5IWLA

Cd47-diabody complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
233
structure length
233
Chain Sequence
b'EVQLVQSGAEVKKPGASVKVSCKASGYTFTNYNMHWVRQAPGQRLEWMGTIYPGNDDTSYNQKFKDRVTITADTSASTAYMELSSLRSEDTAVYYCARGGYRAMDYWGQGTLVTVSSGGSGGDIVMTQSPLSLPVTPGEPASISCRSSQSIVYSNGNTYLGWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPYTFGQGTKLEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5F9 diabody
publication title CD47-blocking immunotherapies stimulate macrophage-mediated destruction of small-cell lung cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 51
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iwlA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iwlA01
3DUSA 2VR4A 3VXPA 1V3LA 4OCRH 2XOTA 4JFDA 3GJEB 3I9GH 4OF7A 5FGRA 3UYRH 3BISA 2B4CC 4P4KB 4FQIL 1RJZA 5IGXL 5D93C 1MIML 5DC0A 2BCKA 4MNQB 4RZCB 3BKMH 4W4OA 4MWFA 2YRLA 3MNVA 2X9XA 3NFSH 2ZWLT 2FX7L 5C0CE 3MNZA 2CKNA 2XZCL 4U4BA 3PWNA 5FA4A 4NRXB 2FO1A 1F42A 1MRCL 2V5TA 1WZMA 1BWWA 2F54E 1ZVSA 2VLJD 2NX5E 3NPSC 5EN2B 5D7IB 2MCPH 1ZKAA 4FRWA 1ZLWH 4H1LH 5SWQB 3PWLB 1RZ7H 1PW3A 5J0BA 2R69H 3SJVD 1A3RH 2JLLA 3D69A 5GRJH 1YPZA 3QUYD 4DN3H 4NKOB 4AYFA 5CZXD 5BVPH 3VJ6B 1QFPA 4U0RC 4Y16C 4ZFGH 1OW0C 5D6CB 1INQB 2WWKO 1NCAH 1RPQA 1I7RB 5IMMA 4XP1H 4NKDA 2HKFH 2HJKA 3C5JA 3EOAB 3U46B 4P2RA 4PJBF 1MPAL 1ZT1A 4UIKH 4PJEE 1NGWA 4ZAKA 2DQJL 1UQSB 4QXTB 3HZYB 4Z77B 3MOAH 2Y5TA 2ZG3A 3MCKA 1OPGL 1PFCA 4RWYL 5JW5B 3SDCA 1JYVA 5IW1A 3C60B 1L0XA 4DFIA 2I24N 1T89A 4G7VL 2VUOA 1CF8H 4BQBA 5I73B 1HQ4A 1SHMA 3NZ8A 3QFJD 3T3MF 2VIRA 2AGJL 5FUZL 3MV9B 1CTOA 5LAXA 1P69B 3I3DA 5IK3B 2IEPA 5F3BB 2BVUA 1A6AB 1FL5B 1WWCA 3NH7H 3W2DH 3DI3B 5HBBA 2JCCB 1CD1A 4PJAA 3PE9A 3VD9A 3PGFH 1Q8MA 3EO1B 5ICXA 2ESVA 1KB9K 1RHFA 3LD8B 4HW6A 4QTHA 4WWID 2CDGB 2HLAA 5IBTL 2VDRH 4PJ5E 4CVZB 1KTRL 5TF1H 4HKXB 3RVVD 2BY3A 2VDQL 4CVXB 1C1EH 4PGDA 5HDBE 2VERN 5F7YC 3I50L 4CW1A 3FCTB 2OK0H 2VO5A 1YEDB 3AVEA 4CN1A 4XVSH 3BMVA 1MNUL 4ZOEA 2FBOJ 3MRCA 3PWJA 3AAZA 4AQOA 5GS0C 3KPRD 3ZE1E 3B8SA 5AG9A 1C16A 2WNGA 5JQ6L 3BIKA 3NFPA 3RZCA 4NKIL 5E4EC 4UZGA 3SE9L 1MFEL 4KI5C 3GUTB 4OGXL 4OB5H 1HKFA 1IEAB 3FAWA 4JPKH 5DJCA 5HVHB 2V5SA 2N7AA 4UQ2B 3OTTA 4XMLH 3E8UH 2ED9A 5DQDH 2DWDB 1DQMH 4KAQL 2YUZA 1LE9B 3FL7A 2EDQA 1J1PH 1CCZA 4WDIB 2OM5A 3L1OH 1Q94A 3HC3L 3Q6FB 3GJFB 3MRDA 2P8LA 2KKQA 4P5TA 4YE4H 3ARDB 4JHBA 1LP9B 2Y06L 4MSWB 4M61B 3FFCA 1XH3A 1MH5A 4GRLC 4Z8FL 1FL6B 3UTPE 1P1ZA 1RFDH 3CVHL 5DURB 2MKWA 1NAMB 1A6UL 2BC4A 1NMCB 2I26N 4I0PA 3S8WA 2E6JA 3SDXF 5L2KA 1J05B 1NCNA 5C0CD 3CH1B 4X98B 4YUEL 5BV7C 5EIIB 2DICA 5I9QB 2NY4B 4NN5C 4UUJA 1WZKA 2C3XA 1KFAH 2F54D 5GGSY 4FQLL 3FFDB 1U6AL 4EEEA 1LK2B 1CU4H 2NX5D 4F80A 4N0FB 2YA1A 3UBXA 2H32H 4G8FA 4N0CC 4X7SH 1RIUL 4PV9A 4OBRA 3PV6A 3EJZD 1QOKA 5INCA 4EI5B 4LF3B 4LP4A 3RJDA 4NQCE 2W0FA 3OKYA 4U7SA 2V5YA 1H3PH 5JR1H 1BOGB 4EUPG 1ZGLB 3IU3B 4U6YB 3BZEB 3Q5TA 4AK1A 2DN7A 1JGEB 4LBEB 1OAZL 1OF2B 2GSGA 1QFWL 4FXLA 3VFRA 1RMFH 4ZXBC 4YBLB 3WJLA 5IFJA 1SYSA 3QUKB 3L7FA 3FQTA 3ZDXE 4NBXB 3WXVL 4OGAD 3JV5A 5IW6B 1CFSB 3IDUA 2P44B 1F4WL 3MRQA 5EZIH 4F3FB 3D3VB 1S9XA 1M05A 2AXJA 4TSCL 4OZGE 4WW2A 5MERA 2E7CA 3TNNA 1WSST 4LCYA 5IB3B 2HYMA 3H3PH 4L9LB 3TVMC 3QWRA 4DVBB 3MV8A 4OFDA 2NXZD 4MB5A 1TZGH 4M6MH 5E94A 1DSFL 4BKLB 2X09A 1D5XA 1FZKB 3RDTD 2W59A 5J1AA 5TFSL 3SE3C 3ARFD 5I1KL 3CFIC 3DXAB 3DIFA 1NUGA 4DKFL 1N5AA 4LHUG 3EO0A 5AD0B 3VFTA 1ZT4B 4FXGA 3V0VB 3CLEH 1IKFH 3DURB 3K2UL 3QJFB 5J1TC 4CRPA 3I75B 3SDDA 1FRGL 1J8HA 4PJ5D 3SGDI 4X80L 1R5VA 3KPOA 4JM4L 3UJJL 4NBZB 1NC2D 3SY0A 5E2WL 2GHWB 3G5ZB 1I3RA 2Q86A 3LPFA 1LDSA 1MY5A 1IT9H 2BNQB 2JB6A 5FYJU 5D4QA 4LRIC 4X5XA 4DTGH 2JF1A 3TNMB 1FIGH 4RFNB 4ODUA 1OCWH 4MDJB 4BQCA 4OZHF 4HQQL 4J12A 2R2BB 2ADFH 2B0SL 3ZO0A 2XI9A 1HYRC 2C7UA 3Q6GH 3BRDA 4Z7UA 5DVOA 7FABH 1N0LA 4QHNB 3RWHB 3GMQB 3QQ9C 4UDTA 2D0GA 4ONHB 3GMMA 4XMPH 1I1YB 4KKCC 3VXRE 2H3NA 2QJDA 1LEKA 4D0BA 3JWDL 1IGML 2DTMH 3KPNA 3BHBA 2HTLD 4XBGA 4Z78A 3DO7B 4LDEB 5HHOE 1IC4L 1ONQA 4WI4A 1IQDB 3QXAB 4YHLL 5F93C 1ACZA 4HX1A 4ZUTA 3SQOH 1JWSB 3NIFF 3KHOA 3F12B 4NM8H 2NY3C 1EPFA 3C5ZC 4XP9H 5DWUH 3WUWG 4GSDH 1KGCE 4OCWL 3TIEA 4PJ8A 1CE6A 1NL0H 1CQKA 3OR6B 3STLB 4QOKA 1N3NA 1N8ZA 2N1KA 4BSWB 1GCFA 3UTPD 2B1AL 2XG4A 2ZCHL 1RUAL 3HNSH 3V6FB 2C5DC 4L8CB 3QH3B 4JZNA 1JRHI 1J18A 1I3VA 3IAGC 4ENED 4HKZB 3T0WA 3L6FB 1YMME 4R9HA 4M5YL 1HZHL 5ADOH 3LQZB 3IB4A 5ENWB 1T0MA 2CLVA 1UGNA 2N7BA 5I1CH 5CGMA 1FGNL 5IVXB 5CLWA 4MZ3A 4PB0H 1I1FA 1MRDH 2A73A 3UC0L 3FRUB 3JV4B 2QQNL 3S97C 4JFOB 1Z2KA 3OAZH 5C0BE 3KGRA 1KTDA 4LLDB 2B4CH 3I9GL 4JG0H 2DL2A 1JN6B 2KBGA 3MUGA 2VLME 2F8OA 1FE8H 4NNYB 4NQCD 3TIDA 1ZANL 3NN8A 4JDZA 5KSBB 3LEYH 3WIHA 4NHCL 4GRWF 3BKML 3DRTA 4APQA 5D7JD 3NFSL 4Y4HD 3I6KB 1JYWA 4V1DB 5EU6A 5EBGA 1HSAA 3MJGX 3SJVB 4HUVA 1QKZH 3QUYB 2FJFB 3CXDL 5TE7H 2CLRB 4MXVE 4XRCA 2BDNL 3EYOB 1F00I 4LSQL 1FAIH 1GC1L 3MBXH 3FO9B 4MCYB 2V17H 3L3DA 4P9HC 3T08A 4TRPH 1EEUA 3BGFC 3BN9D 1QACA 3SE8L 2HFFB 5I19L 1WAAA 1RZ7L 2GCYA 5BRZE 4CL7A 1SJXA 3GBNL 1AXSB 3FT4B 3MODH 3OGOE 2R69L 2Y7QB 4Y4KC 3HB3C 1SY6A 1RUKL 3F7QA 4P0DA 1NGZA 2OR7A 4MD4A 1MCDA 3MYJA 3Q1SH 5D1ZA 5C0EB 2R2EB 2W9LA 1ITBB 1ZA6B 3Q2CA 2EYSB 3ARSA 1NDGA 3GBMH 3MCG1 4H88H 1K3ZA 2KQMA 2VB5A 1CD8A 4U6XB 5CSBA 5E9DB 5D1QC 1T4KB 4UV4H 3KVQA 3F62A 1Q72H 2OP4H 5EU3B 3LDBC 3R4DA 1J88A 4EUPB 3VMNA 5DD3H 1RK0B 4U1MB 4XXDA 3SKJL 3V4VL 3QIUC 4HF5H 2CSPA 1J1XH 2GK2A 1OLLA 5IMKB 1RZIB 2CK2A 2JJWA 2LQRA 3BN3B 2EDWA 4ZSOE 1PLGL 3O3DB 4Z7VF 2VLLB 1H3GA 1CGSH 5C8JA 5JPNA 4DOHB 1AIFB 1NMBH 4D0CA 1IAIM 3OKEB 2O5XH 2YD9A 1R3IL 2EZ0C 3OF6A 3REWA 4RAVB 5D2NA 5GRYA 4GXUN 5CD5C 5DD0H 1Z9OA 1EHLH 1QFWI 1I9IH 4QHMB 3NH7L 1MJUH 2IAMA 2ILLA 5D9SB 2AJYL 3VGBA 2Q1EA 3HPLA 2H6PA 4X4XA 3VXRD 5FIEA 2BSED 3WEXA 4JKPH 2VDRL 3D9AH 4MX7B 4TNWF 2I9TA 4JPWH 3T0AA 5HHOD 3VH8G 2P45B 4LHUB 2PTUA 2OK0L 2Z92A 3RPIA 2P5WA 1NFDF 4XVSL 3V6ZB 1BGXH 3NCYS 2FEDC 5GS0H 2LU3A 3KWWA 2ZCKH 4C56B 3VXMA 3DUUB 1YJDC 5EUOB 2ICWB 1OAKH 2ZSWA 3BW9A 1HIMH 1P2CB 1P84J 3PWPA 1KGCD 1S7VB 3AMKA 3FQNB 4PS4H 2GUOA 2XTJB 5GS1B 1KCRH 5HVGB 2IMNA 4HC1A 5EBMB 3ZKNC 4YK4C 3HE6C 1FC1A 4AEIH 5J06A 4R7NA 4MQ7B 3BJ91 1F3JB 1M7DB 3U0TA 1JGUH 3ETBF 4WO4B 1IM9A 3E8UL 3ZLQC 4BQ8A 4NPYB 3PV7A 1YN6A 1IRAY 4U6HA 5FKPB 1FQ9C 1YMMD 5BMFL 3AB0C 3FT3A 3H42H 5DGRA 3WNNA 5HHPA 1KN2H 3VGHA 1J1PL 4X4ME 4BSJA 1D5BA 3ZKQD 1R3KA 1QEWB 4HHAB 2E9WA 3DHJA 3T4AA 1IMHC 4I77H 3KJ4B 5D6DA 3THMH 1U58B 1CE1L 2Y9RT 4PRIA 5C0BD 4X7FC 3A6BH 4YE4L 2YBRB 1S7QA 2I60H 2VH5H 4RX4A 2VLMD 2X89D 1FJ1A 3WSQL 5E03A 3QCUH 1Z9MA 2HT3C 3BP5B 3FT2A 3DARA 1XGTA 2F74B 3RGHA 1BX2B 5CSGA 4L3AA 4OZFH 4HKJB 4XTRD 3WUWB 4KMTH 1J87A 1U8MB 5BV7H 1TZHB 1CFNA 2RBLA 3MA7B 4JVUA 4QNPE 3S3SA 1OP5H 5DK0B 3MSPA 4PRPE 4DW2H 3BP4A 3ARGA 1Z5LB 1CDCA 1QR1B 4OZ4B 1F02I 4TOYL 5CKGA 3QZWA 5I8CA 4RGOH 3TN0C 4X7SL 2NY0D 5BRZD 1MRFL 1UEMA 1GIGL 5IWLC 1JF1B 2F19L 1FFOB 3L3JA 1W8OA 2HJLA 4LPXA 4WVRA 1HHJB 4R0LA 4KUZL 1LGVA 1ZHNA 4GKSB 5E5RB 4AH2B 4NQVA 5HYJE 3KYNB 3RNQB 4GXVL 5ECJE 2PYFB 3DVIA 4K55A 1LWRA 1QZ1A 2NY6D 1ZHKB 3OWEA 2E27H 1U3HA 4NUJA 4NFDA 1KUMA 4G8IA 1ORQA 5EZIL 3WDJA 5C0GB 4Q9QH 1W72L 1VGKA 3ARFB 3D0VA 2EDOA 1UACH 3QNZB 4FG6C 3DECA 1I3GH 3LB6D 5D7KE 3TBYA 3FB5A 5T5NF 2NW2A 4U1GC 5BJTB 4IRJA 2X4SB 4M6ML 3ROLA 4UDUB 1T1WA 2LABA 3AM8C 1B0RB 1QRNE 5F1KC 2FJGB 4KJPC 4K8RL 4Z7WB 3QXUA 3ZHLA 5CD3B 3L5WB 4F7CB 5F9OL 2UWEE 5KW9L 3VU2A 3CLEL 1JNLL 1JCKA 4HXBL 2HT4C 1BLNA 3T0EE 3HUJA 3VXSB 4S1DC 4G8EB 3CPLB 3GSOB 2NYYC 3HZMA 1QVOB 4NSKB 2VKWA 4YHIB 5IROC 1NDMA 3IDGB 3MACL 4U1JB 4ELMF 4H0HB 1FIGL 4YJZL 3KXFA 4XVTH 1T66C 4N9GA 5MHSE 4HS3A 4MQSB 1CGVA 1BZ7B 2X4UB 4MD5A 5IHBA 2ADFL 2PCPA 3RL1A 1U8HA 4L9DA 3FO2A 3GGWA 5EWIH 3JVGC 3AREB 3PABA 1QBLH 3IJSB 4XMPL 1NBYA 2OS7A 5F7HA 4F7PA 1AKJD 2DTML 4HGWB 4YHOH 1P7QD 1S78D 3BPOB 4NO2B 1QA9A 4U1IB 1X6NA 3L7EA 3VFUA 1NJ9B 1OGAA 1JZ7A 2ZOKA 3HNTH 4WUUA 1A64A 4HULB 1UWEH 3SQOL 2C3VB 4CN4A 3RBSA 1EERB 12E8L 1WK0A 4NM8L 4PYHA 1HQRA 2GJ6E 4P3DA 1T1ZB 3VH8B 3HPJA 4XP9L 3TO2B 3UTZB 4X6CF 1IEHA 3UTOA 3GI9H 2BSTA 2IWGA 4Y4FC 1H0DB 4LCWE 2DM3A 4M7KH 5IUSA 3DMMD 3VFGH 2XN9B 4R4BB 3OAZK 3HNSL 3QNXA 4M7LH 5JNYA 4KJWD 1PSKH 1FZOA 3O45A 5KS9A 2HMID 3CC5A 4KKAD 4OLWL 4X83A 4KRPC 5JOFA 3KYOA 1ZLSH 4AG4L 2NY5H 1AGEA 3V52L 4XGZA 3O8XD 3BO8A 1BQHA 5ESQA 2PTTA 2DQFA 2ZSVA 4P23A 3RVUC 1MFDH 2W9DH 4PRPD 4BH8A 3OKDA 4PB0L 1MRDL 4N1EA 5AAMA 3K7UA 5D7JB 4Y4HB 1FFNA 2A6KA 5K59E 1G6RA 5CJOL 1YPZF 3NCJH 5E6ZA 3REVB 4YHML 2DKMA 3QEQE 4KQ4H 1S5HA 2AJSH 1FE8L 1CGWA 3A6CH 1JMZA 1GXEA 2OJZH 3WE6B 3MLVH 4WFGE 2JELH 3VMOA 2ADGA 2VDMH 4K94C 3LEYL 4UIMA 4QF1B 3B8YA 2DYPA 4NO3A 2QADB 2O5YH 3DYPA 5CBAB 5HYJD 1NGYB 3EGSA 4ORGA 1QKZL 3OGCB 4F58H 5EG6C 1KIRA 5DVNA 5KANG 4FFYH 3QDHA 4P9HH 3K46A 4R90H 1IVLA 1FAIL 4D3CL 2VUYA 1PQZB 1EEQA 3E2HC 4Y1AB 4TRPL 1QTYT 5AYUL 3ULSA 5T1KA 2AJUH 3HRZB 4NGHH 3P30H 2NMSA 1SEQH 1ERNA 2EIEA 5JHDB 4JFEE 2WBJC 1NBQA 3MNWB 3EOBB 1E4WL 4NQDE 5D7KD 3G5YB 3C5SA 1DZBA 1FZMB 2RR3A 4YBHA 1T04A 5DFVC 5KSAA 3MA9H 3Q1SL 4JRWA 4OQTL 4WV1C 2XRAH 1GZQB 4W6YB 2BVTA 3GBML 1QRND 3JTTB 4H88L 3BSZH 5EPMB 1KENL 1EAPB 1NCWH 5DEGA 3R0NA 4NKMB 2A6DB 1OAUL 4GG6B 1UG9A 3HTLX 2FEEL 3M17A 2DTSA 4UV4L 3C2AH 1Q72L 2OP4L 3TA3A 5DMIL 5DD3L 3T0ED 1E4JA 4ZUWA 1HH9B 3U4BL 1ZHBB 1WUNT 4OLUH 2H8PB 2WUBH 4HF5L 3V8CA 3VG9B 4ZFFA 1J1XL 3S34H 1A7OH 4H1LA 4WI3A 5DUBA 5JHLL 2XXCB 3QUMH 1VEMA 1XEDA 3KS0J 4Y19E 5JIHA 3E6HA 4HXAH 1IE5A 3B3IA 1CGSL 4ODTL 5I75C 2XWTB 5GZND 1U2HA 3QIBB 3VXRB 1NCDH 1NMBL 1UB5B 5DI8A 3C6LC 4LVHB 5ANMA 4EVNB 5MHSD 4G8GE 1L4IA 5ID0B 4QRPE 1HXYA 4IRSA 2PXYA 3MRMB 5MEOB 3S96B 4FQQA 4J4PA 3EDFA 1MJUL 4JREC 3QDMA 4PJ7A 1I8IB 1UWGH 2MWCA 3CDFA 5EOCH 3H6JA 2O61A 3BD4A 3RVXC 2OJEB 1AGFA 1MHPL 4PJEF 2YXFA 1NCCH 4FQXC 4WFEE 3D9AL 5D7LE 4LL9A 5DHYA 3C8DA 1R5WB 1U8OA 1BIIA 4HPOL 1F3RB 1HHHB 5F89B 4PD4K 4LLAA 2IALA 3UTTE 1BGXL 4PGBA 5GS0L 1K85A 3RTQD 1G7QA 3RGVD 2X2YA 1QHPA 5C0ND 1EHXA 1HWHB 2Y6SD 3HMXH 2M1KA 5BS0E 5C09B 1OM3H 1NGXA 1OAKL 2GJ6D 3PQYE 4QCIB 1HIML 3TPUA 4X99B 3QIWC 1EZVY 2CKBA 1GHFH 1KIPB 1EVUA 5EO1A 4LCWD 2CR6A 1MAKA 1HHGB 3IKCB 5IG7B 4XCEA 3UZEA 5EUKA 2EE2A 3D18A 3P4OA 4I3SL 2DQIL 3AY4A 2FATL 2A38A 4X9GA 5E7BA 5DUMH 5MEPA 4NNPL 1MF2L 4CU6A 5KOVC 3H42L 1AP2B 4G6ML 5DJZA 3K81A 4HIHB 2DLHA 1T83C 1ED3A 1UJ3B 4JY4A 5DXWA 4R4FL 4I77L 3X3FH 1LO5A 2IH3A 4YXHH 4ZFOB 4XB7A 5J12C 2VABA 2NY1D 5E1AA 3THML 3S5LG 5DJYB 3ZE1F 4OF8A 3ULUH 1MQ8A 1F3DJ 4KKLD 2BMKB 2HRLA 3TZVD 2D0HA 3KLHD 1M7IA 2I60L 3QEQD 1P6FA 1OAQH 2Z31C 5E8EA 4Z6AT 3FN9A 2Y36H 3INUL 1CT8A 2Z4QA 4WFGD 5I8OH 1EUUA 3OJMB 2F58L 3TBSA 4PJXB 5B3NA 4A6YH 4KMTL 4YHKH 3EAKA 4K07A 1A1OB 4LLWA 5BRZB 5A3ID 4RAHA 5L2JA 4YZFE 2WSKA 4YR6A 4JZOB 5MP6H 4POYA 1U8LA 3IJYB 3BPNC 3KPQA 3EO9L 1DCLA 2C26A 4DW2L 4RMTA 1G7PB 3ZSSA 2NR6D 4ZQKB 1VERA 3DYOA 1KPRB 4GRMB 4LCUA 3O4LA 1A7RH 3BVNB 4JFED 3IF1A 4CGTA 4NQDD 3WHXA 5DDHB 1G1CA 1AD0B 4PJGB 4FN0A 3P9MA 3TCXA 1WIUA 3QWOA 3CDYA 1L7TH 2H26A 1DQTA 5K9JH 3UPCA 2OZ4H 4OT1H 5GRWA 1T1XB 3U7WL 2QKIA 1QYGH 3FHAA 5HGDA 5IHUH 2YEZB 4J7RA 4J6RH 5GGRB 4Y5VB 3LKOB 4I4WB 2BRRL 2CDEB 3OSKA 2E27L 5DJAA 2OXGA 4HJJH 2H32A 4HJ0C 4ODWA 4O4YH 3VD4A 1T6VN 1HDMA 4Y19D 3ECBB 4XPTH 1I9RL 1T1YA 1IC5H 4YXLH 5LBSH 3X12B 2AK1L 3P4MA 5EBLB 2W92A 1E28A 4RMWA 2K1MA 5GSRA 4QRPD 4I2XA 4CADB 1K4DB 1QFWM 5HHNA 3V6OC 1QPXA 3RWDB 5F7DA 3IGAB 2AJXH 5IIEB 1DTUA 4YPJA 2AXFB 5GRXG 5EOQL 3ZDXF 5B22A 4YX2H 2OSLA 4K71C 3KDMA 4WFED 4HFWB 4S0SD 4KDVA 5D7LD 1KEGL 1CR9H 3MJ8B 4HWEH 2ORBH 4Q2ZA 4OZGF 3UTTD 5E8DL 5BQ7B 3VG0H 2FECL 3GSNB 1LO3H 1AR1C 3WFZA 1XF2B 3NACL 4XVTL 1OSZB 1PKQA 5BS0D 4KPHH 2RJMA 3PQYD 3MRHA 2A6IA 5FYKH 1SVCP 1WBYB 4PJCA 4KRLB 4KH2A 4GMTL 3TO4A 4HFUH 2DQTL 5I66B 3GNMH 3MRRB 1VKXB 2DJ4A 5EWIL 3QUXC 5DRNA 4UOW0 4YFLI 4I18B 1IL1A 1MFNA 1QBLL 1VSCA 2DQEH 2G9HB 5EOTA 4XPAH 3EFFA 1OAYH 1F4AA 4MLSA 4TNVK 1T5WB 1ZT7B 4YHOL 3FQUA 5CIPH 2O5ZH 4WWKD 2DLIA 4HV8A 2Z9TA 1K8IB 5GZOC 4X6BB 3KPSA 3CVIH 1I1AA 1TVHA 4X7CC 5T5FH 2P5EA 3HNTL 1I9JH 1T7XA 3BH9A 3LQAC 4XCYA 4NP4H 1PZ5A 2A74B 2UVFA 4P46B 1T2JA 4NZRH 1KACB 4JM2D 5I74B 2VDOL 3OMZA 2X4PB 1EK3A 1I7TB 4NYLA 1FO0B 1G84A 1I4FB 1FSKC 1XIWC 2F5AH 4B41A 1NUDA 4G6AC 3O2WH 3GI9L 4FQCH 5EORH 5LGKA 4WTWA 4M7KL 3VXTB 4FZ8L 2FSEB 3BXNA 3B9KA 1C7SA 5L2KE 1MREH 4YXKH 1EHAA 4YDKL 1OTSD 3EHBD 1PSKL 3ZL4H 2HVKA 3RZWA 1RULH 1KYOK 4RNRB 1TQBC 5SWZA 1G7JA 2X7LA 4ODHH 3LY6A 2NY5L 3ARVA 3TT3L 3ZSTA 2W60B 1K8DA 2FZ3B 1IGYA 3VWJD 1IKNA 3U9PH 4QHLB 3IJHA 4L3CA 1HILA 1DVFB 1NGPH 3S98A 4F15B 4K3GA 1DBAL 3OJVC 1K4CA 2NY4C 1F11A 4OI9A 3MO1B 1B9ZA 4NFCA 3NCJL 2FD6H 1ZHLB 1MQKH 2WM0A 2YD5A 3PG2A 4FQJL 2QSQA 4ZPTB 5GGUB 1U9KA 2X1QA 5AAWA 4IHOB 2XPGB 1PVHA 3IXAB 4KQ4L 3G5XB 4ERSH 1QLRB 1WC7B 2AJSL 4K94H 3AU1A 3MLVL 5AYQA 1ZA3B 2VDML 5DA4A 3VFPB 1MVFA 1YEGH 3CIQA 4ZTPL 1YZZA 4QKXB 4KTDH 4HKBB 4U6VH 3M8OH 2G2RA 3MBEB 4XZUA 4JG1L 1BJ1J 1Q0YH 2ZOLB 4LSRH 4OCSL 5DJ2B 5DMYA 5HHQA 3S88H 1YY9C 1SJVA 4JQVC 4F9LC 3QBTB 4L4TA 4ELKB 4G6KH 2GK0B 3C2SA 5C0AE 5I17B 1IAOA 2HWZH 3NZHH 2AJUL 3GZKA 1PG7L 3HE7C 4NGHL 1SEQL 1JF5A 5F6IC 4XNZB 3W11D 3B5HA 4RMRA 3VDCA 4JO4H 5SX5K 5L7XH 3B9EA 3S7GA 2XRAL 2JJSC 4Y2DD 1HSBB 4KQ3H 3O6KH 3RWGB 4LSUH 2EECA 1YN7B 3RWFA 5FCUL 5TH2A 3HAEG 2V2TA 4M1DH 1WWBX 1BBJA 2R1YA 2DLEA 1NBZB 4DK6A 2YZ1A 1QSEA 1S9YA 5DT1H 4MXVF 3P3YA 1I8LC 3DX6B 4ZO6A 1ORSA 2AI0H 3BFOA 1U3JA 4IIQB 3MRLA 1A7OL 5D1XD 5E6YA 2IADA 3GHEH 2JIXA 1GL4B 3QUML 2GTZB 2GW5A 4P57B 3S9DB 3J8F7 2PYEA 3HS0A 4HXAL 3OXRB 4O5LH 4PJFB 2EXWC 4Y16A 1AC0A 4OZIB 3P9WB 3GKWH 1KBGL 1J1OL 1AO7E 1OW0A 1S8DA 1JMXA 4ZNEE 2ED8A 1IC7L 1FV1B 3FB8A 1O7SA 2ZKHH 3S6CA 3WD5L 2B5IC 2H2PC 2HFEB 2DBLH 1JZ6A 2WV3A 4N90E 2E6PA 2FX8H 2VZOA 1O0VA 4GBXB 5EOCL 2F9BT 1NGQL 4KTEH 4N0UA 3QPQD 2X41A 2PKDA 1UB6B 2GJ6B 4GKNB 1N2RA 4ZYKA 1NCCL 4PP1C 2VE6B 2XWBA 4U7MA 4QYOA 3QQ4B 5IF0B 1RJLB 2VDLH 4LQ1A 2DQDH 2VXTH 5E99L 1I7UA 2UYLB 4HDIA 1U95B 4MCZA 2AAVA 1E4XH 4NOBA 2OTWB 4YLQT 3WHE0 2CK0H 5D2LE 5C07A 5F1IB 1A9EB 5ACLA 1KC5H 3RNKA 3HMXL 3QSKB 4S0TD 4HG4K 1OM3L 4QOKE 3ARUA 2YKLH 3U1SL 4KKBD 5DRXA 1I8KA 2W0PA 1ADQA 3B9AA 3JWNC 1ZTXL 1AD9B 1CK0H 5HGHB 4ZUSA 4YHPA 3IRZA 1S7XB 2P43B 3MLTA 5L2KD 1MHCA 1ZLVK 3WFDH 5IB4B 1UM5L 5HI5D 2VWEE 3TPKA 4MAYD 4X6EA 4TN9A 1DQQB 3QEQB 2FECI 1X5JA 1YYML 3T0BA 4UOW1 3S4SG 3M45A 3X3FL 4OF3A 4DGIH 3WJJC 2V2WB 2X4QA 1KB5H 3ULUL 1JPGA 5C0FA 3UCRA 1JGLH 3DVFA 4XCNA 5JIIA 3TGXA 1WICA 3U0PA 4H5SA 5HYQB 4E41B 1OAQL 1FGVL 5CGTA 2E9BA 2Y36L 4QRSB 5MENE 1JHLH 1GVIA 5GGTA 4BFIB 3VD7A 4M6OH 3ESVF 3LEXB 4YHKL 1U8PB 2ZUVA 3FB6B 1CICD 4HUXB 4L5FH 3L3GB 1B90A 3V0WH 5CP7A 1MCRA 2FWOB 1IQWH 2EDDA 5MP6L 4XBEH 4XNMA 2OBGA 3OB0H 1QO3A 4AT6A 1EEYB 3BYYA 3DYMA 3U6RA 5A43C 2MCG1 5CZXC 5C0AD 1MI5B 5DZOA 4OCXH 3OR7B 2DLTA 4GRLA 3FB7A 4RGNC 1HHIA 1V5JA 1YNKL 2X70B 3U30C 4EDXB 2D31B 4LEOB 4YNYA 1T7VA 1Y6KR 5LVEA 3WXWH 4FQ2H 4JKKA 2A83B 4OZFA 4UU9B 1XF3B 4XNQB 2AXGB 3A67H 1MIEH 4JRXA 1J8HD 3IDYC 4R4ND 3E1F1 2G5BB 4ZPVA 5D5ME 1I8MB 1QYGL 3ZT7A 5IHUL 4LKXB 3TYFA 4J6RL 4QNPF 2CQVA 4XHQA 4LSVH 3QI9D 3QO0A 1NLBH 4LKCA 4WFFE 4PPTA 4X0KA 3TBWB 1DANU 3L3IA 5EU5A 4XPTL 3ULVL 1OP9A 1DP0A 3P73B 3UP1A 2FH6A 1T7YA 2IGFH 1AO7D 5E8NA 5LBSL 3CFDB 4TPRH 5FXCH 1D5ZA 1Q9KB 3TFKD 1MLBB 1EFXD 1MCBA 4KWUA 2YUVA 4N8CH 4N90D 2DD8L 4ZXBA 4M02A 4LIQH 43CAB 1FO0H 1R3LB 4JZJB 1K2DB 3TH3T 3RVVC 5L0QC 4JO2H 2AJXL 1Y0LB 2WP3T 3AMLA 3CSBA 5JIPA 3FZUD 3MV7E 4HT1H 2D7TL 3P11L 4FTVE 3ARBB 5F88A 3KPLB 3HAEB 3TVMA 2ORBL 5I1DA 2J8UB 3MJ9L 2R0LH 3BQUB 5D70H 1N5YH 1M6OA 3PXJA 3VG0L 2AP2A 2R1XA 3QEUB 3TEUA 2VXSH 3EYFA 4LAQH 4MMZC 3SE3A 4GRWH 4QOKD 5LXGH 2BOCA 1FVCB 2ICWI 3C8HA 1IJ9A 2AJZB 3KPMA 5FYKL 3IFPA 1TVDA 4HFUL 3LQMA 3ZHKA 3DUSB 3VXPB 3MRIA 3V8OA 5BXFA 4Y8DC 2VAAA 4HK0A 3SKNA 3WLWD 1IGJA 2IBZX 2UWEF 4JFDB 1VFBA 2OMBA 1HHKB 3CSYB 4XPAL 5IESH 4X6DE 5I8EA 2XY1A 1RJZB 4LNRA 1UENA 1YEEH 3T2OA 2BCKB 4OM1H 5ELIA 3CVIL 3LQAH 4LRIA 5I1IL 4MWFB 3NCYP 3MNVB 3U7YH 1Y18A 4NP4L 5DGQA 4XCCL 4NZRL 5E2UH 4DGYH 3MNZB 3HZKA 4JVPA 1LDPH 1PBYA 5FA4B 1EJOL 4R7DA 2F5AL 5KZCD 1ZVSB 1INDL 3SCMA 4FQCL 5EORL 4JRYA 1PG7X 3ARZA 4MA1B 2EDYA 3G6DH 3WHE1 2BHUA 5MEND 3N0PB 4Z0BL 1JYNA 3QWQB 3ZKSD 3VGGA 3D69B 4MJIE 4OCMC 1YPZB 2C4FU 4F37F 1AGDA 2APBA 4H0IA 3T0VA 4ODHL 4GW4A 1J5OL 5E95B 2VNCA 5D72H 3ZE2E 2CO6B 2P8PA 7CGTA 3QYCA 4M7LT 3P40A 5IMMB 4HWBL 1FNLA 2VZVA 3GMNB 1ZGLP 3U9PL 5IMOA 4NKDB 5B39G 5I30H 2HJKB 3C5JB 3C5ZA 1YEIH 4IMKC 3V7AE 4MJ5B 3AS2A 3EJZC 1NGPL 5C2BH 4P2RB 1KCSH 1ZT1B 5F96L 4LLQA 4ZUVA 5T3ZL 1NGWB 4ZAKB 2IPTL 4I3RH 2FD6L 1MQKL 4WHCA 4P9ML 4MA7L 4XBPA 2Y5TB 4KGJA 3MCKB 3S4SB 4WI8A 2QV2A 2APVA 4FMFA 2VC2H 4JFYA 2ARJA 3SDCB 4XMKL 5IW1B 3TH2T 3BDYL 3IKKA 1HQ4B 4RDQG 3NZ8B 3ZZ1A 1YEGL 4JN1H 2EDLA 4OGAC 1MVUA 5LAXB 5IBUG 2WINA 4U6VL 2MQCA 4M1CC 4NZUH 3BPLC 3QFDB 2UZXB 3S88L 5J1SC 1CFTA 2FX9L 1CD1B 5CEZE 4PJAB 4P5TC 4G6KL 4RMSA 1KSRA 1Q9LA 5MEQA 4WFFD 5EC2A 5JA9A 2P7TA 2ESVB 5ICXB 4L1HA 3UZQA 4YWGH 2NXZC 4LU5L 4QTHB 1FVDA 2HLAB 5K59F 1YEJL 5DMJB 3GSXA 1IM3A 3RDTC 1ZXQA 4BK4A 3OKLA 4PGCA 4Z18A 4PGDB 4LAJH 4M4RA 2AV1B 3BZFA 4HUMB 4KC3B 2HLFD 3ET9F 3FN0H 4I0PC 5L7XL 1KLFA 3CD4A 1CDYA 3MRCB 3PWJB 3AAZB 3ZDYE 1Z3GL 5M94B 3O6KL 4LSUL 4XP6H 3SDAD 3BIKB 1F6AA 3RZCB 5HSFA 1WCQA 2GSIA 1G0YR 3MV7D 1QLFA 4BFBD 5DT1L 5FOJA 3VFWA 5DJCB 2GQHA 4FTVD 5FKAA 1EX0A 5CJQH 5CMAA 1AQDB 3GHEL 4FZEH 4Y4KA 1TJGL 3RVWD 2LFGA 3EDDA 1AQKL 4O5LL 3PWPD 4O02H 3GKWL 5FM4A 1NAKH 1K6QH 4NWUH 1C08B 2ZKHL 1D5IL 5IT2H 1HH6A 1MCKA 2DBLL 4ZFOL 5D1QA 4EOWL 1LO2H 3MRDB 2P8LB 1ZV5A 2HTLC 3BE1H 5GIRA 5T33H 1NCBH 2F53E 2Q7YA 3QIUA 1KF9B 2CMRH 2HJFA 1XH3B 3GIZL 4KTEL 1MH5B 4Q0XH 1BQLL 2D0FA 1MCPH 4KDWA 3IAQA 1P1ZB 4EIGB 4ODSH 5ISZE 4N1HB 2BC4B 2VDLL 2DQDL 2VXTL 2B2XH 1UH4A 3SGJC 3K4AA 1E4XL 1O5DT 1BAFH 1RVFL 2CK0L 4G3YL 5L2KB 1R0AH 4L8DB 4TSAH 5DSCA 4RX4D 1KC5L 4UUJB 1TJIH 1RV6X 4X9IA 2X5PA 1MJ7H 3KPPA 1ODAA 3LIZL 4C83A 3UBXB 4ENEC 3X17A 3BI9X 1SQ2N 4P2OA 3EOYG 2ZNWA 4OUOA 5ERWA 4PV9B 3PV6B 3WFDL 4MJID 1NEZA 4L3EA 4M4PA 3MLWH 2W0FB 3W0WA 5E8OA 3IDIA 3PNWA 3OJDA 4DCQA 1OB1A 3FRPA 5DVKA 3PL6D 2GSGB 4M03A 3VFRB 1JPFB 3HMXA 5GSVA 2Y23A 4DGIL 5B8CC 3QDGE 2VLRA 5IFJB 1SYSB 1BPVA 4FFWC 4IJ3C 1KB5L 1UZ8A 1JGLL 5HPMA 1BZQK 3HE6A 3O3UN 3MRQB 1B3JA 1M05B 1S9XB 1U8NA 3EOTH 2BNRA 5B21A 4WW2B 5MERB 2I07A 3L5XH 3TNNB 5E6ID 4LCYB 5C08E 4BQ9A 3HZVA 3CNKA 3MV8B 3D85A 3F6IA 4M6OL 3VA6A 3BGAA 5E94B 3MLUH 2ZJSH 5AUMA 1HXMA 1D5XB 4L5FL 3LS5H 3V0WL 3BN9C 4QTIL 5F21B 5J1AB 1CL7H 1IQWL 3DIFB 5EFIA 1N5AB 3EO0B 2ZG2A 4DGVL 4JM2F 3VWKA 4N0RA 35C8H 1R6VA 4OCXL 5D71H 3N50A 3SDDB 4BZ2H 1J8HB 1KULA 1FAKT 2UY7A 3VFMA 2Z0BA 3KPOB 5B39B 3SY0B 2YN3A 1I3RB 1CLYH 2Q86B 3WXWL 4FQ2L 4PJIE 2NTFB 3CFJB 1C5DA 4A6YA 4G9FE 4X5XB 3GSNL 2YC1A 4ODUB 4M5ZH 3F58H 5IB1A 2OMNA 4YZFF 3LKNA 1T7ZA 2C7UB 4NQXA 4GUPB 1AO7B 4Z7UB 4LSVL 4UDTB 3GMMB 5LGJA 1SMAA 1TTGA 3TN0A 4M00A 4CNIA 1LEKB 2H3NB 4XWGL 4D0BB 5IWLA 3KPNB 2A6JB 3BHBB 3OXSA 3TYGH 4CVWA 4JPVH 2D3VA 1NQBA 2YPLE 4HIXH 4JB9L 4QLRA 4Z78B 3G6JA 1CIUA 1ONQB 2V7NA 1IGTB 3U4EA 4TPRL 4UNVA 1Q1JH 4M7ZB 3V5DA 4ZUTB 2MQ3A 5BZDA 1E0OB 3T8XA 2OL3H 4M48L 2OZ4A 1FO0L 5AEAA 2C4XA 3TIEB 2F53D 2L7JA 4PJ8B 4E9LA 5J3HD 1CE6B 3CGTA 1XF5A 3UEZA 4QOKB 1N3NB 1N8ZB 2XZAH 3B43A 3VXUA 2H9GA 1KLGA 4BELD 5ISZD 4JFZL 4LSPH 4JZNB 4Z76A 1XGQA 2J12B 1YNLH 2APXA 3MLRL 2BNUA 3QXVA 2EO1A 3JXAA 1R3JA 5J4MA 1BBDL 4PJHA 5EZLA 3AM8A 1B6DA 3RUGE 4RMQA 2CLVB 1OAXL 3V7AG 4LAQL 3CFBA 5TE4H 1MCFA 3PUCA 5LXGL 2HKHH 1EGJL 3UAJD 2FBJH 1I1FB 2A73B 4PLJD 4Z5RA 4KKNA 4GLRH 3O6MH 5FHBH 1UM6H 1KTDB 5DF0A 4JQXC 4J3VA 4PG2C 5ABDE 5EU7E 4QY8A 1DQJA 5IESL 3MUGB 2ADJA 2HFTA 2VLKA 4OJFH 1UXWB 3TIDB 3NN8B 4JDZB 5IROA 4OM1L 4YDIH 4KVCH 3DRTB 4WTZG 4YPGA 4APQB 1BJMA 3WL9A 4LNVA 4ZS7L 5EU6B 1HSAB 3OKNA 5EA0H 4HUVB 2OR8A 5I15L 1CD0A 5L88L 1RZJL 3QDGD 2M8XA 1LDPL 3JVGA 4XRCB 4UT6L 2ADIA 4JANA 2AK4A 1FN4A 2RGSA 4XTRC 3VD5A 5TGBA 3G6DL 5C08D 1TVBA 2GCYB 5FHAH 2QQLL 1WCBB 3QULA 2DOCA 3KLAA 3PIQA 3VXNB 2HRPL 5CIPA 4KUCD 1H8OA 1DBMH 1NGZB 5F9WB 4MD4B 3MYJB 3Q5YA 5D1ZB 1RHHA 1INEL 5F7MC 4PRHA 2CGRH 1IAMA 2NY0C 4O2CA 1OL0A 3EFDH 4YC2B 3RP1A 4XVUD 5C2BL 5CWSA 4Y4FA 4OFYA 3ZYJA 4XXDB 4I3RL 5JLZA 1S7WA 4GAJH 3FQRA 4PJBA 2VC2L 5IHZA 1QUNA 4FFZH 1T3FA 5C8JB 3IYLW 3LPWA 4G9FD 4D0CB 2NY6C 1KIQA 5D2NB 2WANA 3LMJH 1OVZA 4NZUL 3S35L 5HDOA 2IAMB 4LHJB 2X9YA 4L8SB 3WS3A 4O2FA 3LB6C 5F8QC 3HPLB 2H6PB 4X4XB 3HI5H 4HPYL 4YWGL 3QRFM 4ODVH 4F7TA 3SDAB 4U33A 5FOBA 3RL2A 2YPLD 3LZFH 4PGJA 2I9TB 2I25N 3U4AA 4BFEA 3MRPB 2Z93A 1KV3A 5KANI 1H5BC 1E6JL 3K1DA 3RPIB 4P59L 2P5WB 3FN0L 3ZTJH 1A6VH 3KWWB 3VXMB 1U8JA 2XWJA 1NFKA 4XP6L 2ZSWB 3DPBA 2EXYC 1RZFH 3BW9B 2CLZA 4KXZI 5DLML 5FDWA 1LEIA 3PWPB 1DL7H 4QWWD 3GSUA 3BH8A 4ZO8A 1BQHG 3C09B 4MQTB 3MQIA 4R7NB 4EI6A 4ZODA 4LCIH 4OCYH 3U0TB 2WBJA 5HDQH 2X10A 4FZEL 1YN6B 3GI8L 1P4LA 3RVTD 4U6HB 3IDMA 3FT3B 4O02L 4WV1A 4NRZA 1BP3B 1GOFA 1K6QL 1D5BB 2DQGH 1R3KB 4AM0A 5H94A 2HG5A 1JPSH 3GRWH 2DL9A 1LO2L 3GSWA 4PRIB 1NCBL 3QXDA 4W81A 1B88A 4GQPH 1S7QB 5C1MB 4Q0XL 2EDTA 3CDCA 3H2WA 1FJ1B 1MCPL 5SWSE 3WFHA 4JFFA 3FT2B 1XGTB 3T0XA 3NABH 1G9MH 2IBBA 3C6LA 4UAOC 5GRVK 3RKPA 1BAFL 1R0AL 4IRJC 4LSDA 3W9EA 3O6FC 1CFNB 5DFTA 4Q58C 4R96A 2OTPA 4TSAL 3DMMC 5CKAA 1TJIL 1X5XA 3SDXA 3ARGB 5KG9B 4KJWC 4KVNH 1MJ7L 2HMIC 3DVGA 3CFEA 2QQKL 3AXLB 3QZWB 5I8CB 3ARPA 1L7IH 3K0WA 4A2MA 1NFIA 3O8XC 3V0AC 4FQXA 1VFAB 2PO6D 2Q8AH 1AJ7L 5IFHH 2D7NA 2LV4A 5GRVL 3L3KA 3L3JB 3QG6B 3DGCR 2HJLB 1RUML 5IOPA 2E3VA 4R0LB 1ZHNB 1EO8L 1QFUL 4NQVB 3GSVA 4H1LG 3ARXA 2XTLA 4QRRA 3OKOA 5D2LF 5D7IE 1FZJA 3QIWA 4UB0H 4ZD3H 5KSVA 1JYXA 3MUZ1 1A4JA 1CDIA 1WJ3A 5BZWA 5IR1A 1U3HB 4G8IB 1ORQB 1S7TA 5I71C 3EOTL 4BYHA 1WFOA 3L5XL 4H20H 4MA8H 1TJHL 4TULH 4NO0D 4U1SA 3TBYB 3FB5B 2NW2B 2ZUUA 1KJMA 2R15A 3DETD 3ROLB 3MLUL 2ZJSL 1T1WB 5FB8A 3LS5L 2CH8A 5E2TH 1CL7L 4LRNL 4MB4A 3F8UB 4G6JH 5KOMC 1SJHA 3RRQA 3NPZB 2K7PA 4FQPA 1GGCL 3V5KA 4NQEA 1B0GA 1AXTL 3WLBA 4LVOC 5DR5L 5CUSH 2Z31A 3D2UD 3HUJB 3H9SA 5IV2A 1DLFL 4LHQB 5DD1H 3MV9E 3HZMB 2ZPKL 1RZKC 1CLYL 1JGVL 1NDMB 4PRNA 1TZIA 1BD2A 1QSFA 3T09A 2MPAH 3ES6B 4MNQA 4RZCA 3KXFB 4N9GB 4HS3B 3T0EC 3T65A 1LVEA 1VEPA 4P23C 3WO4B 3O3EB 3F58L 4MD5B 2PCPB 5C9JA 4ZS6D 1U8HB 4OLXH 3FO2B 3L5IA 2YN5A 3AS1A 3GGWB 4L4VA 3BUTA 1AI1H 4XWOD 4FP8H 5DEFB 4KZEH 2DQUH 3CU1A 2L4OA 5JW3H 4OZHA 4OD3H 5GGQL 3QUZD 5GZNC 2LVEA 3PP4H 4F7PB 1D9KD 4GMSH 1F4HA 1ZOXA 1N4XL 4KK9C 3TYGL 1KCVH 4JPVL 1QA9B 3T04D 5ILTH 2WMPA 1CDJA 2BHYA 4K8RD 1F58L 4XT1C 1KJ2H 1H15A 1HK6A 3L7EB 3VFUB 1OGAB 1X6LA 2ZOKB 4JAMB 4EBQL 3P4NA 5ISZB 5E5MA 4HWZA 3ALPA 1MSPA 1Q0XL 5IEHA 2OL3L 4PUBH 4NJ9H 5HJ3A 1I7RA 3WFEL 1HQRB 4P3DB 3HPJB 5H37H 4K7PL 5DO2D 1YEFH 5JUEH 2BSTB 3K3QA 5D5MF 4XHJD 3U46A 5GISH 4CDHA 4XPBL 2XZAL 5SWSD 1U93A 5IM7A 2R56L 1YYLH 2VR5A 3QNXB 1UQSA 3RTQC 5JNYB 3RGVC 1FZOB 5C0NC 4Z77A 2Y6SC 3O45B 5KS9B 3CC5B 1SY6H 1ZSDA 3QHFH 5JOFB 3KYOB 3QHZH 3LKQA 1AGEB 4K7FA 4XGZB 2A0LD 3BO8B 1CDHA 1BQHB 1FNFA 2XZQH 5ESQB 4JHWL 2PTTB 1N0XH 2DQFB 4HS6A 4X4YB 1FYTA 1LP9E 4M8QA 1TNNA 3V6OA 1UXSA 4BH8B 2MHAA 3OKDB 3O4OC 2YUXA 1MFAL 4P4KD 4ALAH 1IGCL 5JO5A 5FHBL 4HUNB 3WIIH 1I85C 2A6KB 1UM6L 4P2YA 1G6RB 2X6MA 2JCCA 5HHVL 2Q8BH 2YK1H 4U1NA 2IQ9H 4PJDE 5B38G 3C9NA 1S5HB 4LOUD 4R6UA 4PFEA 4YHYC 2ADGB 1X5KA 4KVCL 1MCOH 1A0QL 2MMXA 4UIMB 2LTQB 2NY1C 4NO3B 3LS4H 4MLIA 4KKLC 3HR6A 4M6NL 3ZTNL 5EA0L 3EGSB 4ORGB 3TZVC 3KLHC 3UJTH 4S1SL 4HIJA 2GYSA 1KIRB 1EA9C 1HEZA 4ODXA 3QUXA 2JK5A 3N1GC 5CJ5A 5TE6L 3RU8H 1TPXC 3DUHA 4N0YH 5T1KB 5AWNH 3QR2A 2J5LB 3QQ3A 5A3IC 2DLFH 1Y6NR 5FHAL 2SEBA 2EDFA 2FH8A 1YA5A 4X6DF 3C5SB 4K2UL 1T04B 5KSAB 3RWCA 1I9EA 4R2GB 5JXAH 3BOVA 3D5OF 2NR6C 4H26A 5M7QA 1CDGA 5DEGB 2NY2C 4PJIB 2ZUQC 3D3VE 2NXYB 3M17B 1XIWA 4PJ9C 2EH7H 1RK1A 4PV8B 3GJFA 3GDBA 3C60D 4HC1H 4MZ2A 3TA3B 3HLAA 4F7EA 2ZP0T 1MJJB 4ZUWB 3ARDA 2DJUA 3GHBL 4GAJL 4ZFFB 1F90H 4H1LB 5DUBB 3RIAF 3MV9D 1ND0A 4M61A 3JV0A 3HMWH 3E6HB 4UINL 4HCRH 3RX7A 5FA3B 4XP5H 3DXAE 3CU7A 4ORZC 1VB9A 1DUZA 5ANMB 1K9TA 1DDHA 3D87B 4OF5A 1HXYB 4IRSB 2PXYB 2XICA 3FOLA 3ZE2F 1GSMA 3U48A 1PD6A 4FQQB 3VFOA 4BZ1H 1C5CH 4HH9A 1T2QH 5E8PA 3QDMB 3O0RL 4PJ7B 3U0WH 3OHXA 2O61B 1PJ9A 3RHWK 2BNQE 3FFDA 2VXUH 1AGFB 3OV6A 1R3HA 4NN7C 4TVPL 2L7UA 4Y5YC 5DHYB 3CSGA 5FUOH 1U8OB 1MCNA 5F71A 1BIIB 3K2MC 2IALB 2Z8WC 2I27N 5GGSA 5H35A 2X4RA 4PGBB 2HA1A 2KDGA 1G7QB 1BOGA 1ZGLA 1JNHA 1NGXB 4JQVA 4PLKD 1JNJA 4F9LA 1RZFL 4LQFH 5D8JH 1NFDA 3TPUB 5C0JA 5EO1B 1I7ZA 1JL8A 4HMDA 4JJHA 5DMKA 5CLTA 3HE7A 3H9HA 5FYLL 4M43H 5EUKB 2ZCLL 4F3FA 4B7IA 3D18B 3P4OB 4NN6C 4KZDH 4XAWL 4X5WA 1W0YT 3RAJH 4HBCH 5MEPB 2RIKA 3MFFB 4L9LA 5DJZB 2FIRT 2JJSA 4NQSB 2D03H 4JY4B 4LCCC 4D2NA 1LO5B 2IH3B 2GT9A 3BKJL 1B4RA 1FZKA 3GRWL 3ZDYF 1MHEA 1RUQH 1TQCC 2VABB 5DURD 4OGYH 3CZFA 4WWKC 1CBVH 4NQTA 3FJTA 1I8LA 5AD0A 3FQWA 1UCBH 1M7IB 4HIIA 3EJYD 5GS0D 1CT8B 1MAML 4JM2C 3TBSB 3NABL 4IEFB 3UO1L 5IVXE 3CXHJ 2X9WA 1G9ML 5FK9A 5J13C 2BVPA 3K4ZA 3C8KA 3D39A 4LLWB 1NCTA 1DLHA 5L2JB 1Z0NA 2R0ZH 2PTVA 4YR6B 1U8LB 3KPQB 5ESVA 3LCYA 2XT1B 3N9GL 1V05A 1G0DA 3LSOA 4EI5D 1OTSC 1AH1A 5ITBH 1T03L 3HG1A 2DKSA 2EKJA 5KSBE 1L7IL 4LCUB 3O4LB 2DIJA 5AZ2H 4J1UA 5B4MD 2FLRT 3J7HA 4XVJH 3O3BA 3QDJE 4JHAL 2DM7A 4V1DE 5IFHL 3WHXB 2BJMH 3VRJB 3VWJC 2G75A 5KVFH 1MCQA 1UM4H 4U0QB 3QWOB 3WMSA 1A7QL 1EUTA 4JR9L 3RY4A 5B38B 3QXAA 3CMOH 3D3VD 5JZ7C 5JDSB 2QKIB 5HGDB 4UB0L 3VGAB 2CXGA 4LARH 4U1HA 3F12A 3B2VH 4R8WH 1NC4A 4B50A 5DJAB 4OUUA 2H32B 3FHQA 4WTXA 2X05A 4JGMA 1G7IA 1HDMB 3I85A 3W82A 3UPRA 4H20L 5GS2H 4GJTB 4BSWA 5TDOA 1T1YB 3NIDE 4YBQC 3DXAD 3LEVL 4Q6IB 5E9DE 3P4MB 2JJUA 4YDLC 3D2UB 1E28B 5F8RC 2HTKD 5GSRB 5GHWL 3MYZA 5E2TL 5HHNB 4G6JL 2J3SA 5C3TA 5F7DB 3S36H 4D8PA 1UCTA 3W11C 5F7UA 2PW1A 15C8H 1CYGA 4GW1A 1AY1L 1VENA 2BNQD 4PY8I 4NO5A 5CUSL 2OSLB 4DOHE 3KDMB 4XNXL 1RZKH 4Q9BA 5DD1L 4Y2DC 2VJXA 4Q2ZB 4ZXBD 1JN6A 3IDXH 3O9WD 1A7BA 4W68A 4LMQE 3QUZB 1PG7W 5JXED 2MPAL 3OJ2C 3GMLA 5BOZG 2JB5H 1LQSR 2VLJA 4KUCF 5D96B 1II4E 5C0IA 1PKQB 1P4BH 2W91A 3MRHB 2A6IB 4PJCB 4K3JH 1RURL 4WHTA 5D1XC 3TO4B 4ELMA 4NUGH 1AHWC 3QUYA 1WWWX 5TPWL 5DRNB 1XCTA 4FP8L 2AABH 3IT8D 4KZEL 5IQ9A 2DQUL 3O2VL 4FQ1H 4K23H 2OI9B 3P9LA 2ZG1A 4XX1E 5EOTB 4GMSL 3EFFB 3MCLL 3FQUB 4C56E 2IFFH 4HV8B 3WIHL 3FT4A 5EUOE 1KJ2L 3KPSB 1I1AB 1TVHB 4JDTH 3LKPA 2P5EB 5SX4H 1T6WA 3BH9B 4XCYB 1PZ5B 2XTJE 1F6LL 3W81A 2ARWA 5SV4A 5C0EA 5ADPH 1IGFH 3QPQC 4LLYA 2X4OA 1JTTA 4NYLB 4NJ9L 1UKQA 5CHNA 4KRNA 1KPUB 5JUEL 3SGEI 5GISL 1L0QA 4MNGA 2ICES 2YSSA 3QFJA 3BXNB 3B9KB 4EUPA 4X6CA 1XGUA 4MXWH 1CFVH 2HVKB 1AC6A 3TT1L 5SWZB 1G7JB 1SY6L 1REIA 4D0DA 1WT5C 5FDYA 3QHZL 4KKBC 3KNBA 1WZ1H 1WV7T 3MXWH 4Z0XA 2VLLA 1K8DB 1V3KA 1N0XL 3T2NL 3NIGE 1IGYB 1N7ML 1GGIH 4QRQA 1HI6A 4URTB 4W6XB 3OKEA 3JWOC 2OL3A 5HGAA 4L3CB 1HILB 2DI7A 4JFPB 4Z95L 4OZFG 5C0RH 1F2QA 1F11B 5DYOA 4AENB 4OD1L 5HI5C 5C6WH 3UBXI 3MV01 4MAYC 2Q8BL 3NCCB 2YK1L 3I02A 1OHQA 2IQ9L 3QDJD 1MY7A 4V1DD 2CUIA 4YHNA 5EBWA 1UJTA 3HC4H 3KPRA 3AU1B 4MB3A 1GAFL 2AKRA 4EN3C 3C5ZD 4Q9RH 1MCOL 5C92A 4U3HA 3IS1X 4Q9CA 3HCVA 3VFNA 4NBYB 4J8RA 4QXGH 2G2RB 4XZUB 2NLJA 3UJTL 2VZ3A 2J2ZA 3RUGF 3VXOA 1X5GA 4JKLA 5FECA 2H1PH 4L4TB 3VA2C 4LVNC 3RU8L 3FQNA 4G7YH 4X7TB 2XA8H 5D93B 1CICC 2Q3AA 2PNDA 3UJIH 5E9DD 1BFOA 2BY0A 5K33A 4JDVA 4RGMC 1OGTA 2PF6A 2KPNA 3ULUE 2MOVA 4JY5L 2FNBA 3FO0H 3RWFB 1NBVH 5TH2B 2V2TB 3GM0A 1JFQH 6CGTA 5HGGS 2CKBH 1T0NA 5FO7B 1BBJB 2R1YB 2P4AB 3NPSB 3QA3A 4HC1L 1S9YB 3X11A 5GGVL 4GQ9H 4BJLA 1ORSB 3BD5A 3BEVA 1A6TA 3QQNA 4K9EH 5C0CA 1F90L 2IADB 5A16A 1JI2A 2JIXB 4LVEA 3IFNH 2UZIL 4IDJH 3HMWL 2DLGA 3MMEA 4H0GA 3HS0B 4R4NC 3NGBC 4Z7WE 3W5MA 2F54A 2RQ8A 4U0RB 4Y16B 4XCFH 4TSBH 1RU9H 3VFVA 1S8DB 2NQCA 2NX5A 1R24A 3CK0L 3FB8B 2WW8A 3QI9C 5FGSA 5I18H 5LCVL 4HS8H 4XNUL 1TZHA 5DRWA 4GG8A 4IMKA 3T1FA 3VXSE 1C5CL 2V2XA 3ZHDA 1T2QL 3U0WL 1RY7B 2YD8A 2YA0A 2Z8VC 4LHUD 4N5ED 3G6JE 2DWEB 5J11C 2VXUL 2KZWA 4C56D 4V2BA 2VN7A 4ZYKB 4P4RA 2XWBB 4QYOB 5HPOA 3M07A 1IAKA 1RZ8A 1I7UB 2XKSA 4HDIB 4MCZB 4PJEA 5I76A 1FLTX 2XTJD 5DZNA 1FNHA 3SO3C 4DEPC 1W0WA 3O11B 5C07B 1DBBH 3BGMB 3BIAX 1V7NH 5JW4Q 2BOBA 3RNKB 4GAGH 5DJ0A 4AZ8A 5T1DH 1T5XB 4AH2A 2EKSA 4WO4D 4UBDC 1A14H 5DRXB 3KPTA 1I8KB 1I3UA 1K5NA 3BZ4A 4Y88A 1DEEA 1E6OH 3ULVE 4ZUSB 2JJTA 4YHPB 4L8BA 2EIBA 3ILQC 3MLTB 4U3XA 1MHCB 5CD5D 3RDTA 2DQHH 4M43L 1FNEA 4OLYH 3KR3L 5C0GA 3ARFA 4KZDL 1JIBA 3RAJL 1JNNH 4HBCL 4P2CG 4X6EB 3I6LE 4PJDB 5TQ0L 3U9UA 4S1RH 4NFBA 2D03L 3WLWC 3VI3E 4PJ5A 4UDUA 4LEXH 1CZ8L 2XN9E 1B0RA 1NC2A 1RUQL 4R26L 5ETUA 2X4QB 5E4EB 3CCHA 2F8VA 1CBVL 4P3CH 4PP2A 2VWEC 3L5WA 4XCNB 5F1SA 3PHOA 3SKUD 3C08H 1UCBL 3U0PB 3TCLB 1JPST 1AGCA 1D6EA 2IC2A 5AZEL 1Z9SA 2BK8A 3IXTA 4NM4H 3CPLA 1BFVL 3N1PC 1IFHL 4LGPB 1IBGH 4XI5C 3R1GH 5FYKE 1JTOA 3ZKND 1KTLA 5C6TH 4U1JA 2P48B 5I2IA 5CP7B 1SM3H 4ZOBA 1MFBL 4XNMB 5KVGH 1QO3B 4AT6B 3P4LA 3GRWA 2XY2A 3FN3A 1BZ7A 3MV11 2AV7A 3U6RB 5ITBL 4XAKE 2J6EH 2FYYA 1FLRH 4CUCA 4GRLB 2C1OB 1HHIB 5I1EH 5AZ2L 1G9NC 3B5TA 3CUPA 4CU7A 1FL3A 3WDHA 4AMKH 1OSPH 2BJML 2DQCH 4OLVH 4YNYB 3IVKB 5LWYL 1QPPA 2OTUA 1UM4L 4HGWA 3G04A 3SGJA 2VDPH 4NJAH 3AUVA 4OZFB 4YFDB 5DS8A 1U92A 2V5MA 5ICYA 5L6YL 3ULUD 4DZ8A 1FDLH 3BMWA 2VYRE 5BV7B 1NJ9A 3TWCH 2YD4A 2VITA 4JRXB 4NN5B 3DX9A 3ALWA 4Y1AE 1IEBB 1G7HA 5J6GA 4YDVA 2VXQL 4ZPVB 3LHPL 1T20A 1OWRM 3TYFB 5JHDE 1DBJL 3WKML 4XX1G 1OOAA 4M3JA 1YUHA 4HWNA 4OV5A 1LEGA 1S3KH 3B2VL 4R8WL 5A40E 3QO0B 3UTZA 4LKCB 1JK8A 4UNUA 4X0KB 4XPFH 3IFLH 5IKCA 3L3IB 5EU5B 4DKDC 1KCUL 1T7WA 1RZGA 4Y5XC 1LNUB 5JA8B 2YD2A 5E8NB 4GG6E 5T1MA 1D5ZB 2VDKH 4LPYA 5INDA 4LFHD 4BSVA 1IAIH 5T3ZE 5DJ6A 5E2VL 4R97C 5B8CA 4ZXBB 3VXSD 3O9WB 3SOBH 3T77A 4NQCA 2GJZA 3O2DA 3S36L 1DE4B 5D7IF 3DRQA 15C8L 2ED7A 4B0MM 1OD9A 1EMTL 1KJ3H 5D7JA 3SCMC 3KAAA 1S5IL 2HLFC 2W38A 1GJIA 2D7MA 3QCVL 3FAXA 4WEBH 3TVMB 3L95A 5I1DB 2P8MA 2VXVL 3N85L 4J3TA 3O6LH 4BH7B 2E7LC 1TNMA 1M6OB 3DGGA 3R06A 2R1XB 5D7SL 4WUKL 4FNLH 2R8SH 3EYFB 2R9HD 3ARED 3OKKA 3TF7C 4QF1A 2YD6A 4OZGA 2BOCB 1NEZG 1P4BL 3KPMB 5IVZB 3DSNA 3IFPB 2J88H 4K3JL 4NUGL 4F37K 3VXQA 3B5GA 3ULVD 1JGDA 2AABL 1MWAH 3WFBH 3OAYK 1G6RL 4CAGA 5BXFB 3RVWC 4K23L 2VAAB 4HK0B 3SKNB 1IGJB 5EIQA 2AJ3A 1VFBB 3R8QA 4NIKB 4ZMAT 1NMAH 5I8EB 2R4SL 5F3HA 5KAQF 2JKXA 2YMXL 4LNRB 2C4FT 2NZ9D 5C09E 3I6LD 4JDTL 1V7ML 2AEQH 4OTXH 4OM0H 1FNSL 1SBSH 4XNYH 5ADPL 1WEJH 1N6QH 4JHZA 1IGFL 2JCCF 2XN9D 3X13A 3HZKB 2CRMA 1U8QB 2XKNA 4LK4A 4R7DB 2XNAA 1NSNH 4HMEA 4HLZH 4JRYB 2CRZA 4OCRL 3NA9H 1FPTH 2P47B 3UYRL 1VPOH 4CMMA 4F33A 1E27A 4MXWL 1CFVL 5FM8A 5E0QA 2V5RA 1ZLWK 4KROD 2E8YA 1AGDB 3IS0X 1UVQB 1W8NA 5FYKD 1OARH 1KJ2A 2MKLC 4GW4B 1WZ1L 3MXWL 3QDJB 2P8PB 5I6XC 4M8VA 3VXRA 3WCYA 1GGIL 1A1NB 1SJEA 5IMOB 2VN4A 2NY3B 5HGBB 4YFLF 3C5ZB 4WI7A 1QD0A 4MHHI 3MRMA 1ZVYA 4XAKD 3MREA 5HHOA 4LLQB 3ZE0E 5A2JH 2WIMA 3ZYIA 1TCRA 4PJXE 2MCPL 2QADD 5C70A 4FFVD 2XACC 4WY7H 2VL5A 4H25A 4WW1A 3HC4L 1RAMA 4JFYB 3UDWA 2ARJB 1ZMYA 1A3RL 3PL6C 5GRJL 3FOMA 2E8ZA 2CD0A 4DN3L 4QRRE 1LILA 1FCCA 5BVPL 4LFHG 1Z6JT 4ZFGL 2VOTA 3H7LA 1MVUB 2WINB 1U3ZA 1I75A 1NCAL 4Y1AD 4QXGL 1MCSA 2ERJC 4XP1L 3DTXB 2HKFL 2IBZY 2IMMA 3QAZC 4YAQA 1CFTB 1LP9F 3QRGH 5E6IC 5JHDD 2R0KH 1XCQA 2WK2A 4KRPD 1YMMA 4JQXA 4UIKL 1Q9LB 4PG2A 4X99A 5EC2B 5MEQB 2VZUA 4KHTH 4PJGE 4G7YL 3TP4A 4Y2OA 1FVDB 2XA8L 3MOAL 4Y89A 2AEIT 2XXMB 3GSXB 1HHGA 3UJIL 5DUPH 5HDLA 3OKLB 4PGCB 3BZFB 4X8JA 5C0BA 1CF8L 4GKZA 1VFUA 3MR9A 4BM7A 1J0JA 5T3ZD 4I13B 1DUYA 2IANE 1A22B 2X89A 1NBVL 4X6FA 5DRZA 4DZBA 1F6AB 1UJ3A 1JFQL 3W2DL 2CKBL 2GSIB 1ADQH 4RIRA 4XP4H 2GFBA 1QLFB 3BGFB 3PGFL 4D94A 4GQ9L 3QIBD 2GAZB 1A5FH 2ITDA 4P2OC 4K9EL 5FKAB 1RI8A 5CMAB 2DBJA 5TF1L 2V9QA 4Y4KB 5F7KC 1C1EL 2Q76A 2BVOA 4NZTH 3BUYA 4DVRH 2HVJA 5HI3D 4TSBL 4EDWH 2X4TB 1X4XA 2DI9A 1HOCA 4G6FD 5I18L 1HH6B 5BRZA 1UWXH 2YPVH 4HS8L 1MCWW 2BFVH 5D1QB 5FEBA 2DDQH 5LG1A 3LDBB 3IJYA 4HIEA 5GIRB 3RWJA 4WEMB 4OB5L 2Q7YB 3QIUB 2FJHA 2HJFB 3LN5B 4JPKL 1UFUA 1Q9OA 4XMLL 3V4PH 3QUMB 5GRUH 1C12A 1MELA 5DQDL 5GGTH 5C09D 1DQML 5F7WC 4CVUA 1ZS8A 4HCRA 3MGTB 1GOHA 4TQEH 5DK3A 4WU7A 2OX5A 4K3DH 3S3JA 1DBBL 2WBKA 5J3HC 3T4YA 1V7NL 5DSCB 3EYVB 4GAGL 2X42A 3L1OL 2BSSB 3BJLA 4ZSOA 5T1DL 5CCKH 4YQXH 1A14L 3ROOA 1QQDA 3KPPB 1MCIA 1E6OL 1SYVB 4C83B 3VWKC 4OI7A 4GS7C 5TJWK 5FUCE 5ERWB 2CDEA 1IARB 3DV4A 1X4ZA 2DQHL 4U7KA 1NEZB 1RFDL 4OLYL 1KT2A 4L3EB 4AEHH 4DUWA 3ZKMD 5KN5A 4P5KA 1JZ3A 1A6ZB 1H5BA 5C0DB 1KPVA 3JWDC 3W0WB 4JQIH 4WHYH 3IDIB 2D2OA 4DCQB 3WNKA 1OB1B 2EYRA 1X4YA 5GSVB 4LEXL 3ME0A 4ONGH 3WFCH 3BZDA 2VLRB 4Q97A 1K4DA 1A6WH 1KFAL 4MXQD 5HPMB 4YK4B 3HE6B 1CU4L 4KGLA 1QNZH 1VGEH 1Z9LA 2BNRB 2I07B 4OLZH 4QRRD 3HZVB 3DSFH 3VMPA 1G6VK 3AB0B 3D85B 1PY9A 2QSTA 1H3PL 3R1GL 5JR1L 5AUMB 1A3QA 3UTSE 1I1CA 1HXMB 5BQ7A 2R1WB 5C6TL 3G5VA 4MD0A 2VISA 1XF2A 3S36X 1AKJA 1J0KA 1RMFL 5KVGL 5EFIB 1P7QA 1UZ6E 4QHUA 1N6VA 3P0YH 2GTWB 5SV3A 2VDNH 4O51B 1JPTH 4X4MA 2VMFA 4OAWA 3VRLF 3VFMB 3WN5C 2CRYA 3M1BA 1GPOH 4MS8D 3LH2H 3MRNA 4AMKL 1CGUA 5TQ2H 3T0DA 5JOPE 1OSPL 3UZVB 4OLVL 3H3PL 1BREA 1X5LA 2VAJA 4FQIH 1PX3A 1C5DB 2VDPL 2MFNA 4NJAL 4A6YB 4HK3N 4XVUC 3U79A 1TZGL 3F5WA 2UV3A 3O6FA 1FDLL 5IVXF 2YC1B 2IAND 3MJ7B 3LN4A 1VADB 3DMMA 4NHUB 4EQ2A 3QG7H 4JN2A 4M93C 4CU8A 1JHTA 2FX7H 4DKAA 5IB1B 3WO3B 3LKNB 1LK3H 5K9KB 4NQXB 4RFEA 2EH8H 5EU4A 3PJSA 1S3KL 1IKFL 3VI4E 5LGJB 3TN0B 5FO8A 1MRCH 3W39B 3O8XA 1BVKA 3GSRA 2CRIA 3WNPA 4CNIB 4EKXA 4XPFL 5CP3H 4OKVA 5KSBF 1GC1C 4PBXA 3OXSB 4Z7VE 3SGDH 2FSEA 2H2SD 4PRPA 3G6JB 1IT9L 2V7NB 1KB9J 3BRFA 3U4EB 4RAUA 4GAYA 4PB9H 4DTGL 1XGPA 4OCLC 1EDQA 1OCWL 1C8PA 3T8XB 4PRAA 4MAUH 3KYKH 1CLOH 4NCDA 5JIKA 3Q6GL 4L29A 4QHLA 3G9VA 5CBEB 4E5XB 7FABL 1XF5B 1KJ3L 4PJFE 5I1AA 3VXUB 3CFKA 4OZIE 1KLGB 5HYJA 2BVQA 5FGCB 5EO9A 2ATPA 2DJSA 1CGTA 2YOCA 1T2XA 4X4ZA 4WEBL 1XAUA 4QT5B 2FR4A 4IHOA 4HSQA 4IBLT 5I1LA 4RWYH 4HUWA 4ISVA 4U1GB 3NBNA 2BNUB 2EICA 4QWWC 1QBMH 1R3JB 4E42A 4PJHB 5EZLB 3S5LA 5CEYA 3CFBB 2AGJH 5DJXA 5FUZH 5EDXA 4Z5RB 4XB8A 2J88L 4RMUA 5HXMA 4LLVA 1BF2A 5FGBC 3O81A 2X1PA 5DWUL 5DJ2A 4GSDL 3QB7C 3ZYZA 4MJ2A 3WFBL 1MWAL 3ZKXC 4XPGH 1SVZA 1WZLA 3S3PA 2RFXA 4WNQA 1NL0L 1QFHA 2VTFA 4QY8B 4HEPG 1DQJB 5DHVA 1QRNA 3NFNA 2X1XR 2ADJB 4P46D 2VLKB 5IBTH 4U05A 3BEWB 2UWEA 3PWUA 5HTSA 1DQDH 1JRHH 2NNAA 4YPGB 5DQ9A 3VRIA 5HYSG 4GW5A 3WL9B 2AW2A 3T0EA 5ADOL 4OTXL 3OKNB 4OM0L 2VSCA 1MHHA 5E24E 5EU7C 3OB8A 1YNTA 1MNUH 1FORH 1WEJL 5I1CL 8CGTA 4KROB 1HSBA 2B39A 5ESAA 2ADIB 4JANB 3HC0A 5JQ6H 2AK4B 2CIKA 1NSNL 4LGRB 4JVWA 1L6ZA 4NKIH 3RWIA 4O2EA 3SE9H 2CUMA 2B4CL 4JG0L 3U82B 3OBAA 3QULB 3QJHA 3KLAB 3LRSA 3PIQB 5CIPB 1OARL 1MFCH 3GBLA 4WJ5B 1DVFD 5HHXH 5DC9B 1RHHB 3UTSD 5EUOF 4PRHB 1ACYH 5FO9A 1JTPA 4O2CB 4Y0GA 3MOBH 1S9VA 3DV6A 4E41E 2PO6C 5TE7L 5GZOD 4Y4FB 5GQBA 3ELAT 3MBXL 1HE7A 2V17L 2YPKA 4NNXB 1S7WB 4GAFB 2FIKA 1TXKA 4Z7QE 2Y06H 3RTQA 3RGVA 5JOPD 4WY7L 3FQRB 3MODL 4PJBB 5CSZA 4XC1H 3MBED 2GJ6A 4KRPB 1T3FB 4DQOH 4LCWA 2WQ8A 1KIQB 2V7HA 3U36B 1MI5E 3QEHA 1N64H 4YUEH 4NT6A 1H8NA 2XQBH 3QRGL 3WS3B 1I85A 5F9JA 2R0KL 4JY6B 4KK5D 4KHTL 4FQLH 4YDJA 4F7TB 3BYTA 1GZPA 1H8SA 5FOBB 1D5MA 1JWMA 3RL2B 2IQAB 4J3XA 1QSVA 1RIUH 4KK8D 5CEZH 2Z93B 1FG2B 2O5XL 4YH6A 5LQBH 5H8DA 3TZVA 1U8JB 2XWJB 3QEQA 5DD0L 3VE0A 1EHLL 2EE9A 1I9IL 5FDWB 2CLZB 3K74B 1LEIB 1OAZH 5L8JB 1QFWH 3GSUB 3X14A 5IJKC 1ADQL 1UWXK 2GY7B 3BH8B 4KI1A 3E2HB 4CMHC 4XP4L 4G6FB 3EJJX 1EXUA 4EI6B 2XFXA 3WXVH 1A5FL 4JKPL 1F4WH 2GIYA 1WISA 2WBJB 4XPHH 3JV6A 5TDPA 3H7BA 4JPWL 1P4LB 4TVSa 2KL6A 4ZS6C 4NZTL 5IVNA 2E7MA 3MLXH 5DA0B 4EDWL 4ETYA 2Z35A 4WV1B 4XWOC 4GBXD 2EDRA 4NRZB 4V2CB 1GYAA 2MJWA 1YJDH 2ZCKL 3TJEH 3MLZH 4AM0B 1DSFH 4RGNE 5H94B 4JFEA 1D9KC 3NCFB 2HG5B 4PYGA 5CEXA 4F7MA 3ULUF 3L3GA 4PJ9A 4JFQA 4NQDA 3GSWB 2Q3ZA 2DDQL 1FNAA 4PS4L 1A2YA 3BP6A 1KCRL 4CJ0A 1WWAX 3HFMH 4K8RC 5E08H 2J8UE 5EZJA 5ITFA 4AEIL 1UC6A 2ENSA 3WFHB 4DUVA 4JFFB 1JGUL 1PZUB 5IMLA 3BT2H 4WU5A 5GRUL 5GGTL 5I75B 3UJJH 3C6LB 2F8XC 5DTFB 4B7LA 1KN2L 5HDBF 4K3DL 1SEBA 5DO2C 3W9EB 4XHJC 4R96B 1DFBH 2YR3A 4JFDE 5CCKL 3IU4H 4Y19A 4JREB 3KS0H 4A2LA 1G7LA 4YQXL 3SDXB 3D25A 3A6BL 3DVGB 3CFEB 1OP5K 4ZFZA 4U1LA 5FYJH 4G8GA 1NFIB 1U41A 2A0LC 2VH5L 4NDMA 4FQXB 3GMOA 4QRPA 1TDQA 4Y5YA 3QCUL 2FL5A 1IGMH 2XIDA 2NW3A 4RCAA 1G1YA 4UQ3A 1O7VA 4JQIL 3LRHA 5IOPB 4P4KC 1EBAA 2YXMA 1P84K 1EFQA 5BV7L 3GSVB 5KSUA 4QRRB 4YHLH 3OKOB 4E41D 3OL2A 5D7LA 3QIWB 5DJ8B 5KSVB 4OSUH 1A4JB 5T1LD 1UYWH 5IR1B 4KV5E 3DX8A 4JZJA 1YPZE 3UTTA 5HYSB 1QNZL 3N06B 1VGEL 4RGOL 4I0KA 5E5UB 3ULVF 4W70A 5BS0A 1VHPA 3LOWA 3PQYA 5CFHA 2JTDA 4HJGA 1ITCA 4U1SB 3V4UH 5A2LH 5GGRY 2DB8A 4G42A 1KJMB 4LPTA 32C2B 4P2RE 1NC4D 4LCCA 1BVZA 1T22A 2R2CA 1MI5D 5J12B 1SJHB 1KELH 1VFOA 1NUNB 4WWKA 1FGNH 3V5KB 1KB5B 3P0YL 4NQEB 1B0GB 3UC0H 1X5ZA 4PR5A 2IANB 3WLBB 1MLCA 2QQNH 2Y07H 1JPTL 2Y1VA 4PRDB 4Q9QL 2Z31B 3L3HA 3H9SB 5IV2B 1BZ9A 2A77H 1P9MA 1UACL 1GPOL 3LH2L 2H45A 4FS0A 4JM2A 5TQ2L 1HHKA 1I3GL 3CSYA 4Q7DA 1U36A 4PRNB 4DJMA 1N59A 1TZIB 1BD2B 1F3DH 1ZANH 1QSFB 1BEYH 4NHCH 4PJAE 3C60C 4JGJA 3T65B 1UA6H 2NPLX 1EEZA 2ESVE 3BPNB 5I73C 3QG7L 5C9JB 1LK3L 3VFSA 4L4VB 2EH8L 3CXDH 4OZHB 4J3WA 2J6EA 2BDNH 4TUKH 4LSQH 1GC1H 2PN5A 3SE8H 1G7MA 3VWJA 5I19H 3IETA 3LD8C 3GBNH 1A1MA 3I84A 5BVJA 1H15B 3O41A 4ZO9A 2D7QA 2NZIA 3NCBB 4PB9L 1RUKH 3P4NB 5E5MB 3E3QE 4HWZB 4RGND 3O3AA 5IEHB 4MAUL 3KYKL 1CLOL 5HJ3B 3GMNA 3ARBD 2FEEI 4UTBH 3B2UD 4LLMA 5DMGD 3BQUD 4MJ5A 1WIPA 4MNHA 1PY4A 2FGZA 1U93B 3GM8A 5IM7B 3SKJH 5F97E 3BDXA 3V4VH 4WI2A 5HVHC 3S4SA 3BD3A 3F7YA 4TUJA 1ZSDB 4PLKC 1HCFX 1PLGH 3LKQB 1TENA 1FFPA 4K7FB 4XXCA 1QBML 1KCLA 4HS6B 1UWEL 1FYTB 1U91A 1XF1A 4I48A 5E56A 4GG6F 4M8QB 4JFDD 3PGCA 1R3IH 1UXSB 3ARYA 3FFCE 2MHAB 4IOSD 5JO5B 1YECH 3QFDA 4NC1E 1GOGA 2W9EH 4TVPE 4XPGL 4K71B 3WIFB 4U1NB 2X1WL 2EDNA 3ARDC 3VFGL 2AJYH 3C9NB 4Y2DA 3TBTA 3WS6A 4M7LL 1BIHA 1ZVHA 3MFGB 1DQDL 1ZLSL 1JRHL 4S2SA 1HKLH 1NMCC 2AV1A 3L3OA 3RIAK 1XR8A 1MFDL 1FORL 3RIFK 4GRWB 1KG0A 5A2KH 2W9DL 4YGAB 4HIJB 5D1XA 4KY1H 3EJYC 3C6SB 4ODXB 1AHWA 1HEZB 3QUXB 5FYLE 3UTSB 3HR5B 2JK5B 5I9QC 1MWAA 5IFAH 1SBBA 4D9RE 4PG9B 3QQ3B 3DWTA 4UTAH 3OKMA 5T5NG 4J2XA 1DN2A 4KJQC 2SEBB 3A6CL 4LLUA 2RB8A 1R5IA 2OJZL 2YUWA 2APFA 2JELL 1AQDA 4XH2A 1MFCL 3RWCB 1HYSD 5HHXL 4EI5C 4P2RD 4WHDA 4NRYA 4MQXD 5BMFH 3MRJA 2O5YL 4ZAKD 4H26B 3DX7A 3EYQD 1ACYL 1CG9A 4F58L 5B4MC 3BIBX 5L9DH 1C08A 1ULVA 3MOBL 1M71A 4P2QA 1FSKB 1XIWB 4C59B 4X7EC 3V5HA 1RK1B 3SDCD 4FFYL 4P9HL 4R90L 2RHEA 1CE1H 3HLAB 4F7EB 4YBLC 3MV8E 1F6FB 4F9PC 1OQOA 5JPMA 3I3EA 1ND0B 3P30L 1TQBB 4XC1L 4U1KA 3N1MC 3ARQA 2KUTA 2YA2A 4LP5A 3WSQH 1WT5A 5FF6A 4DQOL 1NH6A 4YGVA 3MA9L 1KCKA 1DUZB 4L9LC 1DDHB 4Z7VB 4QRUB 1X5YA 2ESVD 3BSZL 1NCWL 3FOLB 4U49A 1N64L 1J8HE 4L8DA 4GOSA 3VFOB 1QBAA 4HH9B 4PTTA 2XQBL 5E8PB 3C2AL 4PTUA 3OHXB 3U30B 1CN4A 4MAYA 5DZLA 4AQ1B 4TOYH 5JMOC 4OLUL 3ZE0F 2WUBL 3GMPA 1R3HB 3S34L 2HTKC 4PJXF 2EIZA 5I16A 1MRFH 1GIGH 4EN3A 4PREA 2VZSA 5CEZL 3Q0HA 4L1DA 4C55A 2F19H 2VRAA 3RZCD 4P5MA 5GGSB 5H35B 1NCDL 2X4RB 1KXTB 2BVEA 4O58H 4Z7UE 5HVFB 5LQBL 4HLJA 4X9HA 4KUZH 1JNHB 2K7QA 1NFDB 4RFNC 4K3HA 2EC9U 4GXVH 1JPFA 1CTNA 5C0JB 3B9DA 1I7ZB 1UWGL 1X7QA 3NMEA 4I9WE 3O9WC 2J7LA 3CAFA 4M3KB 2FDBP 5DMKB 3HE7B 3H9HB 3MGOB 5F6IB 5JXEC 4YIQA 1CICA 5ALBH 1PX4A 4HEME 4M1CD 4XPHL 4LPWA 4PJGF 1W72H 3NAAH 1BJ1H 4X5WB 1A9BA 5F1NA 4FOMA 3STBA 3PF2A 8FABB 4P5TD 3MLXL 4M9OA 1LHZA 5C0AA 3DVNA 5ID1A 1YJDL 3UYOD 3TJEL 1PKOA 3MLZL 1A4KA 3FFCD 2HN7A 1AGBB 2GT9B 1MHEB 2XA3A 3SKOA 2LVCA 4K8RH 3CZFB 4TVPD 5ICZA 3MROA 1GHFL 5E08L 3HFML 3OX8A 2COQA 4I0PD 5F9OH 5KW9H 1UH3A 3FQWB 3NCEB 1JNLH 4HIIB 4HXBH 4MA3A 3QO1B 5CILH 2MQ0A 3BT2L 2CR3A 5DUML 5B39A 3G08B 5FK9B 2BVPB 3KHQA 3C8KB 5IB2A 3D39B 1BVLA 3HI6H 1DLHB 2NTFA 3QI9A 3CFJA 2B5IB 3MACH 3DBXA 3SN6N 2X1OA 2EYTA 2PW2A 1DFBL 1KEMH 4YXHL 5FYLD 3IU4L 5ESVB 3LSOB 1Q9WA 3UTQA 4D9RD 3HG1B 4GUPA 1AO7A 2R4RH 4ZNEA 5FYJL 1IZKA 1VFMA 3BPCB 4J1UB 1EFXA 4MVBD 3O3BB 5EU6E 1KLUA 4E0RA 5T1LB 1DQLH 3U7AA 2G75B 5FV2A 5I8OL 2VR9A 4DKEH 2A6JA 3BRGC 5F9AC 4A6YL 3QISA 5F44A 1FC2D 1TCMA 3IDNA 5J9PA 2D4DA 4EXKA 1IGTA 4C4KT 3NVQA 1TLKA 2QTEA 3F6LA 4D9QE 2WWMD 4ESKA 1WAAE 2EDHA 12E8H 3CX2A 4OSUL 1L0YA 4U1HB 1UYWL 5BW7C 3QUYC 3QWRD 1NC4B 4JLRA 3MV8D 3PP3H 4KK6D 2XQYG 5D2LA 4OUUB 4M62H 1A7RL 4FXKA 4JEGB 1G7IB 3UPRB 3PHQA 5TDOB 4Y7MA 5HD8D 1B2WH 4RISH 3V4UL 4OLWH 1MUJA 1FCGA 4AG4H 3V52H 1L7TL 5DQJB 1CDBA 5K9JL 3SDDD 2Y72A 2NY5C 1BQSA 2OZ4L 4OT1L 1KELL 5F6HI 2NY7H 4D8PB 2J1KA 2PW1B 5KVEH 2P46B 3AS3A 4GW1B 3OG6B 1TETH 3GMRA 2Y07L 4NO5B 4NOFA 4HJJL 1JBJA 2G60H 5CJOH 1JI1A 2A77L 3V7MA 4O4YL 3UYPA 5D2NE 4YHMH 3RY6C 2FO4A 1IC5L 4FFWD 3A0OA 4YXLL 2ITCA 3GSQA 4DWHA 1UXWA 1JZ8A 2C3WA 3SPVA 1D7FA 1BEYL 3GMLB 2VLJB 5C0IB 1UA6L 1B0WA 1ZK9A 5MENA 4LMQI 4WHTB 4ELMB 1OTTD 2A9MH 4I9WD 1XCTB 5MI0B 1J12A 5IQ9B 1UZ6F 3P9LB 4RGNB 3ZTJG 5JORA 4TUKL 5CS7A 4D3CH 4YX2L 2P5WE 2Z91A 2QHRH 4U31A 3G6AA 5AYUH 1CR9L 3VXME 4HWEL 3MUJA 5FYKU 1WCBA 3VXNA 1U8KA 2BRQA 1E4WH 3LKPB 5J6HA 3PWPE 3UBXG 1P6AB 5IQ7H 1LO3L 4PJ8D 4N5EC 3IDYB 3RJQB 1EH9A 4KPHL 4OQTH 4LLYB 2X4OB 1KENH