5IWLA

Cd47-diabody complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
233
structure length
233
Chain Sequence
EVQLVQSGAEVKKPGASVKVSCKASGYTFTNYNMHWVRQAPGQRLEWMGTIYPGNDDTSYNQKFKDRVTITADTSASTAYMELSSLRSEDTAVYYCARGGYRAMDYWGQGTLVTVSSGGSGGDIVMTQSPLSLPVTPGEPASISCRSSQSIVYSNGNTYLGWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPYTFGQGTKLEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CD47-blocking immunotherapies stimulate macrophage-mediated destruction of small-cell lung cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords 5F9 diabody
total genus 51
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iwlA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iwlA01
3MA9H 4F7TA 4LCIL 1S7SB 4HLZG 4M8QA 3ROOB 4WCYH 2NW3B 3WHE0 1CT8B 3RHWF 4X6DB 4NQDE 4TUJA 3TA3B 1KLGA 1UXWA 5DFVC 3BN9D 4NRXB 4JFYA 2XTJC 5IM7A 4M7ZB 1SYSA 3BKJH 3WJLA 4XT1C 4Y16D 4N0CD 5AAMA 1CGXA 4CDHA 1VGEL 1OP3K 4XBEH 4OSUH 3UTPD 4M7ZC 2ADIA 4KKCC 1G9MH 4A6YH 1ERNA 2BVPB 3HE7D 4QXUL 4IRZH 4JHAL 1T6WA 2BOBA 3L1OL 1H15B 3QFDA 4ZPTB 4XNZC 2HFGL 4CMHC 2XKSA 4K3GA 4YDVA 2FIKA 4LSVL 4MNQA 2EZ0D 3I50H 1SJVA 3SCMA 4HBCL 1YN7A 1NANH 1YN6A 5GJTL 3RFZC 5JR1H 4JRYB 1LEKA 1TPXB 3FB6B 3V4UL 1RUPL 2FX8L 4MXQC 1V7NL 4KC3B 1V3MA 4PBXA 3BSZH 4LSSH 1KFAH 4RAUB 4WWID 1AO7B 1C12A 2NXZC 3KGRA 5EU3A 2W91A 3HI5H 3QAZC 4JY6A 1S5HB 3K8LA 1CDCA 3V0AC 4LP4A 5CBAB 4JFDD 3HE6B 5DEZA 3EDFA 4KDWA 1P84K 4NUGH 1UG9A 5KJRH 4OCWL 3IB4A 1TENA 4I0PB 1OM3L 3VFVA 5E2TH 2BNUA 4JCMA 1IGJA 1RAMA 4NZRL 4W70A 1JPST 2IG2H 4NM4H 2ZKHH 4Y1AD 1BZ9B 2V5SA 4KK8C 3S5LG 3MUY1 1XGPA 1GHFL 1NDMA 2HJFA 3ARED 3RVWD 3LQAH 3D18A 3EYFA 3O6KH 3QFJA 4OTXL 4YHKH 3QWOB 2EIZA 4FXKA 3GSUA 3AMKA 4KKNA 4NNYB 4KHTL 5KSBE 2FGWL 2EICA 4JY5H 4EQ3A 5D5MB 4NQEB 4LSPH 1BFOB 4P57A 5EPMB 1DBMH 1MFCH 1T04A 4JKPH 2L7JA 4WTZA 5E2VL 3RGVA 3QCTH 4OKVA 3B8SA 4YDJB 4PS4L 3SDCC 5BVJA 1CFQA 4ZFOL 3WS6C 3ARFC 4EI6B 4F9LC 1AP2A 1I7TB 2Z8SA 5TH2A 2A83A 5E4EC 4Q74A 5MP6H 4DKDC 5IT2H 1D5BA 4PJCF 3VFTA 4BK5A 1RUAL 1BVKA 4MS8D 4RFNC 2Z35A 1I3GL 2XPGA 3VGFA 5I1HH 3DUHA 2KDGA 4UIKL 3WO4C 4N0CC 3GUTB 1P9MC 1J12A 2HKFH 3NIDF 2GJ6B 4WW2F 2BRQA 1Q9LB 2H32H 3P73A 4JPKH 4GXVH 3ZTJG 5IFHH 3I9GH 1F2QA 1TZGH 5ICYB 3PWPE 2AV7B 4GS7B 2NY1B 2PW1A 3MRBA 3HR6A 1NCAH 2AK1H 1MI5E 5J0BA 3ARSA 1XR8B 5J13B 2YUZA 4UINL 5E8OB 2XZAH 4DJMA 5D1ZD 1F90H 4P3DA 3X3GH 3O0RL 4JR9L 1FGNL 3NCYS 2VLKE 1LHZA 2B2XH 1MVUA 5D7KD 3S5LB 1C1EH 4F7CB 4WCYL 1WZLA 4LHUB 5LGJA 1VPOH 2Y25A 5ACZA 1A6WL 1RU9H 3OGCB 5DMIH 5ALBL 3WBDA 1TLKA 2LU4A 1N64L 4AIZA 3VFVB 3DIFA 4IRSC 4XNXL 3I6GB 4Y2DD 3KJ4B 4OCMC 2O26U 3TBSB 2Q87A 3HCVB 3DPBA 2VXSL 4X7DC 4E5XB 1F6LL 4MD0B 4PRPD 4XP1H 4JRWA 1FORH 3MRQA 1QBML 3ZDYF 2OJZL 2PW2A 3V0WH 1N3NB 2DWDB 5IF0B 2VR9A 2CLVB 3CFJB 4MAYC 4V1DB 4JHBA 5HGBA 4GMTH 1WBXA 4JFHE 4WU5B 2H9GA 3D39A 1YMHA 1J1OH 4P48A 5SV3A 4NFBA 4PRNA 2UZYB 5DK0A 3ZDZF 1HSAA 4PJAE 2A0LC 4QOKA 5C6TH 4B53A 1PG7W 4NDMB 4YXLL 4PYHA 3GSQB 1V5JA 4BSVA 3JSSA 3I6LD 2LV4A 1T1ZA 2APTA 4HFUL 3H3PH 5JW4M 4PJ7B 3MR9A 4GRWB 3RUGB 2VKXA 3FT2A 2BNRD 4LLQA 1V7ML 4N90E 4EDXA 4RSVA 5EFIA 5GGVL 2BFVL 4B50A 5C0CB 4LLDB 4NN6B 3SO5A 4C57C 4LCWA 1LD9B 4OIIL 2DQIL 1KJ2L 2F19H 3IF1A 2GJ6D 5B8CA 1HZHH 1GGCH 2R2EB 3JTSA 4TTGA 4M48L 1E27B 2X10A 3OL2A 4AJ0A 2YZ8A 3RIFK 4HGMA 2WUCL 1TMCB 3MYJA 4WTWA 3HNVH 4O2FA 1G7HB 4ZO7A 5DRXB 5JIHA 3S9DB 4BH7A 2J8UB 4WFFE 4YDKH 2F9BT 2L7UA 2UZIL 5LGJB 1VFAB 3GHBL 3DHMA 4OLXL 3OKOB 4WO4C 4DTGH 2EDWA 4B41A 4WHDA 2X4SA 4XAWL 3WXVL 2C4XA 4BQ8A 3IDNB 4C58B 3KDMA 2QV2A 4L3AA 4I5BB 1OTUD 5I74B 2F5BL 2RBLA 4H1LA 3RBGA 2IALA 4QXUH 4O51B 4HXAL 2YD8A 4JM2C 2PR4L 1J87A 3T4YB 5B3JF 3VXOA 3VD7A 3QWQB 4XAWH 2Q7NA 2AGJH 1TQCB 3T3MF 3V7AE 3RVTC 3G5VB 2MCG1 3HAEG 4S1RH 3TYFB 5AAWA 1QVOB 3LMJH 4HZLB 1F13A 1YEDB 1YNTA 5GS1A 1V7NH 2H8PA 3O2DL 4G6FB 1FYTB 2LQRA 1MRFH 4QHUA 3VD5A 3VXNB 1IEBB 4FMFA 3MNWA 5SX4I 4PGDB 1G0DA 3WFBL 3A6CH 1YDPA 3NVQA 1FL6B 3LKPB 1Z3GL 5DUML 2A77L 5GRJL 2A1WL 1CD1A 4APQD 1FL5A 2DICA 3SEPA 1Q0YH 4DUVA 1J10A 3VFWB 4XPHL 3VH8A 4OQTH 3QI9B 4GAGL 2P48B 5I1GL 4WGVB 4LASH 3O45A 4DGYH 3VGGA 4JANA 2HYMA 3ZZ1A 3MYJB 1MPAL 1F42A 4WO4A 1LO4L 5E94A 5B8CB 1SBSL 4WW1A 4B7IA 4NJAL 2CGRH 3UXFA 1UM6L 1A2YB 3RDTC 1R0AL 2R1YB 2UUDH 2XTLA 3VFGL 1LO2H 2EO9A 4MJIB 1FL3B 1SJXA 2OR7A 1ZVYA 1I3UA 1KIQB 3L7FA 5DRNA 4H8WH 4XNMA 1OCWH 5JPNB 5B38B 2BSRA 5C9JA 4JLRB 2JIXA 1MHHA 1I8MB 1ACYL 2YK1L 3ARGB 5GZOC 3MRMA 3OZ9H 4ZG1A 1F4YH 2FECL 2F54A 2AK1L 3DX9B 5C0EA 2YR3A 4XH2B 1KPVA 2OM5A 2QQKH 4JGMA 5FYJD 1CFVH 4ZPVB 1T89C 3WIHL 4G8GE 2BP3A 3KXFB 3JTTB 1FVDB 2NTFA 5K9JH 2FRGP 4MAYB 4EQ2A 3KR3L 3MUGB 1CE1L 1QR1A 4WEMB 3VFNB 1RU9L 4X6FA 3UYOD 1LE5A 4N0UE 1N3NA 5JORB 5TQ0H 5F6HJ 4K8RD 3KPQB 3KJ4C 4ODXA 5CIPA 4F57L 1CL7L 1FZMA 1CXKA 4ETYA 1PX3A 3WNNA 2EKJA 3OKNA 1KLUA 4X6EA 2P7TB 3MZGB 5EULV 5HVWA 3HUJF 5T1MB 5DMGD 4TUOA 4Y19A 3VXSB 1WAAE 1UKSA 3MRLB 4G6AD 4RNRA 4F9LA 4RGNE 1UM5L 2VUYA 3CFJA 1CBVH 4QRTA 1LVEA 4XP4L 2ZUUA 1VESA 4JFPB 4PY7B 1UB5B 5D71L 3GJFK 3HZYA 4PTUB 3OKLA 3P0GB 2QL1A 4UIMA 3U0TB 5CSGA 2EDBA 1EH9A 3IJHB 1FAIH 4EVNA 2HJLA 4H1LG 4YDVB 2A77H 4OZ4B 4QYOA 5DURD 4UIKH 4ZSOA 2BVPA 4LPTA 4XWGH 1DBAL 3UJJL 2EDQA 2E3VA 3MROA 1QSVA 1BFVH 4RQQA 1GGIH 1K2DB 1F4XL 2J88H 2EH8L 3UO1L 2BVYA 3P30L 4FNLH 1ZKAA 4DK6A 4WJ5A 5DMKB 3PQYD 4U1GB 4HK3J 3M45A 5BOZG 3MCLL 1UB6A 3JWOL 1NAKH 3FT3A 1X5XA 3DXAD 4D8PA 2DM7A 4OZGB 5GRJH 4ENED 3C9NB 1Q8MA 3FO0H 3NCFB 3V5DA 4HIIA 4HMDA 1S7RB 2VLLB 4YR6B 4P2QB 4M93C 3C60C 4WHTB 1HEZB 3GBML 3JBG7 43CAB 5C0AB 3W39A 3ULUH 3JTTA 4Z77B 2E27H 5F1KC 2EIZB 2B39A 4FXKB 1JZ3A 1KG0A 3MFFA 3DBXB 2FJGA 2OJEB 1A6PA 1DE4B 4NCDA 2PXYB 4HK3N 3BPOB 1NDMB 2HJFB 4NOFA 3BH8B 1MH5A 2DLFH 2VERN 2VLRE 3GJFH 1S9YB 1AD0B 3SDXB 1RZGB 1J5OH 4U6XA 3QUYD 2JCCB 5DZNA 3LH2L 4GG6A 2VLMD 4NQED 5IQ7H 5IBLC 2P42B 2G9HA 3PP4H 1HI6B 4EI6A 1CF8L 4PYGA 3LIZH 2J6EL 3EOTH 4S1DC 1MFNA 5JW4N 3SGKA 1ORSB 4YO0A 5HYSB 1JE6A 2GCYA 3LPWA 5C08E 5JDSA 1JPSH 3AREB 4GAJL 5CD5C 4U1KA 1LEIA 2DBLH 1DFBH 2HT4C 5JOFA 1N8ZB 4P3CH 4YHLH 4NKOA 1KB9K 4M6NL 1INEH 3WFZA 3VD9A 1JWMB 3P0YH 3O41B 3RTQA 3W81A 1MI5A 2YN5A 3CK0L 4KQ4H 4IRSA 5C0FA 5D5ME 3H9SA 3QEHB 3TA3C 3V4PL 1INQB 2V7HB 4NO2B 3KPMB 3TJHC 5CEZE 1MAMH 1DTUA 1A1NA 3DGCR 4PLJC 2YPLA 5A16A 3WN5B 2DMBA 2C3HA 2YEZB 1FGNH 3DIFB 2HKHH 1U8PA 4JRYE 4LSRL 3ZYZA 5IIEA 2ADIB 3M17A 1PJ9A 2DYPD 5CZXD 1UVQA 1NBYB 1LILA 5T1KB 1UYWL 1QACA 1WVZA 2R0LL 4X4XA 1RZKH 1C5CH 1VACA 2ZJSL 5LWYH 4QRUA 4CKVX 2P1YA 5C08B 3S37X 4PJBF 2NY5H 1V3JA 3BGFB 4JZJC 3ULUD 2XKNA 3BDYL 4FZEL 5FDWB 5C1MB 3K0WA 4PLOB 5JPNA 5DO2D 4L4TA 3HS0B 2IANE 1SEQL 5KVEL 3OF6D 4WGWB 4DN4L 4HJGA 5I1KL 5FECB 2HVJB 1CFSB 4QHMB 4ELMA 2DDQH 3TH3T 4WUUE 1FC2D 4GFTB 4H0GA 3FB8A 5IB1B 4P5MB 3GSRA 3L95B 5L7XL 3SDAD 1PG7X 3KG5A 3D85B 2QQKL 4JFZH 4GKSB 3A0OA 3PQYE 5I1DB 2QSCH 2W92A 1JZ5A 4XHJC 4MCZB 3TPKA 4Y4KD 3D18B 3GSNH 2EXWC 1T22B 2Y5TA 4PJFA 5ESQA 2X4TB 5BO1L 4NO0A 4LCWE 2R2EA 4JFPA 5C09B 1X3DA 1EMTL 3TBTA 5DJXA 1Z9OA 3NZHL 2CIIB 3F58L 3F12A 2ZNXA 5DQDL 3ZKQD 5F9WB 1J8HE 1BZQK 2ZSWB 2AJSH 5AZ2H 4NNPL 4J1UB 5GISH 3REVA 1MCPL 4Z76B 5FHBH 1RK0B 1OGAD 2FEEL 4LCCA 4ZXBD 3FOLA 1KULA 2GT9A 3RX8A 4YHZL 3RTQB 2GSGA 1Z0MA 3QDJE 1I7RB 1NJ9A 2R0KH 3U36B 3F65A 1KSRA 2F53A 4OLEA 3KPMA 3VMOA 4HLJA 1YZZA 4ZUVA 3NZ8B 1I7UB 1EGJH 3SO3B 2HJLB 4L3ED 4KKLD 5A16B 4JPWH 3MRBB 2WWMD 5TE7L 2WUBL 2BVOA 4LAJH 1EFXA 1PZ5A 5CBEA 1BMGA 1M05B 4HFWB 2GJ6E 2H26B 5CEYA 3C6SA 2MPAH 1HWGB 2E9IA 5C08D 1OB1B 1WIOA 2AERT 3BIAX 4ODWB 4MMZC 4K23L 1QUNA 3G5ZB 3C6LB 3L3KA 1RZKC 1KTDB 1F4HA 3PHOB 4O58H 4C56B 4AEIL 1RMFL 3HB3D 4FNLL 3P30H 3WYRA 3O6KL 4AL8L 4HJJH 4F7TB 3O2VL 3MJ9H 3WLBA 4XC3H 3U9PL 4MAUH 3IJSA 2R2HA 4YGVB 2VWEE 1P4BH 1Q9KB 1JPFB 4OGZA 4BYHA 3Q6GH 1HOCB 4HGWB 3TO4B 3CFEA 1AHWB 3GMNB 4S1SL 5J1AB 2MCPH 3QIUD 4PV9B 2BRRH 3O2DA 3LKRA 5MEQA 3N50A 4GG6B 5L2KD 2IQ9H 2VAJA 4MJ5A 4QNPF 1KTKE 1KELL 5B4MD 1JPTL 3CU1A 3G6JA 5I1CL 1ORQA 4JZOA 3WD5L 1NAMH 4D9QE 1CXLA 1HQRB 1CK0H 4GBXA 4YBLC 4KI5C 4XZUA 4YUEL 4Z0XB 4DW2H 4RIRA 2AQ2A 4HS6B 3QDMB 3WUWB 3ZKNC 2EECA 1XGQB 5DQJB 4P46A 3NA9H 5D2NC 3TCLA 4K3DL 1LP9F 1A6ZA 2YBRA 5EFIB 3KLHD 3QPQC 4JN2B 3OBAA 4ELME 5HD8C 5DD3L 2N7BA 1LO2L 1M4KA 4XGZB 1INEL 2YPLD 5EIVA 4HIEB 3GRWH 4PJIA 1X5AA 1ZT1A 5DJCB 4Q0XL 1AGFA 4KJWD 4MDJA 4APQB 5ID0A 4U6YB 1BD2E 2ITDB 4NJ9H 1A4KB 4AM0A 1W72H 3UJIH 2MHAB 1BVLB 3ZTNH 3QI9D 1PX4A 1DEDA 3LEYL 4MZ2A 4FQCH 4F2MB 1KIRB 4PJAA 1J0KA 1GYAA 4J3VA 1T1WA 3HB3C 4X99A 3QDHA 4NQCE 1N6QH 4XNUL 3H0TA 3QRGH 2R9HC 1ZTXH 1T83A 1QA9B 4OZIB 3PHQA 2BJML 4Y5XC 1W0WB 3TF7C 2PF6A 3WN5C 5HYJE 1KCRL 3RVVC 1IGML 3MRFB 5CP7B 1QRNA 5MP6L 3ZDZE 4P4RA 1GSMA 1VEPA 4NZUL 4DN3L 1YPZA 4M03A 1SJEA 4WFEE 1KEML 5IMMA 2P7TA 2MQCA 5EZIH 1F58H 2C3VB 4RDQG 4LASL 4Y19B 3AXLA 4K7FB 3G5YB 4LVHB 4MD5B 1SBBA 1NCNA 4Y2DA 1HHHA 4MAYD 4F15B 2CLRB 1BIHA 1DBBH 2ARJB 2DN7A 3L7EB 3T2OA 3W9DA 3PDOB 5ESAA 1CICC 4YGAB 4XAKD 1PKQB 1FG9C 4A2MA 5CJBA 3E1F1 4P5MA 2QSQA 3CFCL 1DN0B 1I3VA 1Z9MA 4AY0A 1KCLA 2FJHA 1EO7A 2AV7A 4ZSOE 2OTWB 4G43A 1QRND 3LKQA 3RNQB 1FRGH 5C3LD 1U3JA 2JB6A 3F58H 4KHXH 5CSZB 4D0CA 3GKZA 3NIFF 5HDBF 3OXSA 1IGTA 2V2TB 3JZ7A 5MERB 3Q5OA 4L4JA 5LCVH 5I2IA 2X40A 1NFDF 4X83A 2XA8L 4HUVB 2DTSA 3VXPA 4I2XE 1IT9H 4BKLA 1VDGA 4U1MA 4Y16B 4JQXC 3NACH 3D25A 3CZJA 4KXZI 2R23A 2BVOB 3EOAA 5E2TL 4P5TA 3PHQB 5GGQH 2K1MA 4HPOL 1U42A 1R3IH 2HLFC 1LEKB 1X7QB 3E2HB 5ANMB 4C59B 1KC5H 5FUCC 1TCRA 3RGHA 1JRHL 1IT9L 5BZDA 3HNTL 3IRZA 1AR1C 4JVUA 4H25A 2V2XA 4HKBB 1FVEA 1R24A 4O4YH 1FE8L 4P46D 5E56A 1OGAB 3T77A 2NY3D 2Y07H 4NP4L 1WF5A 2C26A 3IXTA 1NEZB 3LPFA 1QNZL 3RTQD 1CXHA 4R9HA 1OB1A 1NBQA 5JW4Q 1IC7H 2FBJH 3U30B 1N2RB 3OWEA 2DI7A 3TEUA 1F3JA 3U1SH 2BMKA 5D93C 2NY5L 4Z7VF 5JUEL 3QDAA 1F90L 3X3GL 1MCJA 4YX2H 3LKOB 5IMLA 1IGCH 3O4LB 3PV7A 3C5ZC 4X7SH 5HHPA 5JQ6L 4KRLB 2GJZA 4LLWB 1WGOA 3CVHA 1T4KA 3W2DH 3O2WH 2HRPL 1DBBL 4NN6C 4RIRB 1I7TA 3WFCH 4ALAL 3QDMD 1IAKB 1A1NB 2NY0C 4K8RL 4N1EA 5I8EA 5IB5B 4KQ3L 3F7YB 1NCCL 1UH2A 5FOJA 2EH7H 4JZOB 4RRPG 4NZJA 1RPQA 2JB5H 3H42H 2EDEA 4JPIA 4G6AC 4OZFA 1Q9LA 3QO0B 2W0KA 2CJUL 2DLHA 5EBMB 4RMTA 2V5RA 1NGPL 3AY4C 1M1SA 4NC0B 3MLSH 4WTXA 5HHQB 3DO7B 1FZOB 4QCIB 5IB2B 3RWDA 1YEGL 5D1XC 1NBZB 3EYOB 4RQQB 3AB0B 4NQXB 4RWYL 3OAZH 4DKFH 3CCHB 4YPJA 5F7UA 4MXWL 3K8KA 4JRXA 3G5VA 1SJHA 5DA0B 2YS4A 3C8DA 2VQTA 3C8KA 5JIPA 1F11B 3AC0A 1RVFH 4QKXB 3WFEL 3BZ4A 5IOPA 1Y18A 1CIDA 4ISVA 4MWFA 5IEHB 1AO7E 2RAMA 1XGUB 2X4PB 5IHZB 5AEAA 2VAAA 1YC8A 5C3TA 4EUPB 4GMSL 2NNAB 5I19L 1K3IA 4HW6A 4OZHB 2DQCH 3IS0X 4MQ7B 4W6XB 5FGCB 1ROWA 1C7SA 4JQXA 3JVGA 4GSDH 4QTIL 5J6GA 5DJ0A 4LNRB 2YD6A 4HKBA 4G5ZL 3TNNA 1FNLA 4MB5A 3QEUA 5DTFA 5F88A 1U8NB 5KOMC 1FLRH 5F7MC 1JTTA 1XF3B 1U8OB 2GK2A 5FCSH 5GGVY 2CQVA 5EU6E 1HXMB 2F5BH 1YDPB 3BDBA 5ENWB 4R0LB 2GI7A 3PWUB 2VZOA 3WS3B 2AP2A 1BECA 1OPGH 3G5YA 4E41E 1BGXL 1JP5A 2P5WD 1MWAB 1RJLA 2VDQL 4LCCB 3LKOA 4CJ1A 3LY6A 4CW1A 2DD8H 2VDKH 4TVPH 2GT9B 3HPLA 5FKAB 1WBZB 3LKSA 4ZD3L 4PLNC 1GL4B 3QUYB 3ARVA 3REVB 4POUB 4ZFGH 4KUCD 3HNVL 1OT2A 3TJHD 1KJ2A 1TNMA 4PRIE 5EZIL 1KXQE 5FYLH 1T0MA 4XPTH 2ED7A 5I0ZA 3QXTA 5CJOL 4WNQA 4LRIA 1H3XA 1FQ9C 3OAZK 4OLXH 3Q2CA 5FHAL 4YHYC 4LHUG 4U1HB 4PRDB 3U83A 5K9KB 2FJHB 1YC7A 2RQ8A 2X4UB 3IXAA 1IBGH 1FJ1B 3O41A 4HX1A 1NKOA 5I1AA 1SM3L 5KVFL 2R1XA 2PO6A 3VFNA 3ZO0A 3UTTD 1OPGL 1G7IB 3B9KB 1DL7L 3QUKB 1UCBL 1Y18B 1WT5C 4ISVB 3NH7L 4O5LH 5IEHA 4NO5B 3E3QE 2R23B 1FYHB 2EXYD 4NQDD 4FHBD 1YA5A 1JHKL 1BQSA 4HSQA 1WWWX 3IJSB 3T09A 2YD2A 1X5ZA 5C7XL 4O02H 1YEIH 5F7EL 5IR1A 4MWFB 4W68A 3GI9L 4N0YH 1LEGA 3SE8H 1QP1A 1A02N 4KI5D 1XIWA 1A21A 5HHOA 1SMAA 4NUJB 4HDIB 2MKWA 3G6JB 5EDXA 3VXMD 3IAQA 1Q0XL 2XRAL 4LLMB 2WIMA 4OFVA 3TVMA 4BUHA 3KS0J 5DSCB 1TCRB 2AJYH 2V2WA 1JNLL 5DJDB 4MJ5B 5K9JL 4XPGH 3RWHA 1MCOH 1T0NA 4PIRF 5D5MA 3QRGL 5L2KB 2IC2A 1MRCH 1H8SA 5HHVL 3EJYD 4FFYH 4CN1A 3LB6C 5JO5B 2CR3A 2QR0B 2XQYK 2I25N 4YHLL 3BUYB 5F93C 3X17A 5GPRA 1AGEA 1ZVHA 4X5WA 4YQXL 3NABL 3P9MA 1MAJA 4GLRI 3NN8A 3PWPA 4M02A 4I3RL 3RKDD 4JN2A 2IANA 3GI8H 1CG9B 3M1BA 3NPSC 2G75B 5EOCJ 1NC2B 1IZKA 3EDEA 4M43L 5H2BA 2CK0H 1UM4L 2C4FU 1RURH 4F2MA 2V7NA 4D9QD 2ARWA 1URLA 4PGCA 1QSFB 4PR5B 2DB8A 4RFNB 1J05B 1DVFA 5FCUH 2ZG1A 4OIBA 2X1OA 4O2EA 2PO6B 1HHJA 5D7LA 4UUJB 5EUOB 2BNQE 5K9QG 1Y6MR 4ZMAT 5ADOH 2J4WH 2APFA 3KYAA 4HUXA 3C8KB 4MJIE 3OKKB 3V79C 2PXYA 1F3DJ 4GRLB 2FO4A 2X70A 3ARDC 2NY2C 4HF5H 1QFWH 4NUJA 2C3WA 1MY7A 1UGNA 3QISA 5TFSH 4GW1A 2DS4A 4MZ3A 3FJTA 1MCWM 5FYKD 3IETB 2NY0B 4NT6B 1L7TH 5E6YA 3VXMA 1BZ7B 5BJTB 4FTVD 5C09E 1DQDH 5F1NA 3QG6B 5JMOC 4WV1B 2DQJL 2Y72A 4I1NB 2CDEB 4PJCA 4UT9H 3BT2H 3GEWB 4JO2L 4BZ2L 4OKVB 4YDJA 4R96B 2BSTB 1RHFA 3C5JB 1EO8L 4HUNB 3U0PB 1VB9A 3OF6A 5F7DA 1PVHA 3D2UA 3GM8A 3HZMA 1DN0A 2DQDH 15C8H 4Y0GA 2D4DA 3O6FA 1DQJA 3R1GL 4K94C 3G04B 3VRJB 4UZGA 3P4LA 3VI3E 2ED9A 3MRHA 4PJDA 5IHLB 3OXRB 1M7IB 1HK6A 1FFOA 5FV2A 1ZANH 3VI4E 2AEWA 2QBWA 4R2GB 1BGXH 15C8L 2YEZA 3FZUD 4R6UA 5I1LB 1ZA3B 1M71A 1GGCL 5I2IB 3N0PB 3MRNB 1JN6B 3WNPA 1NBYA 3H9YA 4U1JA 1RQ5A 4I4WA 4MVBC 4LFHG 4PJGE 2AEIT 1MFEL 3RIFF 3KPPA 1XAUA 4JKLA 1CZ8H 3BYYA 2OK0H 5GGVH 2FX9H 1AC0A 1AQKL 2R9HD 3S37L 3QAZB 1ZHNA 3O3BA 4XNYL 1EHLL 5T1KD 1CQKA 4NKMB 4MDJB 1TZHB 1X4ZA 4HH8A 4RMVA 5C0IB 3MV01 3VXTA 1S3KH 5FYKH 5H94A 4DZBB 5ISZD 2YRLA 5D1QB 5HY9B 4FQLL 4I18A 5F7NC 5LKNA 4WO4D 2QQNL 3L5HA 4QHNB 5L7XH 2CDFA 4XP1L 1JZ6A 4JO4H 3RL2B 1ZEAH 4PBVC 2I9TB 25C8H 4Z77A 4P0DA 1BFVL 1D5MB 2AJSL 4E41A 4FS0A 4U05A 2XFXB 4JFOB 2A6DB 3VXMB 1ES0B 1EV2E 3O4LA 4HZLA 4LHQB 4G8FB 43C9B 1T03L 3RQ3A 2FSEA 5IR1B 2IAMB 1JGDA 4HWNA 3REWB 3OAYH 4WI4A 4MNHB 3ZKND 1EERB 3RNKA 4PJXB 1NMCB 3MBEC 5E8PB 3DUUB 4G8EA 2HFFB 2DM2A 2MNUA 3F8UB 3O45B 4PP2A 5I8EB 3EYSH 4JANB 5E6ID 1KTLA 1WTGT 4OF8A 2Z91B 1KNOB 3ZKSD 5CGYC 1DR9A 1DUYA 1CD1B 4FXGB 3WEXB 4CADA 5GS0C 4JM2A 4KTEL 4L8BB 1D7FA 1NCWH 1E6JH 2IAND 1CGVA 3MV8D 4OQTA 4MB4A 4XNUH 4ZXBB 5BV7L 1X5HA 5HBBA 3ARWA 2EE3A 4OZFB 1HH6B 3RZCC 1IM9D 1CGSH 3STZA 3GSVA 3P9LB 3WKMH 1MRFL 1WCBB 1QLFB 4OT1H 2IBZX 2VXTH 5E2JA 1G7HA 2R29H 2CO7B 3EDKA 3L3GB 1B0RA 1MLCA 1MOEA 2NXZD 2FWOB 1KTDA 4L29B 1JN6A 2W59A 3PWPB 3HNSH 2D4FA 1PKOA 3ARBB 2BRRL 1HQ4A 2PKDA 3BIBX 3LIZL 1ETZA 1MIEH 3LHPH 3FFCD 5HY9A 3ARDB 3GSOA 2R0ZH 4UI2A 4MAUL 1YQVH 3RVUD 4D9LH 4H1LB 2P8LA 2EDNA 2ESVD 4GW4A 3CAFA 2Q86B 3CH1A 1QPPA 1QD0A 3K8MA 4PJBA 2B0SL 4L9LB 5EA0H 1J0JA 2PO6C 4KMLB 1MCRA 1F5WA 2ICES 4RGNC 3DI3B 2V6HA 4LRNH 4PY7A 5JXAH 4BZYA 2FX7L 1QO3A 2Y36L 1YEEL 4WV1A 1G7PA 1WBZA 1JPGB 5F89B 3U30C 5DD6A 3QUYA 2FGZA 3I6KA 3BD3A 4WI8A 5DVMA 1AXTH 4NT6A 1K5NB 2R56H 4DUWA 1CDYA 4MHHI 1NFDE 4TYUA 2EYSB 2I60H 1AHWC 3EYUL 3L3JA 3RZCD 4PUBL 1D6VH 3I50L 1DANU 5IMKB 5F3HA 4QHLA 3U6RA 2P5ED 3O4OC 4CADB 3L3OB 5K93A 1LQSR 3KYOB 4KTDL 2GY7B 4TNVF 2YWZA 4LSDA 5D8JL 5C07A 2HFEB 1WFOA 4OCNC 1YPZF 3BAEL 5DK0B 5H35A 2R1XB 3C5JA 2CKBB 2GJZB 2P24B 3IDMA 3BN9C 5ACMA 1BAFL 2H32B 1S7VB 3H3KA 5C0RL 3DYMA 4F80A 5CWSA 2R4SL 3C6LC 4JDZA 3M8OH 5J56B 5KVMC 1A4JA 5DRNB 2OBGA 1CXEA 5E99H 1I1YA 5E24E 4ENEC 4AMKL 3HRZB 5IP4A 1D9KC 4OI9A 5IFAL 1A22B 2VQ1A 4H5SB 3UTQA 2A9ML 2N1KA 3QUZB 2DQUH 4HKXB 2ICCA 4LDOB 4PRID 5DHVH 5FA4A 3I6GA 1OWWA 3ARRA 3DX7B 4K2UL 5IB2A 1L6ZA 3IDGA 1E6OH 1M05A 4HFWA 4KUZH 2X89A 4P4RB 4U6VH 1EHXA 4JCLA 3S4SA 2P46B 3KPRA 4JHAH 4IJ3B 1X4YA 4PGBA 5DUBA 4QHNA 3DLQR 1JNJA 3BO8A 4I48B 3ZDYE 1PQZA 4KZDH 1BJ1J 1X5LA 4IIQC 3DWTA 3B9KC 4HEME 4GKZB 1MUJB 5M7QA 4KVCL 2EDXA 4ONGL 1H0DB 4MNQD 4PRAA 5TQ0L 5JR1L 3FT4A 4TUKL 4WUKL 4LPUA 2F53E 2VLRA 3KYNA 1K85A 12E8H 3KLSA 4WEUD 5HVGB 4NQDB 2EH7L 1RIVH 3L6FA 5D9SB 3RWHB 4LVHC 1JPFA 4M8VA 5DJ0B 5MI0C 2ZUSA 4Z7QE 2N4IA 5HHNA 4OI7A 4IRZL 3VWJD 4HPYL 2Z92A 2GW5A 3RGVD 4M00A 4X6CF 1FYTD 1TXKA 3TH4T 1KGCE 5CP3H 5J89A 3UYPA 4BSJA 5IROA 2KZWA 1YYML 2DJ4A 2YHGA 4J3OC 1AGEB 3THML 4X5WB 2QTEA 4S1QL 2IAMA 1QG3A 3MLVL 4DZ8B 3ZSSA 3FQUA 2O5ZL 2Z8VC 2BNRA 3ROLB 4R90H 3BP7A 4DFHA 4L4VB 4IHOB 3VD4A 3QNZB 5HJ3B 2WNGA 3D0LB 5D6CA 1QSED 2EIEA 4ZXBA 4BA8A 2JTDA 4UT9L 1PSKL 5E2VH 1NH6A 2CKBA 2DF3A 2AJVH 3KHOA 4S0TD 1RURL 1MJ8H 3QUML 3FZUC 1FE8H 1EXUA 2H2PC 4ODUA 1ACZA 3V0WL 3AAZA 1B6DA 1Q0YL 3S35L 3U2SA 3PJSB 2B20A 2ZZUT 4EJ1C 4PJFF 3L5WA 2DTML 4KH2A 1RZJH 4LLYB 1CDUA 4KHTH 3VXSD 1WT5A 3JUYA 5HGAA 3FN0L 4TRPH 1DBJL 4JKPL 4PFEA 5EOQH 4P2QA 1EHLH 5E94B 4F58H 1R5VB 3QEGL 1BZ7A 5BJTA 5GSRB 3W39B 3TJEH 2NR6C 2IPKB 1XCTA 2BNRE 2WLYA 1U8KA 2B4CL 2HRPH 5FV1L 3LQAL 1JHTB 1K6QL 3MJ8A 4QXGH 2RFXB 4CMMA 3RL1A 1AXSB 5HYJA 2YMXH 4JHZA 4OFYA 1MLBB 5IMLB 4BZ1H 3QXAA 3ULUL 1C5BH 4N5UA 5ILTH 2BVUA 4Z0BL 1OAXL 2VZ1A 2W9DH 3LRSB 4WIQA 3D2UB 5IFHL 3GSRB 3L95A 1VSCA 4AIXA 3HAEH 1FLTX 3OB0K 1NL0L 1KJ2H 5E8NA 3RU8L 4UOJA 1GIGH 5I8CA 4R96A 4U7SA 3MBXL 4K3EL 4U7MA 4N8VA 3WFBH 4D94A 5J9PA 4QEGA 4AEFA 1R5IB 1F8TH 3G6AA 2VDRH 5IGXL 2Y07L 3O4LD 4NP4H 1SYSB 2IPUK 1DBJH 3HPJA 3SE3C 1ORSA 4ZFGL 5GJSL 4LGRB 3ZYJA 2LFGA 4KGLA 2OQJA 3B2UD 3TJEL 3OPZL 5F3HB 4FTVE 5C0BD 4JFFD 4IRSD 4U1JB 2PYFA 3BPOC 2C5DC 5IB3A 4FG6C 2UVFA 5F6IB 3IFPA 1U6AH 5CUSH 4I77H 3DUSA 4HMEA 3MV7B 3GK8L 5IMOA 3LB6D 2FATL 5SV4A 2ZSVB 5BVPL 5D7SL 1N5YH 1IKNA 1IGTB 3UTOA 1CYGA 1ZGLA 4U3XA 5DWUH 3M17B 4U0QB 3KPSE 3GMOB 5J6GB 4W4OA 5DJ8A 1A1MB 1SYVA 1HKLL 2OI9C 5F71A 3RWGA 2H2PD 4WDIA 4EUPA 2F58H 2UZXB 3CSYB 4POYA 1U8NA 2G60L 3VGDA 3WLBB 2DD8L 3ESUF 2K3TA 1JVKA 5DJ2A 3EIFA 1CGUA 4JFOA 1T0PB 3EO0A 5IQ9B 4L4TB 4G8FA 2ZJSH 3DMMB 2BC4A 3EFDL 1BLNA 5HYQB 3FRPG 2WIIA 4HQQL 3UTPE 3BP5A 4HJGB 2IPTH 4F8QA 3CSBA 1D5MA 3O3AA 3RNKB 2HVJA 2GYSA 3MMEA 4P57B 1N6QL 2JB5L 1ES0A 4R7DA 3FT3B 4TNWK 2CRMA 3U9UA 5JHDA 2BVEA 4AIZB 5KTEH 5J11B 3GZKA 3UPRB 1HYRC 1NBVH 2X2YA 5K9OA 3MUJA 4MD0A 3VGEA 3BHBA 1H3TA 2DQCL 4LRIC 1LDPH 2LU3A 3CVHH 3IKCA 4N8VB 4S1SH 4EIGB 1D3CA 4PG9A 1IGYA 2Z31A 2VXVH 3MBXH 4TTDD 5GRWA 5BS0B 4HPYH 2E7MA 4F33A 4C83A 4QLRA 1UCBH 4KK9D 4KRPB 2WWMC 4Y5XA 4MDIA 1J86A 4U6YA 5KS9E 4HK0B 4PJ5E 1FAKT 1OAXH 1OSZA 2OXGA 1YEIL 3MGAA 4GG8A 3GBNL 4P4KD 2HH0L 5H37G 1WSST 3GSXA 3RX7A 4OLVL 1D5IL 1TVHA 3ZE2E 1JGVL 4FQXD 4Y5YB 1B0RB 1BAFH 3EBAA 1XR9B 3ZTJH 5DHVA 1ZT1B 1R3KB 5I17A 3QPXL 4JM2D 1Q9WA 1CCZA 1KOAA 3CC5B 5IBLD 1X6NA 2GCYB 3GMMB 4P9HC 3LZFL 3WUWG 2ADJB 3VWJB 3CLFH 4QHKI 4UAOB 3BEVA 1WFNA 2HLAB 5I1JL 5E2WH 5I16A 3T0EA 3KPRE 4OCRH 4U33A 5DJ8B 2H26A 5CEYB 1QR4A 3MRKA 3EO0B 4FTVA 2JJUA 3MLWL 5A2IH 1WIPA 1OP3H 3VFOB 2V2WB 2WUBH 3SKNA 5BW7A 2XA8H 2OXHA 2VDNH 3HTLX 5D2NA 1G9EA 4H8WC 4L4TD 4QRRE 2FHCA 5JQHC 4P23A 5HDOA 5EU7C 2BHZA 3PWPD 1A14H 2CIKA 4RMQA 5FM4A 3LN4B 4PJDE 4JN1H 4UT6H 4DGVH 1E0OB 1IJ9A 1Z5LB 3JV4B 2OSLA 5DJDA 1TQBC 3DXAE 2FB4L 3HE7A 1YPZB 1LO3H 3D39E 1P7KB 3B5TA 3MLSL 3ARYA 3PDDA 4M62H 3V8OA 4Z8FL 4XHJD 4XWOC 4X4XB 1QZ1A 2IPKA 4I8DA 1FIGL 3UDWC 3I85A 3MRJB 4M6OH 5DI8A 3QHTC 5AZ2L 3NPSB 4ONFH 5IMKA 2P8MA 2Z4QA 2QQQA 1DVFD 4V2BA 3KPSB 3RWEA 4C54A 4G43B 1ZLWK 1S5IL 4BQ6A 1JF1A 4YHMH 3ZHKA 5A2KH 3TVMD 4KTYA 4JAMB 4OD1H 1MCBA 4IOFC 3HUJA 2A9NH 3BPCA 1IGIL 1WAAA 4I9WD 5FB8A 1JWMA 1D9KA 2IPTL 5HYJD 1LMKA 3QIUB 3WFHB 2UUDK 5IVOA 4JQVA 4EBQH 4UUJA 3UTTA 4GKNA 3QEHA 5T3XE 4NFCA 4G42A 3QUXC 5ESVA 5IEKA 1MIEL 4JDVA 4P4KB 5LGHH 1F4WL 1R3KA 3QIBC 3FQTB 5HGDA 5IBUG 4NRXA 1KJVB 3O8XB 2F15A 4CNIA 3ARFA 4K55A 3C08L 3OG6B 3V52H 4APQA 5ID0B 1A4KA 1S9XA 1T83C 3SDCA 2W9EL 5CCKH 1CU4H 3ZT5A 1U91B 5GGSY 3S34H 1D5IH 4U31A 5D7LE 3O6LL 2O5ZH 4P23C 2BOBB 2VIRA 4EI5B 3L3GA 1W72L 1NGPH 3VXOB 4GKOA 1H0DA 4PRAB 3ARBA 1AKJB 5SX5H 4KDTC 4QT5A 4DN4H 2E7BA 1CLZH 2IQAB 3DX6B 4W6WB 2XZCH 1NCDL 1NGWA 5GHWL 2HA1A 4G3YH 3S36L 5BZDB 2DQFB 4GAYB 2AXGA 1QLRA 4I3RH 1A7QH 2Z93A 5D70H 3ZL4L 3FB8B 5IB1A 3U4EB 4XX1E 4JKMA 1DFBL 1DVFC 1Z5LA 3QXUA 1NFIA 2R1WB 5CGYD 3CH1B 4XBGB 2FEDC 2YUXA 5DZOA 1FGVH 3CXHJ 3V6OC 3KXFA 3QXDA 3VG9B 4LLWA 3ILPB 3P11H 4NM8H 4L4VE 2AKRB 4RZCA 3BHBB 4LCUB 3ULVF 3O3AB 3OMZA 3BP7B 2P5EA 1U95A 3QNZA 1T7ZA 1EAPA 3MGTA 4LKXB 3QQ4A 1UWGH 3D0LA 4CN6A 2WW8A 4PPTA 4Q9CA 1OD9A 3QZWB 4MNGE 1U3HD 1UJ3A 3F6LA 3VFSB 1I7ZA 3J7HA 4X6CE 5D7JC 2NY6D 3QEQD 1KN2H 2YSSB 3IFLH 3LKQB 4CVXB 4NBXB 1BOGB 4UV7H 3BPNB 4FQQB 3WIHA 4LOUC 1UB5A 1AQKH 1IGYB 2DMCA 4IRJA 3HZYB 4ZFOA 5C07B 3NZ8A 1I1FA 3QUXD 4K9EL 1R5WB 3FB5A 4OLYL 3V0VB 3ARPA 3HI1B 1JGUL 4G9FB 3B8YA 5AG9A 1W0YT 1FCGA 3PIQB 1HILB 3NGBC 1M6OB 1GAFL 1DQLL 4UBDD 3FN3A 4LBEB 1MREL 5B8CC 4ORGA 2LVCA 4YWGL 3NA4A 3QQ3A 4YLQT 5FGBA 5DHVB 1MJ7H 3WNOA 3EDJA 4HWBL 1G1YA 4WENB 3OKKA 3CUPA 3QDGE 3DGGB 2AXHA 3I2CL 2KL6A 4E41B 3MOAL 1FNFA 5EOTB 4X5LA 2CUHA 3ALPA 5I8CB 5I30H 5BVJB 4QTHB 2LE9A 4DFIA 5FYKU 4LSUL 1IRAY 3UJJH 2W60B 3LRSA 3RZWA 4PG2A 1C08A 1UYWH 3VFOA 1Q72L 1A0QH 1BX2B 1PYWA 1NSNH 4YDIL 1HXMA 3WV0A 4LLUB 1H3PH 4ZAKC 3QSKB 3L3HB 4CRPA 4X8XA 1A9BA 2XN9B 1IMHC 1DQML 5D6DC 5D7JA 3ZHLA 1MY5A 1GPOL 5T3ZL 4L8BA 2XV6B 4WHYH 4TSBL 3DARA 2DKSA 4WNQB 1LDPL 3M07A 5IB3B 1CD0A 4OUOA 1AGBB 3NBNA 4HC1A 3VXUD 4PJ5B 4Z95H 3SDXA 1HH6A 3U82B 3PL6A 3TCLB 2O5YH 4NBYB 2YBRB 3BKJL 1CD9B 1QLFA 1FFRA 1YEKL 4Y1AE 1O5DT 2I07A 2Y06H 3KPOB 4EDXB 3DUSB 4JPIB 3TNMB 1GCFA 1DUZB 4G7YL 3CJJA 4JFEB 4ZUWB 3OGCA 3H9HA 4JFQA 1RIHL 1DQQA 3H9SE 3PGDB 2NXZB 1JWUA 1VFBA 4QY8B 1RZKL 3IDXL 3VU2A 3EKCA 2QSTA 3LH2H 3OJDA 5DGRA 1MCSA 3GSOB 1S9VA 1KIPB 1R6VA 4PJAB 2VZUA 2UWEA 2P8LB 3WIIH 3KPPB 2DQGH 2ENSA 5CZKA 1EXUB 4R2GD 4Z7WF 5HSFA 3DGGA 4PJBB 2X4QB 1XF4A 1GC1H 4PRNB 4LEXL 2YC1B 3QIBB 1YY8B 5TJWK 3GJEA 4J3SA 2A2QT 1CVSC 5F9WC 3LS5L 5J6HA 3VDBA 4UV4L 2W9LA 1C12B 2MSPA 2D9CA 5EU3B 5GSVA 3QIUC 5LGKA 1QSZA 5AZEH 1IEAB 5IMMB 2QADB 2WINB 4M6NH 4Y4HD 5EC2A 5EO0A 5FUCE 2ZCHH 4JR9H 5JO5A 3T0DA 3CX5K 3T3PF 2GAZA 2Q7YB 1IC4H 1MAML 4KKAC 5DSCA 5T1LA 3N1FC 4Y4FA 1SMOA 5BS0A 1BZ9A 4RMSA 4AT6B 1YMMB 2DQFA 1KACB 3X14B 1FIGH 1IILE 1I3RA 3QWOA 3MLXL 5IW6B 4NKOB 4URTB 4G8EB 1A1OA 5EUOE 5BV7B 4C83B 1FYTA 3I84A 4OV5A 3D2UD 2Z91A 1RZ8B 4KMTL 5I30L 2IF7A 1I7ZB 3FFDA 3RPIA 4X6DA 5CSZA 4JREB 3H9ZA 3NIFE 5HDBE 1U95B 1AGDB 3KPTA 2Y5TB 5ESQB 5LQBL 5FA3B 5MEPA 1FO0A 2PTVA 3VXME 5CLWA 5MERA 1KB5B 1XR9A 5EUOF 4HCRA 1MQKL 3N06B 4HC1H 3MNZB 1EEZA 3LD8C 4N8PA 4I5BA 4U1IB 3PL6C 1WBYB 4IMKA 1I9RH 1WAAF 2YA2A 3OX8A 4HHAB 5IB4B 5D2NB 3DV6A 3B9KA 2C1PB 1P1ZA 4UNUA 2X4NA 2XY2A 1EZVX 4ZNEE 1IAKA 4MA7L 1AH1A 1J8KA 4HWEL 1MF2H 1KT2A 3D69A 4ETQA 1N5AB 3TO4D 4NYLA 4H0IA 3EJYC 3L3DA 4QRQA 1D6VL 3QG6A 3KXFD 3ULSA 2Y36H 1MCPH 4KKAD 1IL1A 3HE6D 3O3EA 5HHOB 2VDMH 1O7VA 4J3XA 5EO1B 3K81A 1QFWL 3EYOA 4I0PD 1KN4H 1IGJB 4PJCE 1N2RA 5HPMB 4MXQD 3SDDC 4LEOB 5A2JH 1K8DA 5K9QI 4Q6IB 1BIIB 4X9BA 1PYWB 1K8IA 2J4WL 1HINH 3HMXH 4JY6B 4L8SA 3V5KA 2GIYA 1DANT 4GJTB 3SJVA 3CLEH 3RVWC 3QIUA 1IVLA 2UWEE 4M7LT 4DGIH 3ULUC 4G3YL 1M7IA 4N1HB 2LAAA 3AVEA 5ESVB 3BUYA 4YC2C 1J1PH 5HHVH 4LLVA 4WEBH 2Z8RA 5IKCA 2O5XH 3O8XA 4FQHA 3IDYB 1I7RA 4GKNB 5GRVK 2F54E 1H9VA 2BSRB 4JJ5B 1SEQH 5KVEH 4OFIA 1RUKL 1T7VA 2XPGB 1GGTA 2BJMH 1T21A 3WNMA 3ZYOA 5I6XC 2OTPA 4MYWB 1JGEA 1E4XI 3C08H 3V52L 5I66A 3WIHH 5C70A 2BDNH 1RULL 5IG7B 3SDAB 2CMRH 1E6OL 4FZEH 3IJYB 1JF5A 1Q94B 2NY4C 1KTRL 2B2XL 1RUKH 3IAGC 6CGTA 4ELKA 2NXYB 4XTRD 4UDTB 3QFJD 3MO1B 2EXWD 3HRZA 4YEEA 4QRQB 3SGDI 5C0NC 3N1GC 3NCBB 4JQIH 1UXSA 5CINH 1WK0A 4QNPE 3RKPA 4EZMA 4OZIF 1GZQA 5DJAA 2V5YA 1UT9A 4UOW1 4OZFH 4PB9L 2HLAA 4PRDA 2XZCL 1UM6H 1JZ2A 3VA6A 2X09A 3FAWA 4HXAH 4PJEB 2MHAA 4RRPA 3MRKB 3LEXB 4HIIB 3GIVB 4I3SH 3GMNA 3QQNA 4QRSB 1X5JA 3DUUA 4Q7DA 3GO1L 4WHTA 1NCTA 1ZLSH 3T4AA 4KY1L 1OQOA 3ULVC 4PP2B 4ZAKA 4JPVL 3BKMH 5GIRB 2EDDA 1NC2D 2XFXA 3FN9A 3WFDH 5HHXH 25C8L 5DVLA 4NO5A 3S3JA 4OZHE 43C9A 3QQ9C 4KPHL 1JGDB 2X6MA 1EO5A 1AO7D 1Y0LA 3MA7B 3P4OB 4PJ7F 1N0XL 1UA6L 1QSFD 4ZFFB 3TYFA 1CDGA 5GS0L 2XWBB 3R06B 3O8XC 3HCVA 3EO9L 5GGTA 1QRNB 2DQJH 1Z9SA 3OB8A 1TDQA 4NDMA 5CGTA 4FQHB 1AIFB 4Z0BH 3DVIA 3NFNB 2P43B 4JY4B 4Z7WE 1OAZH 4XRCA 3BZDA 4YIQA 1I1RA 1E4XL 4MXVE 4BFGA 2EE6A 1SY6H 2DMKA 3JWOC 1VFOA 4UBDC 5C0CD 1DN2A 1ZT7B 2QQLL 4IDJL 4WEBL 5EZJA 4YNYB 3GMLA 5ADPL 4HUKB 4UDUA 3WXVH 3BPCB 5MEOB 4NC1C 5GGUA 3STZB 5GS0D 1CICA 5FO8A 2MPAL 2OP4H 2E7HA 3VD3A 4N8CH 5E03A 5L8LB 3V6BR 3VE0B 1JZ8A 4O2FB 1TJHH 4G7VH 2VN7A 1HWHB 4XX1G 1RZ7L 4PRBA 4NQSA 2Y9RT 2WBJD 4KRMB 5DFTA 3MRFA 4YHOL 3PXJA 2FHBA 4DWHA 1MHHB 1I8MA 3BDXA 3WIFB 4X4YB 4RWHA 2VXVL 2OJZH 2EEAA 1MI5D 1GZQB 4QRSA 3SBWC 2NW2B 3CIQA 5EZOH 3GFUA 2ZUWA 5MHSD 2AJZA 4Q9RH 2VSDA 3PQYB 4Y5VA 3T0XA 2WQRA 5AWNH 4N90D 1OVZA 4XNQB 4JO1L 1U8MB 1RY7B 1BM3H 5FDWA 2ARJA 3L7EA 1EBAA 3BGAA 3GSWA 3W9DB 3K3QA 4GAYA 4PRHE 4LCIH 1KIUA 1T03H 1WCQA 1PG7L 1JF6A 3TA3D 3TBYA 5BW7C 3U4EA 4Z7VB 3GSNB 4GS7C 3VCLB 3I75B 2C1OB 2DDQL 5ERWA 5K59F 3ET9F 2OTUB 2QADC 2D3VA 4TN9A 5F9JA 3KWWA 5EO9B 4ZS7L 2PTUA 4DKEH 4UTAH 1Y6KR 3QBTB 5KSVB 2AABH 3HN3A 3ES6B 4UILH 3U4BL 5EIQA 3EOBA 4N5ED 1T7WA 1K8DB 3MRCB 5I73C 1VCAA 3O6LH 4NFDA 3UBXI 1ZK9A 4RGOH 1OSZB 5E8DL 4RWYH 4X98A 1MHCB 1QLEL 2IAMD 1KCUH 5HGGS 3HUJE 1GC1C 1SVCP 3EUUA 3PE9A 3VFWA 2PYFB 1RUQH 1D9KD 3QDJA 4YPGB 2W0LA 3TBWA 1R0AH 5EG6C 1CU4L 4BELD 5DD0L 2ZCLH 2EYTB 4JFHD 1FSKC 2GTWB 3PG2A 4FABL 4OLUH 4D0BA 3PV6B 1AD9A 1CE1H 1G0YR 3RIAF 1L0QA 2YA1A 2HT3C 4P59L 4FFWC 4JFDB 5F1SA 5JOEA 3QCUL 1VADA 1S9WA 1KIQA 5GGTH 1N0LA 1UXWB 4JPKL 2P4AB 2VZ3A 4HKXA 3MGOB 1GXEA 1NEZG 4M7JH 5SWZB 2G5BB 5D2NE 3QA3A 1MRCL 1A7PL 2NXYC 4AEHL 4NQVA 1N26A 4U1LA 4HWEH 3VG0H 4XXCA 4M1GH 1GPOH 4E5XA 4MQXD 3L5IA 3KYMB 3JV5A 4UMGA 2EKSB 3H7BA 4HIXL 5INDA 5CD3B 5B39A 5HYQA 4KHXL 3BKYL 4XCEA 2B1HL 4F8TA 3T4AB 5IBUB 5I6XB 3QCTL 1UQSB 4ZAKB 3HUJB 1NFDB 2VLRB 3MXVL 1YMME 1KC5L 3D9AH 2Q1EA 5I8OL 4OGAC 2ICWB 2MTPA 5DWUL 5GS2H 1YMMA 3TZVD 4OZIE 3IU3A 2NNAA 4UTBH 1FVDA 2NTFB 4N68A 4X6BB 1P4BL 1C08B 5FGBC 2AXFA 1Q9KA 3ABZA 4P5KA 4JN1L 3VDAA 2MFNA 1T1ZB 3STLB 3TO4A 2VDOH 1A6AA 5JIKA 3RDTD 2X1XR 4KKBD 1KLFA 4M7KL 1JZ7A 1FZKA 3R8BB 4L4TE 4QRRD 1CL7I 4DZ8A 1VA9A 1AQDB 3ORJA 5J57B 5EC1A 1JHKH 5SX4H 5HJ3A 1YUHA 3V6OE 4NZRH 3OHXB 1CFQB 3FO0L 1BQUA 2QSCL 3D6GA 1A6UL 2XIDA 1AE6L 1U91A 1P7QA 3VXRA 4PD4J 4KFZC 4M7KH 3RA7H 3QIWD 3QHZH 2QQLH 4IDJH 4WWKB 5E2UH 5TF1L 1OAUH 2EYTA 4NRZA 4M7LL 3W9EA 3H9SB 3S7GA 4GQPH 5HI4D 5AYUH 1ZT4B 3FO1A 4LCWD 5EZJB 2YRPA 5IW1A 3U0TA 5GGSA 5FOBB 1AKJA 3PWJA 5GGUB 2GEEA 4R4NC 1WC7A 2IQAA 3DX6A 5DC9B 3JUZA 2JK5A 2EE9A 3OGOE 3SKMA 3C9NA 4A6YA 3NIDE 4OGYH 3SN6N 5IV2B 4AENA 1HSBA 2QHRH 3QO1B 1OGAE 4K94L 4ZUTB 5KSAA 8FABB 1JWSA 2I27N 3QWRA 3MRIA 4F58L 4L9LC 1MUJA 5CILL 1NCBL 1IZJA 2LABA 2D31B 4Y4FD 5ID1B 2B4CC 1YY8A 1R5IA 5EOCH 2DKUA 2HWZH 2FSEB 2BNQB 4WU7A 4LL9A 3S96B 2XN9E 3IDIB 1ZGLM 2NLJA 2DTMH 1S7WB 1QFUH 3VW3L 3MRDB 2YKLH 2X4OA 4LHUA 1FZJB 1YJDH 1HYSD 4G6JL 3QQ4B 4XP4H 3TBYB 2PTTB 4FQIH 4PJXE 2FH6A 1XGQA 3FCTB 1U93B 2E7LC 4GXUM 4U6XB 5DRZB 3QEGH 1IAOB 4XVSL 3G6AB 2FECI 5HHOD 5BV7C 4RFOH 4UV7L 4NPYB 3F7QA 1T0MB 1XIWC 5GRUL 4OM1H 5HGBB 3BKCL 3LN5A 4G8GD 3AM8A 4FQIL 5HYSA 1QBMH 5ESAB 5FB8B 4XI5D 3P11L 2QEJA 2X4UA 5DQ9B 3U46B 5KAQG 3MBEA 2NY2D 5MENB 1G7PB 5KW9H 1U8JA 4P2RE 4PREA 2WBWB 1S3KL 3TN0B 2DJSA 4P2RA 5J12C 5LXGH 2NX5E 4YXKL 1A2YA 4U2ZA 1P6AB 2CKBH 2J8OA 5EBWB 1J1XL 3F7PC 1K5NA 1G7LA 4PJHA 5L2KE 1OAYL 5D7IB 2YKLL 3SGJC 4L1DA 1UWXK 1T6VN 4J7RA 3FT2B 3OKMB 1VGKA 1P4IH 5ITFA 3IF1B 2O61A 3RZCA 4PG2C 4FFYL 5D2LF 4YBQC 1FDLH 1QSEB 4OB5H 5L9DH 4M6MH 4A6YB 4XPGL 2R0LH 4TVPD 4UNTA 5BRZA 4IMLB 1NCAL 3PWJB 4OFKA 5FO9A 5E6IB 4MXVF 1WC7B 1NLDL 3EDDA 3HZVA 3DV6B 1VERA 4G9FE 4ZD3H 4PGCB 5GGTL 4I0PA 4OI8A 1P4LB 4LGPB 1U0QA 4OJFL 4TOYH 5JPMA 5E00A 3WHXA 1BX2A 4AG4L 3KYMA 1UZ6E 3SDAC 4BJLA 2CDGA 3QXWA 4FQJH 1EIBA 4KV5E 1H5BB 4OV6F 3PP3H 3S37H 3PGCA 1FZJA 3SQBA 5AD0B 5DXWA 1MFAH 1YEEH 3D3VA 4U2YA 5FF6A 4G7YH 4I2XA 1EO8H 5KAQF 2W9EH 5CCKL 4YHOH 4LKCA 3T0AA 1JV5A 3FTGB 2FL5B 1KCVH 2DQHH 4K9EH 5TF0A 3EJJX 3DVNB 1HHIB 3O3DA 5HPMA 4G80B 4AQ1B 2JJTA 3IDYC 4ONHA 3NN8B 4X9IA 1G6RB 1VHPA 1Z6JT 3BZFB 3AS3A 2ZUXA 3DHJA 3I02A 4HUUB 1I9JL 1U8LA 3O11A 3O81A 3GMPA 2AABL 1SY6L 1GGBL 3UZQA 4N0FA 3NCCB 5D8JH 3AU1A 3CXHK 3MA9L 4PJCB 2B8OT 3TIEB 3GMLB 4Y4FC 3FHQA 5C6PB 5HHPB 1MQKH 4OD1L 1V3KA 2DRUA 3D25B 1ADQL 5ABDE 3DRTA 1YQVL 3CVHB 4TRPL 3SDDD 3VRIB 4X6DF 1RJZB 3HFML 3ULUE 4P2YA 4LSUH 1A6ZB 2Y4SA 5DC0A 2VLRD 1FCCA 2E5EA 4Y5VC 1BVZA 4LPXA 5DMKA 3RUGF 1RZIA 1ZLVH 1DQDL 4QRPE 2VLJE 2DQTL 1T7YA 2X4QA 1UB6B 1EBPA 2VSCA 4Z7QF 5FA4B 3VWJA 2DM4A 4XVUD 3FOMB 4CL7A 1JRHI 4GLRH 4EDWH 1UM4H 1CDJA 5E4EB 4Y5VB 1P4LA 1PSKH 3BQUC 5JNYA 2W9DL 4TNVK 1X6LA 5CEZD 5E00B 3WHXB 5I1JH 3WXWL 1UKQA 3R0NA 5IBTH 4P5TC 4MLIA 3Q48A 1KXVC 4XB7A 3AROA 3NIGE 1W8OA 1N6VA 4LMQE 4G8GA 1MFBH 5A2LH 4AEHH 3FFCA 3CUPB 4XH2A 4KKLC 3KYNB 4CAGA 1CDBA 5EOTA 4BFIA 1M7DA 4Y4FB 4DN3H 2ICWI 4YUEH 4JLRA 2GJJA 3DVGA 5C0IA 5J11C 3IDIA 4HD9A 3VFUB 3EYSL 1JWSB 4OB5L 5IVXA 3BGMB 2EDJA 3MRJA 1SJEB 4Q6YA 1R5VA 3EW3B 3R0MA 3WDHA 1YPZE 2IH3B 2VMFA 5ICXB 5CGMA 3DYOA 1BQHB 5T3XL 3RWCB 3U0WL 4HUWA 1ZWIA 3LQMA 2HT2C 3EOBB 1RULH 1JHTA 1QFHA 2BNQA 3D1MC 3MJ8B 1HHKB 1YJDL 4PJDB 4UILL 1P7HL 1QR1B 2AQ1A 2DQGL 5J4MA 4KK5D 2DIJA 3G6JE 4R0LA 2N56A 2CJUH 3EO1A 2OX5A 3KPQA 4L3EE 4ODXB 5CIPB 3ARFB 1J5OL 4GMTL 5C0JB 4GRLD 4M4RA 1S9XB 2W65B 3SDCB 1H5BC 1QKZH 4LVOC 4KI5F 4EN3A 1JK8A 1OTTC 3D85D 1IAOA 4PJHF 4FQLH 2YPVL 4JDVB 3DXAB 4JGUA 4UU9A 1QPXA 2Z35B 4OF7A 5CFHA 2OL3H 4HS3B 2ZUQC 1RFDL 1DUYB 1EFQA 1UWXH 4AK1A 4JFEA 2GHWB 5E7BA 5TE7H 2VAAB 3QRFM 4Q9RL 3CC5A 2F53D 1GZPB 4KVCH 1DQMH 2FR4B 4JE4B 4HXBL 1EEYA 5IK3A 3BEVB 4XP9L 2AEQH 3HFMH 3B6SB 2XTJB 3OR6A 2CGRL 1BM3L 5FUOL 5KVGL 1YEJH 4F7EA 3IFOA 3VFMA 1UVQB 1Z3GH 2XQYG 3ULVE 5GSRA 5TQ2H 1MCDA 5D1XA 1D5ZB 1T2JA 5DYOA 4RGMB 4H20H 3EOTL 1F6FB 2WM0A 1HXYB 2CKNA 4F7CA 1KN4L 4LPVA 2R8SH 2VDNL 4QWWC 4ZTPL 5C8JB 2I60L 5FYJU 3PDGA 4HWZA 1KXTB 3MLWH 3H0TB 1UC6A 4O4YL 5KSBB 2GSIA 4JO3L 4PLKD 2BVTA 4N9GA 2EC8A 3HNTH 2R39A 3WDIA 2VXUH 1RI8A 3SQOH 5DEFA 4RGMC 2VLLA 1HKLH 3L5XL 2NY6C 4WI3A 1LK3L 4YR6A 1CFSA 1NFIB 3D5OF 4U49A 5ICZA 4WV1C 2OMNA 3VXNA 4FQXB 4GW4B 4GRMB 4P9MH 4MCYB 1XIWB 4FN0A 3TC9A 5LG1A 3U7AA 1PEZA 4XXDA 1WQVT 4L9LA 3O6ML 3SDYL 4R0LC 4M5ZH 2OP4L 4HT1L 3JWOH 3C6LD 2DWEA 3LKPA 5EU6B 2B7DT 1YUHB 4JFDE 3C8HA 5CJOH 5JW5B 3UC0L 4MA8L 3UMTA 3C2AL 4AG4H 2W1NA 4V1DD 5HYSG 3ESVF 1H3PL 4ZOCA 3SCMC 2YUWA 1MRDH 3QZWA 3QNXA 4R7DB 4Y2OA 2J7LA 3Q1SH 2R0ZL 1YMMD 3EYQC 4Z7UA 1AD0A 3MLYH 1HH9A 1FRGL 5I15H 5A40E 2YN3A 4HS3A 4I3GA 4F57H 3DRQB 3BPLB 4ZNCD 4RMUA 2FZ3A 3L5XH 3VRIA 4KY1H 3X3FH 1YN6B 4AIOA 4Y4HB 2VE6A 4MJ2A 4DCQB 5DJAB 1JI1A 4LDEB 4ZFOB 4LSVH 2L0DA 3V7AG 5HVHB 1FNSH 4JO2H 4BZ2H 3EZJB 3DO3A 4LCCC 3GGWA 3WL9B 1H3VA 2F53B 1E6JL 1A7OH 4HH9A 1YEGH 3TIEA 3LEXA 1RIUH 3B2VH 2ZP0T 4YPGA 1LEGB 4KRPC 4E0RA 2NXYD 3CGTA 1DBKL 3SGEH 4U6TA 1RHHA 2J8UA 1BJ1H 2ATPB 2J8HA 2BHUA 4R7NA 1P53A 5IVXF 4J2XA 4Y16A 3I3DA 3OR7A 4NWUL 5DMIL 1B4RA 4KTEH 3MBED 1MIML 3NGBB 4ODSH 3VWJC 3FO2B 2XXMB 1QBAA 5C0BB 4P3CL 3B5HA 2XN9A 3MOBH 4L8SC 2NY1C 3VXPB 3SPVB 2KUTA 3LAFA 5C0GA 4Q58C 3TPUA 4KI1A 2FO4B 2ATKA 2VXTL 4HCRH 4OZFG 3UJTH 3UTTE 2IFGA 3IXTB 2VOTA 4FTVB 1MJUL 1U93A 1MHPL 3QCVH 2ADGB 2XWTA 5B38G 5EU4B 5FECA 5TPWH 2E6PA 3L3OA 2XKNB 4HV8A 4ELMB 3CPLA 5I1KH 3BFOA 2ICWA 3OKLB 3FAXA 3H3PL 5FEBA 5KVDL 3O6FD 3QHFL 2K7QA 3PGFH 3BDYH 4JO4L 5DD5H 3BGMA 5FKPA 2Q8AH 1AR1D 4LMQI 4GG8B 5FKAA 7FABH 5ICXA 4QHUB 3TP4A 3DSFL 2XWJB 4FZ8L 5JW3L 4P9HL 2VQUA 3MROB 4ZO8A 1HHKA 4LNVA 1H8OA 5D96C 4XC1L 1FFNB 1NLBH 4MCZA 3PHSA 2NR6D 1IBGL 3ME0A 3FB5B 2G2RB 4WFED 3UJTL 4G6KL 5J8OA 2DI9A 5JIIA 4GG6E 2X4TA 3O6MH 2ZSWA 3SDYH 3KLAB 4HIJB 1X5YA 3HZVB 1QSFE 3UYRL 1FFOB 5D1QD 3C87A 2WQ8A 1GH7A 4AM0B 4Z5RB 2KQNA 3IDUA 1Q1JL 3UTSD 4E0RB 2BSSA 4XCNB 1II4E 4HWBA 4DKAA 2D7OA 2IBBA 5C9JB 5HHMD 5KVDH 2H6PB 3WDJA 2BY3A 3I3EA 3CCHA 4XPBL 3WIIL 4EI5C 3MLTA 1BQHG 3GI9H 2CDEA 1KPVB 3E6FA 4YAQA 5AG8A 5IOPB 3X13B 4FQ2H 4XNMB 1S78D 2VRAA 1G1CA 2JIXB 4O2CA 1MELA 2PR4H 3F7VA 3QUMA 4XPAL 5EWIL 4LK4A 3VFMB 4YBHA 1J88A 5JHLH 5F9OH 1C8PA 4OD2A 2JCCA 1A64A 4AYFA 2FGWH 4JY5L 1DDHB 4DOHB 2Y6SD 3VJ6A 2IGFL 2I9LA 3QUXB 1NANI 4J3WA 2G9HB 5F8RC 4EUPH 4MA1C 4LHJB 4LLMA 3B5GA 1EK3A 5I76A 5DVNA 4F7MB 2DOCA 4LCWB 3TT1L 3QFJB 5IESL 3T65A 1A1OB 2PCPB 2E27L 3ARGD 4PRIB 4N0FB 2NY3B 3AU1B 4PJ7A 3UP1A 1E27A 3NCJL 3FQWB 3CNKA 4PV9A 4X4ZA 4CN4A 4JY4A 5MEQB 4TVSa 4D9RE 1AXIB 4M48H 3PUCA 5CLTA 3KPOA 5T5FH 4HGWA 3BEWB 3VWKC 1FVCB 3B9KD 1LP9E 3GHEL 2VYRE 3HLAA 4HS8H 3BKYH 1CFVL 4HBCH 1UEYA 2VXSH 4LPYA 3VI4F 1I9IL 1KYOK 3RRQA 4FZ8H 3MV7D 5I8OH 3EZ8A 4Z7UB 1MNUL 3EO9H 1KGCD 1A7PH 2CDFB 2UWEB 2WBKA 5I8KH 4WI5A 2MOVA 4YXHL 3WLWC 1RUMH 2DM3A 1DEEB 4HXBH 1OAQL 2IALB 3C60A 1CVRA 3BVNA 5F21B 3BRGC 2BSSB 2DQEH 5HHMB 5E8OA 2EDYA 5SWZD 5HDQL 1BEYH 5IJVB 4B5EA 4S1QH 4Y4KC 7FABL 5KSUA 1B4JH 1MCOL 2CSPA 3ISWA 2Z8WC 2HFGH 5FXCH 3DURB 3V4PH 1CS6A 3QDME 1T80A 1CWVA 2EDRA 1CBVL 1NGXB 3O2WL 5C0AA 4FQCL 2DWDA 4PJGB 1MJ8L 2YPKB 3ULUF 1IQWH 4O9HH 1OTTD 4HDIA 2GITA 4HIHB 4JHWH 3EFFB 5CEZL 5DO2C 3BD4A 2VJXA 1BLNB 3MRGA 3MJGX 3OSKA 5T3XH 2VR4A 3VMPA 3TV3L 5C09A 4ZTPH 1QA9A 4OZIA 2QHLA 2IFFL 1QFOA 3HC4H 1E28B 3BXNB 1HINL 3CFDA 3ULVL 3KWWB 5T3ZE 3L9RB 3A67L 1BWMA 5HHME 1FV1A 3T0ED 2MMXA 4X5XB 4QOKB 2YSSA 3C2AH 5D7KE 2W60A 3GSQA 3GM0A 5F8QC 1AR2A 2XWTB 1KJMB 1LO0H 1VFMA 4KK6D 4F37K 4KRPD 4TPRH 3GI8L 3I02B 3RKDC 3PDOA 2H45A 3F7YA 1OP5H 3UBXA 1NUDA 4S2SA 3OKEA 1N8ZA 2YD1A 4XCFH 1OM3H 3MRMB 1B9ZA 3MNZA 3QIWB 4Y8AA 1LO5A 4U1IA 2XYCA 4U3HA 1XH3B 2FEEI 4OLWH 2R1YA 4ZQKB 1LO3L 4KI5E 1AGBA 3WFCL 1HILA 4R2GC 4ALAH 2X1QA 2PYEA 3SKMB 2KQMA 4KVNH 3LKNB 4OKDA 2HN7B 1I1AC 3VW3H 4D0DA 2NQCA 1NEUA 2K7PA 3S96A 1U8PB 1NPUA 1IM9B 3RA7L 2ZOKA 3CMGA 4JRYA 4HUXB 4GXUN 2X41A 5ICZB 4P49A 2E9WA 5BCAA 1JPGA 5F89A 3H6JA 4Z5RA 3MREA 2YPLB 5IQ7L 2Y7QA 3OKNB 2ZG2A 3DECA 3N1QC 1J05A 3QEQB 4Z78A 3N1MC 3HMWL 1DVFB 3RY5A 1PEWA 1S5HA 1Z2KA 3QULB 4JKKA 2VO5A 3U4AA 5HGHA 3QEQE 5F7HA 1EEUA 4JFXB 2KZ1B 1DSFH 3S4SB 2RIKA 3VXUA 2V17L 3FFCB 5JHDE 2CLZB 4NQUA 4PJIE 1RZJL 4LEXH 1G9NC 4PG9B 1Y0LB 4OCWH 32C2A 1JYVA 2CR6A 2D0HA 5GJTH 5GGRY 2CD0A 1J1XH 3W11D 3LS4L 3TN0A 1RJCA 1UWEL 4TUOB 3VH8G 5KVFH 4NHUA 5CS7A 1BWWA 1LDSA 4F7PB 4H25B 3BSZL 2A83B 2FD6H 1ZTXL 1IEAA 1GGIL 4QOKD 1A6UH 4NN7B 1F3JB 3GSXB 3HZMB 1XF5A 2WBJC 4B0MM 4GKSA 1UJTA 4LF3B 1KNOA 3MCLH 3G04A 2LU7A 1QSEA 3VRJA 1AQDA 2H41A 1EX0A 1KLGB 3UPCA 1A3QA 1FVCA 2D7PA 3RY6C 5I73B 1KENL 3T65B 2PW1B 5BV7H 5C0JA 3ZKMD 3QH3A 1JL8A 4RGNB 3ZL4H 4APQC 1T1YB 3SDAA 5CHNB 2L4OA 3RWFB 5D6CB 1LK2B 3KYKL 1CT8A 1U8QA 4J1UA 4WJ5B 4UDTA 3CXDL 2AJZB 4M9PA 4X4MA 5C92A 5I19H 1D5XB 3ARGA 4TOYL 1HZHL 2AEPL 4GW5A 3TCXA 2ICEA 5FGRA 3ARZA 1XGRB 2GFBA 2P5EE 4OD3L 4YHIB 3SCMB 1Z9LA 3S35H 1RSFA 3MCG1 2DJUA 4X4YA 5IK3B 3VFPB 4LKCB 2CKBL 5JZ7D 2PN5A 3HE7B 3DROB 5LVEA 3DVNA 5AD0A 1KB5H 4PY8J 2G5RA 1WUNT 3KJ6H 4X0KA 1IAIM 4LDLB 4OBRA 5EBLB 4YHNB 2OR9L 1QHPA 1ZXQA 1B0WA 1EJOH 1CFNB 3K2UH 1MNUH 4ODWA 1VEMA 5F97E 3D0VB 4Y89A 4Z7UE 5GIRA 3G5ZA 1E4WH 2A6IB 4JRYD 3MJ7A 3WFEH 4O00A 1HSAB 3QXVA 2XQBL 5IHUL 1U3HB 2EO1A 3U0WH 1I3RB 3QXAB 3MNVA 4LCYA 2VC2H 4OFPA 4WU5A 2NY3C 1OARL 1R3JA 4OCLC 3H9SD 4LNRA 3D48R 4KK5C 3LEVH 4P3WA 4TVPE 3CK0H 4KQ4L 2A74B 2XTJD 3CD4A 3FHAA 1IGFL 3EYQD 2VZSA 2VNCA 3RP1A 2UYLB 2J8UF 3DYPA 2JJWA 4YIQB 5HDLA 1PFCA 1J8HA 4E42A 5EO1A 2FIRT 5T1MA 3DSNA 3FQXA 5M95B 5A2FA 4X7TB 1G7MA 1NMCC 12E8L 4XCYB 3BAEH 2XWJA 3L5WB 3KJ6L 1NGZA 1AI1L 1W72A 3VXQA 4IRJC 2IAMC 1FG2A 4LLYA 3PWLA 4LQFH 3D39D 2Z9TA 3I2CH 4XPFH 2R4SH 1MEXH 4X6DE 1S7XA 1MHEA 1D6EB 2DYPB 3C5ZA 4TVPL 1J11A 1UH4A 2NY4D 4YJZL 4WI9A 5EIIB 35C8L 1P1ZB 2JLLA 5I1HL 3OB0H 4X80L 1I9IH 4YX2L 4XPHH 3SE9L 5F7EH 3ECBB 2NYYD 4NN5C 3G6DL 5F9AC 3U7WH 3I9GL 1QBLL 3MV8A 1JGLL 2GK0B 3OKEB 2Q20A 4YHML 2EKSA 3TO2B 5INDB 2IH1B 1ADQH 4XC3L 3GUTA 3SCMD 5JXAL 2LVEA 3F62A 2EIBA 3GB7B 4PJEF 5FM5O 3SOBL 3GMQB 2NW2A 4KAQH 4K7PX 5B22A 2E7LA 5C08A 4L8DA 5KSAD 1PAMA 3GKWH 3T4YA 1KCVL 2DQHL 3OKDB 5A3IC 4ODHL 3FB7B 4LEOA 3S3PA 1OOAA 3Q1SL 2AKRA 4WI6A 1GGUA 3S5LA 2WSKA 3T0EC 5CP7A 3O8XD 4HBQA 4HG4K 1X5KA 4JJHA 1SEBB 2FJGB 1ITBB 3VXSE 1X4XA 1U3HA 3HR5B 4Q6IC 2Q86A 5FUZH 4PJ7E 1KFAL 2DL2A 1EHNA 4CVXA 1RJYA 3P0VH 4UTBL 1BHGA 4MMXC 4YHZH 2VITA 1IEBA 4ONHB 1OT1A 4NKIL 1G7QB 3MODL 1BBJA 4C56E 3UTSE 1HIML 1J8HB 4E42B 2CXGA 3O11B 2BCKA 2XT1B 1DBAH 4U1KB 1JYWA 4KRNA 3NTCH 1GC1L 1IAII 2YD7A 3B83A 3BT2L 4XCYA 3OHXA 3AB0C 4H88L 3FFCE 4NBZB 1E4JA 4F7EB 3HMXA 1MFAL 4Y1AA 3RI5F 1LWRA 4MS8C 5TDPB 5B4MC 4F3FA 4Z18A 2BFVH 3V2AR 2FNBA 3RWDB 1R3HA 1QRKA 5CWSB 1P2CB 2E6JA 5CBEB 1JTPA 1DP0A 5J06A 2JCCF 1REIA 3U36A 1LK2A 4HFUH 4NJ9L 2BC4B 5DD0H 5DEGB 3LCYA 3LHPL 1IGMH 3S3SA 4NSKA 1UXSB 4ZUVB 3CDCA 1BF2A 5H35B 3MV8B 1WWBX 3HG1E 3OKOA 3BI9X 1XGUA 3LV3A 1I8KB 5KS9A 1AGCB 1KENH 1F2XK 3VXTB 3VFPA 2NLJB 4MQ7A 3LN9A 2O5YL 1JBJA 4JVWA 4BUGA 1EFXD 2BY2A 5LGHL 4WFGD 2A6JB 2XKUA 4QXWA 1XGYL 1U3ZA 4BH7B 5FCUL 1HOCA 5A3ID 2EXYC 5B39B 4YFLI 4BKLB 1QKZL 5I1CH 5ELIA 1VFAA 3VGHA 5J1AA 4QRUB 3GJFB 4ERSL 3BZEB 1UQSA 3HC0B 4KROB 5D7JB 5IVZB 1HN1A 2VLKB 2A6DA 4RGOL 5E8DH 5LBSH 1JI2A 1SM3H 3HA0A 4N0YL 2FCBA 3CDYA 4L5FL 4RBPK 4IOIA 2ESVE 4DUXA 3JV4A 4PB0H 4D3CL 4JZJA 4FFZH 1EVTC 1X5IA 3MZTA 3VXUE 3PL6B 2R69L 1F4YL 4JRXD 4O51A 1OAKL 2GKIA 4MD4B 4ODTL 4KDTA 3FQRB 4ZFZA 5TE6H 5T5NF 2VE6B 4NPYA 2VDRL 1S9KC 1M7XA 5E6IC 2DLFL 1P69B 4RDQF 3WL9A 1A5FH 1AY1H 3OPZH 3DRQA 4MA1B 1N59A 4NO0D 4UIMB 1RV6X 5SWQA 2VLJB 1JF1B 3EO1B 1A7BA 2ADJA 1VFBB 5E6ZA 1WZ1H 4NQCA 2W65A 1CQYA 3A6CL 1OY3B 4K3HA 4IHOA 4PJ9A 1P2CA 3FOLB 2UVEA 3PP4L 3MLZL 1D6EA 4IMLA 5FO9B 1WCBA 4F3FB 3MCKB 4ODVH 3ZT7A 4KUCF 1MVUB 3ES6A 4OCSL 4FXLA 2AQ3A 4WUUA 4K9EC 4XVTH 5ITFB 5ACZB 5HYFA 1MHCA 4ESKA 4D0DB 1AFVL 2XY1A 3WSQH 4KZEH 4M7LH 3MODH 1W0WA 3SJVE 2PXYC 4LOUD 1S7TA 2I26N 5E6IA 4UNVA 3RHWK 5L88L 5HGAB 5EBMA 4AENB 1KN2L 4IM8A 4WWKD 2AK4A 3HZKB 4OLVH 2DLEA 5C09D 3QEQA 4QXGL 1FO0L 5IW3A 4P9ML 1DE4A 2COQA 5C8JA 5E08H 1HEZA 2VL5A 1UH3A 2X4NB 3GSWB 5ILTL 5IHZA 5C0CE 3MUGA 3UTZA 5I74C 1ZVSB 3FRUB 4N9GB 4YHYB 3IT8D 4EOWH 3H2WA 4GRWE 3STBA 3GMQA 4OCRL 2R29L 2V5TA 5DS8A 4GO6B 2I9TA 2FYYB 1I1AB 4M61B 4J3UA 1AFVH 4LQ1A 5CJXC 5LBSL 3R8QA 1EGJL 1B88A 3CFCH 3ILQC 1A6VH 2X4RB 2ZCKH 4L3EB 4JM4H 1QLEH 1AGDA 4GBXB 1FIEA 4BSWB 1YECL 3WJLC 3A6BL 3EOYG 1RZ7H 3U6RB 5LWYL 4ZUUB 1CXFA 3S8WA 4R26H 3PWNA 2G2RA 4DOHE 3P4MA 3F6IA 4Z7NF 4M1CC 2VIRB 5HD8D 4EI5A 5DRXA 4IRSB 2AJUH 3RX5A 5C0FB 4MX7A 1WWCA 3HI6L 4Q0XH 4FXGA 4XP5H 3WEXA 1VPOL 3SE4C 4XPFL 4PB0L 3HAEB 1EHAA 3RPKA 1KTLB 4P5TB 5IMOB 5MENE 1A8JH 3G5XA 1SBSH 5AWNL 1U58A 5DFVD 2NY2B 1ZS8B 4HUVA 2OZ4L 2G5BA 5J13C 2FJFA 3U7YH 2HMID 3X13A 5JTWA 1AGFB 1P5VA 4KKCD 4HKZB 2VKWA 1KPUB 2P45B 3ARTA 4KK8D 2VZVA 3O2VH 4ZODA 4EDWL 1KB5L 1J8HD 5E2UL 5E99L 4ZS6C 4HQQH 1YY9D 4G8GB 5DJ2B 3QJHB 4U0RB 3GDBA 1N7MH 3W5MA 1TJHL 4KPHH 3H8NA 3U7YL 2A9MH 2MCPL 4BFIB 1FVEB 1R24B 4OT1L 4HKJB 4P2CG 4ACPA 5L0QC 4WDIB 1MCEA 3L3IA 2EC9T 5E70A 1ZA6A 1TITA 1HQ4B 2OJEA 1OWRM 1OF2B 4K3JL 3BD5A 2VXQH 1P5UA 4PLJD 3UX9B 1OW0C 4LSPL 1BJMA 4PJEA 5IGXH 5ITBH 4K8RH 3VG9C 1BOGA 3CU7A 1PBYA 1T5XB 5EB9A 4YXHH 4K7PL 3S88L 4M8QB 5DI8B 2C3GA 2P8MB 4TUJB 3TA3A 3G08A 2VLKA 2A38A 3RWJB 3OJVC 1S7XB 3MRRB 4MVBD 2A9NL 4NO0B 3OAUH 5EORL 1FG2B 3MOBL 1ADQA 4FQ1H 4J3TA 4FQXC 4OIAA 3ZKXC 1GZPA 4F7PA 2ZOLA 1MCQA 4Y19D 4P99A 1AC6A 2OR8A 1CLOL 1MCWW 4WI2A 3IVKA 3RUGA 4PJ5A 1IKNC 3T0BA 4CVWA 2GK0A 3NZHH 5D7JD 5E8EB 4AL8H 1FAIL 4MA7H 4O02L 2OTWA 1NAMB 3MLVH 1FNGA 5D2LB 5ALCL 3AAZB 3AREA 5CKGA 3Q6GL 3BZ4B 2V7NB 3TT3L 2W07A 3JWDH 3EGSA 5D71H 1TQCC 2ZKHL 1TZHA 4HKZA 4K8RC 2IANB 3RVUC 4JZNB 4OUUB 4UQ3A 4CMHB 2QADD 2WAHA 1KCRH 1CE6A 4ZTOL 2WP3T 3HMWH 4K7PY 3LS4H 2BOCB 3IKKA 2H6PA 4XP6H 1PZ5B 3DSFH 2D31A 4OLUL 3LQZB 4MCYA 1E4XH 1TJGL 2VDOL 5C0BE 4IMKC 4G6MH 2HTKC 5D2LE 2V2XB 1DCLA 2VL5B 2J1KA 2X70B 1LE5B 2EH8H 4ODBD 3UO1H 3EYFB 5JORA 3T77B 2OMBA 1YNLH 2BSED 3WSQL 5EOQL 2AXGB 2OSLB 3KDMB 4NGHL 2VXUL 3QEUB 1YYMH 1WEJH 3MLUL 3W11C 1P84J 1XZ0A 3T1FB 1ZLVK 3QFJE 2H3NA 2EEDA 1I8LC 1BPVA 1BVKB 3MJ7B 2DQUL 4NM8L 4S2SB 2VITB 3TNMA 4PGBB 3VWKA 3ELAT 5TH2B 2GJ6A 4JQIL 3P73B 4L3EA 3K4DA 5D7IE 3VFTB 2FLRT 1HHGB 3WO3B 4LKXA 4UOW0 3EHBD 4XTRC 3MV11 4M7JL 3DETC 3E0GA 5CKAA 2FL5A 4QF1A 3VFSA 3WD5H 4WHYG 3RUGE 4RAVB 4OV5B 5FGCE 5BO1H 3OZ9L 4JO1H 2JCCE 4R4BB 2Q8AL 3QZWG 4KTDH 5JXED 7CGTA 1U92A 3MLRH 4POZC 3CXDH 4XVJH 1K2DA 3EGSB 1C1EL 5JOPE 4ORZC 2J8UE 4HH9B 2R0WH 3K4ZA 5J3HD 2BVQA 3E8UH 3K1KC 3BQUD 1VEOA 3GMOA 2R56L 4KWUA 5I1IH 5DVOA 1ODAA 5EIIA 1NAML 1JFQL 4V1DE 1U3HC 3LV3B 5ETUB 3OG4B 2F74B 4PGEA 1UWEH 2Y7QB 5MHSE 3CSYA 5IWLC 4V1DA 3ULVH 3TPUB 2Q7YA 1M71B 4DW2L 1FORL 5F6HI 3QNYB 1TJIL 4MQSB 4I4WB 4WWKC 1SHMA 3C6SB 5EH1A 3ZTNL 1X5GA 5C0BA 5HYIA 1VADB 1ZS8A 1C5CL 4HG4J 3I3BA 4QT5B 3HG1B 2VTFA 4J6RL 2HRLA 3V8CA 1GOGA 5A43C 3GNML 4KROD 4BSVB 4I9WE 4LPCA 5C0ND 5HI5D 5DLML 2YD5A 4QO1A 2HKHL 1UADC 1SY6A 4K23H 1AE6H 2VDML 5DD6B 5GS2D 2ERJB 1NUNB 2YD4A 5JQ6H 3FQNA 3PL6D 1YEHL 5EU6A 3LS5H 1IGIH 5E5RB 2AJ3B 4HV8B 1ZANL 2JJSA 1T66D 3IFNH 1FNHA 3L3HA 3KYKH 1S78C 5E95B 1XCQA 4JQVC 3RL1B 2A1WH 3NACL 4M5ZL 5ENWA 2R4RL 3BW9B 1U41A 5TE4L 4Z7OF 3CLEL 1NC4A 2B4CH 2HFEA 2XZQH 2UZIH 3TBWB 3DMMC 4GAJH 5JOFB 3MJ6A 1E4KA 3X12B 2H32A 2XG4A 4NUGL 2ZOLB 4HAGA 1DQLH 3MX0A 3TFKD 4GRWF 1TFHA 1OTSC 3MLYL 3OXSB 4YDK