5IWAO

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
molecule keywords 30S ribosomal protein S2
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5iwaO00
4LF6O 4K0KO 5LL6Y 3SDLA 2VQFO 4LFAO 3O65A 1I94O 1XMQO 4DR7O 1HR0O 2UU9O 4JI1O 4B3MO 4DUZO 4LF9O 4LF8O 1A32A 2ZKOA 4JI7O 2HHHO 4YHHO 1IBLO 4DV2O 2FKXA 4OPHA 2LW7A 4LF7O 1KUQA 4GKJO 4DR5O 4OX9O 4DV6O 3T1YO 4JI3O 4A5UB 5LMUO 1XMOO 1AILA 4JI6O 1N32O 4JI5O 4B3RO 4DV5O 1XNQO 4DR1O 4LFBO 4B3TO 3F5TA 1NS1A 1HNZO 1IBKO 1XEQA 2UUAO 4JI8O 3OTOO 4DR4O 4DUYO 1DK1A 1G1XB 2DJVA 3JAMN 4DV7O 5A2QN 4GKKO 2E5LO 4DR3O 2N74A 1R1BA 1N33O 1R6TA 5IWAO 3J81N 2F4VO 3J7AU 5BR8O 4NXNO 4JI4O 1N36O 1XNRO 1FKAO 3M8AA 3R66A 5H5NA 1F7YA 2UUCO 4DV0O 2JRIA 5FLXN 2ZM6O 4DR2O 2DOSA 4KHPO 4OPAA 1N34O 2UXCO 4AQYO 1X59A 1FJGO 5BXZA 4X62O 4JI2O 4DV1O 1D2DA 5LMNO 2UUBO 1IBMO 3RT3C 3T1HO 1YZBA 4NXMO 4X64O 1J5EO 2UXBO 2Z0AA 5IT9N 4YY3O 4JI0O 1HNXO 4JYAO 4X66O 1AB3A 4B3SO 4JV5O 4DR6O 4LF4O 4X65O 4LF5O 1HNWO 2AGAA 1FYJA 2VQEO 4DV4O 3J80N 2UXDO 4LFCO 5BY1A 4DV3O
chains in the Genus database with same CATH superfamily
4LP8A 1YCIA 1OCRC 1SZTA 4LWSA 4JASA 4CH4A 3P30A 5LXTA 1F4MA 2QKCA 1B3QA 1Q6UA 5FPOA 1R73A 3M99B 5CBHA 3DC5A 2P5OA 1A32A 2ARHA 2C2AA 5BR8B 4J7ZA 1WB8A 3B77A 3K9AA 2HHHO 2JGDB 1OCCB 1V55B 3JAWA 4LH6A 1M90W 2GUZB 1VQ8V 3B4SA 3HKDA 4TV9A 4ZI7B 1URFA 4K0KB 1XREA 3JATA 2UXDB 3BY6A 1YTFD 3SPHA 3K59A 3SYPA 3W7WA 5LA6A 5L3EA 1K5QA 2HG5C 1R6KA 5IE9A 5KHGA 3FD9A 4ZKIA 1JFFB 4ICGA 2AHZA 4O2BB 2ZCEA 1YJ9V 4MVRA 4GUNA 1EN5A 1K4DC 4B08A 3DTUB 3RYIA 5LYJB 3A8TA 5C8YB 3SYQA 4F6RA 4I55A 3DGEA 4DV1O 1CPYA 1XL6A 4KL1A 3ZMTA 4HBNA 4NTYA 1EN6A 2R9IA 3CXCU 5CB4A 4X64O 1AJQA 5B1BB 1N32B 5DEDA 5FPRA 1SF9A 5JVDB 1AI4A 3STLC 1LUWA 5J2UA 3CCUV 2JEUA 1QVFU 2EULA 2A06H 4U3JB 3W7XA 4HZ3A 4TQDA 3OGIB 1I5XA 2BTQB 2HLDG 3B8MA 4CZZA 2DQ0A 4L87A 3J80N 1AP5A 1US6A 5BY1A 1M56C 5CA0B 1XI1A 1M4UA 3K03A 3G80A 5LOVB 4Q20A 2L6LA 3L70H 2E75B 4LF9O 3RBZA 2PI5A 4ASUG 2BE3A 2V1DA 3CC2V 1TUEB 2IW5A 1QLNA 1TA8A 3ZMSA 4HYOA 2HJFC 2LW1A 1GH6A 3SYCA 1RFYA 1OCZC 1KUQA 3CCRV 5H9CA 1XMOO 1X4TA 1S76D 2GDSA 4PI0A 1WPXA 2Q0OC 3HKBA 3BAAA 4B3TO 4WFGA 5LP6C 2KG7B 1M57C 4X62B 3E89A 4CS4A 4GCZA 4GKJB 2HVKC 5E1AC 1Q6HA 2ZD9A 1V54B 4JF3A 2WLJA 3CB2A 1QR8A 4N21A 3LSUA 4EFEA 3RYCB 4LF8B 3ZRXA 1KKCA 4TT3G 3OR6C 1FJGO 3F5WC 3W7TA 3L9DA 2W0FC 1VMGA 4HNAB 4NXMO 1AR5A 3OM3B 1XILA 5GONA 1HNXB 4GX2A 4E2LA 1VQ5V 5KAFZ 4TWKA 3L73H 1TAEA 1ZWIC 4NXMB 2H3OA 4GX1A 1V54C 1TUBA 2AGAA 3WB0A 4OGQB 1K73W 2AZ2A 1P4RA 3AG4C 4DK0A 1K5SA 2ZIMA 3H1KH 3HR0A 2Q68A 1H2NA 1ZUQA 2UU9O 5IYZB 1SQPH 2LO1A 1NU1H 1WA8B 1PP9H 3RVYA 2IU0A 1S5HC 2E76B 3E8FA 5LP6A 4WBNA 2ATKC 2JK5C 3ZRSA 2JGDA 1Q81W 1FPOA 2Y69B 2K9PA 1OCOC 5HFMA 4LBEC 5EIBC 4DR4B 2QDOA 2F43G 2QGNA 2DWEC 3BA8A 3MHHC 4JI5O 2VRZA 1GMGA 4DR1O 1FXVA 1HNZO 2QEXV 2YUAA 1MNGA 1TUBB 2KSDA 4OX9B 1VQ7V 1GM8A 3ABUA 3CCJV 4DR2B 5JH7A 5IWAO 1Q8IA 5A9GA 5EK0A 1K9MW 4O2BA 1SQXH 4K35A 4DRXA 4FIPC 4DR7B 2F4VB 1GO3F 2CTRA 2Q7EA 4DV0O 2P4KA 2ZM6O 4U7OA 2QR4A 2Q67A 2A3QA 4NYKA 2XAHA 2HKOA 2QTSA 3K0GA 5TISZ 3T1HO 1XHZA 1M93A 4EB6B 1WB7A 3ASNB 3W7SA 4D7SA 1HNWB 3CD6V 2ZDIC 5EYPB 2XHBA 1Q90D 1YXBA 1PNMA 2D2CB 4X64B 2V7QG 2Q69A 2UXBB 4FVMA 4G27B 1JJ2U 4DV2B 1QQCA 1RPRA 3OD4A 1CP9A 1SESA 3ABLC 2Q4PA 2JVDA 1H8EG 3KZIZ 3SYAA 4ZIBA 2CH7B 3CCLV 3QG5A 3UM7A 4MVMA 5KA6A 2WLHA 2WLMA 2YSUB 4JI4B 5LGTA 2ZKOA 2ADQB 4X1YA 3KKYA 2JS5A 4MTFA 4YJ3B 2V4DA 1YJWV 4LF7O 4JZGA 4P9PA 1DGSA 3A2FA 3HKDB 4TV9B 3E35A 4ZI7A 2QWRB 3OEEG 2KQXA 2IM9A 3E2EA 4K8XA 4CS3A 3P32A 5JQGB 2CTPA 1FS0G 1UFIA 4GT1A 1R3JC 5CBFA 4B3RB 2H94A 4DR5B 5JCOA 4JZ2A 1DK1A 2JGUA 4MT8A 4CH6A 4DV7O 2LQTA 2QTOA 4PDVA 3ABKC 5B1AB 2N74A 4X1KA 2ZM6B 5KHHA 2Y4UA 2F4VO 2QM7A 3T2MA 4CH3A 4JI4O 1W2BU 2B1GA 3H1LH 2ZDIA 4PI2A 1I94B 1R3IC 1Y74A 3CEIA 2JRIA 4DR2O 4UCSA 1W0JG 1XL4A 4RUFA 4GZRB 3E8HA 2WLKA 4LNUA 3TK1A 1WN7A 1AR1B 1RM1C 4CS2A 3ZBHA 2P90A 3RT3C 1JFFA 1N8RW 5EYPA 1J5EO 3TXQA 2AZ0A 1O9HA 3AG7A 2A79B 3CX5F 4XBFA 3GB7C 2Q7HA 4FK5C 5JQGA 4X65O 2BTQA 2CE4A 4H37A 4HAMA 2G38A 2YXYA 3VQXA 2Y48A 1THZA 3K04A 1H38A 2UU9B 5H2FZ 4J9ZB 2ADPA 2R9RB 1I94O 4WFEA 1XMQO 1UJWB 5CB4B 3AK3A 3BHPA 4PA9A 1RM1B 1GAXA 4WFFA 3PN1A 1E1RG 1XNRB 1WP7A 4NKGB 5CA3A 4LNUB 4DYLA 2IH1C 1M9NA 3E22A 2GHYA 1WP8A 3H1JH 2EINC 4DR5O 4BW5A 3CC7V 5IJ9A 3QO8A 2XAQA 5LGUA 4DV4B 3TXSA 3ZN1A 3RYFA 4X65B 5L3FA 1VF5B 1IXBA 4MW8A 4O4LB 4BWAA 1H8HG 3OTFA 3FB5C 2ZE5A 2GTAA 4PDMA 5AG2A 3CP1A 1KMIZ 4ZHQB 3F7VC 4FM1A 4BAYA 2P06A 2F93B 2CGOA 2E5LO 4MW3A 3ZMVA 3JSNA 1I7FA 1SQBH 3QO5A 1TVKB 1V9PA 1OV9A 5IDJA 1PNKA 1NVPD 5IYCO 2CTWA 4MTOA 1I5YA 4IT5A 4DO2A 3D36A 4NB5A 4X62O 4GX5A 1ZAUA 1EZJA 4DV3B 3UCSC 2VS0A 4GKKB 3IAYA 1KC8W 2X6BA 4X20A 3ETDA 1DF4A 1HNXO 1Z2GA 3D3QA 3N2KB 5KUKA 3THOA 4PA6A 4LF4O 1JVMA 1OJHA 3Q4HA 4FLWA 5BMVA 2QJ1A 1KQSU 4I5SA 2EBOA 5ITZB 4W4KA 1QHTA 3K5LA 4DK1A 1F4NA 4LF6O 5DECA 1PL4A 3D3IA 3JASA 4DR7O 2P67A 4LF6B 3JATB 2GSMB 3G67A 2D3OW 1QLEB 1VQKV 4DUZB 1NBMG 1EZVH 1YHQV 4RWUA 2PTMA 5JVDA 3HPLC 3K06A 2Q9LA 3OTOB 3P3PA 2PGGA 1E1QG 2PY5A 2PZSA 1FD9A 1RSOB 4FZ0A 1AILA 4JAUA 3CC4V 4MVOA 4Z1VA 1NR7A 4H33A 2DE0X 1GTOA 4JYAB 3MDSA 4K3AA 2DWDC 4JI8O 3WB2A 1QLEC 4FLZA 4KXRA 2VWJA 1BCCH 1BE3H 5H6QA 4O4JA 3APOA 2DYRB 4FJCC 1F23A 1N33O 3TETA 2WSSG 4NXNO 1K97A 4I4TA 3T1HB 4LF9B 4BIZA 2HR3A 2YS8A 2Q8VA 3T1CA 5C93A 1FAFA 2N04A 4P2ZA 2HFEC 4B3MB 2LJ2A 2KKWA 3SJAC 3RYHA 5B3SB 1S0VA 3MHSC 4JI2O 1D2DA 5KHKA 5KAIZ 3AG1C 1WLEA 4F6EA 4IYIA 4B7KA 3OT7A 4PA7A 4QJFB 1CEZA 2ZE7A 2IJKA 5EZYB 3QTCA 3CRMA 3X2QC 4MTXA 1K7DA 1RSOA 5IT9N 2YI8A 4ZOLB 3CMAV 4JI8B 1AVMA 2RQ6A 3CCMV 4JYAO 4H44B 2EIKC 2A0LA 5J2TB 4DR6O 5EC1C 3UQ8A 2KG7A 3LUTB 5B5EZ 5IY5C 4F6RB 3ML0A 3CRCA 4JTAB 1AP6A 2A9HA 3ASOB 3HKEA 1XDCA 4X1IA 2P6JA 2YICA 4I55B 3WFVA 4YIPA 4DUZO 2FB5A 4X1IB 2E5LB 4DV2O 1VARA 2EIJB 1BSMA 2CAZC 3VQYA 3OEHG 4TV8B 3QF7A 4J7JA 4EEQA 2P22C 2P7TC 3T4DA 3JD1A 4NVPA 5DM6V 1MOFA 4JI6O 1BS3A 1NQTA 3DXRA 1G4YB 1AJPA 3FX7A 4LFBO 3F5TA 1SZXA 2DN9A 2AXTZ 1NKDA 3SPGA 3LDEA 3AG2C 1KBHA 3JALB 3H9VA 4GKKO 1H2LA 1IDSA 1HDJA 5LHIA 3HKCB 3UO2A 3ABMC 4NR1A 5CMUA 3ZS8C 5GTIZ 1QBZA 1D5AA 1XNRO 1ZLZA 3N27A 1OCZB 5IWAB 3GWOA 2WLLA 5FLXN 4E4EA 4DV7B 2RMKB 3JSLA 3ZHQA 1K4CC 4EKWA 1NTZH 2F66C 3A0BZ 1PKXA 3JARB 4DW0A 4JI5B 2CDYA 1BZKA 3ZCCA 1AJNA 3ABMB 5JWPA 1N4CA 2X0LA 4QGPA 4O4HB 1PD3A 1WJZA 2CTQA 1MZFA 2VWKA 2VQEO 3ZHSA 3CMEV 1NH2D 2OCCB 1FXKC 4JYBA 4BIOA 2ZT9B 1ENVA 3ZHUA 4FLVA 4L8JA 1W0KG 2JEXA 3FKSG 5BZBA 4X89A 1M56B 2OIGA 3JASB 5JJEB 2BTOA 3JAWB 2OT5A 4J9YB 1BQ0A 4JGSA 3TCUA 5C8YA 5GONB 1KD1W 4LFAB 3RYHB 3JARA 3KCXA 3FYIB 5IJ9B 1IBKB 2ZIOA 1I08A 5LHHA 4LF4B 4I9QA 2F95B 5JCOC 3IGAC 2CH7A 1IXMA 2B9ZA 3E86A 1IBKO 3ZJZA 2XT9A 3ZX6A 3VBBA 5J2TA 1XBLA 4R7CA 3RWRD 5CA0A 2BSKA 3RGBA 4JYYA 1SC5B 2JJ2G 3M8AA 4DW1A 3M7MX 1K92A 2DOSA 3JD0A 4GYCB 1NZ6A 1S5LZ 5KMGB 5J9PC 2RNBA 3B2EE 4UV8A 4LFCB 3H01A 2ZE8A 2EX3A 1TGOA 3UT5B 3BRCA 3N2GA 4UCOA 5F2VO 1UPGA 2P4VA 4DR1B 3D8CA 1PL0A 1SA0A 2YXHA 3I5DA 4JI0O 3ABLB 3JCZA 1SQFA 2QA4V 2IU3A 2N05A 4BR6A 4JPRA 3G6BA 3G6EV 3ASOC 5CBGA 4PDLA 3P3NA 1IURA 2JJ1G 2KB1A 3ZRVA 2DMXA 1COWG 4LFAO 4LF7B 1ZL8A 3AG3C 2UUCB 3E8BA 1WNSA 3UT5A 4B3MO 1S77D 1BHAA 2EZPA 1LUVA 3ZN0A 2NN4A 2GV9A 3KCYA 4PDRA 4YHHO 2X6CA 1KYOF 5E79Z 4CH5A 2Q0AA 1XHXA 2WWWA 1S3JA 2ZINA 3E8GA 2FTKA 3T1YO 2Q6AA 4R8CA 3UO3A 2MW2B 2WA3A 2JIZG 1N32O 1H2GA 3AG3B 1M5IA 4FLYA 1L1FA 4FLUA 2B5UA 1G6UA 2WLIB 5FNVB 3GWKC 4IIJB 1K33A 1ROPA 1XEQA 4DR4O 1HP8A 1FJGB 4UV9A 3ZMZA 5L3GA 3OGCC 3RVZA 2YEVB 1KKDA 1JQ0A 1QR9A 1DTOA 3A0RA 4KUMA 5LYJA 1AI5A 4WFAV 3CS5A 2RN9A 3CE2A 1BT8A 2UXNA 1I0HA 4W4LA 3BCCH 2QE7G 1X59A 2WLNA 4R6ZA 4DV0B 2LFSA 2Q5ZA 5GTHZ 3SR2C 4LF5B 2A7WA 4H0LB 4FFBB 5FNVA 1FXKA 1Y76B 4WBNB 4X66B 3CYOA 2AHYA 4UCTA 4I0XB 1FFTB 2RJZA 3AG4B 4YY3O 4EB6A 4IGGA 2ILMA 3LNMB 5CN0A 2Z5UA 1CXZB 3JD2A 1DF5A 4JI6B 2YIBA 4JAVA 4DV3O 2QSAA 3OW2U 1VQLV 2ZXWB 5LL6Y 4AILC 2IJHA 2NR5A 5ITZA 1BQZA 1F51A 4CBCA 4CC5A 2OCHA 4JYCA 4R50A 3BA9A 3JCUZ 4LR3A 3CRAA 4KFMA 5L3CA 1IBLO 1Q5OA 3FAVA 1EM1A 1ZX3A 3TJTA 1N33B 4PHZA 4B3SB 1JMKC 1VQ4V 3K5MA 4RO2A 4B3TB 3U11A 1D5NA 1NR1A 1J5EB 3L74H 1MMMA 1PM9A 3A0HZ 2FYUH 5JJNB 1XNQO 2PI4A 4XDLA 4QPJA 1SQGA 4PA3A 1RPOA 1IBMB 1SA0B 1XMOB 4GLXA 3K57A 4FFBA 4U3FH 4KHPB 1YDXA 2YIBD 1R1BA 4N23A 3OMNB 5LA6B 3CXHF 4YXWG 1AI7A 1QVGU 4JI1B 1E79G 3K5OA 4JI2B 3ABTA 3ZHTA 4WFBV 1F7YA 3C3TA 2Y0IA 2F1MA 1N34B 4TSFG 2LGWA 1SS3A 1XMQB 4LC1A 2L35A 4X1YB 1P84F 4I7ZB 3UKMA 1NH2B 4YJ3A 2Y69C 4JAAA 4O2AB 1B6QA 3DSQA 1W59A 1EFRG 5B1BC 2EILC 3C90A 3QNEA 4J10A 5IJ0B 1YF2A 3FFQA 1LNQA 5B1AC 3NR7A 3MD0A 4CC6A 5B1OA 1SERA 1ZSPA 4I50B 2RDCA 3SDLA 4NTWA 1GK9A 1GRJA 2FL4A 1R6NA 1Z5VA 4IHJB 2ZXWC 1WAZA 2LP7A 4P30A 5IYBO 1JA8A 3EXAA 4C7UA 2GBOA 3AK2A 5EZYA 1AROP 2OTLV 5GW7A 1Q86W 1WPBA 3EHBB 3O9OA 1PPJH 5HFLA 5LHGA 3H1HH 1U96A 4U3JA 4QE9A 4JI3O 1VQ6V 1XNQB 4JTCB 3IC9A 4Q6GA 1Q6IA 1B06A 4J11A 4X20B 3RYFB 3HKEB 1G1XB 3ZMUA 2HEPA 4Z1MG 4RQFA 2LFRA 3ABKB 5A2QN 3FB8C 1JOYA 3RYIB 3J7AU 5BR8O 3MAQA 2Q73A 3SJBC 1GN6A 4MSWC 1FKAO 3JAKB 3R65A 4O2AA 1KU9A 3HKCA 5L3BA 4IHJA 2UXCO 4YJ2A 1MA1A 1GM7A 2HVJC 4UUJC 4EFBA 4FLXA 1XOUA 1R3KC 4FPPA 3ICXA 2UXBO 1VF6C 4QE7A 3CSXA 1Y66A 2XASA 4PJ0Z 3ZEDA 2JDIG 4JV5O 2QWOB 2HP8A 4IL6Z 3N2KA 3JD3A 4DV4O 1S5JA 1NTKH 5D5PA 2UXDO 3ETGA 4X8AA 4AQYB 5L3DA 3ZIAG 2ETNA 3E22B 5LBQA 2ZE6A 4ABMA 4UCUA 2VQFB 2K1EA 4HNAA 5KHIA 2QWPB 2F23A 1IX9A 4O4IB 3KG2A 2Z3YA 2HHHB 4J80A 3DC6A 3ASNC 5LOVA 1T5EA 3IC7A 1EN4A 5KLVH 2OTJV 5DN6G 2QKSA 4OX9O 3U0ZA 2PYJA 2DW4A 4LFBB 4DV5O 4O4LA 2PYLA 1P49A 1TVKA 5B1NA 5LMNB 2QKAA 3IFXA 2QM4A 3OE7G 4UCVA 1VQPV 4D6TH 1G8MA 3VOUA 4DR3O 5JH7B 2YI9A 2DYSB 1EBOA 4O4JB 3SJQC 5LXTB 1KP3A 3CWBH 2ODMA 1N0JA 3R66A 1VEWA 1FFXB 4I4TB 2WLLB 3SPCA 3FB6C 1MG1A 1OCCC 1P7BA 3D36C 4AQYO 1VF7A 1XQ8A 5IY5B 1QCEA 4WCEV 1NT2B 3RFRA 1N0NA 2Y4TA 1ORQC 3OUFA 3JALA 5CA1B 2XNDG 5EBMC 4Z2WA 3CJHA 1FXHA 2XOKG 1DLBA 2EINB 2EJRA 3K08A 4G28B 4MS2A 2DYSC 2XAJA 3L71H 1NTMH 1HNWO 1AR4A 2X7RB 1HW7A 3CJHB 1V55C 3B09A 1Q7YW 4JI7B 4LFCO 4DV6B 2Z0AA 3FB7C 3RYCA 3OUSA 2B1IA 4WF9V 2EJ7A 4MVQA 1NVPB 2CK3G 2W0XA 2X6AA 3OFNG 4LCUC 3C3SA 5D5QA 1L0LH 2LGQA 4PELA 1K3EA 4DR3B 2O57A 4NXNB 2W6IG 3FAVB 3RN4A 3CCEV 1VQNV 1OHHG 4DV6O 4A5UB 1JR9A 5LMUO 1HNZB 3OAAG 1IVSA 4TOIA 1GKFA 2YEVA 3LDCA 1YEWA 4DV1B 3LNNA 3LSSA 3WU2Z 2OWOA 2WLIA 4ZBMA 3L72H 1R6TA 4IIJA 1N36O 1VIBA 2EIJC 2QWNB 4XDKA 1GN3A 4KHPO 1Q3EA 1WA8A 2ZNJA 2ZNIA 3JAKA 5IYZA 4UB8Z 4PV1B 2NLJC 2EZOA 5J2UB 2CUGA 2VQEB 4O4IA 4I0XA 4LWSB 3BPZA 1YZBA 2XAGA 2YIDA 4JV5B 3HKBB 4J7KA 4GX0A 3B8NA 2GTSA 3BFRA 1L0NH 1VQMV 1S72V 5B66Z 2BSKB 3K58A 5EC2C 3QO7A 3K79A 3OMAB 1MSWD 1OCOB 2Q7GA 5B3SC 4UVCA 2XUMA 4I9WA 1FYJA 1MABG 4MVSA 2XTAA 2PUSA 2YC0A 4FMTA 4X1KB 4UCRA 4OXSA 1HR0B 1K8AW 3VQWA 1HR0O 4JI1O 3WB1A 1YI2V 2DYRC 2QM8A 4LF8O 4UXNA 1NJIW 1QU7A 2OCCC 3ZRWB 1JX9A 3IJ4A 3TGUH 5LP6B 3GVMA 2FKXA 2LW7A 4FFKA 4TV8A 1KECA 1M1KW 4GKJO 5KMGA 3K3WA 4PA4A 1SQQH 3OMIB 3VQVA 1YITV 2UUAB 1OCRB 3NXSA 4FM0A 2IBZH 3CHXA 2WPDG 3T4ZA 1J95A 3F7YC 5CA1A 1NS1A 1SKVA 4BIUA 2UUAO 3CCSV 4PD4F 4UVBA 2ZR3A 5KX5B 2IJIA 3E83A 4QNHB 1Q43A 1ZL8B 1IBLB 2NNUA 2RCVA 2DQ3A 1P7GA 4U7NA 4AHCA 5EIBD 1JJOA 4DXWA 5KX5A 4NTXA 3S3WA 4UB6Z 4J41A 1KP2A 1LR1A 1GN4A 4OPAA 1KB9F 2BCCH 5JJJB 5LMNO 4BW9A 2UUBO 3CCQV 2CGNA 3L75H 3WG7C 4F4LA 4DR6B 3U10A 4DV5B 5EBLC 4ZOLA 2R9AA 1K34A 1GM9A 3OR7C 1H2SB 1SETA 3N2GB 3CCVV 1JCHA 2M6YA 4QIWF 3T1YB 2YIAA 2OYQA 3RW0A 3SYOA 1GN2A 1PNLA 3I55V 4P9OA 4LF5O 5LGNA 1ZTEA 5KUMA 5IJ0A 1FXKB 1Y76A 4H13B 3LSQA 4JI3B 3BVOA 3CRQA 1VQ9V 2VQFO 3O65A 2XAFA 2R70A 1OZ0A 3HB3B 1IZ3A 4JI7O 5KHJA 4FZ1A 1Q82W 4MVUA 1BGYH 3PJSK 4LH7A 3ZHRA 1H2MA 3K9SA 4X88A 3Q4HB 2BOCC 1Z5WA 2EIKB 1BMFG 1U97A 2ZQMA 4RUEA 4JI0B 3FYEB 4DUYB 1JPXA 1Y74B 2ITCC 1YJNV 4B3RO 1Y6XA 1YTFB 3ETQA 1RP3B 3S3XA 5LMUB 1B04A 2YXLA 2W6JG 4MVZA 3OTOO 3JAMN 1SQVH 2PF4E 3H1IH 4DRXB 4WFHA 2ZR2A 2AW9A 4YHHB 4I50A 2Y0PA 3EVKA 2MK3A 3APQA 4RAIA 3X2QB 4X9QA 5H5NA 1AI6A 4MTGA 1YVWA 1VP7A 1FFXA 1N34O 2E3CA 1MZEA 2H8PC 1M57B 3ETEA 3AG1B 1N36B 3LDDA 2JS3A 2EIMB 4UFZA 3I56V 1BHBA 3BEHA 3CRRA 4D7TA 5IYDO 4X66O 1AB3A 5K1PA 4FLTA 5FL7G 3SGIA 1R3LC 1BL8A 3EFFK 1QNMA 1XUQA 3STZC 3SPJA 3G4SV 4B7EA 3ZRWA 4K0KO 3CPWU 2BOBC 3W7UA 4TUYA 1PV0A 5K1XA 2UXXA 3K5NA 3SPIA 3QVNA 2IH3C 1HWYA 2EILB 3AG2B 4OPHA 5EBWC 4TQFA 4YJ2B 4JTDB 3WG7B 1YSCA 2QWQB 2WA4A 1MSDA 2ITDC 4XDJA 4J42A 1NI8A 3AEIA 3JD4A 2WAMA 2UUBB 4DUYO 4YY3B 2DJVA 1Y4MA 1O9GA 2M7WA 3B40A 2UXCB 2E74B 3J81N 3ZHVA 1Y67A 4KP4A 2OIEA 2UUCO 3SJCC 2IJJA 2GUZA 3BABA 2FMLA 4RQEA 3DXRB 4QPKA 4YIOA 5KA5A 4TUYB 5BXZA 4IYHA 3K0DA 4AI8A 1IBMO 1SRYA 2HJDA 3AK1A 1H2KA 2R72A 2YDEA 3G71V 4K8ZA 4FM2A 1VF6A 2EIMC 1L8DA 4B3SO 1YIJV 4O4HA 1VQOV 5H6RA 4UVAA 5BMVB 4G2KA 4ZHQA 3JYCA
chains in the Genus database with same CATH topology
4LF6O 4K0KO 5LL6Y 3SDLA 2VQFO 4LFAO 3O65A 1I94O 1XMQO 4DR7O 1HR0O 2UU9O 4JI1O 4B3MO 4DUZO 4LF9O 4LF8O 1A32A 2ZKOA 4JI7O 2HHHO 4YHHO 1IBLO 4DV2O 2FKXA 4OPHA 2LW7A 4LF7O 1KUQA 4GKJO 4DR5O 4OX9O 4DV6O 3T1YO 4JI3O 4A5UB 5LMUO 1XMOO 1AILA 4JI6O 1N32O 4JI5O 4B3RO 4DV5O 1XNQO 4DR1O 4LFBO 4B3TO 3F5TA 1NS1A 1HNZO 1IBKO 1XEQA 2UUAO 4JI8O 3OTOO 4DR4O 4DUYO 1DK1A 1G1XB 2DJVA 3JAMN 4DV7O 5A2QN 4GKKO 2E5LO 4DR3O 2N74A 1R1BA 1N33O 1R6TA 5IWAO 3J81N 2F4VO 3J7AU 5BR8O 4NXNO 4JI4O 1N36O 1XNRO 1FKAO 3M8AA 3R66A 5H5NA 1F7YA 2UUCO 4DV0O 2JRIA 5FLXN 2ZM6O 4DR2O 2DOSA 4KHPO 4OPAA 1N34O 2UXCO 4AQYO 1X59A 1FJGO 5BXZA 4X62O 4JI2O 4DV1O 1D2DA 5LMNO 2UUBO 1IBMO 3RT3C 3T1HO 1YZBA 4NXMO 4X64O 1J5EO 2UXBO 2Z0AA 5IT9N 4YY3O 4JI0O 1HNXO 4JYAO 4X66O 1AB3A 4B3SO 4JV5O 4DR6O 4LF4O 4X65O 4LF5O 1HNWO 2AGAA 1FYJA 2VQEO 4DV4O 3J80N 2UXDO 4LFCO 5BY1A 4DV3O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 O;  4K0K O;  5LL6 Y;  3SDL A;  2VQF O;  4LFA O;  3O65 A;  1I94 O;  1XMQ O;  4DR7 O;  1HR0 O;  2UU9 O;  4JI1 O;  4B3M O;  4DUZ O;  4LF9 O;  4LF8 O;  1A32 A;  2ZKO A;  4JI7 O;  2HHH O;  4YHH O;  1IBL O;  4DV2 O;  2FKX A;  4OPH A;  2LW7 A;  4LF7 O;  1KUQ A;  4GKJ O;  4DR5 O;  4OX9 O;  4DV6 O;  3T1Y O;  4JI3 O;  4A5U B;  5LMU O;  1XMO O;  1AIL A;  4JI6 O;  1N32 O;  4JI5 O;  4B3R O;  4DV5 O;  1XNQ O;  4DR1 O;  4LFB O;  4B3T O;  3F5T A;  1NS1 A;  1HNZ O;  1IBK O;  1XEQ A;  2UUA O;  4JI8 O;  3OTO O;  4DR4 O;  4DUY O;  1DK1 A;  1G1X B;  2DJV A;  3JAM N;  4DV7 O;  5A2Q N;  4GKK O;  2E5L O;  4DR3 O;  2N74 A;  1R1B A;  1N33 O;  1R6T A;  5IWA O;  3J81 N;  2F4V O;  3J7A U;  5BR8 O;  4NXN O;  4JI4 O;  1N36 O;  1XNR O;  1FKA O;  3M8A A;  3R66 A;  5H5N A;  1F7Y A;  2UUC O;  4DV0 O;  2JRI A;  5FLX N;  2ZM6 O;  4DR2 O;  2DOS A;  4KHP O;  4OPA A;  1N34 O;  2UXC O;  4AQY O;  1X59 A;  1FJG O;  5BXZ A;  4X62 O;  4JI2 O;  4DV1 O;  1D2D A;  5LMN O;  2UUB O;  1IBM O;  3RT3 C;  3T1H O;  1YZB A;  4NXM O;  4X64 O;  1J5E O;  2UXB O;  2Z0A A;  5IT9 N;  4YY3 O;  4JI0 O;  1HNX O;  4JYA O;  4X66 O;  1AB3 A;  4B3S O;  4JV5 O;  4DR6 O;  4LF4 O;  4X65 O;  4LF5 O;  1HNW O;  2AGA A;  1FYJ A;  2VQE O;  4DV4 O;  3J80 N;  2UXD O;  4LFC O;  5BY1 A;  4DV3 O; 
#chains in the Genus database with same CATH topology
 4LP8 A;  1YCI A;  1OCR C;  1SZT A;  4LWS A;  4JAS A;  4CH4 A;  3P30 A;  5LXT A;  1F4M A;  2QKC A;  1B3Q A;  1Q6U A;  5FPO A;  1R73 A;  3M99 B;  5CBH A;  3DC5 A;  2P5O A;  1A32 A;  2ARH A;  2C2A A;  5BR8 B;  4J7Z A;  1WB8 A;  3B77 A;  3K9A A;  2HHH O;  2JGD B;  1OCC B;  1V55 B;  3JAW A;  4LH6 A;  1M90 W;  2GUZ B;  1VQ8 V;  3B4S A;  3HKD A;  4TV9 A;  4ZI7 B;  1URF A;  4K0K B;  1XRE A;  3JAT A;  2UXD B;  3BY6 A;  1YTF D;  3SPH A;  3K59 A;  3SYP A;  3W7W A;  5LA6 A;  5L3E A;  1K5Q A;  2HG5 C;  1R6K A;  5IE9 A;  5KHG A;  3FD9 A;  4ZKI A;  1JFF B;  4ICG A;  2AHZ A;  4O2B B;  2ZCE A;  1YJ9 V;  4MVR A;  4GUN A;  1EN5 A;  1K4D C;  4B08 A;  3DTU B;  3RYI A;  5LYJ B;  3A8T A;  5C8Y B;  3SYQ A;  4F6R A;  4I55 A;  3DGE A;  4DV1 O;  1CPY A;  1XL6 A;  4KL1 A;  3ZMT A;  4HBN A;  4NTY A;  1EN6 A;  2R9I A;  3CXC U;  5CB4 A;  4X64 O;  1AJQ A;  5B1B B;  1N32 B;  5DED A;  5FPR A;  1SF9 A;  5JVD B;  1AI4 A;  3STL C;  1LUW A;  5J2U A;  3CCU V;  2JEU A;  1QVF U;  2EUL A;  2A06 H;  4U3J B;  3W7X A;  4HZ3 A;  4TQD A;  3OGI B;  1I5X A;  2BTQ B;  2HLD G;  3B8M A;  4CZZ A;  2DQ0 A;  4L87 A;  3J80 N;  1AP5 A;  1US6 A;  5BY1 A;  1M56 C;  5CA0 B;  1XI1 A;  1M4U A;  3K03 A;  3G80 A;  5LOV B;  4Q20 A;  2L6L A;  3L70 H;  2E75 B;  4LF9 O;  3RBZ A;  2PI5 A;  4ASU G;  2BE3 A;  2V1D A;  3CC2 V;  1TUE B;  2IW5 A;  1QLN A;  1TA8 A;  3ZMS A;  4HYO A;  2HJF C;  2LW1 A;  1GH6 A;  3SYC A;  1RFY A;  1OCZ C;  1KUQ A;  3CCR V;  5H9C A;  1XMO O;  1X4T A;  1S76 D;  2GDS A;  4PI0 A;  1WPX A;  2Q0O C;  3HKB A;  3BAA A;  4B3T O;  4WFG A;  5LP6 C;  2KG7 B;  1M57 C;  4X62 B;  3E89 A;  4CS4 A;  4GCZ A;  4GKJ B;  2HVK C;  5E1A C;  1Q6H A;  2ZD9 A;  1V54 B;  4JF3 A;  2WLJ A;  3CB2 A;  1QR8 A;  4N21 A;  3LSU A;  4EFE A;  3RYC B;  4LF8 B;  3ZRX A;  1KKC A;  4TT3 G;  3OR6 C;  1FJG O;  3F5W C;  3W7T A;  3L9D A;  2W0F C;  1VMG A;  4HNA B;  4NXM O;  1AR5 A;  3OM3 B;  1XIL A;  5GON A;  1HNX B;  4GX2 A;  4E2L A;  1VQ5 V;  5KAF Z;  4TWK A;  3L73 H;  1TAE A;  1ZWI C;  4NXM B;  2H3O A;  4GX1 A;  1V54 C;  1TUB A;  2AGA A;  3WB0 A;  4OGQ B;  1K73 W;  2AZ2 A;  1P4R A;  3AG4 C;  4DK0 A;  1K5S A;  2ZIM A;  3H1K H;  3HR0 A;  2Q68 A;  1H2N A;  1ZUQ A;  2UU9 O;  5IYZ B;  1SQP H;  2LO1 A;  1NU1 H;  1WA8 B;  1PP9 H;  3RVY A;  2IU0 A;  1S5H C;  2E76 B;  3E8F A;  5LP6 A;  4WBN A;  2ATK C;  2JK5 C;  3ZRS A;  2JGD A;  1Q81 W;  1FPO A;  2Y69 B;  2K9P A;  1OCO C;  5HFM A;  4LBE C;  5EIB C;  4DR4 B;  2QDO A;  2F43 G;  2QGN A;  2DWE C;  3BA8 A;  3MHH C;  4JI5 O;  2VRZ A;  1GMG A;  4DR1 O;  1FXV A;  1HNZ O;  2QEX V;  2YUA A;  1MNG A;  1TUB B;  2KSD A;  4OX9 B;  1VQ7 V;  1GM8 A;  3ABU A;  3CCJ V;  4DR2 B;  5JH7 A;  5IWA O;  1Q8I A;  5A9G A;  5EK0 A;  1K9M W;  4O2B A;  1SQX H;  4K35 A;  4DRX A;  4FIP C;  4DR7 B;  2F4V B;  1GO3 F;  2CTR A;  2Q7E A;  4DV0 O;  2P4K A;  2ZM6 O;  4U7O A;  2QR4 A;  2Q67 A;  2A3Q A;  4NYK A;  2XAH A;  2HKO A;  2QTS A;  3K0G A;  5TIS Z;  3T1H O;  1XHZ A;  1M93 A;  4EB6 B;  1WB7 A;  3ASN B;  3W7S A;  4D7S A;  1HNW B;  3CD6 V;  2ZDI C;  5EYP B;  2XHB A;  1Q90 D;  1YXB A;  1PNM A;  2D2C B;  4X64 B;  2V7Q G;  2Q69 A;  2UXB B;  4FVM A;  4G27 B;  1JJ2 U;  4DV2 B;  1QQC A;  1RPR A;  3OD4 A;  1CP9 A;  1SES A;  3ABL C;  2Q4P A;  2JVD A;  1H8E G;  3KZI Z;  3SYA A;  4ZIB A;  2CH7 B;  3CCL V;  3QG5 A;  3UM7 A;  4MVM A;  5KA6 A;  2WLH A;  2WLM A;  2YSU B;  4JI4 B;  5LGT A;  2ZKO A;  2ADQ B;  4X1Y A;  3KKY A;  2JS5 A;  4MTF A;  4YJ3 B;  2V4D A;  1YJW V;  4LF7 O;  4JZG A;  4P9P A;  1DGS A;  3A2F A;  3HKD B;  4TV9 B;  3E35 A;  4ZI7 A;  2QWR B;  3OEE G;  2KQX A;  2IM9 A;  3E2E A;  4K8X A;  4CS3 A;  3P32 A;  5JQG B;  2CTP A;  1FS0 G;  1UFI A;  4GT1 A;  1R3J C;  5CBF A;  4B3R B;  2H94 A;  4DR5 B;  5JCO A;  4JZ2 A;  1DK1 A;  2JGU A;  4MT8 A;  4CH6 A;  4DV7 O;  2LQT A;  2QTO A;  4PDV A;  3ABK C;  5B1A B;  2N74 A;  4X1K A;  2ZM6 B;  5KHH A;  2Y4U A;  2F4V O;  2QM7 A;  3T2M A;  4CH3 A;  4JI4 O;  1W2B U;  2B1G A;  3H1L H;  2ZDI A;  4PI2 A;  1I94 B;  1R3I C;  1Y74 A;  3CEI A;  2JRI A;  4DR2 O;  4UCS A;  1W0J G;  1XL4 A;  4RUF A;  4GZR B;  3E8H A;  2WLK A;  4LNU A;  3TK1 A;  1WN7 A;  1AR1 B;  1RM1 C;  4CS2 A;  3ZBH A;  2P90 A;  3RT3 C;  1JFF A;  1N8R W;  5EYP A;  1J5E O;  3TXQ A;  2AZ0 A;  1O9H A;  3AG7 A;  2A79 B;  3CX5 F;  4XBF A;  3GB7 C;  2Q7H A;  4FK5 C;  5JQG A;  4X65 O;  2BTQ A;  2CE4 A;  4H37 A;  4HAM A;  2G38 A;  2YXY A;  3VQX A;  2Y48 A;  1THZ A;  3K04 A;  1H38 A;  2UU9 B;  5H2F Z;  4J9Z B;  2ADP A;  2R9R B;  1I94 O;  4WFE A;  1XMQ O;  1UJW B;  5CB4 B;  3AK3 A;  3BHP A;  4PA9 A;  1RM1 B;  1GAX A;  4WFF A;  3PN1 A;  1E1R G;  1XNR B;  1WP7 A;  4NKG B;  5CA3 A;  4LNU B;  4DYL A;  2IH1 C;  1M9N A;  3E22 A;  2GHY A;  1WP8 A;  3H1J H;  2EIN C;  4DR5 O;  4BW5 A;  3CC7 V;  5IJ9 A;  3QO8 A;  2XAQ A;  5LGU A;  4DV4 B;  3TXS A;  3ZN1 A;  3RYF A;  4X65 B;  5L3F A;  1VF5 B;  1IXB A;  4MW8 A;  4O4L B;  4BWA A;  1H8H G;  3OTF A;  3FB5 C;  2ZE5 A;  2GTA A;  4PDM A;  5AG2 A;  3CP1 A;  1KMI Z;  4ZHQ B;  3F7V C;  4FM1 A;  4BAY A;  2P06 A;  2F93 B;  2CGO A;  2E5L O;  4MW3 A;  3ZMV A;  3JSN A;  1I7F A;  1SQB H;  3QO5 A;  1TVK B;  1V9P A;  1OV9 A;  5IDJ A;  1PNK A;  1NVP D;  5IYC O;  2CTW A;  4MTO A;  1I5Y A;  4IT5 A;  4DO2 A;  3D36 A;  4NB5 A;  4X62 O;  4GX5 A;  1ZAU A;  1EZJ A;  4DV3 B;  3UCS C;  2VS0 A;  4GKK B;  3IAY A;  1KC8 W;  2X6B A;  4X20 A;  3ETD A;  1DF4 A;  1HNX O;  1Z2G A;  3D3Q A;  3N2K B;  5KUK A;  3THO A;  4PA6 A;  4LF4 O;  1JVM A;  1OJH A;  3Q4H A;  4FLW A;  5BMV A;  2QJ1 A;  1KQS U;  4I5S A;  2EBO A;  5ITZ B;  4W4K A;  1QHT A;  3K5L A;  4DK1 A;  1F4N A;  4LF6 O;  5DEC A;  1PL4 A;  3D3I A;  3JAS A;  4DR7 O;  2P67 A;  4LF6 B;  3JAT B;  2GSM B;  3G67 A;  2D3O W;  1QLE B;  1VQK V;  4DUZ B;  1NBM G;  1EZV H;  1YHQ V;  4RWU A;  2PTM A;  5JVD A;  3HPL C;  3K06 A;  2Q9L A;  3OTO B;  3P3P A;  2PGG A;  1E1Q G;  2PY5 A;  2PZS A;  1FD9 A;  1RSO B;  4FZ0 A;  1AIL A;  4JAU A;  3CC4 V;  4MVO A;  4Z1V A;  1NR7 A;  4H33 A;  2DE0 X;  1GTO A;  4JYA B;  3MDS A;  4K3A A;  2DWD C;  4JI8 O;  3WB2 A;  1QLE C;  4FLZ A;  4KXR A;  2VWJ A;  1BCC H;  1BE3 H;  5H6Q A;  4O4J A;  3APO A;  2DYR B;  4FJC C;  1F23 A;  1N33 O;  3TET A;  2WSS G;  4NXN O;  1K97 A;  4I4T A;  3T1H B;  4LF9 B;  4BIZ A;  2HR3 A;  2YS8 A;  2Q8V A;  3T1C A;  5C93 A;  1FAF A;  2N04 A;  4P2Z A;  2HFE C;  4B3M B;  2LJ2 A;  2KKW A;  3SJA C;  3RYH A;  5B3S B;  1S0V A;  3MHS C;  4JI2 O;  1D2D A;  5KHK A;  5KAI Z;  3AG1 C;  1WLE A;  4F6E A;  4IYI A;  4B7K A;  3OT7 A;  4PA7 A;  4QJF B;  1CEZ A;  2ZE7 A;  2IJK A;  5EZY B;  3QTC A;  3CRM A;  3X2Q C;  4MTX A;  1K7D A;  1RSO A;  5IT9 N;  2YI8 A;  4ZOL B;  3CMA V;  4JI8 B;  1AVM A;  2RQ6 A;  3CCM V;  4JYA O;  4H44 B;  2EIK C;  2A0L A;  5J2T B;  4DR6 O;  5EC1 C;  3UQ8 A;  2KG7 A;  3LUT B;  5B5E Z;  5IY5 C;  4F6R B;  3ML0 A;  3CRC A;  4JTA B;  1AP6 A;  2A9H A;  3ASO B;  3HKE A;  1XDC A;  4X1I A;  2P6J A;  2YIC A;  4I55 B;  3WFV A;  4YIP A;  4DUZ O;  2FB5 A;  4X1I B;  2E5L B;  4DV2 O;  1VAR A;  2EIJ B;  1BSM A;  2CAZ C;  3VQY A;  3OEH G;  4TV8 B;  3QF7 A;  4J7J A;  4EEQ A;  2P22 C;  2P7T C;  3T4D A;  3JD1 A;  4NVP A;  5DM6 V;  1MOF A;  4JI6 O;  1BS3 A;  1NQT A;  3DXR A;  1G4Y B;  1AJP A;  3FX7 A;  4LFB O;  3F5T A;  1SZX A;  2DN9 A;  2AXT Z;  1NKD A;  3SPG A;  3LDE A;  3AG2 C;  1KBH A;  3JAL B;  3H9V A;  4GKK O;  1H2L A;  1IDS A;  1HDJ A;  5LHI A;  3HKC B;  3UO2 A;  3ABM C;  4NR1 A;  5CMU A;  3ZS8 C;  5GTI Z;  1QBZ A;  1D5A A;  1XNR O;  1ZLZ A;  3N27 A;  1OCZ B;  5IWA B;  3GWO A;  2WLL A;  5FLX N;  4E4E A;  4DV7 B;  2RMK B;  3JSL A;  3ZHQ A;  1K4C C;  4EKW A;  1NTZ H;  2F66 C;  3A0B Z;  1PKX A;  3JAR B;  4DW0 A;  4JI5 B;  2CDY A;  1BZK A;  3ZCC A;  1AJN A;  3ABM B;  5JWP A;  1N4C A;  2X0L A;  4QGP A;  4O4H B;  1PD3 A;  1WJZ A;  2CTQ A;  1MZF A;  2VWK A;  2VQE O;  3ZHS A;  3CME V;  1NH2 D;  2OCC B;  1FXK C;  4JYB A;  4BIO A;  2ZT9 B;  1ENV A;  3ZHU A;  4FLV A;  4L8J A;  1W0K G;  2JEX A;  3FKS G;  5BZB A;  4X89 A;  1M56 B;  2OIG A;  3JAS B;  5JJE B;  2BTO A;  3JAW B;  2OT5 A;  4J9Y B;  1BQ0 A;  4JGS A;  3TCU A;  5C8Y A;  5GON B;  1KD1 W;  4LFA B;  3RYH B;  3JAR A;  3KCX A;  3FYI B;  5IJ9 B;  1IBK B;  2ZIO A;  1I08 A;  5LHH A;  4LF4 B;  4I9Q A;  2F95 B;  5JCO C;  3IGA C;  2CH7 A;  1IXM A;  2B9Z A;  3E86 A;  1IBK O;  3ZJZ A;  2XT9 A;  3ZX6 A;  3VBB A;  5J2T A;  1XBL A;  4R7C A;  3RWR D;  5CA0 A;  2BSK A;  3RGB A;  4JYY A;  1SC5 B;  2JJ2 G;  3M8A A;  4DW1 A;  3M7M X;  1K92 A;  2DOS A;  3JD0 A;  4GYC B;  1NZ6 A;  1S5L Z;  5KMG B;  5J9P C;  2RNB A;  3B2E E;  4UV8 A;  4LFC B;  3H01 A;  2ZE8 A;  2EX3 A;  1TGO A;  3UT5 B;  3BRC A;  3N2G A;  4UCO A;  5F2V O;  1UPG A;  2P4V A;  4DR1 B;  3D8C A;  1PL0 A;  1SA0 A;  2YXH A;  3I5D A;  4JI0 O;  3ABL B;  3JCZ A;  1SQF A;  2QA4 V;  2IU3 A;  2N05 A;  4BR6 A;  4JPR A;  3G6B A;  3G6E V;  3ASO C;  5CBG A;  4PDL A;  3P3N A;  1IUR A;  2JJ1 G;  2KB1 A;  3ZRV A;  2DMX A;  1COW G;  4LFA O;  4LF7 B;  1ZL8 A;  3AG3 C;  2UUC B;  3E8B A;  1WNS A;  3UT5 A;  4B3M O;  1S77 D;  1BHA A;  2EZP A;  1LUV A;  3ZN0 A;  2NN4 A;  2GV9 A;  3KCY A;  4PDR A;  4YHH O;  2X6C A;  1KYO F;  5E79 Z;  4CH5 A;  2Q0A A;  1XHX A;  2WWW A;  1S3J A;  2ZIN A;  3E8G A;  2FTK A;  3T1Y O;  2Q6A A;  4R8C A;  3UO3 A;  2MW2 B;  2WA3 A;  2JIZ G;  1N32 O;  1H2G A;  3AG3 B;  1M5I A;  4FLY A;  1L1F A;  4FLU A;  2B5U A;  1G6U A;  2WLI B;  5FNV B;  3GWK C;  4IIJ B;  1K33 A;  1ROP A;  1XEQ A;  4DR4 O;  1HP8 A;  1FJG B;  4UV9 A;  3ZMZ A;  5L3G A;  3OGC C;  3RVZ A;  2YEV B;  1KKD A;  1JQ0 A;  1QR9 A;  1DTO A;  3A0R A;  4KUM A;  5LYJ A;  1AI5 A;  4WFA V;  3CS5 A;  2RN9 A;  3CE2 A;  1BT8 A;  2UXN A;  1I0H A;  4W4L A;  3BCC H;  2QE7 G;  1X59 A;  2WLN A;  4R6Z A;  4DV0 B;  2LFS A;  2Q5Z A;  5GTH Z;  3SR2 C;  4LF5 B;  2A7W A;  4H0L B;  4FFB B;  5FNV A;  1FXK A;  1Y76 B;  4WBN B;  4X66 B;  3CYO A;  2AHY A;  4UCT A;  4I0X B;  1FFT B;  2RJZ A;  3AG4 B;  4YY3 O;  4EB6 A;  4IGG A;  2ILM A;  3LNM B;  5CN0 A;  2Z5U A;  1CXZ B;  3JD2 A;  1DF5 A;  4JI6 B;  2YIB A;  4JAV A;  4DV3 O;  2QSA A;  3OW2 U;  1VQL V;  2ZXW B;  5LL6 Y;  4AIL C;  2IJH A;  2NR5 A;  5ITZ A;  1BQZ A;  1F51 A;  4CBC A;  4CC5 A;  2OCH A;  4JYC A;  4R50 A;  3BA9 A;  3JCU Z;  4LR3 A;  3CRA A;  4KFM A;  5L3C A;  1IBL O;  1Q5O A;  3FAV A;  1EM1 A;  1ZX3 A;  3TJT A;  1N33 B;  4PHZ A;  4B3S B;  1JMK C;  1VQ4 V;  3K5M A;  4RO2 A;  4B3T B;  3U11 A;  1D5N A;  1NR1 A;  1J5E B;  3L74 H;  1MMM A;  1PM9 A;  3A0H Z;  2FYU H;  5JJN B;  1XNQ O;  2PI4 A;  4XDL A;  4QPJ A;  1SQG A;  4PA3 A;  1RPO A;  1IBM B;  1SA0 B;  1XMO B;  4GLX A;  3K57 A;  4FFB A;  4U3F H;  4KHP B;  1YDX A;  2YIB D;  1R1B A;  4N23 A;  3OMN B;  5LA6 B;  3CXH F;  4YXW G;  1AI7 A;  1QVG U;  4JI1 B;  1E79 G;  3K5O A;  4JI2 B;  3ABT A;  3ZHT A;  4WFB V;  1F7Y A;  3C3T A;  2Y0I A;  2F1M A;  1N34 B;  4TSF G;  2LGW A;  1SS3 A;  1XMQ B;  4LC1 A;  2L35 A;  4X1Y B;  1P84 F;  4I7Z B;  3UKM A;  1NH2 B;  4YJ3 A;  2Y69 C;  4JAA A;  4O2A B;  1B6Q A;  3DSQ A;  1W59 A;  1EFR G;  5B1B C;  2EIL C;  3C90 A;  3QNE A;  4J10 A;  5IJ0 B;  1YF2 A;  3FFQ A;  1LNQ A;  5B1A C;  3NR7 A;  3MD0 A;  4CC6 A;  5B1O A;  1SER A;  1ZSP A;  4I50 B;  2RDC A;  3SDL A;  4NTW A;  1GK9 A;  1GRJ A;  2FL4 A;  1R6N A;  1Z5V A;  4IHJ B;  2ZXW C;  1WAZ A;  2LP7 A;  4P30 A;  5IYB O;  1JA8 A;  3EXA A;  4C7U A;  2GBO A;  3AK2 A;  5EZY A;  1ARO P;  2OTL V;  5GW7 A;  1Q86 W;  1WPB A;  3EHB B;  3O9O A;  1PPJ H;  5HFL A;  5LHG A;  3H1H H;  1U96 A;  4U3J A;  4QE9 A;  4JI3 O;  1VQ6 V;  1XNQ B;  4JTC B;  3IC9 A;  4Q6G A;  1Q6I A;  1B06 A;  4J11 A;  4X20 B;  3RYF B;  3HKE B;  1G1X B;  3ZMU A;  2HEP A;  4Z1M G;  4RQF A;  2LFR A;  3ABK B;  5A2Q N;  3FB8 C;  1JOY A;  3RYI B;  3J7A U;  5BR8 O;  3MAQ A;  2Q73 A;  3SJB C;  1GN6 A;  4MSW C;  1FKA O;  3JAK B;  3R65 A;  4O2A A;  1KU9 A;  3HKC A;  5L3B A;  4IHJ A;  2UXC O;  4YJ2 A;  1MA1 A;  1GM7 A;  2HVJ C;  4UUJ C;  4EFB A;  4FLX A;  1XOU A;  1R3K C;  4FPP A;  3ICX A;  2UXB O;  1VF6 C;  4QE7 A;  3CSX A;  1Y66 A;  2XAS A;  4PJ0 Z;  3ZED A;  2JDI G;  4JV5 O;  2QWO B;  2HP8 A;  4IL6 Z;  3N2K A;  3JD3 A;  4DV4 O;  1S5J A;  1NTK H;  5D5P A;  2UXD O;  3ETG A;  4X8A A;  4AQY B;  5L3D A;  3ZIA G;  2ETN A;  3E22 B;  5LBQ A;  2ZE6 A;  4ABM A;  4UCU A;  2VQF B;  2K1E A;  4HNA A;  5KHI A;  2QWP B;  2F23 A;  1IX9 A;  4O4I B;  3KG2 A;  2Z3Y A;  2HHH B;  4J80 A;  3DC6 A;  3ASN C;  5LOV A;  1T5E A;  3IC7 A;  1EN4 A;  5KLV H;  2OTJ V;  5DN6 G;  2QKS A;  4OX9 O;  3U0Z A;  2PYJ A;  2DW4 A;  4LFB B;  4DV5 O;  4O4L A;  2PYL A;  1P49 A;  1TVK A;  5B1N A;  5LMN B;  2QKA A;  3IFX A;  2QM4 A;  3OE7 G;  4UCV A;  1VQP V;  4D6T H;  1G8M A;  3VOU A;  4DR3 O;  5JH7 B;  2YI9 A;  2DYS B;  1EBO A;  4O4J B;  3SJQ C;  5LXT B;  1KP3 A;  3CWB H;  2ODM A;  1N0J A;  3R66 A;  1VEW A;  1FFX B;  4I4T B;  2WLL B;  3SPC A;  3FB6 C;  1MG1 A;  1OCC C;  1P7B A;  3D36 C;  4AQY O;  1VF7 A;  1XQ8 A;  5IY5 B;  1QCE A;  4WCE V;  1NT2 B;  3RFR A;  1N0N A;  2Y4T A;  1ORQ C;  3OUF A;  3JAL A;  5CA1 B;  2XND G;  5EBM C;  4Z2W A;  3CJH A;  1FXH A;  2XOK G;  1DLB A;  2EIN B;  2EJR A;  3K08 A;  4G28 B;  4MS2 A;  2DYS C;  2XAJ A;  3L71 H;  1NTM H;  1HNW O;  1AR4 A;  2X7R B;  1HW7 A;  3CJH B;  1V55 C;  3B09 A;  1Q7Y W;  4JI7 B;  4LFC O;  4DV6 B;  2Z0A A;  3FB7 C;  3RYC A;  3OUS A;  2B1I A;  4WF9 V;  2EJ7 A;  4MVQ A;  1NVP B;  2CK3 G;  2W0X A;  2X6A A;  3OFN G;  4LCU C;  3C3S A;  5D5Q A;  1L0L H;  2LGQ A;  4PEL A;  1K3E A;  4DR3 B;  2O57 A;  4NXN B;  2W6I G;  3FAV B;  3RN4 A;  3CCE V;  1VQN V;  1OHH G;  4DV6 O;  4A5U B;  1JR9 A;  5LMU O;  1HNZ B;  3OAA G;  1IVS A;  4TOI A;  1GKF A;  2YEV A;  3LDC A;  1YEW A;  4DV1 B;  3LNN A;  3LSS A;  3WU2 Z;  2OWO A;  2WLI A;  4ZBM A;  3L72 H;  1R6T A;  4IIJ A;  1N36 O;  1VIB A;  2EIJ C;  2QWN B;  4XDK A;  1GN3 A;  4KHP O;  1Q3E A;  1WA8 A;  2ZNJ A;  2ZNI A;  3JAK A;  5IYZ A;  4UB8 Z;  4PV1 B;  2NLJ C;  2EZO A;  5J2U B;  2CUG A;  2VQE B;  4O4I A;  4I0X A;  4LWS B;  3BPZ A;  1YZB A;  2XAG A;  2YID A;  4JV5 B;  3HKB B;  4J7K A;  4GX0 A;  3B8N A;  2GTS A;  3BFR A;  1L0N H;  1VQM V;  1S72 V;  5B66 Z;  2BSK B;  3K58 A;  5EC2 C;  3QO7 A;  3K79 A;  3OMA B;  1MSW D;  1OCO B;  2Q7G A;  5B3S C;  4UVC A;  2XUM A;  4I9W A;  1FYJ A;  1MAB G;  4MVS A;  2XTA A;  2PUS A;  2YC0 A;  4FMT A;  4X1K B;  4UCR A;  4OXS A;  1HR0 B;  1K8A W;  3VQW A;  1HR0 O;  4JI1 O;  3WB1 A;  1YI2 V;  2DYR C;  2QM8 A;  4LF8 O;  4UXN A;  1NJI W;  1QU7 A;  2OCC C;  3ZRW B;  1JX9 A;  3IJ4 A;  3TGU H;  5LP6 B;  3GVM A;  2FKX A;  2LW7 A;  4FFK A;  4TV8 A;  1KEC A;  1M1K W;  4GKJ O;  5KMG A;  3K3W A;  4PA4 A;  1SQQ H;  3OMI B;  3VQV A;  1YIT V;  2UUA B;  1OCR B;  3NXS A;  4FM0 A;  2IBZ H;  3CHX A;  2WPD G;  3T4Z A;  1J95 A;  3F7Y C;  5CA1 A;  1NS1 A;  1SKV A;  4BIU A;  2UUA O;  3CCS V;  4PD4 F;  4UVB A;  2ZR3 A;  5KX5 B;  2IJI A;  3E83 A;  4QNH B;  1Q43 A;  1ZL8 B;  1IBL B;  2NNU A;  2RCV A;  2DQ3 A;  1P7G A;  4U7N A;  4AHC A;  5EIB D;  1JJO A;  4DXW A;  5KX5 A;  4NTX A;  3S3W A;  4UB6 Z;  4J41 A;  1KP2 A;  1LR1 A;  1GN4 A;  4OPA A;  1KB9 F;  2BCC H;  5JJJ B;  5LMN O;  4BW9 A;  2UUB O;  3CCQ V;  2CGN A;  3L75 H;  3WG7 C;  4F4L A;  4DR6 B;  3U10 A;  4DV5 B;  5EBL C;  4ZOL A;  2R9A A;  1K34 A;  1GM9 A;  3OR7 C;  1H2S B;  1SET A;  3N2G B;  3CCV V;  1JCH A;  2M6Y A;  4QIW F;  3T1Y B;  2YIA A;  2OYQ A;  3RW0 A;  3SYO A;  1GN2 A;  1PNL A;  3I55 V;  4P9O A;  4LF5 O;  5LGN A;  1ZTE A;  5KUM A;  5IJ0 A;  1FXK B;  1Y76 A;  4H13 B;  3LSQ A;  4JI3 B;  3BVO A;  3CRQ A;  1VQ9 V;  2VQF O;  3O65 A;  2XAF A;  2R70 A;  1OZ0 A;  3HB3 B;  1IZ3 A;  4JI7 O;  5KHJ A;  4FZ1 A;  1Q82 W;  4MVU A;  1BGY H;  3PJS K;  4LH7 A;  3ZHR A;  1H2M A;  3K9S A;  4X88 A;  3Q4H B;  2BOC C;  1Z5W A;  2EIK B;  1BMF G;  1U97 A;  2ZQM A;  4RUE A;  4JI0 B;  3FYE B;  4DUY B;  1JPX A;  1Y74 B;  2ITC C;  1YJN V;  4B3R O;  1Y6X A;  1YTF B;  3ETQ A;  1RP3 B;  3S3X A;  5LMU B;  1B04 A;  2YXL A;  2W6J G;  4MVZ A;  3OTO O;  3JAM N;  1SQV H;  2PF4 E;  3H1I H;  4DRX B;  4WFH A;  2ZR2 A;  2AW9 A;  4YHH B;  4I50 A;  2Y0P A;  3EVK A;  2MK3 A;  3APQ A;  4RAI A;  3X2Q B;  4X9Q A;  5H5N A;  1AI6 A;  4MTG A;  1YVW A;  1VP7 A;  1FFX A;  1N34 O;  2E3C A;  1MZE A;  2H8P C;  1M57 B;  3ETE A;  3AG1 B;  1N36 B;  3LDD A;  2JS3 A;  2EIM B;  4UFZ A;  3I56 V;  1BHB A;  3BEH A;  3CRR A;  4D7T A;  5IYD O;  4X66 O;  1AB3 A;  5K1P A;  4FLT A;  5FL7 G;  3SGI A;  1R3L C;  1BL8 A;  3EFF K;  1QNM A;  1XUQ A;  3STZ C;  3SPJ A;  3G4S V;  4B7E A;  3ZRW A;  4K0K O;  3CPW U;  2BOB C;  3W7U A;  4TUY A;  1PV0 A;  5K1X A;  2UXX A;  3K5N A;  3SPI A;  3QVN A;  2IH3 C;  1HWY A;  2EIL B;  3AG2 B;  4OPH A;  5EBW C;  4TQF A;  4YJ2 B;  4JTD B;  3WG7 B;  1YSC A;  2QWQ B;  2WA4 A;  1MSD A;  2ITD C;  4XDJ A;  4J42 A;  1NI8 A;  3AEI A;  3JD4 A;  2WAM A;  2UUB B;  4DUY O;  4YY3 B;  2DJV A;  1Y4M A;  1O9G A;  2M7W A;  3B40 A;  2UXC B;  2E74 B;  3J81 N;  3ZHV A;  1Y67 A;  4KP4 A;  2OIE A;  2UUC O;  3SJC C;  2IJJ A;  2GUZ A;  3BAB A;  2FML A;  4RQE A;  3DXR B;  4QPK A;  4YIO A;  5KA5 A;  4TUY B;  5BXZ A;  4IYH A;  3K0D A;  4AI8 A;  1IBM O;  1SRY A;  2HJD A;  3AK1 A;  1H2K A;  2R72 A;  2YDE A;  3G71 V;  4K8Z A;  4FM2 A;  1VF6 A;  2EIM C;  1L8D A;  4B3S O;  1YIJ V;  4O4H A;  1VQO V;  5H6R A;  4UVA A;  5BMV B;  4G2K A;  4ZHQ A;  3JYC A; 
#chains in the Genus database with same CATH homology
 4LF6 O;  4K0K O;  5LL6 Y;  3SDL A;  2VQF O;  4LFA O;  3O65 A;  1I94 O;  1XMQ O;  4DR7 O;  1HR0 O;  2UU9 O;  4JI1 O;  4B3M O;  4DUZ O;  4LF9 O;  4LF8 O;  1A32 A;  2ZKO A;  4JI7 O;  2HHH O;  4YHH O;  1IBL O;  4DV2 O;  2FKX A;  4OPH A;  2LW7 A;  4LF7 O;  1KUQ A;  4GKJ O;  4DR5 O;  4OX9 O;  4DV6 O;  3T1Y O;  4JI3 O;  4A5U B;  5LMU O;  1XMO O;  1AIL A;  4JI6 O;  1N32 O;  4JI5 O;  4B3R O;  4DV5 O;  1XNQ O;  4DR1 O;  4LFB O;  4B3T O;  3F5T A;  1NS1 A;  1HNZ O;  1IBK O;  1XEQ A;  2UUA O;  4JI8 O;  3OTO O;  4DR4 O;  4DUY O;  1DK1 A;  1G1X B;  2DJV A;  3JAM N;  4DV7 O;  5A2Q N;  4GKK O;  2E5L O;  4DR3 O;  2N74 A;  1R1B A;  1N33 O;  1R6T A;  5IWA O;  3J81 N;  2F4V O;  3J7A U;  5BR8 O;  4NXN O;  4JI4 O;  1N36 O;  1XNR O;  1FKA O;  3M8A A;  3R66 A;  5H5N A;  1F7Y A;  2UUC O;  4DV0 O;  2JRI A;  5FLX N;  2ZM6 O;  4DR2 O;  2DOS A;  4KHP O;  4OPA A;  1N34 O;  2UXC O;  4AQY O;  1X59 A;  1FJG O;  5BXZ A;  4X62 O;  4JI2 O;  4DV1 O;  1D2D A;  5LMN O;  2UUB O;  1IBM O;  3RT3 C;  3T1H O;  1YZB A;  4NXM O;  4X64 O;  1J5E O;  2UXB O;  2Z0A A;  5IT9 N;  4YY3 O;  4JI0 O;  1HNX O;  4JYA O;  4X66 O;  1AB3 A;  4B3S O;  4JV5 O;  4DR6 O;  4LF4 O;  4X65 O;  4LF5 O;  1HNW O;  2AGA A;  1FYJ A;  2VQE O;  4DV4 O;  3J80 N;  2UXD O;  4LFC O;  5BY1 A;  4DV3 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...