5IWLA

Cd47-diabody complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
233
structure length
233
Chain Sequence
EVQLVQSGAEVKKPGASVKVSCKASGYTFTNYNMHWVRQAPGQRLEWMGTIYPGNDDTSYNQKFKDRVTITADTSASTAYMELSSLRSEDTAVYYCARGGYRAMDYWGQGTLVTVSSGGSGGDIVMTQSPLSLPVTPGEPASISCRSSQSIVYSNGNTYLGWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPYTFGQGTKLEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CD47-blocking immunotherapies stimulate macrophage-mediated destruction of small-cell lung cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords 5F9 diabody
total genus 51
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iwlA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iwlA01
1R5VA 4TUOB 2W65B 1B0GB 3V79C 4R26L 4L3CB 4I18C 4CU6A 4K3EH 2V2WA 4M7ZB 4XBGA 1DFBL 5AWNH 4KJPC 4QHNB 5J1AA 3L3HA 1K6QH 4JJHA 2V9QA 1NBVL 4R9HA 1U92A 2ZOKB 3TP4A 3QUYA 5TQ0L 1J7VR 4LCWA 1G6RB 2X7LB 2XTJE 5C71A 5HDQH 5IEKB 3BD3A 1IL1B 4UU9B 3WFZA 5C2UB 4HS8L 2DMKA 1YPZB 4JRXB 2AGJH 3VXNA 2KQNA 5TGBA 5F9OL 3BP6A 4JY5L 5A1AA 4LHUG 7CGTA 2F74B 4P49A 1ZHKA 3C6SA 4IMKA 3DX8A 1CK0L 2F53E 2EDDA 1MJ7H 4LSTL 5IESH 5JOPD 3QHFL 4NC2B 3PWPA 2HG5B 4BSWB 3SE9H 2R1YB 2OZ4A 2GSGA 1CXFA 1D9KD 4CAGA 5DD3L 3KPSA 1KLUB 3FN3A 3CVIH 1FJ1A 3UMTA 4WY7H 4DUVA 1OCWH 1S7UA 4XNMB 1ES0B 2R2HB 4OF0A 2CGRH 3MJ9L 3OB8A 4MXWH 4P46B 3U46A 1SJHA 5IB4A 3H7LA 3WD5H 1L0YA 4PY8I 1VESA 2XTLA 3QEGL 1ZEAH 3QUKB 4YZFF 3ME0A 3CFKB 4DFIA 4HFWA 4UT9H 3PXJA 4XVTH 1PX3A 3O2WH 5MERB 3D0LA 4IHOA 1OAZH 1I7RB 3GSWB 2WUBH 1JNLH 3T8XB 2AJUL 5C0BE 5HI3C 3WHXB 4MZ2A 1YMME 3WXWL 5I15H 2OMNA 2VIRB 4PJCA 4RQQB 2Y25A 5IBUG 3QWRA 3MV11 5IHZA 3MOAH 3RIAF 2A9NL 1AO7D 1RMFL 3MODL 1XH3A 4EI5B 1A6VL 2XKNB 3QULB 1BQHB 3KDMB 5F9OH 3RNKA 1JNJA 3STZA 4DN4H 4JY5H 1IGTB 1LO4L 3RGVD 3L7EB 4PJCB 3ISWA 1RUML 4X7EC 3RL1A 2DWEA 2PTTB 2XACC 2ZSVA 4HH9B 3EJYD 2F53D 2V7HB 3GSNB 1AO7E 4H1LA 4WW2A 2ZUXA 3RDTC 5SX4H 1UXSA 4HGWB 2PW1B 2X1WL 2DI7A 2WLYA 3O9WA 3DUSA 4HWNA 5ESVB 2FD6H 1MCWM 3HE6A 3QXDB 1M7IA 4HXBH 3L1OL 2O5XH 1EEYB 1KN2H 1S7UB 3IFPA 4PJIA 4AEHL 1OGAB 3VJ6A 2OS7A 1KLGA 3GMRA 3TO2B 5ACMA 3EOAB 4WCYL 3EZJB 1DBKL 4ONGH 4NKOA 1OW0C 1DUZA 3RKPA 1JGLL 2J4WH 5J13C 2A6IA 3B3IA 3QNXA 3VFGH 4RWYH 2X09A 1M05A 2J6EH 1MCRA 5GS1C 2B2XL 1FGVL 2OR7A 2NCMA 4PJIE 1MH5A 1MCKA 5DVOA 5HHME 2PXYD 4M7JH 1SYSA 3WDJA 2YRLA 5DD5L 4DCQA 2H2PC 5JOPE 3BKCH 4M9PA 3ZKMD 1EJOH 1HHIA 2HVJB 3B3IB 2B0SH 1OQXA 1INEH 5SV3A 4UOW1 1FN4B 1DQJB 4PJBF 4Y5VB 1WLHA 5GRJL 3L3IB 3PV6A 3C6LC 3U7YL 4OBRA 1IAIH 3IFNL 3GJEA 4MLSA 1T3FA 4D3CL 2AKRA 1KT2B 2VDQL 3RY6A 1CLCA 4J4PD 4U3HA 5DYOB 4TULH 5H2BB 3SDYH 5FDWB 4KDTA 2VLMD 3SCMD 4L8CA 5TE4H 2BVQB 3ARGA 1AHWC 3GIZH 1J0IA 1BOYA 2D0FA 5DJ2B 3CXHK 3BZ4B 1A5FL 4HG4J 3ARQA 1FRGH 3GJEB 2IADA 1A22B 5DD0L 3ZDXE 2C4FU 4U2ZA 1HINL 4M7JL 3P11H 1ZMYA 3CLEL 5IFAL 5MEPA 4XCCH 3BE1H 3NIDE 1MCPL 3BDXA 3V6FB 2CK2A 1T7ZA 3UX9B 2XPGB 4X6CB 4ZFGH 1EHNA 2Z93B 4YO0A 2UWEB 5FAAA 5F7DA 1ETZA 3L5HA 3MSPA 3NFPB 3W0WD 5IB2A 2VDKH 2QSQA 2Z0BA 4X99A 1IC5L 4OLEA 3N50A 4A2LA 4XX1E 5FUOL 5SWZD 4HIJB 3BH8B 3WFBH 3EW3B 4MAUL 2OP4L 3IDXL 3OKDB 4Z0BL 2RFXA 2ZSWA 2VDLL 3RVWC 4LVEA 3VG9C 3RTQD 1R3JA 1XF5B 1YPZE 3NAAH 3TIEA 1OGAA 1FV1B 4H26A 3BPCA 4WWID 1WFNA 1AJ7L 2GJ6D 3RHWK 4M5YL 2DKUA 5ALCL 2P8LB 4LSVH 3MGOA 3IDJA 3QUKA 5AUMB 5J8OA 2D31B 3GSXB 3VWKA 1JN6B 4U05A 5TE7H 1YDPA 4JQVC 2FEDC 4OI8A 1FNSL 5T3XE 2HLFC 1E4KC 2ADFH 4OZHB 4EDXA 1INQB 3MLRL 3WN5A 3MLWL 4NN7B 5JW3L 3HFMH 4PB9H 1CTNA 1KLGB 3GMRB 3KPTA 3BX7C 4X4ME 1A6UH 1A6ZB 2AERT 2FSEA 5J1SC 2EDWA 1IE5A 1A7PH 3IDIB 1E4JA 3GHBH 3ARYA 1K4CB 4NUGH 2HVKA 3PABB 3L95B 4Z7WA 2FB4L 3CD4A 4QRQA 3BP5B 3DMMB 3TBYB 3O2WL 5I0DA 4PRIB 3IDGA 4ELMF 5I0ZA 4U1SA 1CFSB 4MNQD 4N90E 3H7BA 3SPVB 4FRWA 4PGDA 3UTQA 5DFVC 4NYLB 5KSAD 1HYSD 4JCMA 4UIMA 3RBGA 3TA3C 1F8TL 3UCRA 5TH2B 3ORJA 4LRIA 3EYSH 2ZG2A 1FL3A 1OQOA 4NQEE 3W0WB 4CNIB 1OTSC 1CE6B 4DN4L 1B9ZA 2DQFB 1AGDA 1XCQA 4G5ZH 4PRAB 1BX2B 5EFIA 4IRSC 3QIBB 4MB3A 4X4XB 2HWZH 3KYNA 2NY5C 4I3RL 2G60L 4OZIB 1DBML 1Q9WA 3MJ7A 3P73A 4UILL 5MP6H 4GBXA 3TESA 4XBPB 2HAZA 1IQDB 1A3RL 4UDTA 1IAIM 2J8UE 4KKCD 1UG9A 3GGWB 1CU4H 4HIHB 3P30H 3MBXH 1ZLVH 1DSFH 3F62A 2DYPB 1YNTA 3TH2T 4YO0B 1KCLA 1OSPH 2G9HB 1EDQA 4HJJH 3UAJD 4AM0B 4GAYB 4NN5B 5EA0H 4JPIA 1NDMA 3IU3A 4YXKH 5SWSA 5J13B 4M5ZL 4R4FL 3EAKA 4P4KD 1EH9A 4CRPA 4NHCH 4PJDB 1G0YR 1WAAA 1XF4A 4OLVL 4Y5XC 2M2DA 1OP3K 5B8CC 4K7PX 3GK8H 1T0PB 1I9RL 1S5HA 4YFEA 2OTUA 1JI2A 1QRNB 1A6WL 1HQ4B 5IMMA 2JELL 4H8WH 4NUGL 3L9RB 1NGYB 1UENA 3B4NA 3HI1B 1SQ2N 4XP6H 1JI1A 1F3DJ 3MREA 1ITBB 1DBBH 5F7UA 5MEND 5IESL 4QO1A 2OZ4H 3IS1X 3CGTA 5FDWA 5C0JB 4LLVB 4ODXA 5HDOA 5CJXA 2VXUL 3TN0B 5DJAB 4G8GE 1E4KA 1PY4A 4WHYH 4GMSL 1KENH 4FXKA 1GJIA 4GMTH 4XVSL 5IV2A 1IEAB 4LEOA 3OKLB 2ESVA 3BP4A 4JB9H 4ALAL 3TCLA 5BQ7A 5I1GH 3MOBH 2IGFL 3SE3C 1ZA6A 1D9KA 3QRFM 1YUHB 4WGWB 5F3HB 3SDDC 3DXAE 1JGUL 1F00I 3FN9A 3QCUH 4ZNCD 1UWXK 3HNSH 3OKYA 1CXIA 4URTB 2A2QT 5D7LE 3FONB 2QV2A 5FB8B 2ZUSA 1OGTA 3C5SB 4GXVL 3V0WH 4JZJA 4KK5D 1QFOA 3T0DA 4ZS6C 2AK4D 4PY7B 4X4YB 1TCRB 4WI5A 1F4YL 4DKFL 4DTGL 5L0QB 4ZQKA 1JUFB 3V5KA 3VA2C 5HHPA 4OGAC 3TYGL 4O5LL 2ZZUT 3GUTA 43CAB 1XCQB 2ICWI 5IOPB 4M1CC 3O6FD 1JK8B 1NC4D 3MLYH 4IIQA 3DHMA 3V4UL 4EDWH 5SWQB 3GGWA 3N9GL 3H9HA 5H37H 4Q9QL 5HYSA 1JV5A 1HYSC 2K7PA 1OPGH 3I3BA 1KFAL 3S4SB 3CCHA 4JM2B 4EOWH 2NW2B 3T0BA 5C7XH 1GC1L 2V17H 3HLAB 4RGNE 4E41E 1B4JH 1Z0MA 2WWKT 1JGDA 5IB1A 1D6VL 5MERA 1QRKA 3PABA 3T09A 2X9YA 3UTPD 1MEXL 3HZVA 2HVKB 5GS0D 1T5WA 5F7MC 1M1SA 1DE4A 3QDMA 5E03A 3QWOA 4XPTL 1R3IH 25C8L 1JPTH 4ZS7L 5L9DH 3VU2A 1HOCB 2BSSA 3RPIA 4PGEB 4U1SB 5KSBE 4TUKL 4JVWA 3JVGC 4F37F 5T3ZE 1F2XK 1J87A 1GAFL 5E94B 1I8IA 1F45A 2VLKE 3SHSA 4OD3H 1G7MB 1UEYA 3KPQB 2LQRA 4LAQL 12E8L 4TTDC 1FCCA 2DLGA 5B4MC 3NCYP 3MGOB 3SDAA 1I1AD 1IBGH 4MHHI 1RUKH 2A1WL 4PJAA 3B9DA 3HG1B 2BVPB 2PYED 3ARDB 1YNLH 3KPQA 2LVCA 3ZYOA 3G9VA 3U46B 2H8PB 3K2UL 4Z7OF 4WUUD 1UJ3B 4C54A 5ITBH 1G1YA 1TPXC 2BXZA 4KAQH 1S7QA 1DL7L 4QXGH 1DUYB 3M8OL 4QXTB 4HK0A 3MV01 4OD1H 4XMLH 5FXCH 25C8H 4OSUH 2BERA 4D0BB 1D5IH 1JPTL 1WICA 2W9EH 2GK2A 5IVXF 1GGBH 5MEQA 2L7JA 2EIZB 1SMOA 4BFGA 4X99B 4L9DA 1G9NH 2GCYA 5CINL 3IYLW 5HGDA 1BQUA 4ORGB 4YE4L 2I9LB 1D6VH 2V2WB 3RU8H 4G6AD 4XGZB 2ZUYA 1HSAB 4WTZA 5J3HC 5EOQL 2V9RA 2P43B 5EUOA 3EYOB 2WP3T 4K94H 5HJ3A 5E00A 2OSLA 4G6AC 4JAMA 4NZTL 1BAFL 1J1OH 4ZAKA 1EEZB 4A6YB 3VXRD 5AAWA 4JN1L 1KB9J 2IH3B 3OV6A 1RJLA 3LS5H 1LE5A 3O0RH 4HPYL 4JPKH 1MCHA 2DD8H 1MFAH 5FGCB 4ZUSA 3JTTA 4OF7A 1KPVB 2RCSL 3GI9L 4I5BA 5C0EA 2BJML 3DUHA 1G9ML 4FQHA 3PIQB 1F6AA 5IFAH 2YR3A 3CX5J 4DAGH 2A6DA 5CKGA 4Z0XB 2WNGA 4WU7A 3WBDA 3VDAA 5DRWB 1BJ1J 3ARFD 5ACZB 2P8MB 2Y7QA 4CVZA 4HBCH 4PV9B 3V5KB 1V3KA 1JP5A 3GHEH 5I18H 1GIGH 4APQA 4YDJA 1I1FA 2OR8A 3B9KB 1NGQL 4QTHB 3KYKH 3CDYA 3WJLA 1U42A 1RI8A 4G9FA 4OFIA 4KJWD 1ZVYA 4O00A 2IANB 5ABDE 3WIIL 5DT1H 4FZ8L 2EIEA 2IPKB 3LSOB 3ZDYE 3UTPE 4BSVB 1SEBB 3RWGA 4CADA 4MQXD 1EJOL 1TVBB 1YNKL 3LHPH 2X10A 3VXMD 3MOBL 3C8DA 5DVLA 3D85D 4WUKL 1JHTA 3LQAH 4UTAH 3TO2A 4UILH 1AD0A 5JR1L 1XT5A 3HG1A 4ODUB 2UVFA 2GFBA 4YDKH 4LEXH 5E9DD 1SYVB 3MNZA 5I1CH 5GJTL 4B41A 4G8EA 1DBKH 3O3DB 3EOTH 3DUSB 4QXWA 1G7IA 3LPWA 3BPOB 1ZGLB 1MJ8L 4TPRH 4M03A 1W72L 1I1AC 4EXPX 4OCNC 2VXTH 2R23B 2F58H 2VLRE 1ZVHA 3EYVA 3T0EA 3EO9L 5CJOH 4HJJL 1NCAL 3OXSA 4H25A 3Q6GH 1P4IL 2WUCH 3B5HA 1NCCH 2XKNA 4U1KB 4P9ML 1T5WB 5DS8A 4ZO8A 2GHWB 5IHLB 3P4NA 4MA8L 3F6LA 5BXFA 4F33B 3SEPA 2UYLB 3JWNC 4RFOH 2APFA 2Q87A 4NQCD 1AQDA 4NO0B 1X5GA 2PTTA 1TXKA 3WEXB 1NMBL 1T5XB 4JVUA 3UYRL 5F71A 2MPAH 3TVMB 4NO5A 2HRLA 2P7TB 3GSWA 2L7UA 1SM3H 3TBVB 3NTCL 1DN0B 2J8HA 5HY9B 1NEZB 5LBSL 4MJIA 2CPCA 2VN7A 3VRIB 3TZVD 3PNWB 4CVWA 4M62L 3QDGD 1Y18B 1L0XA 3QIUC 4XP9H 5GQBA 1IGIL 1V8HA 1JGEB 3IDNB 4UAOB 5IHZB 5KANI 2BNRA 1FSKC 4WVRA 4Y88A 3V0AC 3VXOB 2VLJA 4IDJL 1P4IH 2DRUA 2OCFD 1HH9B 4WFGD 1AFVH 1N3NA 3TCXA 1ND0A 4KGLA 4NO2A 4YJZL 5IF0A 1FG9C 4U33A 4P4KA 4Z5RB 1TJGL 3K4DA 3KHQA 4IJ3C 5E4IA 4P5MA 3P30L 4LP5A 3GKZA 4P2OD 3GRWL 4LLWA 1YEGH 4RAHA 4X6EB 1NGZA 2F74A 2OBGA 5GZOC 3ROOA 1RZJC 2FB4H 2LFGA 4QNPE 4MA3A 1JRHH 5B8CA 2BVQA 2V7NB 5IVNA 3QXWA 1WZLA 3RX7A 4LARL 2DQTH 4PREB 4IMKC 2NNAA 4OFPA 4WIQA 5F8QC 4X7SL 2M26A 2B1HH 4QWWC 2HT3C 5ICZA 4NKDB 4OLWH 1PFCA 3F5WB 4Q9BA 3QB7C 1INQA 4ELME 1T80A 4DW2L 1DQJA 5C0JA 5F6HJ 2ADFL 5IK3A 4XI5D 5JOFA 1CD0A 5J1AB 1QA9B 1A9EA 3IRZA 2FO1A 4MDJA 4HF5H 4Z6AT 1AJ7H 2BNUA 4X98B 4POZC 5EULV 1PZUB 2BSTA 3MV8B 3WIHA 1TPXB 1U36A 2X4QB 5FCUH 5GGRY 3IXTB 4Q0XL 4ZOCA 2R0WH 2KL6A 1XIWB 4NC0B 5GS3A 3QIWC 3LQMA 2NXZC 1A7BA 3H0TA 3KYOB 43C9B 2IAND 1ADQL 3W9DB 2XWTB 1Z0NA 4FP8L 4NQVB 4X6CE 4GRMB 5D6CB 1TNNA 4KKCC 1QR4A 3B5GA 5MEOB 5DI8B 3V8OA 1MIEL 1K3ZA 4BQCA 1I9IL 3MV9D 4PTTB 5GRWA 3SGDI 2JJSC 1GGCL 4Y1AB 5CZKA 3BD5A 4K3JL 1CFVL 1RURH 1FVDB 3MRBB 5CD5D 2PR4H 4Z7VB 1QSFA 1BHGA 1SJXA 5B38B 2AEPL 2X4RB 1ZT1B 2N7AA 3HE6B 3SO3C 2CIIB 2J8OA 2VLKA 3MLWH 1M7DA 2H2SC 1NSNL 2GJZA 2FATL 1TVHB 4GSDL 3GI9H 4Y1AA 4LF3B 2MWCA 4K7FB 5CIPA 1XF2A 1I3GL 4HMEA 4OIBA 4JFXB 2W0PA 3AM8C 1MFCH 3QUYD 3W0WA 1IKFH 4KHXH 1BQSA 1HHHB 1C1EL 5LAXB 3EYOA 1W0VA 4PY8J 4Y16D 4FG6C 4PRAA 4U6XB 1MI5A 3D2UD 1EZVY 3RWIB 1RZKH 1IARB 5H2BA 5KJRL 2RJMA 4NYLA 2GKIA 1IAII 5E5UB 3R06A 5D70H 1EXUB 1UB5A 2MTPA 4H1LH 1G9MC 1A9EB 3RU8L 3PGFH 1F4WH 1CGSL 3ZDZF 3B9VA 3IXAB 4D0BA 2MFNA 4L5FL 1CGWA 1R3HB 5GRJH 5I1KH 3DYPA 3SDCB 3F5WA 1Q0XH 3WFEH 2X2YA 1QLEL 4PJ5A 3PDOA 3MRIA 4WHTA 4PB0L 3OAYK 3IDIA 1EERB 5C6PB 3OGOE 2C4FT 3HNVL 1Q0YH 4JDZA 3HI6L 1DVFD 5F7FA 1J0JA 3TO4A 3VFGL 2VZUA 2FX7H 1HNGA 4P2OC 4WFED 1HEZA 2VN4A 3K3QA 2A1WH 4YHKH 2VLLA 1U8JB 4KH2A 3EFFA 3H9SB 3AS3A 4JRXE 2J4WL 3B2UC 2YEZA 3MOAL 1CL7H 3MA9L 3L3JB 1I3RB 1ZK9A 4YFLI 3RTQB 1CICC 3QI9A 4QKXB 4F7PA 1AKJB 3LEYL 3E1F1 2X70A 4NO3B 3M17A 1JRHL 4Q97A 2Q76A 4M8VA 1T0NA 4LLUB 3V52L 4EEEA 3GSXA 2F5AL 5FO8B 5D7SL 5LAXA 1RJYB 3FFDA 1OARH 5H37G 4KI5D 5D7JC 1PKQA 1CFTA 4IEFB 4PJHE 1YN6A 3VI4E 1AGFA 1X4XA 2OTWB 1OL0A 4LF3A 4R90H 1NKRA 3DSFL 5I1GL 5F44A 3VE0B 4C83B 3HG1E 3CVIL 5IVXB 1A21A 2R2EA 3DRTA 3CX2A 4D0DA 5FF6B 2VXUH 2VDNL 3WO3B 1CTOA 1EO7A 5DMKB 3QISA 5DJDB 3WSQH 4H0GA 1FZKA 3CSBA 1HH6B 3LOWA 4RQQA 3ARGD 4MDIB 3EDEA 4NQVA 4P23B 1Z3GL 5JXEC 4LNRB 2ZUQC 2GJZB 4MQSB 1ACYL 1B2WL 4CMMB 1OF2A 2O5XL 1OAZL 4MCYA 2WUBL 5T3ZL 3WFHA 4QLRA 4Z18A 1PQZA 4HUKB 3ZSTA 4Z7VA 4P2QE 5FGRA 3KLAB 5I1LA 3RVTD 3V0VA 4IRJD 1UM6H 3L5WA 5DD1H 4FQXB 4ODTL 3RVWD 4JLRA 5TDNB 3DVNA 1DJSA 2AK4B 3QRGL 5C6TL 3QEQB 2FHFA 4FFVD 4KKAC 4HLZH 1JPGB 5C0IA 4HW6A 4JY4A 4XP9L 3LB6C 2IAMD 4K71B 4G6FB 4LKCB 3SKOA 1ORQB 2XTJB 1IEAA 4LEOB 3P4LA 1U92B 2ZOKA 3LS4L 3FO0L 3EOBA 1CK0H 3F7YB 2FEDD 1T04B 4JB9L 4E5XA 2AJVH 4H8WC 4U7KA 1IGCH 1RHFA 3P9WB 4YDKL 3EJZD 3BZDA 4QGYA 3KWWB 1A1NA 1FFNA 3ILPA 5D5MF 2D7TH 3BUYA 1EHAA 1D5MA 3DSFH 1IT9H 2QADB 5FM5O 2EKSA 2CO6B 1PG7H 1RZ8A 3VD5A 5FECA 2DBLH 1NC2B 3LV3B 3WUWA 4HFUL 2R29L 5DQ9A 3U6RB 4HD9A 4MB4A 1P9MC 2F54E 2ZUTA 4LNVA 4MAUH 1NGZB 4S2SB 4YIQA 2BXYA 3T04D 2Q6WA 4X8JB 2D03L 4OLYH 1XR8B 3MBEB 1OLLA 3HC3L 1V05A 4OKVA 5EWIH 3HZKB 1IM3A 2W07A 1N6QL 2NX5A 2W60A 1HXMB 4OZIA 4KVNL 1OTUD 2BOBA 1UH3A 4K9EC 5C0DB 1VFMA 2FDBP 3I02A 1HE7A 1C5DA 3V4PH 4EN3D 4H1LB 5HGHB 4I0PB 3NZ8A 3EFDL 1HZHL 2J8UA 3ROLA 5DD6A 3IAQA 4JHAL 4HS3B 5ID1A 2DWDA 4NCC2 1I7TB 1P7KA 4WUKH 1NC4B 4QRTA 4UTAL 3ULVD 4D8PB 2Y06H 5DUPL 4KTDH 1TQCB 3TYFB 1OP5H 2AJSH 2GJ6A 5B3JF 2AV7B 1YQVH 5I6XC 1B6UA 1NCWH 5FYJL 1A02N 2R23A 2B8OT 1NANH 4PLNC 4UMGA 4WV1C 3ULUD 1T2QH 4DFHA 5I2IA 3Q5TA 4QXTA 2XYCA 5I8KH 1HIMH 3UDWA 3N1GC 4D8PA 4X6BB 3FCTB 2FHBA 1S9YA 2B5IB 4QF1A 3GHEL 1NC2D 4P3WA 1UJ3C 3QO0A 3Q6FB 4PJDF 2VWEE 4HBCL 1R5WA 3N85H 5EC2B 2ENSA 1C1EH 3AB0B 4ONOA 5ADPH 5B21A 1U8KB 1JIBA 4R96B 1P4LA 4TRPH 4Z7VF 4GW1B 1YNLL 5CEXA 1JNHA 2WWMC 4CVXB 1S7VB 3DARA 2FECI 1WC7A 2BSSB 5FHBH 1T0MA 4DJMA 3FTGA 2ZUWA 2DTMH 1L7IH 5IB5B 4OZIF 4NKQB 3GSUB 4GQ9H 2BCKA 1FC2D 3GIZL 3NABL 1BVLB 3P9LA 4JFQB 4TTDD 4G6ML 3OB0K 3ROLB 1CS6A 3BKMH 1X5LA 1TIUA 4OAWB 5FM5M 4D3CH 4KZEH 4M8QA 3T4YA 4Y19A 3IFNH 3QZWG 4I18B 3OR6A 1JYNA 2B1AH 2H41A 2GJ6B 4JRWA 3SBWA 4RGOL 5BS0B 3CFDB 1WVZA 2B1AL 4UAOC 4YDVA 4IIQB 1B0GA 3RUGF 3LKNB 2FJGA 1BBDL 4U1GC 5GGUA 3JTTB 3GSNH 5LGJB 3C08H 1NAMA 4Y5YB 1X5YA 4O58L 5INDB 3O9WC 4G6KL 1JVKA 1U8PA 2D4DA 5C1MB 5C0IB 3E2HB 3GM0A 4OD2A 5J3HD 4M02A 5ACZA 4MCZB 5IMLA 2AJ3A 1BJ8A 1JF1A 4NFBA 2JJTA 2EC9T 1KN4H 3ARFC 3WE6B 4N9GA 3QUMB 1CFVH 2XWBA 12E8H 5IKCA 3TF7C 4NC1E 5D1QA 3ARBD 4WO4D 4JGUA 5ICYA 3RWEA 1KJ2B 1CIUA 2AEWA 3A6CL 4OZHF 2NYYC 5L2JB 4LKXB 3BP4B 4NN6C 4OV6F 3OKLA 1AGBB 3UYOD 4OT1H 2P5WE 2PUQT 1I9JH 1F3JA 4EBQH 2BC4B 4NOFA 3VXPA 2VQUA 4FQPA 3GKWH 4LLAA 2K7QA 3EYFB 4IS6B 1YEEL 4P3DA 4Y5VA 4KJPD 5EU6E 5GGSY 1B4JL 4QRSA 5DJDA 4F8QA 3WV0A 2YZ8A 1AKJD 5CJ8A 5CBEA 5LWYL 2Y5TA 1CT8B 2HKFL 1ZV5A 4NM8H 3V5HA 4WDIB 5LBSH 3W81A 3FQUA 3OKOB 5JQHC 1NCWL 3EOBB 5CBAB 1MJUH 2EYSB 3FT4B 2NZ9C 2OL3B 1II4E 2VQTA 3TN0C 3RVVC 1IGJA 5D7IA 3A67H 3P0YH 3S5LB 1ZLWH 3UAJC 3IKCA 3RZCB 3SKMB 4KKBC 2VSCA 3H3PH 5TPWH 5D9SA 2X9WA 5DHYA 5FV2A 5EU6A 4X6CF 4N8VB 1FFOB 3ZHLA 5F3BB 3VW3L 4HUWA 3TYGH 2Z4QA 2H9GA 5K9QI 4GAYA 1T7XA 2H2SD 1G9NC 1QLFB 4HJGA 4P2QA 2JJSA 1YEIH 3R0MA 4UT9L 3FTGB 2JELH 4H8WL 4P5TB 3BIAX 4GW4B 4OLYL 1S9WA 2VZ3A 4LSRH 3RKDC 3RQ3A 1FG2B 4NHCL 5KVGL 4K2UH 1WT5C 3D39E 5SWZB 4HJ0D 3EYUH 1N64L 4HS6B 4ZDHA 3P3YA 1I7UA 4FQXC 2ZKHL 3MBXL 5D1XD 3FT2A 5JW4Q 2IGFH 4YGVA 3BGFC 4UTBH 4MJIB 3RNKB 4EVNA 3QUZB 5DEGB 3TBVA 5MP6L 2NXZB 3D3VB 5D5ME 1KENL 3VMOA 2YXMA 4FFYH 2B20A 3MZTA 4JANB 3OR6B 4N8CL 2NY4C 2YPKA 1FNGA 3MV9A 2E27H 1INDH 4HIXL 2G5RA 4R4BA 2CO7B 3CFIC 1QHOA 4DZ8B 5HYSG 2UYLA 3R06B 4L4VE 4RMVA 4GRLB 1Q9KB 4RAVA 5C07A 2WSKA 3QUXD 1J8HA 5DMGD 2R9HD 3PWNB 4UINL 5DRZA 1A0QH 4OLVH 3BXNB 3IJYA 3OR7B 5IB5A 4R4FH 1A6TA 43CAA 5D1ZA 5F1NB 1QKZH 4NZJA 4TQEH 3FB5A 5HHOB 3SDAD 1F11A 3QT2A 3DMMC 3K74B 1MCLA 2AQ2A 4YUEH 1HXYB 4Z7UF 1X5FA 4JFZH 2DQJL 1ACZA 4P2OA 4X6DE 4P57B 4X9GA 5BS0D 5F96L 3IKCB 2AXHA 3LQAC 4FABL 1ROWA 2E7LC 3WN5B 5D71H 4LVHB 5GXBB 1KGCE 3HR6A 2R8SH 1EVUA 3I75B 2VL5B 4JGMA 3N1MC 3VWKB 3KPSE 3HC0B 2IQ9H 4N1CA 4OGYL 4QRRD 3T1FA 3WKNA 3BKYL 5L7XH 5HHQA 2ITDA 1WFUA 1Q0XL 1E27A 3MJ8B 3U0TB 3HAEH 4NKIH 2G2RA 1HI6A 4YHOH 4BFBD 4U1LA 1YYMH 2H2PD 4X5WA 3WIHL 5EOQH 4GG8B 4JDVA 3OMZA 3NCMA 4L8SA 1DVFA 2X89D 3MA7A 1NFKA 5KSBF 4LU5L 2QBWA 5D1QB 4AEFA 2BHYA 3U48A 5J11B 3RJDA 1AXSA 3FQRA 3MRDB 1S3KH 3B83A 4L4JA 1J10A 2W1NA 3G6DH 3RFZC 5GPRA 1ACYH 2X9XA 4W4OC 1HN1A 2NXZD 1NCTA 1NJ9A 3PQYD 4M4PA 2O61B 1LEKB 1T7YA 3ULUL 3O6FA 3C2AH 1MAML 2ARJB 5JW4R 4TVSa 3PWJA 1T89C 1FL5A 2PYFB 1U2CA 3TIDB 2XWBB 3DRTB 1DEDA 4R3SB 5I1AA 4O9HH 3ALXA 1LEKA 3KG5A 4RMRA 5K33A 1QPXA 4QGTA 4WI3A 3JSSA 2ICEA 5ALCH 1ZE3C 1DQLH 2VDML 4R90L 4XWOD 1CLZH 1YN6B 3SCMB 1ZHLA 3ES6B 1G9NL 5C09B 1V7ML 4OT1L 1MEXH 4NQEA 4BH8A 2V7NA 5DEGA 2F5AH 4V2CB 4P59H 2IQAB 5DZNA 5JXAH 3ZKND 1UZ6E 5BV7H 4JM2F 1JTPA 5DEZA 3SE8H 2FIKA 4XCYA 1MLBA 3MMEA 4K8RH 4AY0A 1T5XA 5I66B 3V95A 1JZ5A 1S7SA 3IB4A 3GMQB 3ARRA 5FYLL 1UJ3A 3RWFB 4GAGH 3LH2L 4O2CB 3RRQA 2VLLB 4W70A 3LKRB 1RUKL 5F93C 4YHKL 4FZEH 1K5NB 1EEQA 2YC1A 3IDNA 3S34H 1CDCA 1KJMB 1CGYA 3G5YA 1K85A 1P53A 3LDBC 3S3SA 4LPCA 4CW1A 1BM3L 4HG4K 5KN5B 1U41A 1FP5A 4NN7C 4OB5H 5E6ID 3HTLX 2MCG1 3IJSB 2X44D 4HUWB 3WFHB 4CVXA 3JWOH 4JR9H 2W0LA 5IF0B 4N0FB 5EU7C 3REVA 4M43H 2F5BL 2DQHL 4P57A 4K71C 2XI9A 3TBSA 3QHZL 3QO1B 4UI2A 2ZCLL 5T1MB 1ZWIA 5E7FA 35C8H 2VLJE 4QHLA 2X4NB 1AIFB 2IAMB 4NN5C 3QNZA 5K59E 3ULVC 3QO0B 1Y18A 3PNWA 3QEQD 4KFZC 5D6DA 3LD8C 5AAMA 4C4KT 5JLZB 1ETZB 4ZUWA 4MJIE 4NUJB 2QHLA 3OAUH 4DUWA 4G6MH 4PG2C 3DETC 2OXHA 1YEJH 1YQVL 2PETA 5C3LD 4YZFE 1IVLA 4RBPH 2XPGA 4KTDL 4JFDD 5CAYB 2AJSL 1FNFA 3OKDA 1U58A 3LPGA 3VGDA 4N8CH 4JE4B 1LO3H 3VI4F 4ALAH 1RY7B 2I24N 5KBNC 1S8DB 4RMTA 1NFDA 3FB8A 3B2VL 3HB3C 1MHCA 4GAJH 5DS8B 2C1OA 1NSNH 3PE9A 4JY6A 5E8EA 4YNYB 5C2BH 1ZTXH 3TLRA 4I8DA 4W6XB 1ORSB 1TCMA 2NY5L 2FGZA 4X7SH 2VITA 2IQAA 3F6IA 1N6QH 1MAMH 1SVZA 3P9MB 4MQTB 3U4EA 1KIRA 3Q6GL 4J4PC 3VXSD 3ZHKA 4J8RA 1N64H 1KCRL 4Y4FB 4RGMB 5CIPH 5CJOL 3QUMA 1CDGA 5ENWB 3U7AA 1QRNE 1I3RA 2EICA 3MLUH 4PTTA 4H88H 1FZMA 1T2JA 2XY2A 2VQ1B 4K2UL 5T1KD 4IMLA 5JMRA 1OAUH 1E4XH 2LTQC 3PDGA 5SWSD 1HKFA 1S9VA 4PRPD 3CFJB 3QFDB 3EGSA 3KPRA 5CCKL 2FX8L 2CIIA 3VGEA 2F19L 2XXCB 4P5TA 5I66A 3DX9A 3BIKA 1XGPA 3WXVL 1VEOA 3T2NH 4G7VH 1U8MB 2ZJSH 3DX7A 2VUOA 5CMAA 4AG4H 3R8BB 2BP3A 1UEMA 9CGTA 4Y5VC 4QTHA 3AY4C 3ARVA 3S37X 1B0WA 1D7FA 4X6FA 1X3DA 1CICB 4WI9A 1ZS8B 4LOUC 3TO4C 4QRSB 2R2CA 2D7NA 1GZQB 3I3DA 5INCB 4W81A 4YFLF 2ZNXA 4JFEE 4XC3L 2X1QA 4D2NA 5C0GB 4Z0XA 3DURA 1QBMH 2DJUA 2NXYB 4UT7H 2OQJA 3I6LD 4CJ1A 1M6OB 2H3NB 3SBWC 5ICYB 5D2LA 4XVUC 2WBJD 1VSCA 3ZE1E 1I8MB 4JFOB 4RFNC 4YHYB 1XCTB 4FABH 5ILTL 4XP5L 4OV5A 2ED9A 3CU1A 4QCIA 3EYFA 1S7VA 1S9XB 5GGVL 1KTDA 5LKNA 5EA0L 4X9FA 2VRAA 3EO9H 3U2SA 2AAVA 4PP1C 3UZVB 3L3KB 4LNRA 1LP9E 3S37L 4OIIL 4JQXA 5T1KB 3VXOA 5T3ZH 4I4WB 4G80B 4FQJH 5DC4B 1J05B 4R0LA 1A1MB 5DC0A 4ISVB 5HHOD 1U8HA 1VFOA 3FB5B 3EHBD 2AXGA 4P2RA 1FNAA 1G6RL 5EO0B 4LQ1A 4JRYE 2OYPA 2HKHL 1CXHA 1TTGA 4ONFH 1PW3A 2BMKB 4U6HA 3H9YA 2XZCH 2KZWA 1I8LC 1UM5L 3GSNA 5FYKU 5IEHB 2MPAL 3GSOA 3MCLH 3O4LD 3X11A 5JQ6H 3BI9X 3BQUC 5EFIB 3IDYB 3BAEH 5DFWH 3LY6A 4ZSOA 4NZTH 1KJ3L 4WFHD 1U93A 4F7MA 2ATPA 3CVHH 4X7TB 4NN6B 3HE6C 4RWHA 4MQ7B 4LSPL 4ESKA 1D6EA 2NY1B 2ERJB 3S7GA 5JXED 3ZE2E 4QHMA 1J88A 4GH7B 1JNNH 4HUUA 3BYTA 2F58L 4XTRD 1KLUA 2VMFA 1NH6A 4KU1A 3QI9B 4I18A 4F7PB 3VFSB 5DUBA 3V52H 4F58L 3QNYB 1NAML 3LN5A 3INUL 4IRSD 5T1MA 2XZQH 4DOHE 5HHXL 3MLUL 5HHNA 4PJEF 3IJHA 1ZLSH 2MSPA 2HN7A 4PGCB 4HZAA 4PG9B 5C08D 3BH9B 4NQXA 5GGVY 3D3VA 1RPQA 3ZLQC 1T1ZA 5H35B 1MFCL 4CGTA 5T5NF 1RULL 5GIRB 3GZKA 5KAQF 2CDEA 4HT1H 4N8VA 4XZUA 5F3BA 3SQBA 5DURB 4PGCA 4UIKL 1S7XB 3EYQC 2GSGB 4PS4H 5JHDE 4MNHB 4XTRC 4H20L 3QFJA 5AZEL 5CUSL 5MENB 1HCVA 4MD5A 5DJ8A 3N1PC 2DQDH 4XRCB 2CRZA 3NCJH 3S5LA 1FLRL 2VH5H 4JDZB 5I76B 4QRPD 3O3UN 1A5FH 1RURL 1KSRA 5CHNB 1CYGA 3OAUL 1MY5A 4ACPA 5I1KL 3VXUA 1A7NL 2J12B 3V9FA 1NEZA 5E1AB 2IBBA 2COQA 4UOJA 4I77L 5D2NC 4PYGA 4OFYA 4FP8H 2Y5TB 4GKSA 1QFPA 5EUOE 4AENB 4D0CB 4PLKC 1WZ1L 1NUFA 1SVCP 2B4CH 4APQB 2GUOB 5ETUA 3QIUA 1V7MH 2YSSA 4OF5A 4M7ZC 2OR9L 4BKLA 4P3CH 5CIPB 1KLFA 4KHXL 4AL8H 1KJ2H 3VXTB 1TJHL 3O6ML 1A7RH 1LNUB 4PLJD 4XBEH 5DJZB 1H5BB 5ITBL 5IB2B 4W68A 3RUGE 1DCLA 4EI5C 4RRPG 4WEBL 5IOPA 4GSDH 4ORZC 3EDJA 5D8JL 2R39A 2DMCA 1FGVH 2R0ZH 2IALB 3MRBA 4I9WD 1S5HB 5AG9A 4Y2DC 4F7MB 5CEYA 1VKXB 3V7AE 3MUGA 5E8PA 2B1HL 1BD2E 1GL4B 2NY7H 5KVEL 3G6JF 3TPUB 5F1OB 1F3JB 3TPKA 3BWAB 3ULUH 1GOHA 4K9EL 4YHNB 1OGTB 3O3EB 4NFDA 2YN5A 4NWTH 7FABH 3HZMA 2PCPB 2R9HC 5CEYB 2AEQL 4HDIB 1QLRB 3DRQB 3NH7H 1I8MA 2J8UF 3QCVL 5HI4C 4ZD3L 4MWFA 2R2EB 2VAAA 3CPLB 5FCUL 2X4TA 3F8UB 2R0WL 5FECB 3DMMD 3O6KL 1EO5A 3QIBA 2FNBA 1DUYA 4OD2B 5E2JA 2P5EE 2CRYA 4E0RA 1Q9OB 1U6AH 2AJXL 4MVBC 2CDGA 4GLRH 3TN0D 3QJHA 4ZOBA 3D39B 1P2CA 1NAMB 2LAAA 4P4KC 4MVBD 1T7VA 1OM3L 3P9LB 5IFHH 1T03H 1I7ZB 4XXCC 3MRHA 1NCBL 3L9RA 4LPWA 5E1AA 2WP3O 4MD5B 1J1PL 2UZYB 1EMTH 2YWZA 4LGSB 5IW1B 3V4UH 5C09E 1WAAE 4CMMA 4DGVH 1YJDC 1H3PL 3G04B 3CDGB 4JO3H 1A1OB 1FIGL 1ED3A 3X14A 4AMKL 3S3JA 3VJ6B 4DQOH 4U31A 4B50A 3D9AH 1GYAA 4IOIB 4LSSH 3O2DL 1DSFL 5I8KL 2X5PA 2EYRB 1G7MA 1TITA 3FRUA 4IRZH 1UC6A 3QCUL 4J3SA 5KSBB 2ERJC 2V17L 4Y5XB 3SKJH 3ZKSD 4G8FA 3GB7B 4KVCL 4NKIL 3QQ9C 1Z2KA 5E00B 4FMFA 4OZFB 2YA0A 4JANA 3QNYA 2HWZL 1FHGA 4F3FA 5DUPH 5BRZA 1DE4B 1QFWM 1IGTA 3V4VL 2LU3A 4HJ0C 4PYHA 3ARZA 4Z7OE 3H9HB 3QCTL 4JRYB 3MNWA 3TBTB 2X4OA 4LIQL 3CK0L 5DWUL 5MEQB 5KG9B 4XMPH 1R3JB 4MQ7A 1P7QA 5D7KE 4NO3A 3V5DA 2JJVA 3IRPX 5GJSL 1N59B 3HUJE 5K9JL 4XAWL 2Y4SA 2NW2A 2PF6A 4PRHE 1J8HD 3UPAA 5I1JL 2F19H 3H9SA 2NW3B 3DBXA 4HWZA 3HC3H 2FEEI 2W60B 4GRWE 5E6IC 4KJWC 1VFAB 1FPTH 3KYKL 2E8YA 4CN6A 3HCVA 1RIHH 3FMGH 3TA3B 1LP9A 4HS3A 5GRUL 1OP9A 1FYTB 4HLJA 5GZNC 4L4VB 5HPMB 2YC1B 4BK5A 3BZEB 4HIIA 2GFBB 4YQXL 3DXAB 1LMKA 3I02B 4L3ED 5IBTH 3SKMA 3RZCA 1VEPA 3D1MC 4Z7UE 3HHRB 2VAJA 1MJ7L 4Q74A 5DK2B 3OKKA 1DANU 2P49B 1XR9A 1A3RH 3K1KC 3A6BL 3C60C 5JW3H 3BT2L 4XPHL 4PJ9C 4FFYL 2LE9A 2MCPH 4NQTA 2GJJA 4OKVB 3IDJB 5AUMA 4PV8A 2P5EA 3U1SH 4G8IB 2R1WA 1MCSA 3A67L 1S7RA 1UZ8B 4LHJB 2AJXH 2AJVL 2OM5A 4X98A 1LGVA 4TUJA 5C0CE 5DDHA 3QP3A 4ODHL 2VJXA 4RCAA 4Y4HC 4Y4KB 1J1OL 4JFXA 3GEWB 4P2YA 1A6WH 5HD8C 4IRSB 1WWWX 4NBYB 4P23C 5HPOA 3V6ZA 2IANA 1NKOA 1NGQH 1R3KB 5HD8D 5I8EB 3KXFB 3DX7B 1AQKL 4OFVA 4YXKL 4C56A 1U91A 3CIQA 1NMCB 1CICA 2GT9B 6CGTA 1YEIL 2W59A 3WS3B 1D5IL 5JPMB 5KVEH 1PDKA 3U82B 3V0VB 4UQ2B 3HRPA 5M95B 4D9RD 4QYOA 5C0AD 2GTZA 2P42B 2OI9C 4JR9L 4DGVL 3RIFK 1UM4L 5DJCB 1XF2B 2C7UA 3W39A 2XZAL 3E8UH 2Q3ZA 4JY4B 1LE9B 2W0KA 4ODVL 4M7KH 3I84A 3WLWD 1KIRB 3BZFB 4P23D 5HVWA 3D5OF 5JO5B 1TZGH 3DROA 3LKSB 4YXHH 3BUYB 2UZIH 1KPVA 4JFDB 4OUUB 3RGHA 1EAPA 2XKSA 1XZ0B 4KXZI 3N0PB 4WV1A 3BSZH 1ORSA 3D2UA 2R2BA 2DMBA 3GI8L 1KIPA 3I6GB 3PGFL 2ZWLT 3O6KH 2ORBL 2ZOLA 4HH9A 3TCLB 4ETQA 5GISL 3HNTL 3AMLA 4YC2C 3TBWA 3MACH 1F4XL 4MNGB 1CD8A 3HNTH 4O2EA 4OAWA 3SGKA 3LEVH 4F33A 4KUCF 1RZGB 1DQQA 3UTTE 2IAMC 3SQOL 5JLZA 2BNUB 3FFDB 2GTWB 4PRIE 1FLTX 3QXDA 1MQKL 5CEZD 1VEMA 4PJAB 4ELMB 3EDDA 5DK0B 3SE4C 1W0YT 3M45A 3T2PA 3ARWA 3UTQB 3SDDD 4C57C 1MAJA 4RWYL 4KROD 1RULH 1HI6B 4BFEA 5FKAA 2YMXH 5CJXC 1DDHA 1NDMB 2AV1A 3IU3B 3FKUS 4I3GA 4ZS6D 3P77A 3MFFA 2HJFB 4P4RA 3MO1A 2V2TA 5ISZA 4YXLL 1JF5A 5I74C 3GMPB 1QFWL 5GS2H 1D9KC 2DM2A 3MRPA 4JFPB 4NZRL 3KPOB 5T3XL 3QYCA 4XBPA 4FTVE 2OR9H 1KTKE 5IQ9A 2GSIB 2E6QA 3CZJA 3CSPA 3QEHA 4WJ5A 2XN9B 5LXGL 4OFKA 4BSWA 4JGJA 1CGSH 5JHLL 3DJ9A 2BY0A 5H94B 4OF3A 3T1WA 5JHDA 3H3KA 5IJVA 1YY8A 3C09C 2WBJA 2J88L 1FH5H 4UBDD 3VH8A 1XH3B 1EHLL 3I2CH 3DVFA 4XNXL 4X83A 1J18A 3EYVB 5FOBA 1FORL 4Z7NF 2EDRA 3MGTA 1MWAB 1G7QA 5E08H 3MNVB 4BQ8A 3BGFB 4OIAA 4ZFGL 4ZDHB 1U3ZA 2HP4A 3N9GH 5ISZE 3MLYL 2HKHH 3QUYC 3QG7H 4TRPL 2BVOB 1T21A 2KKQA 4JO1L 4Y2DA 1WF5A 5CSZA 1B0RB 4YX2H 4O5LH 3SJVE 4PJBA 4U49A 5IW3A 5MI0C 2QEJA 4I5BB 1JL8A 3O2DA 5GS1B 5EN2A 4PGBA 4EQ2A 5BW7C 1K4DB 2HRPH 3KPMA 3O4LA 3BDYH 3WJJA 1RZ8B 1VFUA 3TC9A 4HV8A 1AD9A 3X12A 2RQ8A 2NXYD 4V1DD 5IIEA 3MC0A 5BRZE 2HJLA 3T3ME 5K9JH 4XVJH 1I1YB 2H32A 4U7SA 1I4FB 3C9NA 2GT9A 1CXKA 3TN0A 4G6JL 4Y19E 5T5NG 4Y16C 3CK0H 4PJFA 5DWUH 1FAIL 1Q94A 5DQJB 1H8OA 3HUJF 4UQ3B 2EZ0C 3K8MA 3RL2A 5BQ7B 3MCLL 1WZKA 3H9ZA 3CLFH 1F97A 1H3GA 4IDLA 1QSZA 4GG6A 1BEYL 3DGGA 1K8DA 5DJAA 1NMAH 3UTOA 1IGJB 3HR5B 4PRPB 2C9AA 4DCQB 2ICCA 5SWSB 3ULVH 2AJUH 3L5WB 4RDQF 2VOTA 2JIXA 3CPLA 1A64A 3TEUA 1HNFA 1EBAA 4RDQG 5DSCB 3TJHC 3VFOB 3QH3B 2ARWA 5GGRB 1L9NA 3L3GB 1WT5A 1RU9L 2PW1A 5C09D 4P2OB 1VACB 1MRCL 5HYQB 3QFJD 1IGFH 2CKBA 3G08B 1G7PA 1LEGA 1ZXQA 4M48H 4NKDA 4KDWA 4P2RD 1WFTA 1BBJA 1WWCA 2PO6C 4XPBL 3H0TB 2D7TL 4WO4A 4HMDA 2BNRE 4TVPL 1JPSH 1A7PL 1I1CA 2PO6D 4DZBB 2MQ0A 2BK8A 1SM3L 4UT7L 2EDKA 1HCFX 3MRQB 5A16A 5D5MB 2E5EA 5C0CA 3BO8A 5LGKA 3RPKA 1IEHA 4PRDB 3RVXD 4ZFZB 3UJJH 1ND0B 4JM4H 4GBXD 3KXFD 3MRJA 3PGCB 4FQLL 4AQOA 3VFPA 1YMMB 5D4QA 3X13B 5KG9A 1CFTB 4GBXC 4WU5A 2YPKB 3HRZB 2HT2C 1CE1H 2FJFB 2LU4A 4LMQI 5CHNA 3FFCE 3KDMA 1YEDA 5F89B 2RB8A 4APQC 2JCCA 5SWQA 2R4SH 3S5LG 3IFLH 3FT3A 3J8F7 3VRJA 15C8H 5C8JB 3QJFA 3T0EE 3GUTB 5FM8A 3GDBA 5CLTA 1X9QA 1C08A 1PJ9A 4OCLC 4ZTOL 1UXWB 1H3PH 1JNHB 4D9QD 1HWGB 1U95A 4P9HC 5DTFA 5F1KC 1KN4L 3S36L 4K3DL 4PP2B 3HI5L 1S5IH 1KIQB 1MFEL 4JO4L 1CI5A 4L3EB 1T22A 5FYLE 4LSTH 2FL5A 3HZYB 4U1KA 2NY3C 4PBVC 1UB6B 4JJ5A 3IJHB 3MNZB 4G42A 3MO1B 1I75A 3AB0C 3B2VH 2PXYA 2ESVD 3NGBB 4ZTPL 2NY3D 3MRKB 2AW2A 1MOEA 5D96C 2HFEA 2H6PB 1XF5A 5FYJE 5IW1A 5JHLH 1HHJA 4A2MA 1I3UA 1YEJL 4PR5B 1QEWB 3KPLB 3O3DA 1OY3B 4F57H 4WV1B 2W0FA 1BGXH 4LLDB 1DFBH 5AWNL 3DV4B 3IFOB 3MXWH 4C56D 4HAFA 3BGMA 4N0YL 2R69L 3QHTC 5L88H 4PFEA 2EDHA 2R0LH 4P0DA 5CGMA 1KG0B 2J8UB 4OM1H 5GSRB 3S97C 5EIQA 4NCC1 5IJKA 4MB5A 1CFBA 2VDKL 4J3XA 4ZSOB 5JORA 2YD9A 3AS0A 3H9SE 4YXHL 3BKCL 3C09B 5F9DC 1HXMA 4LGRB 3BHBA 4Q9QH 5EOTA 3LSOA 4FXLA 5F6HI 5C92A 3G6JB 2DLIA 4ZFFA 4KK9D 1EZVX 4FQQB 3ZT5A 1J0YA 2Q7NA 2PCPA 2QQKH 4F7CB 4XAKD 1MF2L 3U9UA 5IB4B 5D7LB 5E2TL 4MQXC 3LRSB 1KCUH 3CSGA 5D1XB 2P45B 3FL7A 4NBZB 5D1QD 1N8ZB 2EDTA 1JZ8A 3AMKA 3D69A 4TULL 2UUDH 1KNOA 4L4TE 1W72A 1F4YH 3QIUB 2WBKA 4ZFOA 1EEZA 4K8RL 4QHKJ 4L5FH 4JM2C 3DO7A 3PHQB 2A83A 3ARDC 2C3XA 1BLNA 1HIML 4N0UE 1MFNA 4NQDD 1HHIB 1KYOJ 3ZYJA 1CE6A 1YYML 3QDHA 5A2IH 4X9HA 4I3SH 1Z5LA 1B88A 4NWUH 1CBVH 4WI7A 4TOYH 1C5BL 3KPLA 5J57B 1LE5B 3VWKD 3WUWB 4FQCH 4NZUH 5GZND 5EO9A 2PTVA 4KRPB 2X05A 2ESVB 5SX4I 5E9DB 4OB5L 4RSVA 4YHZH 4LKCA 5L2KE 5I75C 2FATH 3EFDH 3SCMC 2JCCF 3GFUA 3TBYA 3RX5A 3UP1A 1B4RA 5EPMB 2R15A 1G7HB 1NBYA 3MREB 3QFDA 1DBJL 3CFJA 3KPRE 3C2AL 3NIGF 1TLKA 4JVPA 3GSUA 3SDYL 1ADQA 5KVFH 4LSUH 5KVDH 1OAKL 3BIKB 4YUEL 1MCBA 1FDLH 3ULVF 2KDGA 4XPGL 4X9BA 1NGPL 3AXLB 3KYAA 1F4HA 3VMNA 3MUGB 1BFVL 4I77H 3QUXB 5JXAL 4BUHA 3MYZA 5HPMA 5IMKA 3FRPG 4Q0XH 2AXJA 4R96A 2WWMD 1ZEAL 2BNRB 3OL2A 2HTKC 3OR7A 5HI3D 3NPSC 5I16B 1CZ8H 4JY6B 1CU4L 4JFEA 3ZDXF 2LTQB 4MX7A 4M6MH 4DGYH 3CFBB 1JHLH 1YEDB 2I9LA 2W0FB 4DN3H 1B3JA 1QSEE 1YY8B 3K4AA 3VXUD 1R24B 3MJ7B 3P73B 2IBGA 1WIUA 3SPVA 1HHJB 1MRDH 3LKQA 4LRNL 2AV7A 3ZE1F 4NGHL 8CGTA 5IROA 3BRFA 4W4OA 4M6AA 1O5DT 3KLDA 3PGDB 5C0NC 2X1XR 1R24A 2DQTL 5FK9A 2ZUUA 5K9OB 1MUJB 4RFOL 1JNLL 1JYXA 2DICA 2Y6SC 1AR2A 3OJVC 2CUHA 4UNUA 4FQJL 3C2SA 2Q1EA 1KEGH 4G3YH 5TQ0H 3QFJB 1BBJB 3BJLA 3PGCA 3L3JA 3VXSE 5J6HA 1XGQB 3CAFA 2HFEB 1FJ1B 1LO5A 4JM2A 5DJ0B 2Z31D 5CP7A 4OZHA 5GGQL 1MHEA 4EDXB 4X5XA 4JKWA 1G7JB 4XMKL 2DQUL 2XIDA 2C1PA 3C60B 3V6BR 4HJGB 3CVHL 1P5VA 1JGUH 3VA6A 3FAXA 4UT6H 1K5NA 2A73A 4IOIA 3DGCR 2AKRB 4N1HB 3ARDD 4Y2OA 1FQ9C 3SE9L 1OLZA 1WQVT 5D6DC 1MLCA 3HRZA 4ENED 4EXKA 4YEFA 4NP4L 2XZZA 1KTDB 2Z8RA 3MRJB 1NCDL 5EU4A 2P48B 4G9FE 1FNSH 1JPSL 3BH8A 1EAJA 4YBQC 5DEFA 1ZS8A 3HMXA 1RFDL 5CS7A 4ELMA 3QEQE 1KEMH 3BP6B 4N8VG 4DGYL 5GS0L 5D5MA 2DQIH 4JFDA 3ZE0E 1A4KB 4NOBA 2EYTB 1YEHH 4TVPD 4OZIE 4I48B 2FECL 2C4XA 4HEPG 1NCAH 3BRDA 1DQDH 3EGSB 5DHVB 2CDGB 4HULB 1FYTD 4Z7WE 4E0RB 2VDPH 4G3YL 5I9QC 1BQHG 5IIEB 2YHGA 5BOZG 1ZHLB 1D5ZA 4QOKE 5DJ6A 4M5ZH 1RK1B 4XAKE 3T65B 5BVJA 3CXHJ 2OJEB 3K80A 1Q72H 1X7QA 4XBGB 1IMHC 1BZ7A 1Q94B 3T0WA 1KPUA 1JFQL 1DBJH 3U9PH 3ZTNL 1TETL 2P47B 2EH8L 3FONA 5DR5L 4N1EA 4R3SA 2FR4A 4G80A 4ZO9A 5T1KA 5E8EB 2AS5M 3VGFA 3BYYA 2P4AB 3RZWA 4AQ1B 3EKCA 3WDIA 2K3TA 3TVMC 4G6JH 4DN3L 4RRPA 1WIOA 4XHQA 1IC4H 2VISA 5ENWA 4G5ZL 4M5YH 4R97C 5INDA 4PJFF 3WJJC 5FYKD 1N0XH 1QO3B 4MJ2A 3L7EA 3TV3L 1QBLH 3VGHA 4L8BB 5TQ2H 1SYSB 3CXDH 2JB6A 1CGTA 2ZP0T 4CL7A 4K23H 1FL3B 1UYWH 4Z77A 3LCYA 4HWEH 4FQ2H 3OX8B 3WFBL 4ERSH 4D0DB 1F02I 3QNXB 4JDVB 4CU8A 2X41A 4LCWE 4RA3A 1WEJL 1XR9B 1AH1A 4OZHE 2YXFA 3PWPD 1GHFL 4LCCC 2FZ3A 5C0RL 4RX4D 4WI2A 1MWAA 4GKZB 3P4OB 3H9SD 4JG1L 2IMNA 3QUXC 1I8KA 2KQMA 2GI7A 3O8XD 4KI5C 3CSYA 1RZIA 4PJEA 1NMCC 3SE3A 2CK0H 3VH8G 3DBXB 2NW3A 4LGPB 4JN1H 1XMWA 2EKJA 5CZVL 3QSKB 1LO5B 4G6FD 2DS4A 4JO2H 2DM3A 4KRPC 3TO4B 4HGMA 4PJ7E 4IJ3B 5F1NA 2QSVA 3D6GA 1RJZA 3FFCD 4K94L 5EBMA 3L1OH 3MXWL 1BBDH 3W5NA 2Z31B 3MNWB 5BO1L 5SV4A 5D7JD 4KV5F 3FQXB 3E3QC 1ADQH 1MUJA 1BF2A 1BWWA 3HAEG 5CILH 2YD6A 2DTSA 4PRBA 1T1WB 3RGVA 3RWFA 4PJ5B 4X80H 1NPUA 2YD3A 1J8HB 1K8IA 3ESUF 5I8CA 2HT2D 5FUCC 2BHZA 1DL7H 5GGSB 4HBQA 2Q86A 2APXA 1FVEB 4C58B 1T2XA 3SGJA 1CFSA 3HMWH 4O4YL 4Y4FC 2HLAA 2GSIA 4Y8DC 3K2UH 4NNPH 5HYJD 4U6TA 5DK0A 2YMXL 4FOMA 3MODH 1U8NA 1P7KB 3BKYH 1J11A 5IJKC 4GRLD 3U0WH 3WJLC 1PY9A 4HS6A 4BFIB 4R2GC 3HE6D 1KTLB 3QQ4A 3QWQB 4K3DH 4JG0L 2R0ZL 1VGKB 4OM1L 5EORH 1CGUA 4QHLB 3TVMA 5HVHC 3CDGA 4IBLT 1VCAA 2YD2A 5JDSB 2HFGL 4OCWH 5D71L 3OJ2C 3D3VD 4OF8A 3K81A 4ZS7H 2R1YA 1U8QB 5E6ZA 3OJDB 3WYRA 4YDIH 1ZT7B 5D72H 4LFHD 2IH1B 5TE4L 3NIFE 2YD5A 1V7NH 3QEGH 4RGOH 1WZ1H 5GISH 1MIMH 5ISZB 2YA2A 4IOFC 1PEZA 1SJHB 4HH8A 3V0WL 2CXGA 1SMAA 3S96B 32C2B 1S7WA 4PJ9B 1A7NH 2EDYA 2IFFH 1XGRB 3C5JB 4ODUA 1FNLA 3V8CA 1NCDH 5EIIA 5BVJB 2ITDB 2KH2B 4RNRB 1TTFA 1YPZF 2VDRL 1IQWH 4QRPB 2ARJQ 2WZPD 4C4KO 1G7IB 3BZ4A 4WHYG 1M4KA 3VDBA 3RA7L 2FH6A 3GO1H 4V2BA 2Q3AA 3H42L 3LZFL 2AGJL 1C8PA 3D39D 3QJHB 2W65A 3SCMA 2A38A 4TNVK 1MFDH 5DR5H 3DO7B 5IVXE 3EZ8A 1XGYL 3U0TA 1S9VB 1Q9LB 2EXYC 1NCCL 1H3XA 1LE9A 1JPGA 4XI5C 3O45B 4UB0H 4HWBA 2DQJH 5E8PB 2VISB 4FA8A 4WTZG 2OMBA 2NX5E 1NLDL 1UWGL 1ZLSL 4HIIB 2H1PL 5GRZA 2BDNH 4KTEH 3K1DA 2GYSA 2Y07H 4WU7B 3FQWA 1G9EA 4KTEL 2DYPA 1OD9A 3CFCL 3OWEA 5EC1B 1UWEH 4XXDB 2EXWD 4NJ9H 3OJDA 5DJZA 5JW4M 5ISZD 1RK0A 3TV3H 4NRYB 4JFYB 3H6JA 2DL2A 5EOTB 4GBXB 1CDYA 2E27L 5A2LH 2BSRA 2DL9A 3JWDH 4UBDC 1FNGB 2AP2A 4Z7QE 2DKMA 5BRZD 5CJQL 3U1SL 4E41A 2Q8BH 2FBOJ 3HPLA 2VZOA 4LIQH 5GS2D 2DWEB 5CGYC 4PJGF 3D18B 4NQCB 5FUZH 4JFHD 1XGUB 3L3OA 4UUJB 4P9MH 2JJTC 2KZ1B 4KVNH 1P1ZA 4K7PH 3WFDH 2Y36L 5ESVA 1GOGA 5GRUH 4Z95H 3ESVF 4PV8B 1C16A 1HQRB 4YHIA 1AQDB 5I8CB 2VKXA 3GK8L 4Q9RL 3W2DH 1QVOA 3SJVD 2DLTA 5EBGA 2CLZA 5L0QC 4K3EL 3VFVA 1FPTL 1BVLA 5FYKL 1YEEH 5DVNA 2BSED 1UM6L 1YMHA 3JXAA 5AD0A 1UGNA 2V2XB 1PSKL 2Z31A 4YEEA 4LLDA 3F7RA 1MFDL 1VFAA 4K55A 1U2HA 5BVPH 4M00A 5I71B 1UCBH 5KSVA 3MXVL 5JPNB 1VPOH 4S1SH 3MJ6A 1A3LL 1DBMH 1S7XA 3EFFB 2HTLD 3C8HA 5FOJA 4PJ5E 1TQBC 4LHUB 5CEZE 3BZEA 1KJVA 1NGWA 5FHAH 1T4KA 4L4VA 5C07E 5SX5H 3UTTA 1UKQA 1S7SB 2NR6D 4L8SC 5JPNA 2ZKHH 1TQBB 4KVCH 5LGHH 3LB6D 2DJ4A 1AR1C 4G6KH 1A7OH 1I7ZA 3PDOB 2WWKO 2J88H 1BAFH 1FVCA 5I71C 2A6KA 2EDXA 4N0UB 3SJVB 1EFXA 4M6NL 5F9WB 3EO0A 2VE6A 3IF1A 1N4XH 1R3HA 1ZHBA 4OZFA 5C3TA 2H26B 2XN9E 1WJ3A 4F37K 4J23A 4YGAB 3LRHA 3R1GH 4LKXA 3FT3B 3AREC 3BPLB 3VRJB 1PZ5B 1MCDA 2NR6C 1E6OL 4KZEL 4KAQL 3SGEH 1Z5LB 1J05A 4R0LB 4UUJA 4L3CA 2YK1H 4K9EH 1WBZA 1XGTB 2QKIA 2F54B 1KCVL 1MCCA 2L4OA 4JFFD 1JF1B 2JB5H 2NX5B 4LPUA 1HHGB 4MS8D 3L3DA 1RQ5A 3BWAA 4PJ8D 5F6IC 2IG2H 4Y1AD 1YQ2A 4U1JA 5FYLH 1X6LA 3PWLA 2BSRB 1V3LA 4I0PC 5TFSH 1P84J 2VDOH 2FYYB 2EIBA 5HYSB 5GGRA 4KQ3L 3BKJH 6FABL 1VFBB 2X4PB 3ULUC 3SE8L 1JE6A 3LKNA 3NZHH 4OGZA 5TDPB 1EHXA 3R1GL 4PPTA 1L6XA 3ULUE 5DHYB 2Y6SD 1SEQH 1J86A 4KK9C 1D5XA 4LU5H 1WBYA 1QSED 3VFNA 4ODWA 4YBQD 4CJ0A 3JV0A 3BQUB 3MROA 4UU9A 1K8DB 4ETYA 5MHSE 5C0CD 3K2MC 3DTXB 2P8PB 4HIEB 5BO1H 5E9DA 1IGYB 5JUEL 1TJIH 2BSTB 3MV8A 1IC5H 1F42A 2GCYB 4KRMB 4YBHA 1A14L 3WLBA 1U8MA 4O9HL 3TM6A 1JZ2A 4QHNA 3HPJB 5KZCD 2VL5A 2OQJB 3CFEA 3MJ9A 4ZMAT 1MI5E 4I13B 4RMQA 5IK3B 5FHBL 4L3EE 4M7KL 2BNQB 3HI1A 1BM3H 1JHKL 1GZQA 2EIZA 4YHNA 2AK4A 4OLUH 3RVUC 1QHPA 5KSUA 2UWEF 2DB8A 3MXVH 1GOFA 4O2FB 1FRGL 3B6SA 5EZIH 4E9LA 5F96H 2EE6A 4HGKC 4EUPB 2BNQD 5EUKA 3ZTNH 2YKLH 4PJ9A 3GBNH 4RA0C 1OAQH 1AP2B 4MXVE 1MCQA 4PD4K 4PGBB 4LCIL 1VADB 1TVDA 5F7WC 3U83A 4LLWB 4NFCA 3O3BB 1G7JA 5ALBL 4K94C 1OF2B 4PRHD 1DEEB 2V5TA 4NQXB 2NY4D 1NAMH 3IDYC 4PG9A 2Z35A 3WIFA 3WIHH 4AEIH 5FGSA 5D7KD 1X6NA 2VYRE 4PP2A 4JFHE 3S36X 3QAZB 5F7LB 3MRMB 4OGAD 4HFUH 4XP4H 1A7QL 3UJJL 3RJQB 4F80A 1X5KA 1F11B 2MHAA 5IWLC 3MLTA 2K1MA 4O02L 3BFOA 4JQIL 1LDPH 4YDLB 1FZKB 4HZLB 3GNML 4PJBB 3PL6B 1OTTD 3QIWB 2J5LB 3MRLB 5IT2L 2YZ1A 4L4TD 4TSCH 3SGJC 4YAQA 1U3YA 3DNKA 3ABZA 1JMZA 2YPVH 1KC5L 3AM8A 1HHKB 3REWB 4L3AA 3V4PL 1U58B 4UNVA 4JHWH 4PJHA 1MY7A 1T6WA 1MFEH 1KBGH 1KCVH 4EQ3A 1DBBL 3I6KA 4JFZL 2VR5A 2NX5D 1LO2L 1PKOA 5J7CC 4RFNB 3GJFA 4KK6D 4OZ4B 1E0OB 5BOPA 5HYIA 2D2OA 2I60H 2R4RH 3LVEA 4HKJB 1KXQE 2Z4QB 2VDPL 3B2UD 2IC2A 2W9DL 4LLUA 1B6DA 4Z7QF 1ZWIB 3M17B 1RUPL 1IT9L 3LN5B 1BEYH 5IEHA 3X14B 2XN9A 5D93C 5E0QA 3X3GL 1IC4L 3MBEA 2HG5A 1IKNC 2V5RA 4Y4KC 3WUZA 1V3JA 4YHOL 4GW5B 1VHPA 1T83A 1RZJH 1BMGA 2HH0H 1YDPB 3HG1D 1AP2A 1NEUA 2P5ED 4GQPH 5FYJD 4WDIA 2DQEL 1KF9B 1ZA6B 3JWDL 5I1DB 3NACL 3VFVB 5DVMA 3UJIH 1NC2A 3B5TA 1RVFH 4KV5E 4PJCF 4U1IB 4LL9A 4KI5E 1M7XA 3EYSL 4GLRI 5INCA 1CFNA 3FMGL 3LN9A 5K9QG 1T1XB 3VD4A 4HPOL 4MYWB 5TDNA 1QSFD 3O11A 3WNMA 3OG4B 3FO2B 3HPJA 1MCOH 3S37H 2CJUL 3IFLL 3O81A 5EO0A 1NGYA 2FX8H 3NA4A 3K8KA 1N5AB 2DYPD 5C0DA 4XX1G 1YEFL 5ANME 4OCWL 5D1XC 3E3QE 4ETQB 5DRNB 2VL4A 3WKMH 3GSQB 1J12A 1CN4A 5HSFA 4ZNEA 3RWCA 5IWLA 1NCBH 3CVHA 3WSQL 1QNZL 4XC3H 1IAKA 5E4EB 1MRDL 2ITCB 3MLRH 1WAAF 1XF1A 4BZ2H 3RDTA 2E6JA 3O6FB 3PL6D 1U8QA 1RJLB 5JA9A 1QFUH 2WW8A 3L6FB 4S1DC 1IJ9A 1H5BA 2YA1A 3CH1B 4OM0H 2W38A 1N6UA 2AEIT 3V6ZB 1J5OL 1JF6A 3X3GH 4HLZG 4GUPB 2ADIB 3T65A 5KW9L 5IFJA 4GG6B 3VXMA 1CD1B 3MYJB 2V9TA 3VGGA 3KWWA 2DIBA 5CCKH 5D1ZD 3TH3T 4P2RE 5CP3H 1OAUL 5EU3B 3BMWA 4PRHB 1SJVA 5CMAB 2EDBA 5D1ZC 4I9WE 1EK3A 5D96B 4IOFD 5I8EA 3C9NB 2EDLA 4Z8FL 1JRHI 4JEGB 1KCRH 1TNMA 4MAYB 4U1IA 1YY9D 2H45A 5KS9E 3HAEA 4PJXB 4MD0B 4M61B 3WHE1 3AAZA 5KSVB 4MA3B 1T83C 5HXMA 3E6HB 2Y23A 3MRPB 3GMMA 2WV3A 1KIQA 5H35A 4G8IA 2AXFA 2O93L 1T1ZB 5KZCB 3UTTB 1Y6MR 5L9DL 3OG6B 4WI4A 5LCVH 4FTVA 5ESAA 3TA3D 4U1MA 3ZTJH 1MHEB 2IFFL 2HJKA 5CILL 4Y19D 1QG3A 1HH6A 2XXMB 5F9JA 5K9KB 5FYKE 5JZ7D 3X3FH 1NBZB 3BPNC 5EC2A 2AXFB 3BW9B 1QSEB 2OK0L 1MIML 4LVOC 5F6IB 1FAKT 4OZ4A 2N7BA 3ET9F 5JHDD 1QBLL 1PYWA 2DQHH 3MUJA 3WMSA 4UDUB 4L1HA 3O9WB 1KB9K 3OZ9H 5EZIL 5ID1B 3M8OH 2HMID 1HWHB 4HF5L 4R0LC 1EUTA 2V5YA 4H20H 3ULSA 2DIAA 4HCRA 4GAFB 4JRYD 2V6HA 2X42A 2XZAH 4UIKH 5C0AB 3T8XA 3KPNA 4DVBB 3RWDA 4XNQA 2BNQE 5A2KH 3QUZA 1RZKC 4L8BA 1ZT1A 4RZCA 3ZKQD 5EBLB 3IS0X 1R5IB 4RIRB 3MLVL 1IGMH 1IM9A 1AXTH 2AJZB 3TVMD 2PYFA 5E8NA 1GRWA 2UZXB 4WFGE 2ICES 5KANG 1ZANL 4TVPE 5EIVA 4EZMA 4APQD 5IB3A 5BV7L 4EN3A 4XNUL 3O45A 5KSBA 2XG5A 3CH1A 4P59L 3KPSB 1D5MB 1JNNL 2GK0A 4G9FD 2EYSA 1YEHL 4XVUD 1SEQL 4OV5B 2DOCA 3MRCB 4XXCA 1R0AL 1BIIB 4ODHH 3SDXA 3ZL4L 4LOUD 5IMOB 2PTUA 1NBYB 1NANI 1U8IB 5I1IL 4O51B 4M61A 3OBAA 1X5ZA 5MEOA 1N0LA 3NFSL 4HX1A 2J6EL 1Y0LB 1IAOB 5IGXL 3TO4D 1KELH 2G2RB 4JDTH 3LS4H 4BQBA 5AZ2H 1BZQK 1WTGT 2JB6B 1MVUA 5IP4A 4NBXB 2LABA 4U6XA 4X4ZA 1J0KA 4TUJB 1IAKB 4PJGE 5SWSE 1CG9B 1E6OH 3MR9B 4NQEB 4PJ9D 4EI6A 1NFIB 1IFHH 3VWJC 1S7TB 5EU4B 1QRNA 5IMMB 1AD9B 1R3IL 2UUDK 2VZTA 3S8WA 1Z9LA 1IGFL 5E99L 5FA4B 2PXYC 4RISH 4LCWB 1SBSL 3JV6B 3OKKB 3QEQA 1K4DA 2MKWA 3KS0J 2CR6A 2BVTA 4JFED 5CJBA 5E2UH 5DK3A 2E9WA 4PV9A 5CZXC 5MHSD 3L3HB 4NRZA 2YUXA 1BVZA 4W6YB 5IVZB 3IVKB 1FL5B 4L8DA 5DD3H 4I3RH 1A7OL 3C6LD 3VXUE 4P5MB 3SKNA 3HB3D 5C0EB 3VXME 3UJIL 1T21B 1RVFL 3KLSA 3EIFA 4MCYB 5CWSA 1Q9KA 3DWTA 5FHAL 4L9LB 2IQ9L 2NTFA 5DMIL 1AI1H 5DMJB 2HH0L 4MJID 5T5FL 1BFOB 1L4IA 3H3BC 4ZPVA 4D0CA 3ZTJG 1A4KA 1CF8H 4I0PD 3WS6C 1J8KA 1U8LA 2WUCL 5C07D 5I73C 4E42B 1OT1A 4PJ5D 4XGZA 1NBVH 4NT6B 2VLJD 3WLWC 1LNUA 5JHDB 3F12B 1YA5A 4LSSL 3F58H 4W6WB 3MCG1 1MCEA 5C0AE 1ZHBB 3P2TA 4HPOH 5F1IB 4WGVB 4X0KB 1JWSA 3GJFH 2AK1L 2X1OA 5KVDL 5I74B 2HJKB 2C5DC 4KKLD 5F7EL 4M62H 3NFNA 4YBLC 4AYFA 3WL9A 4NDMB 1TENA 4HFWB 3W9EB 3AS1A 3T1FB 2XN9D 5FO8A 5L2KD 2BRRH 3AU1A 4H25B 3ARDA 1K4CA 1HK6A 1PYWB 3MFFB 2C3HA 2XA3A 5IFHL 4X5XB 5KN5A 4JFDE 4OKDA 1T03L 4MXVF 5FUZL 3QCTH 3NFNB 4GKZA 5T1LD 4Q58C 3RA7H 2IBZY 4NQDE 1I1RA 4N0CD 4WW1B 3VFSA 2JJWA 4FTVB 3C6SB 4O02H 1DEEA 3O6FC 4XHJC 3S6CA 2Y1VA 4ZXBA 2IBZX 5HHVH 3O6LH 2FIKB 1T89A 2ZCKL 3V5HB 1BOGB 3K7UA 1ZLUK 5KVGH 5DMYA 3UZQA 1AGCB 2BDNL 1W0VB 2I07A 2BVEA 2YD4A 4DZ8A 1KCKA 3LKQB 2FZ3B 5I18L 4S0SD 1CD1A 3MYJA 4YHIB 4LVNC 4KUZH 4HIJA 5D72L 4L9LA 2YKLL 1EGJA 4WHCA 5HVHB 3GB7A 1OAQL 2BNQA 2F5BH 3FB6B 1AE6L 5I17A 2MQ3A 2EXWC 4ZUTB 4JO3L 3S4SA 2FGWH 1F6AB 3OGCB 2X4TB 3UTSE 5B22A 3IU4H 3WLBB 1DANT 5FO9B 3UPRA 5JTWA 2QJDA 1X5HA 2J1KA 3HNVH 2AXGB 4P2RB 4NRZB 1JHKH 1HINH 1HHHA 4M93C 2BZDA 3LHPL 1LDPL 3VG0H 4JM2D 2VDRH 5ADOL 4XVJL 4GG6E 1KJ2L 3D69B 3LH2H 4A6YA 5TDOB 3Q48A 4ODWB 1NJ9B 1PEWA 2HKFH 4NM8L 3OHXB 4XP4L 1WV7T 1SY6L 2IJ0C 43C9A 2ICWB 4R7NA 3L6FA 2CKBB 5DHVA 5AYUL 2EDNA 2OK0H 5B39A 3FQRB 4A6YH 3X3FL 3PG2A 4E41D 4L4TA 4HKXA 5IQ7H 5H8DA 2YPLB 2XFXB 2WINB 3DSNA 1QZ1A 3SE4A 2OJZH 4NNXA 1QQDA 3DV6A 5GHWL 4U1NA 2HFFA 2IH3A 4F2MA 5JOFB 3RWCB 5GS0C 4P46D 3PHOB 2VLRA 4MCZA 1HHGA 4YXLH 2I26N 3L7FB 2MJWA 4NJAH 1KIUA 5IBUB 1CDIA 5EORL 2GUOA 5ETUB 5DDHB 4Y4HD 4F15B 5JDJA 1S7RB 4B5EA 1GVIA 5JA8B 5M7QA 4QY8A 5D2LB 4NHUA 1PZ5A 2BY1A 4MDJB 5C08B 1WWBX 1XGPB 4HUXB 1QLRA 4ODVH 5IKCB 3G5ZA 2APVA 3QXVA 4OD3L 2Z8WC 5BS0A 1CLYL 1I8IB 4OGXH 4AIOA 2VC2L 4U1JB 1UVQA 2AK4E 3TGXA 3QI9D 3UO1H 2JLLA 5HHXH 4WI6A 5BCAA 4HUNB 1N3NB 1S7WB 3O2VL 2B39A 5FM4A 3NA9H 4MNHA 5D1XA 4LDOB 4XH2A 1FO0A 4R97B 2R4SL 1SJEB 3DXAD 5I1DA 3KXFE 4L4VD 4OFYD 2Y5EA 8FABB 1CVSC 4HKJA 1REIA 1WISA 5FO9A 3UPRB 2NY2B 2FX9H 4LCUA 4XNUH 1YNTB 3VFUA 1N5YL 1YC8A 3BXNA 4J4PA 4QRRE 5DFTA 1KJVB 1NGWB 3GI8H 1AHWB 4FQLH 3WO4C 4AJ0A 4OLXL 1QFUL 4J3UA 1XGQA 1NFDB 3FB8B 2CLZB 3D25A 1GPOH 4XT1C 5LJYH 4EI5D 3C5ZD 3BESR 5F1IA 4PJHB 4IM8A 4QTIL 1IKFL 3P40A 1OSZA 3BEVA 3GMLB 1RMFH 3C5ZC 4J8RB 4JRYA 1PD6A 2A6KB 4ODBD 2CK0L 2EDOA 1JGEA 1RZFH 3TYFA 4X8XA 5C0BA 3WCYA 4DVRL 1BOGA 3QFJE 4QHUB 2BVUA 1VPOL 4PR5A 4XPBH 3OGCA 1BD2D 3VXUB 3DOSA 4YGVB 3MFGB 4PLJC 1XIWC 4DVBA 1ZGLP 1HSBA 3VI3E 2VIRA 2EE2A 4MJ5A 2ADJB 3IDMA 4UIMB 1JUFA 3HN3A 4LHUA 4XPTH 4P3CL 1MSPA 1TZHB 4WW1A 5I9QB 1PKQB 4N9OB 4M7LT 3OPZH 4DTGH 3QO1A 1AO7A 1DR9A 1HEZB 1HHKA 1MCOL 2EDEA 3REWA 4G42B 1XF3A 4BUGA 2WIIB 2NYYD 4U6YB 2YS4A 5D7IF 4TTGA 1OCWL 1R5WB 2FD6L 3RVVD 3ZE2F 3ULVL 2R29H 4WHTB 5J4MA 3PWPE 1AKJA 1BFTA 4LCWD 3OQ3B 1JZ3A 3AAZB 4X6BA 4FQ1H 2IAMA 1CDHA 3SDCA 2GY7B 3FFCA 1EJ6A 2GAZA 4S11A 1X5XA 1LVEA 4ODSL 1FL6A 4LCYA 1Q9LA 4XMPL 4MAYA 4NQED 5T1DL 5T5FH 1N26A 4HUXA 3PUCA 2VKWA 2D31A 4J6RH 5DMIH 5EZLB 5T1DH 4LQFL 4AIXA 2DBJA 1ZT4B 1DLHA 4FFWD 2JIXB 4YWGH 4OLWL 3NVQA 5HDLA 3O3BA 1U3JA 1DP0A 2OL3A 4P9HL 3FQWB 4AG4L 4YQXH 2OZ4L 3AUVA 2ZJSL 4GXUN 1YPZA 5EU5B 1I7TA 4KKBD 5DT1L 3AGVA 5DA4A 4MMZC 1Q72L 1NUNB 4LBEB 3BN9D 4PJCE 4ZPVB 1FV1A 3UTSD 5DC9B 3FHQA 1RIHL 1UWEL 4GUPA 4F9LC 5FYKH 3GMQA 2ED7A 4IS6A 1OOAA 2B4CC 5GGTL 1E4XL 5DGQA 4D94A 2RGSA 1NLDH 1UWGH 4J2XA 4RISL 1LK2B 2ED8A 4MNQA 1OSPL 4NCDA 5C08E 3RY4A 5DHXB 2DBLL 1MJJB 5E5MB 1UKSA 2ZCHH 5F8RC 2QHRH 2FCBA 3M1BA 1KB5A 5GJTH 3CVHB 2XFXA 3VW3H 4ZG1A 1PBYA 1ZA3A 4RNRA 3W11D 1PQZB 1UACL 4GT7A 4GRLC 1Z3GH 2Z93A 4WWKC 3KPRB 1G7PB 3F65A 5JO5A 4KI1A 5JORB 3NPSB 4G7YL 5IG7B 5D2LE 1N8ZA 5FA3A 3TZVB 1OTTC 5MEPB 5DJCA 4QCIB 1S7TA 4M7LL 4GOSA 5ICXA 4HQQH 1WGOA 5I1LB 3PWJB 2VXSH 4JKKA 2NY4B 4MSWB 4RIRA 1F8TH 1UWXH 1PGRB 3F7YA 5DJ6B 2X40A 5DD1L 3PWLB 4MLIA 4C56B 4PGDB 1JBJA 2Z92B 5JDSA 5EDXA 3ZYZA 2DM7A 4LIQE 3O9WD 1XIWD 3W0WE 3ILPB 3ULSB 3I85A 4M43L 1XGYH 1EGJL 4NPYA 3B8YA 4CNIA 5E6IA 4QOKD 4N8PA 4Z76A 1OT2A 3ARSA 2VWEC 3WNKA 4ORGA 1M05B 7FABL 3O3AB 4KWUA 4WNQB 5HGDB 5KVFL 1T0NB 4WW2F 2ZG1A 2CRMA 1URLA 4KMTL 4JG0H 4OCYH 3RZCD 4ZUWB 2WANA 5MENA 2JKXA 3X12B 3I9GH 3QPXH 1ORQA 2D3VA 5IBLC 3QHFH 3ZSSA 1L9MA 4PJBE 4K07A 3CUPB 2H6PA 1ULVA 4PB9L 1ONQB 4LEXL 4NGHH 3UTTD 3W82A 1NGXB 1UXWA 4RGNC 3UC0L 4AH2B 4U1MB 4XPFH 3DMMA 1IEBB 3QA3A 1OP3H 1CQYA 3WNPA 3GSNL 4YBLB 2V5MA 4YPGB 3HC0A 3VGAC 1JHLL 3UTZB 5E2UL 2FL5B 3HZYA 4HHAB 3QXTA 1R0AH 3IGAB 3QQ3B 4HWBL 1CLOH 3U7WH 3ZL4H 2HT4D 4XC1L 4QT5B 3THMH 2APTA 3BVNA 5CP7B 1YJDL 2X70B 1A7QH 2BVOA 1H0DB 3L5XL 3FZUD 2X89A 1YMHB 3VRLF 5C07B 5I8OH 1A6PA 5I19L 3ARTA 2Q86B 4NDMA 4QXUH 1TZHA 3ULVE 1T7WA 1TMCB 2HMIC 4MXQC 2GIYA 1EA9C 1T66D 3P4NB 4NWTL 3OAZK 2GITB 1GZPB 4U1HA 3ARGC 3TNMA 1A8JH 2NY6C 2I27N 5F89A 4U4BA 2P5WA 2YRZA 3LIZL 5HYJA 4GKOA 4YX2L 4GJTB 1R5IA 2X4OB 5IJVB 4RZCB 2CKBH 4NO5B 5IVXA 1YMMA 3ILQC 2F53B 3ARFB 5T33L 3FZUC 4LLQA 3LPFA 1F5WA 3ES6A 2VNCA 4LAQH 4DVRH 4F3FB 3NZ8B 1G7LB 5IFJB 4ZFZA 5T33H 2FGWL 3KPRD 3QUZD 3UYPA 2V5SA 3QIBC 4NRXB 1KCSH 3K8LA 3EO1B 5FFLA 3ZE0F 4EJ1C 2CD0A 4JFPA 3ZKNC 1RIVH 3WFEL 3CFKA 3I2CL 1RJYA 4MXQD 3MRQA 2G75B 2VLKB 5BV7C 3UBXB 4AT6A 1UH2A 4I3SL 1N6VA 4JCLA 1JTTA 2XQYG 4I4WA 1WSST 2AABH 4X8JA 3LEXB 5IW6A 1MHHB 1KPUB 5F97E 3DYOA 1UYWL 4M6NH 5F9JB 5K9KA 4QRRA 4CDGC 4MD0A 3LMJH 4XNMA 3UTSB 1SY6H 1P7QD 4NSKB 1FN4A 4BZ1L 2BY3A 3VGAB 5TE6H 4CUCA 3DVGA 2EKSB 1WFOA 1R6VA 4OD1L 2UZIL 3MOQA 4Q2ZA 3G6AB 3MQIA 3OKNB 1MF2H 5EPMA 5HVGB 4LSQH 2R0KH 1KCSL 1CLYH 1A6AB 4PGZA 3JBG7 1U8OA 2L0DA 3E8UL 4KJYA 4ZODA 2Z31C 1AR1D 2EC8A 1T04A 5ECJE 1KXTB 2I5YL 3OJMB 3VXMB 4JRXA 3BWUC 4X5WB 1KOAA 3PV7A 4X6DB 4ONHA 5IV2B 1VENA 1I1AB 2NLJA 3U36B 3VWJD 4UQ3A 1DQMH 4KROB 5D2NA 4P2QD 3U30B 4PJIB 5HHQB 4NNYA 4U1NB 5FGBA 3DVNB 1LK3H 1MIEH 1MVFA 2Y72A 1NCUA 5F7YC 3GRWH 1H3WM 3LRGA 3HE7C 4K23L 4P2CG 3OF6A 4XB8A 3MACL 5JIPA 2YWYA 1PG7L 3MRGB 3O41B 1R5VB 4TUOA 5JZ7C 4GRWH 4XC1H 3THML 3GRWA 2IPTH 2GK0B 4XAWH 2O61A 4M3JA 4ZUVA 1XF4B 4C56E 1CE1L 3ARXA 4OM0L 2ZUVA 4Z7WF 1H8NA 3TA3A 3UJTH 5D7LA 5EUOB 4ZAKD 4XP1L 1HSAA 5HI4D 3MRDA 2LV4A 5JXEA 3Q1SH 4BH7B 3G6JA 4M7LH 1F90H 4ZFFB 4ZXBC 4HC1L 4Y4FD 5JW5B 3D87B 3AREA 1OWRM 4I0KA 4OGYH 4OUOA 1XFPA 2PO6B 2QTEA 3PWNA 4HK0B 4LBEA 3DYMA 1EX0A 2FH8A 4OI9A 3KHOA 3H7BB 4AZ8A 4OQTH 4YLQT 4ZTOH 1ZAGA 1SY6A 1TTUA 3LD8B 2ID5A 1BVKB 2SEBB 4N5EC 3WXVH 5BXFB 1U3HA 2H1PH 2D9CA 2A73B 1QBAA 2FJGB 4HHAA 4NM4H 4OCMC 5SX5K 1ZHNB 4H1LG 2FJHA 3FQNB 4F9PA 3U0PB 1X4ZA 2P7TA 3MJ9H 2QADD 4MXWL 1S78D 4R2GD 3MUZ1 5F88B 4EUPH 1MCIA 4NO2B 3CH8A 5SWZ