RYH A;  4LF7 B;  4NKG B;  1SZT A;  5IE9 A;  5K1X A;  5IJ0 B;  4LNU A;  3U10 A;  3BA8 A;  4RQF A;  3STZ C;  1KQS U;  4PJ0 Z;  4PA7 A;  4QNH B;  2QA4 V;  4X1Y B;  3D8C A;  4WFF A;  2P4V A;  3ASN C;  4FMT A;  4LF5 O;  1GAX A;  2XHB A;  1PD3 A;  1YF2 A;  1S5J A;  2CGN A;  1M1K W;  3P3N A;  2HJD A;  3RGB A;  3CCM V;  1OCZ B;  4B3M B;  4JTC B;  4YIO A;  4UB6 Z;  3SDL A;  4EKW A;  3HKE A;  4CH3 A;  2P06 A;  2LFR A;  1YJ9 V;  3ZHU A;  1EBO A;  4PA9 A;  2ZNI A;  4HAM A;  3EXA A;  1D2D A;  4UB8 Z;  2JK5 C;  1GRJ A;  3ETD A;  3QG5 A;  2HJF C;  2QM7 A;  1COW G;  3FB6 C;  4NYK A;  1H2G A;  1TUB B;  3BRC A;  1MSW D;  2UXC O;  2X7R B;  2FYU H;  4NXM B;  3G6B A;  1FD9 A;  4IIJ B;  5LHH A;  3VOU A;  2H94 A;  4MT8 A;  1YJN V;  4MSW C;  5IY5 B;  4QPK A;  1QLE C;  1Z5W A;  2L6L A;  2IW5 A;  3D36 C;  1S3J A;  5JH7 B;  3Q4H B;  4DXW A;  4JYA O;  3K08 A;  1XNR B;  2K9P A;  2F95 B;  4MVM A;  4GX0 A;  3CMA V;  2CE4 A;  2ZD9 A;  1AJN A;  4LF8 O;  1Q8I A;  4MW3 A;  2ZIO A;  1XUQ A;  5CN0 A;  3OEE G;  4CBC A;  4X62 O;  1I7F A;  2FTK A;  2JJ1 G;  2ZE6 A;  2ZM6 O;  2BCC H;  4YJ3 B;  1VF5 B;  4FPP A;  4AHC A;  5LOV A;  3SYC A;  3JAL B;  2X6A A;  3CCQ V;  1N0N A;  4B3R B;  1VF7 A;  1XMQ B;  1NVP D;  5LMN O;  4I50 A;  4UVC A;  5EK0 A;  3ZMU A;  1Q3E A;  2HR3 A;  1WLE A;  5LYJ B;  4GX5 A;  2QE7 G;  5ITZ A;  5IWA B;  5B5E Z;  2E3C A;  1CPY A;  4IYH A;  4YJ2 A;  1L0N H;  1JPX A;  3HKD A;  3JYC A;  3OM3 B;  4TV8 B;  2Q9L A;  1AIL A;  4GKK B;  4PI0 A;  3IJ4 A;  4PA6 A;  2ITD C;  3L73 H;  1A32 A;  4MTX A;  4LF7 O;  1F7Y A;  1NR7 A;  4FFK A;  4GCZ A;  1YI2 V;  5LA6 B;  3CS5 A;  3JCZ A;  3OTO B;  4IHJ A;  4WFE A;  4O4I A;  4QE9 A;  3ZHT A;  3SGI A;  3CCL V;  1TA8 A;  2Q7E A;  3RBZ A;  1K33 A;  3ZRS A;  5B1B B;  2B9Z A;  3B8M A;  3GVM A;  1PV0 A;  2UUB B;  2PF4 E;  5EYP B;  3ZHS A;  1OHH G;  3ZBH A;  1SA0 A;  3BFR A;  5EC2 C;  1LUV A;  1XHX A;  4LWS A;  2NNU A;  3JAW A;  4G27 B;  1QBZ A;  2XAH A;  2EX3 A;  3K0D A;  5C8Y B;  1JVM A;  4F6E A;  4E2L A;  2ODM A;  4WBN B;  3UT5 A;  4TV9 A;  3C3S A;  1P49 A;  5J2U B;  1DF5 A;  5BR8 O;  3E22 B;  1H8H G;  1H2N A;  1H8E G;  2EIM B;  2UU9 B;  2EIK B;  4WF9 V;  3E35 A;  4KXR A;  4WFA V;  1XL6 A;  4LF6 O;  1BQZ A;  4XBF A;  2EIL C;  4NXM O;  1R3I C;  1PNM A;  2NR5 A;  1I5Y A;  4TUY B;  2HHH B;  5LP6 A;  3AG1 C;  3ZX6 A;  3QO5 A;  4MVU A;  5B1A B;  1M90 W;  2AHZ A;  2Q5Z A;  1S76 D;  1JJO A;  1YCI A;  1R1B A;  1R6N A;  1IBK B;  1XNR O;  1NH2 D;  2IH1 C;  2JGD B;  2F4V B;  2LW7 A;  1WNS A;  3A0R A;  4ZIB A;  3CP1 A;  5CB4 B;  5KA5 A;  4J42 A;  4OGQ B;  4LF4 B;  3ASO B;  3CYO A;  3N2G A;  4MVZ A;  4JAU A;  4CH5 A;  1Y67 A;  2A79 B;  2ZDI A;  4PHZ A;  3OFN G;  4I55 B;  4CS2 A;  3B2E E;  1W0J G;  5L3C A;  3QO8 A;  1XEQ A;  4X20 B;  1IX9 A;  4B3R O;  1G6U A;  2GBO A;  1XDC A;  1W2B U;  2LGQ A;  1GK9 A;  1SS3 A;  2FB5 A;  1N33 O;  2ZKO A;  4ZHQ B;  5CA0 B;  5IWA O;  3BA9 A;  3E8H A;  5CA1 B;  1IXM A;  1JA8 A;  2F43 G;  1SQG A;  4PA3 A;  4K8Z A;  1SF9 A;  5B66 Z;  4CZZ A;  3AK3 A;  3L74 H;  4GKK O;  4Z1M G;  1Q6I A;  3UKM A;  3G80 A;  2Q8V A;  3WFV A;  1VQ8 V;  4X65 B;  1E79 G;  1AR1 B;  4I0X A;  1VQ5 V;  1HNX B;  2AGA A;  3OTO O;  4RUE A;  3ZHQ A;  2GTA A;  1I0H A;  1AR4 A;  5DM6 V;  4MVO A;  2UUB O;  1WP8 A;  4CH4 A;  1FXK A;  3OMA B;  2Z0A A;  4JI7 B;  4PI2 A;  1TAE A;  1F4M A;  3JAS B;  3AG3 B;  1B06 A;  4NR1 A;  5EBM C;  4K35 A;  3RT3 C;  2O57 A;  4GZR B;  3TET A;  4O2B B;  2NLJ C;  3ABL C;  1VQP V;  4DR3 B;  4X1I A;  1K9M W;  1YHQ V;  4UCS A;  1KU9 A;  1WP7 A;  1PM9 A;  1OJH A;  4JAA A;  4QGP A;  4UFZ A;  3FYI B;  4TQF A;  5IYZ B;  1URF A;  2UU9 O;  1XNQ B;  3E89 A;  1HR0 O;  3IC7 A;  5EIB C;  3QNE A;  3MDS A;  3JAK A;  2YS8 A;  1M9N A;  3TCU A;  3ASN B;  5CA3 A;  2VWJ A;  2GV9 A;  1V54 C;  4K0K B;  4EB6 B;  1T5E A;  3ICX A;  5KMG A;  1B04 A;  2QM4 A;  3FAV A;  2PZS A;  3D3I A;  2LGW A;  2F4V O;  1GH6 A;  3BVO A;  1JFF A;  1JJ2 U;  3K57 A;  1UPG A;  4JTA B;  4JI5 O;  2X6C A;  2WA4 A;  2DYS C;  3HKC A;  3ZRW B;  1BQ0 A;  3H1K H;  3SYA A;  1DGS A;  2WLL B;  4DK1 A;  1PNL A;  1K92 A;  2ZR2 A;  1AP5 A;  2QGN A;  3E8G A;  2ZCE A;  2CDY A;  4O4J A;  3SYQ A;  5D5Q A;  5H5N A;  4JI3 O;  3RFR A;  3E86 A;  4N23 A;  3RYI B;  3BAA A;  2WLI B;  1KP2 A;  4EFE A;  5JQG A;  3CXC U;  3RVY A;  1DLB A;  3L9D A;  1QLE B;  2ZT9 B;  3K0G A;  1FPO A;  2Y69 B;  2CUG A;  4JI6 B;  3FYE B;  3OE7 G;  3ZRX A;  2JJ2 G;  1VQL V;  1ZWI C;  1HWY A;  3BCC H;  2QWP B;  4X65 O;  5H2F Z;  1M93 A;  4YY3 O;  3UQ8 A;  1IBM B;  1QCE A;  4JI0 O;  5LMU B;  2UXD B;  1HNX O;  3R65 A;  1WA8 A;  5EZY B;  2EZP A;  4FFB A;  2DYR C;  3AG2 C;  2RJZ A;  5IJ0 A;  3F7Y C;  2P67 A;  2FML A;  4LFA B;  4UCO A;  3S3X A;  3P30 A;  4JI7 O;  4JYB A;  4X88 A;  2ZE7 A;  1MG1 A;  4DO2 A;  2KSD A;  3E8F A;  4JGS A;  2YC0 A;  1IVS A;  3O9O A;  3CJH B;  2ZNJ A;  3E8B A;  4EFB A;  2CAZ C;  2ADQ B;  4UCV A;  1YTF D;  2AZ2 A;  1WB7 A;  1EFR G;  4X1K B;  1Y6X A;  2Q7G A;  5J9P C;  4X9Q A;  1X59 A;  4X89 A;  4G28 B;  3T1Y B;  1N4C A;  1XNQ O;  2Y4U A;  4DV7 B;  3SYP A;  2LW1 A;  2DMX A;  1SKV A;  2KKW A;  2E5L B;  2UUC B;  2HLD G;  3WB0 A;  2ZR3 A;  3B8N A;  1P7B A;  3SJA C;  2CTQ A;  2ZE8 A;  3LDE A;  4J11 A;  4QE7 A;  3G6E V;  1N32 O;  1R3K C;  2YUA A;  5CMU A;  4D6T H;  4K0K O;  4IIJ A;  4OPH A;  4DR2 B;  4GYC B;  2Q73 A;  3DSQ A;  1G1X B;  1F23 A;  1YZB A;  2EIN C;  1JCH A;  4CC6 A;  2VQF O;  5JH7 A;  1VQ4 V;  2W6I G;  2V1D A;  3CCU V;  3JD2 A;  2OCH A;  3UO3 A;  4FLW A;  5L3E A;  1ZX3 A;  1K4C C;  2QEX V;  3U0Z A;  1Q90 D;  3JSN A;  4U3J B;  2OTJ V;  1KBH A;  4FM0 A;  2YIA A;  4YJ3 A;  4L8J A;  3BAB A;  4ZKI A;  3E83 A;  1VQN V;  2CK3 G;  4O4L B;  3CRA A;  1Q5O A;  3KKY A;  4DV5 B;  3ABK C;  3F7V C;  4PA4 A;  1SQP H;  2DWE C;  1ORQ C;  4DR7 B;  3K3W A;  3JD0 A;  3EHB B;  1SQQ H;  1OV9 A;  3JD4 A;  4LC1 A;  4FIP C;  4JI6 O;  4FLU A;  1O9G A;  4W4L A;  5GON A;  4BWA A;  3APO A;  2PI5 A;  4GUN A;  4YIP A;  2HVJ C;  4FLX A;  2A06 H;  3IC9 A;  4ZOL A;  1QU7 A;  4O2A B;  3VQY A;  1DTO A;  2XAJ A;  1IBM O;  1G4Y B;  5LMU O;  2UXD O;  5LP6 C;  4FM1 A;  3DC6 A;  1IBL O;  1P84 F;  2QWQ B;  1Q81 W;  1QVG U;  2ILM A;  5IYB O;  1Z2G A;  1HW7 A;  4DR5 B;  3H1H H;  3T1H B;  1RSO B;  3ZMV A;  2CTP A;  2WA3 A;  3UO2 A;  2P4K A;  4LFA O;  1TVK B;  1M56 C;  3TK1 A;  2DQ0 A;  5IDJ A;  2QWR B;  5EYP A;  1Y74 A;  4UCT A;  2XUM A;  3ETQ A;  4QJF B;  3TXQ A;  1YJW V;  1E1Q G;  5BR8 B;  2ZDI C;  1EM1 A;  3LDD A;  3OUS A;  3ZMS A;  5KX5 B;  5FPO A;  4F4L A;  4JAV A;  1HNW O;  4LF6 B;  1GN6 A;  4WBN A;  1FFX A;  2WLH A;  4J7J A;  4DV2 B;  2VQE B;  1SER A;  3T1Y O;  5D5P A;  4LH6 A;  3CB2 A;  4DV7 O;  2MK3 A;  3FX7 A;  2VS0 A;  2E5L O;  2UUC O;  4Q20 A;  1J5E O;  3BY6 A;  3JAM N;  3DXR A;  5FPR A;  5BMV A;  2R70 A;  3OUF A;  5LBQ A;  4ABM A;  4QIW F;  1NJI W;  2G38 A;  2Z3Y A;  1R3L C;  4DR2 O;  1Q6U A;  1K3E A;  1MZE A;  1NI8 A;  2ZXW B;  4J80 A;  5IYC O;  3CME V;  2QSA A;  3ABL B;  2JGD A;  3FKS G;  3T2M A;  3AG7 A;  2UXX A;  2YEV B;  1XOU A;  1FXK C;  4Q6G A;  3SR2 C;  2CTR A;  3L72 H;  5FNV A;  3WU2 Z;  1N33 B;  2LP7 A;  1NTZ H;  1BL8 A;  3ABT A;  5LXT A;  4TQD A;  2YXY A;  2LQT A;  1MNG A;  2CH7 A;  2ITC C;  2GDS A;  1L1F A;  1M57 C;  2QM8 A;  4FLZ A;  1Q86 W;  4K3A A;  3GB7 C;  4DV5 O;  1K97 A;  4DR7 O;  1V54 B;  4ZHQ A;  5KHJ A;  4J7Z A;  2IJH A;  5DED A;  2Y0P A;  1FJG O;  4JI8 B;  4DV0 O;  1L8D A;  1R73 A;  2DYS B;  4F6R A;  2EJ7 A;  4I9W A;  1H38 A;  1ZTE A;  4CS4 A;  4R6Z A;  1QHT A;  4PDV A;  5JJN B;  2ARH A;  3FB5 C;  3QO7 A;  3QVN A;  1ZSP A;  4DR5 O;  3T1H O;  1OCC C;  4I9Q A;  3LSU A;  1THZ A;  4O4H A;  4D7T A;  4MVS A;  3CPW U;  3OMN B;  3OR6 C;  2LFS A;  1XHZ A;  1YIT V;  3CWB H;  3SJQ C;  3RYC A;  2ADP A;  2HKO A;  4DUZ B;  3ZN0 A;  2IM9 A;  3W7W A;  4PDL A;  2HP8 A;  3LDC A;  1IDS A;  4NTW A;  4ZBM A;  1Y66 A;  3OGC C;  3JAS A;  3B77 A;  1GMG A;  2X6B A;  2Z5U A;  2YXL A;  1Y76 B;  2P6J A;  3DC5 A;  4WCE V;  1Q7Y W;  2DOS A;  1YXB A;  1OZ0 A;  4FJC C;  5IT9 N;  5KA6 A;  2JIZ G;  1HR0 B;  4RWU A;  5EBL C;  4I7Z B;  3EFF K;  4DV2 O;  3ZIA G;  2VQE O;  4R8C A;  2AHY A;  4W4K A;  2P5O A;  2DYR B;  1YVW A;  1QQC A;  3J81 N;  3AG2 B;  3ETE A;  5IYZ A;  2GHY A;  2L35 A;  1BS3 A;  2QTO A;  1FS0 G;  2ZIN A;  3L75 H;  5JCO A;  4NTX A;  4C7U A;  3ZJZ A;  2Q7H A;  5KHG A;  2QR4 A;  3H1L H;  4JI5 B;  1KB9 F;  2FL4 A;  2ETN A;  2JVD A;  1P4R A;  4LF9 O;  4EB6 A;  1N34 B;  1VAR A;  4XDJ A;  1GN4 A;  2BOC C;  1I94 B;  4JI3 B;  2UXB B;  3VQV A;  2HEP A;  4I50 B;  3LNN A;  1JQ0 A;  2W6J G;  4DRX B;  3VQX A;  5ITZ B;  3JAT B;  3HB3 B;  3GWO A;  1MA1 A;  1N8R W;  4I4T A;  1VQM V;  3HKD B;  2IJK A;  1AI7 A;  1OCZ C;  1HDJ A;  1AI6 A;  1VMG A;  2GUZ B;  4UVA A;  3K58 A;  4KL1 A;  5JWP A;  3KCY A;  2DJV A;  1K7D A;  4YY3 B;  5A2Q N;  1SET A;  3CCS V;  4JI0 B;  4H0L B;  1KMI Z;  1SQF A;  4JYY A;  3K5N A;  4QPJ A;  3CRM A;  4IHJ B;  2BTQ B;  1ZAU A;  4O4I B;  4EEQ A;  4JI2 B;  4JI8 O;  2QTS A;  3K06 A;  4BIU A;  3BEH A;  4MS2 A;  1UFI A;  3CHX A;  2QWN B;  2XOK G;  1NS1 A;  5H9C A;  2RMK B;  1KYO F;  2H3O A;  1O9H A;  1SA0 B;  2HVK C;  3DGE A;  1D5A A;  4JYC A;  3H1I H;  2QKA A;  2DWD C;  5EZY A;  4YHH O;  4IT5 A;  1Z5V A;  2V4D A;  3X2Q C;  2A7W A;  3OGI B;  3RW0 A;  4X64 O;  1W59 A;  1K73 W;  2B5U A;  2R72 A;  4TV9 B;  5JVD B;  3B09 A;  1NVP B;  2UUA B;  3ABK B;  3N27 A;  1OCR C;  4DW1 A;  4DUZ O;  1H2K A;  1FXH A;  2QJ1 A;  3WB1 A;  3FB8 C;  3CX5 F;  2BOB C;  3CCV V;  3H1J H;  3ETG A;  1H2M A;  4JF3 A;  4GLX A;  3TJT A;  3ZHV A;  5L3F A;  1U96 A;  2YIB D;  4JPR A;  4DV4 B;  1ARO P;  1N32 B;  3FB7 C;  1V55 C;  1XL4 A;  2KQX A;  3AG4 C;  1RM1 C;  1M56 B;  3AK1 A;  3ZHR A;  1CXZ B;  2VQF B;  3C90 A;  1K5S A;  1UJW B;  3ZRV A;  1QVF U;  4JZG A;  4IYI A;  4R7C A;  2BSK A;  2P7T C;  1S77 D;  4B7K A;  1BT8 A;  3RYF B;  5GTH Z;  1N34 O;  3H01 A;  2UXN A;  2X0L A;  4BW5 A;  4B3S B;  1VQ7 V;  1I94 O;  4NXN B;  2XAG A;  3HR0 A;  5LGU A;  2UXB O;  1XRE A;  2N74 A;  4A5U B;  3W7X A;  1KEC A;  4DR4 O;  4DUY O;  2F66 C;  2Q68 A;  2Q4P A;  1U97 A;  4JV5 O;  2R9R B;  1B3Q A;  4UV8 A;  4HNA B;  1GKF A;  5KHH A;  3S3W A;  4OX9 B;  4ZI7 B;  3I5D A;  4U3J A;  2IH3 C;  3K5L A;  3ZMT A;  5FL7 G;  3CC4 V;  2LO1 A;  1CP9 A;  4DV6 B;  3M99 B;  3KG2 A;  3UCS C;  5LL6 Y;  2JS5 A;  1RFY A;  3SPC A;  5LHI A;  2YIB A;  4O4L A;  1ROP A;  2B1G A;  4DR1 B;  4I0X B;  2DW4 A;  4PDR A;  3K04 A;  3FD9 A;  1IBL B;  1NH2 B;  4NVP A;  4JI2 O;  4RUF A;  1NTK H;  5KLV H;  4DR6 B;  3SJC C;  2EIK C;  1FXK B;  3G4S V;  1R6K A;  1DF4 A;  4MVQ A;  4X1Y A;  2QDO A;  2Q69 A;  3NXS A;  4P9P A;  3O65 A;  1AP6 A;  3BPZ A;  1M57 B;  3ZED A;  2OIG A;  3ZS8 C;  3RWR D;  2OT5 A;  5KUK A;  1GM8 A;  3C3T A;  4N21 A;  2UUA O;  1YIJ V;  5DEC A;  1BCC H;  3ZMZ A;  1HNW B;  4HYO A;  3I56 V;  4RAI A;  1SZX A;  4GX2 A;  3N2K B;  1B6Q A;  3SPG A;  5KX5 A;  2XND G;  3W7T A;  1J5E B;  4KUM A;  5EIB D;  4BIZ A;  3FFQ A;  1TUB A;  3BHP A;  2W0X A;  3T4D A;  5E79 Z;  1F4N A;  2JGU A;  2OWO A;  1S0V A;  1JR9 A;  4DV4 O;  3QF7 A;  2JRI A;  3DTU B;  3SPI A;  5LGT A;  2DQ3 A;  2P22 C;  5KMG B;  2N05 A;  1OCC B;  5H6Q A;  3MAQ A;  1FYJ A;  3E2E A;  1JFF B;  3Q4H A;  4DK0 A;  3AK2 A;  4IL6 Z;  1XI1 A;  3CXH F;  2WAM A;  3HKC B;  1BHA A;  5IYD O;  4JI4 B;  1S72 V;  4P30 A;  4LBE C;  1AR5 A;  4NB5 A;  5IJ9 B;  2F1M A;  2WSS G;  2PI4 A;  1JOY A;  3M7M X;  4B3T B;  4ICG A;  3CSX A;  1PL0 A;  4B3S O;  1GM9 A;  4O4J B;  3MHS C;  4UXN A;  3P3P A;  4DV1 B;  5B3S C;  4NXN O;  3M8A A;  2EIL B;  3I55 V;  1M5I A;  5TIS Z;  3JAL A;  1RPR A; 
#chains in the Genus database with same CATH homology
 1IBM O;  5LMU O;  2UXD O;  1N33 O;  2ZKO A;  1IBL O;  2F4V O;  1AB3 A;  1N36 O;  4LFC O;  5IWA O;  4LF9 O;  4OX9 O;  4DV5 O;  1X59 A;  2UXC O;  4LFA O;  4JI4 O;  4JI5 O;  4DR7 O;  4DV6 O;  1XNQ O;  4AQY O;  1R6T A;  3O65 A;  4GKK O;  3J80 N;  4GKJ O;  1HNZ O;  4B3T O;  4DR1 O;  1FJG O;  3F5T A;  4DV1 O;  2UUA O;  1N32 O;  4DV0 O;  5H5N A;  4JYA O;  4JI3 O;  2AGA A;  5BY1 A;  4K0K O;  3OTO O;  4OPA A;  4OPH A;  4DR6 O;  5BR8 O;  1G1X B;  4JI1 O;  1YZB A;  1HNW O;  4LF8 O;  2UUB O;  2VQF O;  4DR5 O;  5BXZ A;  3T1H O;  2Z0A A;  2FKX A;  4DV3 O;  3T1Y O;  4X62 O;  4LF6 O;  1N34 O;  2ZM6 O;  3J7A U;  2DJV A;  4DV7 O;  4NXM O;  4DV4 O;  5A2Q N;  2E5L O;  2UUC O;  1J5E O;  2JRI A;  1I94 O;  3RT3 C;  2UXB O;  3JAM N;  2N74 A;  3R66 A;  4A5U B;  4DR4 O;  4X65 O;  4DUY O;  4JI8 O;  4YY3 O;  5LMN O;  1R1B A;  4JI0 O;  1FYJ A;  2HHH O;  1HNX O;  1XNR O;  1DK1 A;  4JV5 O;  1KUQ A;  2LW7 A;  1XMQ O;  4DR2 O;  2DOS A;  1NS1 A;  4DR3 O;  5IT9 N;  1IBK O;  4LF5 O;  1XMO O;  4DV2 O;  2UU9 O;  2VQE O;  4JI7 O;  5LL6 Y;  4LF4 O;  4KHP O;  1AIL A;  4JI6 O;  1FKA O;  1HR0 O;  5FLX N;  4YHH O;  4X66 O;  3SDL A;  4X64 O;  4B3S O;  1A32 A;  3J81 N;  4NXN O;  4LF7 O;  4DUZ O;  3M8A A;  1F7Y A;  4B3M O;  1XEQ A;  4LFB O;  4B3R O;  1D2D A;  4JI2 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...