5IWQA

Crystal structure of aspartate aminotransferase (aspat) from corynebacterium glutamicum atcc 13032
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
424
structure length
424
Chain Sequence
b'VSLQDFDAERIGLFHEDIKRKFDELKSKNLKLDLTRGKPSSEQLDFADELLALPGKGDFKAADGTDVRNYGGLDGIVDIRQIWADLLGVPVEQVLAGDASSLNIMFDVISWSYIFGNNDSVQPWSKEETVKWICPVPGYDRHFSITERFGFEMISVPMNEDGPDMDAVEELVKNPQVKGMWVVPVFSNPTGFTVTEDVAKRLSAMETAAPDFRVVWDNAYAVHTLTDEFPEVIDIVGLGEAAGNPNRFWAFTSTSKITLAGAGVSFFLTSAENRKWYTGHAGIRGIGPNKVNQLAHARYFGDAEGVRAVMRKHAASLAPKFNKVLEILDSRLAEYGVAQWTVPAGGYFISLDVVPGTASRVAELAKEAGIALTGAGSSYPLRQDPENKNLRLAPSLPPVEELEVAMDGVATCVLLAAAEHYANL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title Structural Insights into a Novel Class of Aspartate Aminotransferase from Corynebacterium glutamicum.
pubmed doi rcsb
source organism Corynebacterium glutamicum (strain atcc 13032 / dsm 20300 / jcm 1318 / lmg 3730
molecule tags Transferase
total genus 153
structure length 424
sequence length 424
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12897 Aminotran_MocR Alanine-glyoxylate amino-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 5iwqA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 5iwqA01
4ZAHA 4GEBA 4XJPA 4ADBA 1DJ9A 4UHOA 3B8XA 2BIEA 1MGVA 1ARTA 3ASAA 4AH3A 2ZJGA 1O69A 4R8DA 2X3LA 3CQ6A 3F6TA 1AAWA 1MAQA 1BJOA 1MAPA 1D2FA 3P1TA 2VLHA 3FDBA 3BB8A 3I4JA 2GB3A 1GEYA 2ZY2A 2XBNA 3ZRPA 1IJIA 2AEUA 4ZSYA 3GZCA 3E2YA 1CQ8A 1N31A 1WYUA 3G0TA 4FFCA 1BS0A 1OHWA 1AHGA 3BN1A 1AKAA 3FZ6A 3VK3A 3AEMA 1SF2A 1LC5A 4KXKA 3AATA 2O1BA 3OKSA 3HLMA 4J5UA 1DJEA 3BWNA 4U2HA 1RV3A 4ZASA 1AY5A 2OATA 2YOBA 2YRRA 1CL2A 4RKDA 5AX8A 4FL0A 5HHYA 3R9AA 3ATHA 5G09A 3NRAA 3PDXA 4LW4A 4OC9A 1XEYA 2JJFA 3KE3A 4A0FA 2O0RA 2HORA 2O7CA 1M6SA 2CH1A 1ZC9A 2YCTA 3VK2A 5I92A 3NNKA 3A8UX 3KGWA 5M4DA 3P6KA 1M0QA 3AEMC 4XK1A 1AX4A 1J32A 3R4TA 1U08A 3WCOA 1AJSB 4BMKA 4TV7A 2V0YA 2HUFA 1O4SA 3BWNC 3EI5A 3NTJA 3FVXA 4BA4A 1BJ4A 4JEVA 3DYDA 2DKBA 2HP1A 1OXOA 2ORDA 3FKDA 2R5EA 4PFFA 1W7MA 1BT4A 1GDEA 4CXRA 3GSBA 2HZPA 5DB5A 4JEWA 5LH9A 2D7ZA 1ASAA 3LVKA 4WXBA 3UAKA 4F5GA 1GD9A 4EMYA 2AY3A 2D5YA 4ZSWA 3ZZKA 1ARSA 4H51A 4ISYA 3W1HA 4ATPA 5HXXA 1B4XA 2EPJA 1QISA 4AZJA 2AY9A 3D6KA 3ECDA 3NX3A 1IX7A 2EH6A 3ASBA 3A9YA 4LNLA 4RM1A 2BIAA 3NYUA 4R5ZA 3COGA 1AJRA 2CSTA 2W8TA 4A72A 4EU1A 4K2MA 1E5EA 2CH2A 1OATA 2VGUA 2VMUA 3NYSA 1ARHA 4M2JA 2OQXA 3AEPA 3QBOA 4O6ZA 1D7RA 2DKJA 3KKIA 3QI6A 1M0PA 2BHXA 2VMYA 3CQ4A 2CB1A 4WLJA 3TFTA 1JF9A 2Z20A 1AAMA 2Z67A 2GSAA 4ZDOA 1CL1A 2R5CB 1LC8A 2YCNA 1TPLA 3NDNA 1PMMA 4RLGA 4F4EA 2V1PA 3B1CA 1ASGA 4OT8A 4KYOA 1DJUA 2W8WA 3F0HA 2BWPA 3B1DA 4A0RA 2EZ1A 1IUGA 4PFNA 2FN6A 2VMRA 3AV7A 4GRXA 1LC7A 3NUBA 1TASA 2DGLA 3DZZA 1CZCA 1CJ0A 4XQ2A 4WB0B 4U1TA 2BYLA 1D7UA 1ELQA 1V2DA 3FFHA 2W7HA 1W7NA 1ASNA 1LW4A 2VGVA 2W8VA 3ACZA 4A0HA 1I48A 5EUEA 1VEFA 1JG8A 2CJHA 2WK7A 1JS3A 3PD6B 3I5TA 4ITGA 4AZKA 2ZUKA 1WYTA 3RBLA 5IWQA 4B98A 2BWNA 2W7DA 4WP0A 5G4JA 4A00A 1X29A 4W1XA 1YIZA 1AHYA 2FYFA 2EZ2A 5M49A 3MEBA 2ZC0A 5BJ4A 2QA3A 1DGEA 1C0NA 2YKUA 4Y0DA 5EIGA 4IYOB 1O61A 1KKJA 3JWAA 3WCNA 1C9CA 3AOWA 4GE9A 1ASMA 3E2ZA 3MADA 2E7JA 1EJIA 3FD0A 4K2BA 9AATA 3DXWA 2G6WA 3MC6C 4W1WA 4LNMA 1YJZA 4OMAA 3DC1A 1TATA 4PIWA 2OKJA 2W7JA 2C44A 2QLRA 4F5KA 3GWPA 2DGKA 2DOUA 1UKJA 4ZDPA 2W7KA 1BQAA 4DQ6A 3VOMA 3EI7A 2AEVA 2CY8A 3G8MA 3FZ7A 1YNUA 3HT4A 1VJOA 5E4ZA 5G4IA 3VK4A 1KMKA 4RITA 1M4NA 4E1OA 4ZWMA 1MDZA 1SVVA 1UU0A 3N75A 4JF1A 4ADEA 4F5MA 1B5PA 3GZDC 5M46A 3QGUA 1Z7DA 2AATA 4JF0A 4W5KA 4UHMA 3NU7A 4XAUA 3WX9A 1BKGA 1SFFA 3MBBA 2PO3A 4IX8A 3IF2A 4JEYA 3E77A 3MKJA 4MKJA 2VGWA 2BKWA 1BJOB 2QB3A 3PA9A 2JGTA 3N0LA 3MAFA 3CQ5A 3HVYA 1WYUB 3JWBA 4WYGA 3VAXA 3GETA 1CS1A 2AY2A 4MQPA 1AIAA 1LKCA 2HP2A 1SZSA 3AENA 3LVJA 1H0CA 1GEWA 1S09A 1SPAA 3EIAA 3F9TA 4RJ0A 2VI8A 1Z3ZA 1ZODA 1DKAA 3FRKA 4RAEA 4TN4A 5EUNA 4BQ0A 2Q7WA 1M0NA 2E54A 2NMPA 2Z9XA 3E9KA 3FDDA 2WKAA 3JU7A 1Y4IA 1T3IA 1ASDA 2FNUA 1S06A 1QITA 3LG0A 1AHXA 4BA5A 5C6UA 2HOXA 5F9SA 2YCPA 1FC4A 2ZY4A 2OGAA 3EIBA 3K28A 5M4BA 2FQ6A 4UOYA 1AKCA 2C0RA 3HBXA 3FVSA 1KKPA 2VGSA 5DJ9A 1C7GA 4DGTA 3NU8A 1ORDA 3HDOA 3GR9A 2XH1A 1G4XA 4OBUA 3WGBA 1TOEA 3L8AA 1ARGA 1MLZA 4CBRA 4F5IA 2QBTA 3LY1A 2ZYJA 1SZKA 3GBXA 1ELUA 2JG2A 4MGRA 2W7MA 1UU2A 1V2EA 2AY8A 3M5UA 5JAYA 3WZFA 3DR4A 1G7XA 1GC0A 2DGMA 1S08A 1ASBA 3DXVA 1DFOA 5FT6A 4JE5A 4RKCA 4F5HA 1GEXA 5D95A 3RI6A 1MDXA 2HOYA 2ZSMA 4GDYA 2BYJA 5E5IA 4A6UA 4ZLVA 1I43A 2R5CA 3GJUA 1X0MA 4WXFA 1AHEA 1WYVA 4Y0IA 8AATA 1YJSA 2AY7A 3B46A 3LWSA 2JJGA 1BJWA 1N8PA 3W1JA 3L44A 2FM1A 4WYAA 3TCMA 2W7EA 3N5MA 4MY5A 2D65A 1B5OA 1V72A 3FCRA 4IW7A 2ZY5A 1PMOA 1P3WA 1M32A 2F8JA 2PB0A 3T32A 3A9XA 3ELEA 3FFRA 1ASCA 1ASLA 1WSTA 4LC3A 2CJDA 2GMUA 4R2NA 1WKGA 3EI9A 5HDMA 4IXZA 3MC6A 5D5SA 3HQTA 1XI9A 2BWOA 4QGRA 3AEJA 3JZLA 3FSLA 4Q31A 4ADCA 2Z9UA 1QGNA 4UQVA 4Y0HA 2W7FA 3E6GA 1W3UA 1QJ5A 3ZZJA 1YIYA 4R5FA 3K7YA 2RFVA 5FT4A 1OHVA 3H7FA 2VMNA 3II0A 1RVUA 3QN6A 4IYOA 1IAXA 5EAVA 3UE8A 3BWOA 2VMWA 4IXSA 4P7YA 3K40A 2Z9VA 3RCHB 5DX5A 4OCAA 3W1IA 4A6TA 3PPLA 1AMQA 3TFUA 1WYTB 2X5FA 3AEJC 4ITXA 2W7IA 5BJ3A 1VP4A 1W23A 3GZDA 4AOAA 1AMRA 4LNJA 4P3MA 1GC4A 4JEZA 4K2IA 2GMSA 2W7LA 4F5JA 3WKRA 4N0WA 2W8UA 4NOGA 1OHYA 2C7TA 5G0AA 3PDBB 2YKYA 1BQDA 5EIGB 3AOVA 4UHNA 4XEWA 2VIBA 3WY7A 4GE7A 1JS6A 1QZ9A 2Z1ZA 2EO5A 2VI9A 4Q6RA 4WD2A 2AY6A 1I29A 3LVLB 3PIUA 1TOIA 2CANA 2CJGA 1O62A 4GSAA 4WXGA 4W91A 1E5FA 3CAIA 3QHXA 4IY7A 3KGXA 1GC2A 2FNIA 1DTYA 4I8AA 2WK8A 4F5LA 1H1CA 3PJ0A 4BHDA 2VMXA 1AHFA 3ZRQA 4J8LA 2X5DA 1S07A 1G7WA 1YAAA 3JTXA 1KL2A 1QJ3A 4PVFA 5TF5A 2YKVA 4M2MA 3FQAA 2JISA 5EFSA 3BS8A 3H14A 4A6RA 2ZSLA 2PB2A 4ZM4A 2Z9WA 1AY4A 2VMZA 4RIZA 3Q8NA 1CQ6A 2AY5A 1BJNA 3FTBA 1AJSA 1GCKA 4JE5D 2HUIA 4OTLA 1IAYA 1M7YA 2VMQA 1ASEA 4CXQA 2ZY3A 1IBJA 2JJEA 3FVUA 1TOKA 1B8GA 1C7NA 2E7UA 3FQ8A 3JW9A 2D63A 4RJYA 5EAAA 1D7SA 4MSOA 2E7IA 2BI2A 2VMTA 3MAFB 2YHKA 3EZ1A 1AIBA 3AENB 3WKSA 1C7OA 1TARA 1I41A 4XJLA 3RUYA 1LK9A 4WYEA 3VP6A 3WLXA 3BCBA 5F8VA 4HF8A 3EI6A 3G7QA 1S0AA 1X28A 2HUUA 2Z61A 1W7LA 3FZ8A 4F5FA 2C81A 2YRIA 3OP7A 1FG3A 3FQ7A 3LV2A 4WYFA 1ECXA 3QM2A 1GC3A 4M2KA 3DR7A 1RV4A 4W1VA 4JEXA 2GQNA 2Z1YA 4HVKA 1IVRA 1ARIA 5E3KA 3PGYA 2D66A 2JJHA 2AY4A 4GE4A 4ZWVA 3DRDA 3QPGA 2VGTA 3TATA 1D7VA 4WLHA 4Q75A 1ZOBA 2OGEA 1ASFA 7AATA 2BI9A 1BW0A 2BI3A 2R2NA 5EQCA 1AMAA 3DODA 4E3RA 2X8UA 2VMSA 3B1EA 5G2PA 4IXOA 3DU4A 3WGCA 1IX8A 4A0GA 3RQ1A 5J8QA 3NYTA 2D7YA 1B9HA 2VMVA 4L0OA 1DGDA 4MQQA 4ZDLA 4E3QA 2EGYA 3I16A 4WBTA 1QIRA 3USFA 1MDOA 1V2FA 5EUDA 3CBFA 2QB2A 2W7GA 3BV0A 4WYDA 1RVYA 1IX6A 3MAUA 2W8JA 2VIAA 2VMPA 1PG8A 4WB0A 1CZEA 3UWCA 4CBSA 1YOOA 2QMAA 1AY8A 2DR1A 2VYCA 3ZRRA 1G4VA 1WKHA 4ATQA 1WYVB 2BI1A 3AELA 3ELPA 3NUIA 4OYTA 4XJOA 3BCXA 3PD6A 1MLYA 1AICA 2CINA 1OXPA 4WYCA 5G2QA 1EG5A 2VGZA 4EB5A 2YKXA 4TMRA 3LVMA 4XJMA 4EFFA 3EUCA 3E2FA 4ADDA 3HL2A 2D61A 3ISLA 5FT8A 3RBFA 3BCAA 1J04A 3HMUA 2VLFA 4MQRA 2WK9A 3PAAA 1TOGA 2TPLA 3EI8A 3IHJA 3TQXA 2R0TA 2VMOA 1AMSA 3RCHA 4ZM3A 3EZSA 1LW5A 4CVQA 1TOJA 1B9IA 4KAMA 3A9ZA 1PFFA 4B9BA 1C4KA 3BC8A 5DJ1A 1KL1A 2HOZA 1X2AA 1YJYA 1AKBA 4W8IA 3PDBA 2CTZA 4EB7A 1CQ7A 1LS3A 4LW2A 1M0OA 3E2ZB 5FT5A 3A2BA 2ZP7A 5K8BA 2OKKA 1GBNA 4AO9A 4E77A 4N0BA 4Q76A 4DBCA 5LHAA 2BI5A 1UU1A 2BIGA 2AY1A 1EQBA 2D64A 2CFBA 4AO4A 1KMJA 4MKKA 1N2TA 1FG7A 1SZUA 3AEOA 4OBVA
chains in the Genus database with same CATH superfamily
4ZAHA 4GEBA 4XJPA 4ADBA 1DJ9A 4UHOA 3B8XA 2BIEA 1MGVA 1ARTA 3ASAA 4AH3A 2ZJGA 1O69A 4R8DA 2X3LA 3CQ6A 3F6TA 1AAWA 1MAQA 1BJOA 1MAPA 1D2FA 3P1TA 2VLHA 3FDBA 3BB8A 3I4JA 2GB3A 1GEYA 2ZY2A 2XBNA 3ZRPA 1IJIA 2AEUA 4ZSYA 3GZCA 3E2YA 1CQ8A 1N31A 1WYUA 3G0TA 4FFCA 1BS0A 1OHWA 1AHGA 3BN1A 1AKAA 3FZ6A 3VK3A 3AEMA 1SF2A 1LC5A 4KXKA 3AATA 2O1BA 3OKSA 3HLMA 4J5UA 1DJEA 3BWNA 4U2HA 1RV3A 4ZASA 1AY5A 2OATA 2YOBA 2YRRA 1CL2A 4RKDA 5AX8A 4FL0A 5HHYA 3R9AA 3ATHA 5G09A 3NRAA 3PDXA 3N7NA 4LW4A 4OC9A 1XEYA 2JJFA 3KE3A 4A0FA 2O0RA 2HORA 2O7CA 1M6SA 2CH1A 1ZC9A 2YCTA 3VK2A 5I92A 3NNKA 3A8UX 3KGWA 5M4DA 3P6KA 1M0QA 3AEMC 4XK1A 1AX4A 1J32A 3R4TA 1U08A 3WCOA 1AJSB 4BMKA 4TV7A 2V0YA 2HUFA 1O4SA 3BWNC 3EI5A 3NTJA 3FVXA 4BA4A 1BJ4A 4JEVA 3DYDA 2DKBA 2HP1A 1OXOA 2ORDA 3FKDA 2R5EA 4PFFA 1W7MA 3N4RA 1BT4A 1GDEA 4CXRA 3GSBA 2HZPA 5DB5A 4JEWA 5LH9A 2D7ZA 1ASAA 3LVKA 4WXBA 3UAKA 4F5GA 1GD9A 4EMYA 2AY3A 2D5YA 4ZSWA 3ZZKA 1ARSA 4H51A 4ISYA 3W1HA 4ATPA 5HXXA 1B4XA 2EPJA 1QISA 4AZJA 2AY9A 3D6KA 3ECDA 3NX3A 1IX7A 2EH6A 3ASBA 3A9YA 4LNLA 4RM1A 2BIAA 3NYUA 4R5ZA 3COGA 1AJRA 2CSTA 2W8TA 4A72A 4EU1A 4K2MA 3N4XA 1E5EA 2CH2A 1OATA 2VGUA 2VMUA 3NYSA 1ARHA 4M2JA 2OQXA 3AEPA 3QBOA 4O6ZA 1D7RA 2DKJA 3KKIA 3QI6A 1M0PA 2BHXA 2VMYA 3CQ4A 2CB1A 4WLJA 3TFTA 1JF9A 2Z20A 1AAMA 2Z67A 2GSAA 4ZDOA 1CL1A 2R5CB 1LC8A 2YCNA 1TPLA 3NDNA 1PMMA 4RLGA 4F4EA 4H63Q 2V1PA 3B1CA 1ASGA 4OT8A 4KYOA 1DJUA 2W8WA 3F0HA 2BWPA 3B1DA 4A0RA 2EZ1A 1IUGA 4PFNA 2FN6A 2VMRA 3AV7A 4GRXA 1LC7A 3NUBA 1TASA 2DGLA 3DZZA 1CZCA 1CJ0A 4XQ2A 4WB0B 4U1TA 2BYLA 1D7UA 1ELQA 1V2DA 3FFHA 2W7HA 1W7NA 1ASNA 1LW4A 2VGVA 2W8VA 2WB6A 3ACZA 4A0HA 1I48A 5EUEA 1VEFA 1JG8A 2CJHA 2WK7A 1JS3A 3PD6B 3I5TA 4ITGA 4AZKA 2ZUKA 1WYTA 3RBLA 5IWQA 4B98A 2BWNA 2W7DA 4WP0A 5G4JA 4A00A 1X29A 2KFPA 4W1XA 1YIZA 1AHYA 2FYFA 2EZ2A 5M49A 3MEBA 2ZC0A 5BJ4A 2QA3A 1DGEA 1C0NA 2YKUA 4Y0DA 5EIGA 4IYOB 1O61A 1KKJA 3JWAA 3WCNA 1C9CA 3AOWA 4GE9A 1ASMA 3E2ZA 3MADA 2E7JA 1EJIA 3FD0A 4K2BA 9AATA 3DXWA 2G6WA 3MC6C 4W1WA 4LNMA 1YJZA 4OMAA 3DC1A 1TATA 4PIWA 2OKJA 2W7JA 2C44A 2QLRA 4F5KA 3GWPA 2DGKA 2DOUA 1UKJA 4ZDPA 2W7KA 1BQAA 4DQ6A 3VOMA 3EI7A 2AEVA 2CY8A 3G8MA 3FZ7A 1YNUA 3HT4A 1VJOA 5E4ZA 5G4IA 3VK4A 1KMKA 4RITA 1M4NA 4E1OA 4ZWMA 1MDZA 1SVVA 1UU0A 3N75A 4JF1A 4ADEA 4F5MA 1B5PA 3GZDC 5M46A 3QGUA 1Z7DA 2AATA 4JF0A 4W5KA 4UHMA 3NU7A 4XAUA 3WX9A 1BKGA 1SFFA 3MBBA 2PO3A 4IX8A 3IF2A 4JEYA 3E77A 3MKJA 4MKJA 2VGWA 2BKWA 1BJOB 2QB3A 3PA9A 2JGTA 3N0LA 3MAFA 3CQ5A 3HVYA 1WYUB 3JWBA 4WYGA 3VAXA 3GETA 1CS1A 2AY2A 4MQPA 1AIAA 1LKCA 2HP2A 1SZSA 3AENA 3LVJA 1H0CA 1GEWA 1S09A 1SPAA 3EIAA 3F9TA 4RJ0A 2VI8A 1Z3ZA 1ZODA 1DKAA 3FRKA 4RAEA 4TN4A 5EUNA 4BQ0A 2Q7WA 1M0NA 2E54A 2NMPA 2Z9XA 3E9KA 3FDDA 2WKAA 3JU7A 1Y4IA 2FKIA 1T3IA 2EYQA 1ASDA 2FNUA 1S06A 1QITA 3LG0A 1AHXA 4BA5A 5C6UA 2HOXA 5F9SA 2YCPA 1FC4A 2ZY4A 2OGAA 3EIBA 3K28A 5M4BA 2FQ6A 4UOYA 1AKCA 2C0RA 3HBXA 3FVSA 1KKPA 2VGSA 5DJ9A 1C7GA 4DGTA 3NU8A 1ORDA 3HDOA 3GR9A 2XH1A 1G4XA 4OBUA 3WGBA 1TOEA 3L8AA 1ARGA 1MLZA 4CBRA 4F5IA 2QBTA 3LY1A 2ZYJA 1SZKA 3GBXA 1ELUA 2JG2A 4MGRA 2W7MA 1UU2A 1V2EA 2AY8A 3M5UA 5JAYA 3WZFA 3DR4A 1G7XA 1GC0A 2DGMA 1S08A 1ASBA 3DXVA 1DFOA 5FT6A 4JE5A 4RKCA 4F5HA 1GEXA 5D95A 3RI6A 1MDXA 2A1VA 2HOYA 2ZSMA 4GDYA 2BYJA 5E5IA 4A6UA 4ZLVA 1I43A 2R5CA 3GJUA 1X0MA 4WXFA 1AHEA 1WYVA 4Y0IA 8AATA 1YJSA 2AY7A 3B46A 3LWSA 2JJGA 1BJWA 1N8PA 3W1JA 3L44A 2FM1A 4WYAA 3TCMA 2W7EA 3N5MA 4MY5A 2D65A 1B5OA 1V72A 3FCRA 4IW7A 2ZY5A 1PMOA 1P3WA 1M32A 3N4SA 2F8JA 2PB0A 3T32A 3A9XA 3ELEA 3FFRA 1ASCA 1ASLA 1WSTA 3H9XA 4LC3A 2CJDA 2GMUA 4R2NA 1WKGA 3EI9A 5HDMA 4IXZA 3MC6A 5D5SA 3HQTA 1XI9A 2BWOA 4QGRA 3AEJA 3JZLA 3FSLA 4Q31A 4ADCA 2Z9UA 1QGNA 4UQVA 4Y0HA 2W7FA 3E6GA 1W3UA 1QJ5A 3ZZJA 2QSRA 1YIYA 4R5FA 3K7YA 2RFVA 5FT4A 1OHVA 3H7FA 2VMNA 3II0A 1RVUA 3QN6A 4IYOA 1IAXA 5EAVA 3UE8A 3BWOA 2VMWA 4IXSA 4P7YA 3K40A 2Z9VA 3RCHB 5DX5A 4OCAA 3W1IA 4A6TA 3PPLA 1AMQA 3TFUA 1WYTB 2X5FA 3AEJC 4ITXA 2W7IA 5BJ3A 1VP4A 1W23A 3GZDA 4AOAA 1AMRA 4LNJA 4P3MA 1GC4A 4JEZA 4K2IA 2GMSA 2W7LA 4F5JA 3WKRA 4N0WA 2W8UA 4NOGA 1OHYA 2C7TA 5G0AA 3PDBB 2YKYA 1BQDA 5EIGB 3AOVA 4UHNA 4XEWA 2VIBA 3WY7A 4GE7A 1JS6A 1QZ9A 2Z1ZA 2EO5A 2VI9A 4Q6RA 4WD2A 2AY6A 1I29A 3LVLB 3PIUA 1KAFA 1TOIA 2CANA 2CJGA 1O62A 4GSAA 4WXGA 4W91A 1E5FA 2G7JA 3CAIA 3QHXA 4IY7A 3KGXA 1GC2A 2FNIA 1DTYA 4I8AA 2WK8A 4F5LA 1H1CA 3PJ0A 4BHDA 2VMXA 1AHFA 3ZRQA 4J8LA 2X5DA 1S07A 1G7WA 1YAAA 3JTXA 1KL2A 1QJ3A 4PVFA 5TF5A 2YKVA 4M2MA 3FQAA 2JISA 5EFSA 3BS8A 3H14A 4A6RA 2ZSLA 2PB2A 4ZM4A 2Z9WA 1AY4A 2VMZA 4RIZA 3Q8NA 1CQ6A 2AY5A 1BJNA 3FTBA 1AJSA 1GCKA 4JE5D 2HUIA 4OTLA 1IAYA 1M7YA 2VMQA 1ASEA 4CXQA 2ZY3A 1IBJA 2JJEA 3FVUA 1TOKA 1B8GA 1C7NA 2E7UA 3FQ8A 3JW9A 2D63A 4RJYA 5EAAA 5KTBA 1D7SA 4MSOA 2E7IA 2BI2A 2VMTA 3MAFB 2YHKA 3EZ1A 1AIBA 3AENB 3WKSA 1C7OA 1TARA 1I41A 4XJLA 3RUYA 1LK9A 4WYEA 3VP6A 3WLXA 3BCBA 5F8VA 4HF8A 3EI6A 3G7QA 1S0AA 1X28A 2HUUA 2Z61A 1W7LA 3FZ8A 4F5FA 2C81A 2YRIA 3OP7A 1FG3A 3FQ7A 3LV2A 4WYFA 1ECXA 3QM2A 1GC3A 4M2KA 3DR7A 1RV4A 4W1VA 4JEXA 2GQNA 2Z1YA 4HVKA 1IVRA 1ARIA 5E3KA 3PGYA 2D66A 2JJHA 2AY4A 4GE4A 4ZWVA 3DRDA 3QPGA 2VGTA 3TATA 1D7VA 4WLHA 4Q75A 1ZOBA 2OGEA 1ASFA 7AATA 2BI9A 1BW0A 2BI3A 2R2NA 5EQCA 1AMAA 3DODA 4E3RA 2X8UA 2VMSA 3B1EA 5G2PA 4IXOA 3DU4A 3WGCA 1IX8A 4A0GA 3RQ1A 5J8QA 3NYTA 2D7YA 1B9HA 2VMVA 4L0OA 1DGDA 4MQQA 4ZDLA 4E3QA 4K05A 2EGYA 3I16A 4WBTA 1QIRA 3USFA 1MDOA 1V2FA 5EUDA 3CBFA 2QB2A 2W7GA 3BV0A 4WYDA 1RVYA 1IX6A 3MAUA 2W8JA 2VIAA 2VMPA 1PG8A 4WB0A 1CZEA 3UWCA 4CBSA 1YOOA 2QMAA 1AY8A 2DR1A 2VYCA 3ZRRA 1G4VA 1WKHA 4ATQA 1WYVB 2BI1A 3AELA 3ELPA 3NUIA 4OYTA 4XJOA 3BCXA 3PD6A 1MLYA 1AICA 2CINA 1OXPA 4WYCA 5G2QA 1EG5A 2VGZA 4EB5A 2YKXA 4TMRA 3LVMA 4XJMA 4EFFA 3EUCA 3E2FA 4ADDA 3HL2A 2D61A 3ISLA 5FT8A 3RBFA 3BCAA 1J04A 3HMUA 2VLFA 4MQRA 2WK9A 3PAAA 1TOGA 2TPLA 3EI8A 3IHJA 3TQXA 2R0TA 2VMOA 1AMSA 3RCHA 4ZM3A 3EZSA 1LW5A 4CVQA 1TOJA 1B9IA 4KAMA 3A9ZA 1PFFA 4B9BA 1C4KA 3BC8A 5DJ1A 1KL1A 2HOZA 1X2AA 1YJYA 1AKBA 4W8IA 3PDBA 2CTZA 4EB7A 1CQ7A 1LS3A 4LW2A 1M0OA 3E2ZB 5FT5A 3A2BA 2ZP7A 5K8BA 2OKKA 1GBNA 4AO9A 4E77A 4N0BA 4Q76A 4DBCA 5LHAA 2BI5A 1UU1A 2BIGA 2AY1A 1EQBA 2D64A 2CFBA 4AO4A 1KMJA 4MKKA 1N2TA 1FG7A 1SZUA 3AEOA 4OBVA
chains in the Genus database with same CATH topology
4ZAHA 4GEBA 4XJPA 4ADBA 1DJ9A 4UHOA 3B8XA 2BIEA 1MGVA 1ARTA 3ASAA 4AH3A 2ZJGA 1O69A 4R8DA 2X3LA 3CQ6A 3F6TA 1AAWA 1MAQA 1BJOA 1MAPA 1D2FA 3P1TA 2VLHA 3FDBA 3BB8A 3I4JA 2GB3A 1GEYA 2ZY2A 2XBNA 3ZRPA 1IJIA 2AEUA 4ZSYA 3GZCA 3E2YA 1CQ8A 1N31A 1WYUA 3G0TA 4FFCA 1BS0A 1OHWA 1AHGA 3BN1A 1AKAA 3FZ6A 3VK3A 3AEMA 1SF2A 1LC5A 4KXKA 3AATA 2O1BA 3OKSA 3HLMA 4J5UA 1DJEA 3BWNA 4U2HA 1RV3A 4ZASA 1AY5A 2OATA 2YOBA 2YRRA 1CL2A 4RKDA 5AX8A 4FL0A 5HHYA 3R9AA 3ATHA 5G09A 3NRAA 3PDXA 3N7NA 4LW4A 4OC9A 1XEYA 2JJFA 3KE3A 4A0FA 2O0RA 2HORA 2O7CA 1M6SA 2CH1A 1ZC9A 2YCTA 3VK2A 5I92A 3NNKA 3A8UX 3KGWA 5M4DA 3P6KA 1M0QA 3AEMC 4XK1A 1AX4A 1J32A 3R4TA 1U08A 3WCOA 1AJSB 4BMKA 4TV7A 2V0YA 2HUFA 1O4SA 3BWNC 3EI5A 3NTJA 3FVXA 4BA4A 1BJ4A 4JEVA 3DYDA 2DKBA 2HP1A 1OXOA 2ORDA 3FKDA 2R5EA 4PFFA 1W7MA 3N4RA 1BT4A 1GDEA 4CXRA 3GSBA 2HZPA 5DB5A 4JEWA 5LH9A 2D7ZA 1ASAA 3LVKA 4WXBA 3UAKA 4F5GA 1GD9A 4EMYA 2AY3A 2D5YA 4ZSWA 3ZZKA 1ARSA 4H51A 4ISYA 3W1HA 4ATPA 5HXXA 1B4XA 2EPJA 1QISA 4AZJA 2AY9A 3D6KA 3ECDA 3NX3A 1IX7A 2EH6A 3ASBA 3A9YA 4LNLA 4RM1A 2BIAA 3NYUA 4R5ZA 3COGA 1AJRA 2CSTA 2W8TA 4A72A 4EU1A 4K2MA 3N4XA 1E5EA 2CH2A 1OATA 2VGUA 2VMUA 3NYSA 1ARHA 4M2JA 2OQXA 3AEPA 3QBOA 4O6ZA 1D7RA 2DKJA 3KKIA 3QI6A 1M0PA 2BHXA 2VMYA 3CQ4A 2CB1A 4WLJA 3TFTA 1JF9A 2Z20A 1AAMA 2Z67A 2GSAA 4ZDOA 1CL1A 2R5CB 1LC8A 2YCNA 1TPLA 3NDNA 1PMMA 4RLGA 4F4EA 4H63Q 2V1PA 3B1CA 1ASGA 4OT8A 4KYOA 1DJUA 2W8WA 3F0HA 2BWPA 3B1DA 4A0RA 2EZ1A 1IUGA 4PFNA 2FN6A 2VMRA 3AV7A 4GRXA 1LC7A 3NUBA 1TASA 2DGLA 3DZZA 1CZCA 1CJ0A 4XQ2A 4WB0B 4U1TA 2BYLA 1D7UA 1ELQA 1V2DA 3FFHA 2W7HA 1W7NA 1ASNA 1LW4A 2VGVA 2W8VA 2WB6A 3ACZA 4A0HA 1I48A 5EUEA 1VEFA 1JG8A 2CJHA 2WK7A 1JS3A 3PD6B 3I5TA 4ITGA 4AZKA 2ZUKA 1WYTA 3RBLA 5IWQA 4B98A 2BWNA 2W7DA 4WP0A 5G4JA 4A00A 1X29A 2KFPA 4W1XA 1YIZA 1AHYA 2FYFA 2EZ2A 5M49A 3MEBA 2ZC0A 5BJ4A 2QA3A 1DGEA 1C0NA 2YKUA 4Y0DA 5EIGA 4IYOB 1O61A 1KKJA 3JWAA 3WCNA 1C9CA 3AOWA 4GE9A 1ASMA 3E2ZA 3MADA 2E7JA 1EJIA 3FD0A 4K2BA 9AATA 3DXWA 2G6WA 3MC6C 4W1WA 4LNMA 1YJZA 4OMAA 3DC1A 1TATA 4PIWA 2OKJA 2W7JA 2C44A 2QLRA 4F5KA 3GWPA 2DGKA 2DOUA 1UKJA 4ZDPA 2W7KA 1BQAA 4DQ6A 3VOMA 3EI7A 2AEVA 2CY8A 3G8MA 3FZ7A 1YNUA 3HT4A 1VJOA 5E4ZA 5G4IA 3VK4A 1KMKA 4RITA 1M4NA 4E1OA 4ZWMA 1MDZA 1SVVA 1UU0A 3N75A 4JF1A 4ADEA 4F5MA 1B5PA 3GZDC 5M46A 3QGUA 1Z7DA 2AATA 4JF0A 4W5KA 4UHMA 3NU7A 4XAUA 3WX9A 1BKGA 1SFFA 3MBBA 2PO3A 4IX8A 3IF2A 4JEYA 3E77A 3MKJA 4MKJA 2VGWA 2BKWA 1BJOB 2QB3A 3PA9A 2JGTA 3N0LA 3MAFA 3CQ5A 3HVYA 1WYUB 3JWBA 4WYGA 3VAXA 3GETA 1CS1A 2AY2A 4MQPA 1AIAA 1LKCA 2HP2A 1SZSA 3AENA 3LVJA 1H0CA 1GEWA 1S09A 1SPAA 3EIAA 3F9TA 4RJ0A 2VI8A 1Z3ZA 1ZODA 1DKAA 3FRKA 4RAEA 4TN4A 5EUNA 4BQ0A 2Q7WA 1M0NA 2E54A 2NMPA 2Z9XA 3E9KA 3FDDA 2WKAA 3JU7A 1Y4IA 2FKIA 1T3IA 2EYQA 1ASDA 2FNUA 1S06A 1QITA 3LG0A 1AHXA 4BA5A 5C6UA 2HOXA 5F9SA 2YCPA 1FC4A 2ZY4A 2OGAA 3EIBA 3K28A 5M4BA 2FQ6A 4UOYA 1AKCA 2C0RA 3HBXA 3FVSA 1KKPA 2VGSA 5DJ9A 1C7GA 4DGTA 3NU8A 1ORDA 3HDOA 3GR9A 2XH1A 1G4XA 4OBUA 3WGBA 1TOEA 3L8AA 1ARGA 1MLZA 4CBRA 4F5IA 2QBTA 3LY1A 2ZYJA 1SZKA 3GBXA 1ELUA 2JG2A 4MGRA 2W7MA 1UU2A 1V2EA 2AY8A 3M5UA 5JAYA 3WZFA 3DR4A 1G7XA 1GC0A 2DGMA 1S08A 1ASBA 3DXVA 1DFOA 5FT6A 4JE5A 4RKCA 4F5HA 1GEXA 5D95A 3RI6A 1MDXA 2A1VA 2HOYA 2ZSMA 4GDYA 2BYJA 5E5IA 4A6UA 4ZLVA 1I43A 2R5CA 3GJUA 1X0MA 4WXFA 1AHEA 1WYVA 4Y0IA 8AATA 1YJSA 2AY7A 3B46A 3LWSA 2JJGA 1BJWA 1N8PA 3W1JA 3L44A 2FM1A 4WYAA 3TCMA 2W7EA 3N5MA 4MY5A 2D65A 1B5OA 1V72A 3FCRA 4IW7A 2ZY5A 1PMOA 1P3WA 1M32A 3N4SA 2F8JA 2PB0A 3T32A 3A9XA 3ELEA 3FFRA 1ASCA 1ASLA 1WSTA 3H9XA 4LC3A 2CJDA 2GMUA 4R2NA 1WKGA 3EI9A 5HDMA 4IXZA 3MC6A 5D5SA 3HQTA 1XI9A 2BWOA 4QGRA 3AEJA 3JZLA 3FSLA 4Q31A 4ADCA 2Z9UA 1QGNA 4UQVA 4Y0HA 2W7FA 3E6GA 1W3UA 1QJ5A 3ZZJA 2QSRA 1YIYA 4R5FA 3K7YA 2RFVA 5FT4A 1OHVA 3H7FA 2VMNA 3II0A 1RVUA 3QN6A 4IYOA 1IAXA 5EAVA 3UE8A 3BWOA 2VMWA 4IXSA 4P7YA 3K40A 2Z9VA 3RCHB 5DX5A 4OCAA 3W1IA 4A6TA 3PPLA 1AMQA 3TFUA 1WYTB 2X5FA 3AEJC 4ITXA 2W7IA 5BJ3A 1VP4A 1W23A 3GZDA 4AOAA 1AMRA 4LNJA 4P3MA 1GC4A 4JEZA 4K2IA 2GMSA 2W7LA 4F5JA 3WKRA 4N0WA 2W8UA 4NOGA 1OHYA 2C7TA 5G0AA 3PDBB 2YKYA 1BQDA 5EIGB 3AOVA 4UHNA 4XEWA 2VIBA 3WY7A 4GE7A 1JS6A 1QZ9A 2Z1ZA 2EO5A 2VI9A 4Q6RA 4WD2A 2AY6A 1I29A 3LVLB 3PIUA 1TOIA 2CANA 2CJGA 1O62A 4GSAA 4WXGA 4W91A 1E5FA 2G7JA 3CAIA 3QHXA 4IY7A 3KGXA 1GC2A 2FNIA 1DTYA 4I8AA 2WK8A 4F5LA 1H1CA 3PJ0A 4BHDA 2VMXA 1AHFA 3ZRQA 4J8LA 2X5DA 1S07A 1G7WA 1YAAA 3JTXA 1KL2A 1QJ3A 4PVFA 5TF5A 2YKVA 4M2MA 3FQAA 2JISA 5EFSA 3BS8A 3H14A 4A6RA 2ZSLA 2PB2A 4ZM4A 2Z9WA 1AY4A 2VMZA 4RIZA 3Q8NA 1CQ6A 2AY5A 1BJNA 3FTBA 1AJSA 1GCKA 4JE5D 2HUIA 4OTLA 1IAYA 1M7YA 2VMQA 1ASEA 4CXQA 2ZY3A 1IBJA 2JJEA 3FVUA 1TOKA 1B8GA 1C7NA 2E7UA 3FQ8A 3JW9A 2D63A 4RJYA 5EAAA 5KTBA 1D7SA 4MSOA 2E7IA 2BI2A 2VMTA 3MAFB 2YHKA 3EZ1A 1AIBA 3AENB 3WKSA 1C7OA 1TARA 1I41A 4XJLA 3RUYA 1LK9A 4WYEA 3VP6A 3WLXA 3BCBA 5F8VA 4HF8A 3EI6A 3G7QA 1S0AA 1X28A 2HUUA 2Z61A 1W7LA 3FZ8A 4F5FA 2C81A 2YRIA 3OP7A 1FG3A 3FQ7A 3LV2A 4WYFA 1ECXA 3QM2A 1GC3A 4M2KA 3DR7A 1RV4A 4W1VA 4JEXA 2GQNA 2Z1YA 4HVKA 1IVRA 1ARIA 5E3KA 3PGYA 2D66A 2JJHA 2AY4A 4GE4A 4ZWVA 3DRDA 3QPGA 2VGTA 3TATA 1D7VA 4WLHA 4Q75A 1ZOBA 2OGEA 1ASFA 7AATA 2BI9A 1BW0A 2BI3A 2R2NA 5EQCA 1AMAA 3DODA 4E3RA 2X8UA 2VMSA 3B1EA 5G2PA 4IXOA 3DU4A 3WGCA 1IX8A 4A0GA 3RQ1A 5J8QA 3NYTA 2D7YA 1B9HA 2VMVA 4L0OA 1DGDA 4MQQA 4ZDLA 4E3QA 4K05A 2EGYA 3I16A 4WBTA 1QIRA 3USFA 1MDOA 1V2FA 5EUDA 3CBFA 2QB2A 2W7GA 3BV0A 4WYDA 1RVYA 1IX6A 3MAUA 2W8JA 2VIAA 2VMPA 1PG8A 4WB0A 1CZEA 3UWCA 4CBSA 1YOOA 2QMAA 1AY8A 2DR1A 2VYCA 3ZRRA 1G4VA 1WKHA 4ATQA 1WYVB 2BI1A 3AELA 3ELPA 3NUIA 4OYTA 4XJOA 3BCXA 3PD6A 1MLYA 1AICA 2CINA 1OXPA 4WYCA 5G2QA 1EG5A 2VGZA 4EB5A 2YKXA 4TMRA 3LVMA 4XJMA 4EFFA 3EUCA 3E2FA 4ADDA 3HL2A 2D61A 3ISLA 5FT8A 3RBFA 3BCAA 1J04A 3HMUA 2VLFA 4MQRA 2WK9A 3PAAA 1TOGA 2TPLA 3EI8A 3IHJA 3TQXA 2R0TA 2VMOA 1AMSA 3RCHA 4ZM3A 3EZSA 1LW5A 4CVQA 1TOJA 1B9IA 4KAMA 3A9ZA 1PFFA 4B9BA 1C4KA 3BC8A 5DJ1A 1KL1A 2HOZA 1X2AA 1YJYA 1AKBA 4W8IA 3PDBA 2CTZA 4EB7A 1CQ7A 1LS3A 4LW2A 1M0OA 3E2ZB 5FT5A 3A2BA 2ZP7A 5K8BA 2OKKA 1GBNA 4AO9A 4E77A 4N0BA 4Q76A 4DBCA 5LHAA 2BI5A 1UU1A 2BIGA 2AY1A 1EQBA 2D64A 2CFBA 4AO4A 1KMJA 4MKKA 1N2TA 1FG7A 1SZUA 3AEOA 4OBVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZAH A;  4GEB A;  4XJP A;  4ADB A;  1DJ9 A;  4UHO A;  3B8X A;  2BIE A;  1MGV A;  1ART A;  3ASA A;  4AH3 A;  2ZJG A;  1O69 A;  4R8D A;  2X3L A;  3CQ6 A;  3F6T A;  1AAW A;  1MAQ A;  1BJO A;  1MAP A;  1D2F A;  3P1T A;  2VLH A;  3FDB A;  3BB8 A;  3I4J A;  2GB3 A;  1GEY A;  2ZY2 A;  2XBN A;  3ZRP A;  1IJI A;  2AEU A;  4ZSY A;  3GZC A;  3E2Y A;  1CQ8 A;  1N31 A;  1WYU A;  3G0T A;  4FFC A;  1BS0 A;  1OHW A;  1AHG A;  3BN1 A;  1AKA A;  3FZ6 A;  3VK3 A;  3AEM A;  1SF2 A;  1LC5 A;  4KXK A;  3AAT A;  2O1B A;  3OKS A;  3HLM A;  4J5U A;  1DJE A;  3BWN A;  4U2H A;  1RV3 A;  4ZAS A;  1AY5 A;  2OAT A;  2YOB A;  2YRR A;  1CL2 A;  4RKD A;  5AX8 A;  4FL0 A;  5HHY A;  3R9A A;  3ATH A;  5G09 A;  3NRA A;  3PDX A;  4LW4 A;  4OC9 A;  1XEY A;  2JJF A;  3KE3 A;  4A0F A;  2O0R A;  2HOR A;  2O7C A;  1M6S A;  2CH1 A;  1ZC9 A;  2YCT A;  3VK2 A;  5I92 A;  3NNK A;  3A8U X;  3KGW A;  5M4D A;  3P6K A;  1M0Q A;  3AEM C;  4XK1 A;  1AX4 A;  1J32 A;  3R4T A;  1U08 A;  3WCO A;  1AJS B;  4BMK A;  4TV7 A;  2V0Y A;  2HUF A;  1O4S A;  3BWN C;  3EI5 A;  3NTJ A;  3FVX A;  4BA4 A;  1BJ4 A;  4JEV A;  3DYD A;  2DKB A;  2HP1 A;  1OXO A;  2ORD A;  3FKD A;  2R5E A;  4PFF A;  1W7M A;  1BT4 A;  1GDE A;  4CXR A;  3GSB A;  2HZP A;  5DB5 A;  4JEW A;  5LH9 A;  2D7Z A;  1ASA A;  3LVK A;  4WXB A;  3UAK A;  4F5G A;  1GD9 A;  4EMY A;  2AY3 A;  2D5Y A;  4ZSW A;  3ZZK A;  1ARS A;  4H51 A;  4ISY A;  3W1H A;  4ATP A;  5HXX A;  1B4X A;  2EPJ A;  1QIS A;  4AZJ A;  2AY9 A;  3D6K A;  3ECD A;  3NX3 A;  1IX7 A;  2EH6 A;  3ASB A;  3A9Y A;  4LNL A;  4RM1 A;  2BIA A;  3NYU A;  4R5Z A;  3COG A;  1AJR A;  2CST A;  2W8T A;  4A72 A;  4EU1 A;  4K2M A;  1E5E A;  2CH2 A;  1OAT A;  2VGU A;  2VMU A;  3NYS A;  1ARH A;  4M2J A;  2OQX A;  3AEP A;  3QBO A;  4O6Z A;  1D7R A;  2DKJ A;  3KKI A;  3QI6 A;  1M0P A;  2BHX A;  2VMY A;  3CQ4 A;  2CB1 A;  4WLJ A;  3TFT A;  1JF9 A;  2Z20 A;  1AAM A;  2Z67 A;  2GSA A;  4ZDO A;  1CL1 A;  2R5C B;  1LC8 A;  2YCN A;  1TPL A;  3NDN A;  1PMM A;  4RLG A;  4F4E A;  2V1P A;  3B1C A;  1ASG A;  4OT8 A;  4KYO A;  1DJU A;  2W8W A;  3F0H A;  2BWP A;  3B1D A;  4A0R A;  2EZ1 A;  1IUG A;  4PFN A;  2FN6 A;  2VMR A;  3AV7 A;  4GRX A;  1LC7 A;  3NUB A;  1TAS A;  2DGL A;  3DZZ A;  1CZC A;  1CJ0 A;  4XQ2 A;  4WB0 B;  4U1T A;  2BYL A;  1D7U A;  1ELQ A;  1V2D A;  3FFH A;  2W7H A;  1W7N A;  1ASN A;  1LW4 A;  2VGV A;  2W8V A;  3ACZ A;  4A0H A;  1I48 A;  5EUE A;  1VEF A;  1JG8 A;  2CJH A;  2WK7 A;  1JS3 A;  3PD6 B;  3I5T A;  4ITG A;  4AZK A;  2ZUK A;  1WYT A;  3RBL A;  5IWQ A;  4B98 A;  2BWN A;  2W7D A;  4WP0 A;  5G4J A;  4A00 A;  1X29 A;  4W1X A;  1YIZ A;  1AHY A;  2FYF A;  2EZ2 A;  5M49 A;  3MEB A;  2ZC0 A;  5BJ4 A;  2QA3 A;  1DGE A;  1C0N A;  2YKU A;  4Y0D A;  5EIG A;  4IYO B;  1O61 A;  1KKJ A;  3JWA A;  3WCN A;  1C9C A;  3AOW A;  4GE9 A;  1ASM A;  3E2Z A;  3MAD A;  2E7J A;  1EJI A;  3FD0 A;  4K2B A;  9AAT A;  3DXW A;  2G6W A;  3MC6 C;  4W1W A;  4LNM A;  1YJZ A;  4OMA A;  3DC1 A;  1TAT A;  4PIW A;  2OKJ A;  2W7J A;  2C44 A;  2QLR A;  4F5K A;  3GWP A;  2DGK A;  2DOU A;  1UKJ A;  4ZDP A;  2W7K A;  1BQA A;  4DQ6 A;  3VOM A;  3EI7 A;  2AEV A;  2CY8 A;  3G8M A;  3FZ7 A;  1YNU A;  3HT4 A;  1VJO A;  5E4Z A;  5G4I A;  3VK4 A;  1KMK A;  4RIT A;  1M4N A;  4E1O A;  4ZWM A;  1MDZ A;  1SVV A;  1UU0 A;  3N75 A;  4JF1 A;  4ADE A;  4F5M A;  1B5P A;  3GZD C;  5M46 A;  3QGU A;  1Z7D A;  2AAT A;  4JF0 A;  4W5K A;  4UHM A;  3NU7 A;  4XAU A;  3WX9 A;  1BKG A;  1SFF A;  3MBB A;  2PO3 A;  4IX8 A;  3IF2 A;  4JEY A;  3E77 A;  3MKJ A;  4MKJ A;  2VGW A;  2BKW A;  1BJO B;  2QB3 A;  3PA9 A;  2JGT A;  3N0L A;  3MAF A;  3CQ5 A;  3HVY A;  1WYU B;  3JWB A;  4WYG A;  3VAX A;  3GET A;  1CS1 A;  2AY2 A;  4MQP A;  1AIA A;  1LKC A;  2HP2 A;  1SZS A;  3AEN A;  3LVJ A;  1H0C A;  1GEW A;  1S09 A;  1SPA A;  3EIA A;  3F9T A;  4RJ0 A;  2VI8 A;  1Z3Z A;  1ZOD A;  1DKA A;  3FRK A;  4RAE A;  4TN4 A;  5EUN A;  4BQ0 A;  2Q7W A;  1M0N A;  2E54 A;  2NMP A;  2Z9X A;  3E9K A;  3FDD A;  2WKA A;  3JU7 A;  1Y4I A;  1T3I A;  1ASD A;  2FNU A;  1S06 A;  1QIT A;  3LG0 A;  1AHX A;  4BA5 A;  5C6U A;  2HOX A;  5F9S A;  2YCP A;  1FC4 A;  2ZY4 A;  2OGA A;  3EIB A;  3K28 A;  5M4B A;  2FQ6 A;  4UOY A;  1AKC A;  2C0R A;  3HBX A;  3FVS A;  1KKP A;  2VGS A;  5DJ9 A;  1C7G A;  4DGT A;  3NU8 A;  1ORD A;  3HDO A;  3GR9 A;  2XH1 A;  1G4X A;  4OBU A;  3WGB A;  1TOE A;  3L8A A;  1ARG A;  1MLZ A;  4CBR A;  4F5I A;  2QBT A;  3LY1 A;  2ZYJ A;  1SZK A;  3GBX A;  1ELU A;  2JG2 A;  4MGR A;  2W7M A;  1UU2 A;  1V2E A;  2AY8 A;  3M5U A;  5JAY A;  3WZF A;  3DR4 A;  1G7X A;  1GC0 A;  2DGM A;  1S08 A;  1ASB A;  3DXV A;  1DFO A;  5FT6 A;  4JE5 A;  4RKC A;  4F5H A;  1GEX A;  5D95 A;  3RI6 A;  1MDX A;  2HOY A;  2ZSM A;  4GDY A;  2BYJ A;  5E5I A;  4A6U A;  4ZLV A;  1I43 A;  2R5C A;  3GJU A;  1X0M A;  4WXF A;  1AHE A;  1WYV A;  4Y0I A;  8AAT A;  1YJS A;  2AY7 A;  3B46 A;  3LWS A;  2JJG A;  1BJW A;  1N8P A;  3W1J A;  3L44 A;  2FM1 A;  4WYA A;  3TCM A;  2W7E A;  3N5M A;  4MY5 A;  2D65 A;  1B5O A;  1V72 A;  3FCR A;  4IW7 A;  2ZY5 A;  1PMO A;  1P3W A;  1M32 A;  2F8J A;  2PB0 A;  3T32 A;  3A9X A;  3ELE A;  3FFR A;  1ASC A;  1ASL A;  1WST A;  4LC3 A;  2CJD A;  2GMU A;  4R2N A;  1WKG A;  3EI9 A;  5HDM A;  4IXZ A;  3MC6 A;  5D5S A;  3HQT A;  1XI9 A;  2BWO A;  4QGR A;  3AEJ A;  3JZL A;  3FSL A;  4Q31 A;  4ADC A;  2Z9U A;  1QGN A;  4UQV A;  4Y0H A;  2W7F A;  3E6G A;  1W3U A;  1QJ5 A;  3ZZJ A;  1YIY A;  4R5F A;  3K7Y A;  2RFV A;  5FT4 A;  1OHV A;  3H7F A;  2VMN A;  3II0 A;  1RVU A;  3QN6 A;  4IYO A;  1IAX A;  5EAV A;  3UE8 A;  3BWO A;  2VMW A;  4IXS A;  4P7Y A;  3K40 A;  2Z9V A;  3RCH B;  5DX5 A;  4OCA A;  3W1I A;  4A6T A;  3PPL A;  1AMQ A;  3TFU A;  1WYT B;  2X5F A;  3AEJ C;  4ITX A;  2W7I A;  5BJ3 A;  1VP4 A;  1W23 A;  3GZD A;  4AOA A;  1AMR A;  4LNJ A;  4P3M A;  1GC4 A;  4JEZ A;  4K2I A;  2GMS A;  2W7L A;  4F5J A;  3WKR A;  4N0W A;  2W8U A;  4NOG A;  1OHY A;  2C7T A;  5G0A A;  3PDB B;  2YKY A;  1BQD A;  5EIG B;  3AOV A;  4UHN A;  4XEW A;  2VIB A;  3WY7 A;  4GE7 A;  1JS6 A;  1QZ9 A;  2Z1Z A;  2EO5 A;  2VI9 A;  4Q6R A;  4WD2 A;  2AY6 A;  1I29 A;  3LVL B;  3PIU A;  1TOI A;  2CAN A;  2CJG A;  1O62 A;  4GSA A;  4WXG A;  4W91 A;  1E5F A;  3CAI A;  3QHX A;  4IY7 A;  3KGX A;  1GC2 A;  2FNI A;  1DTY A;  4I8A A;  2WK8 A;  4F5L A;  1H1C A;  3PJ0 A;  4BHD A;  2VMX A;  1AHF A;  3ZRQ A;  4J8L A;  2X5D A;  1S07 A;  1G7W A;  1YAA A;  3JTX A;  1KL2 A;  1QJ3 A;  4PVF A;  5TF5 A;  2YKV A;  4M2M A;  3FQA A;  2JIS A;  5EFS A;  3BS8 A;  3H14 A;  4A6R A;  2ZSL A;  2PB2 A;  4ZM4 A;  2Z9W A;  1AY4 A;  2VMZ A;  4RIZ A;  3Q8N A;  1CQ6 A;  2AY5 A;  1BJN A;  3FTB A;  1AJS A;  1GCK A;  4JE5 D;  2HUI A;  4OTL A;  1IAY A;  1M7Y A;  2VMQ A;  1ASE A;  4CXQ A;  2ZY3 A;  1IBJ A;  2JJE A;  3FVU A;  1TOK A;  1B8G A;  1C7N A;  2E7U A;  3FQ8 A;  3JW9 A;  2D63 A;  4RJY A;  5EAA A;  1D7S A;  4MSO A;  2E7I A;  2BI2 A;  2VMT A;  3MAF B;  2YHK A;  3EZ1 A;  1AIB A;  3AEN B;  3WKS A;  1C7O A;  1TAR A;  1I41 A;  4XJL A;  3RUY A;  1LK9 A;  4WYE A;  3VP6 A;  3WLX A;  3BCB A;  5F8V A;  4HF8 A;  3EI6 A;  3G7Q A;  1S0A A;  1X28 A;  2HUU A;  2Z61 A;  1W7L A;  3FZ8 A;  4F5F A;  2C81 A;  2YRI A;  3OP7 A;  1FG3 A;  3FQ7 A;  3LV2 A;  4WYF A;  1ECX A;  3QM2 A;  1GC3 A;  4M2K A;  3DR7 A;  1RV4 A;  4W1V A;  4JEX A;  2GQN A;  2Z1Y A;  4HVK A;  1IVR A;  1ARI A;  5E3K A;  3PGY A;  2D66 A;  2JJH A;  2AY4 A;  4GE4 A;  4ZWV A;  3DRD A;  3QPG A;  2VGT A;  3TAT A;  1D7V A;  4WLH A;  4Q75 A;  1ZOB A;  2OGE A;  1ASF A;  7AAT A;  2BI9 A;  1BW0 A;  2BI3 A;  2R2N A;  5EQC A;  1AMA A;  3DOD A;  4E3R A;  2X8U A;  2VMS A;  3B1E A;  5G2P A;  4IXO A;  3DU4 A;  3WGC A;  1IX8 A;  4A0G A;  3RQ1 A;  5J8Q A;  3NYT A;  2D7Y A;  1B9H A;  2VMV A;  4L0O A;  1DGD A;  4MQQ A;  4ZDL A;  4E3Q A;  2EGY A;  3I16 A;  4WBT A;  1QIR A;  3USF A;  1MDO A;  1V2F A;  5EUD A;  3CBF A;  2QB2 A;  2W7G A;  3BV0 A;  4WYD A;  1RVY A;  1IX6 A;  3MAU A;  2W8J A;  2VIA A;  2VMP A;  1PG8 A;  4WB0 A;  1CZE A;  3UWC A;  4CBS A;  1YOO A;  2QMA A;  1AY8 A;  2DR1 A;  2VYC A;  3ZRR A;  1G4V A;  1WKH A;  4ATQ A;  1WYV B;  2BI1 A;  3AEL A;  3ELP A;  3NUI A;  4OYT A;  4XJO A;  3BCX A;  3PD6 A;  1MLY A;  1AIC A;  2CIN A;  1OXP A;  4WYC A;  5G2Q A;  1EG5 A;  2VGZ A;  4EB5 A;  2YKX A;  4TMR A;  3LVM A;  4XJM A;  4EFF A;  3EUC A;  3E2F A;  4ADD A;  3HL2 A;  2D61 A;  3ISL A;  5FT8 A;  3RBF A;  3BCA A;  1J04 A;  3HMU A;  2VLF A;  4MQR A;  2WK9 A;  3PAA A;  1TOG A;  2TPL A;  3EI8 A;  3IHJ A;  3TQX A;  2R0T A;  2VMO A;  1AMS A;  3RCH A;  4ZM3 A;  3EZS A;  1LW5 A;  4CVQ A;  1TOJ A;  1B9I A;  4KAM A;  3A9Z A;  1PFF A;  4B9B A;  1C4K A;  3BC8 A;  5DJ1 A;  1KL1 A;  2HOZ A;  1X2A A;  1YJY A;  1AKB A;  4W8I A;  3PDB A;  2CTZ A;  4EB7 A;  1CQ7 A;  1LS3 A;  4LW2 A;  1M0O A;  3E2Z B;  5FT5 A;  3A2B A;  2ZP7 A;  5K8B A;  2OKK A;  1GBN A;  4AO9 A;  4E77 A;  4N0B A;  4Q76 A;  4DBC A;  5LHA A;  2BI5 A;  1UU1 A;  2BIG A;  2AY1 A;  1EQB A;  2D64 A;  2CFB A;  4AO4 A;  1KMJ A;  4MKK A;  1N2T A;  1FG7 A;  1SZU A;  3AEO A;  4OBV A; 
#chains in the Genus database with same CATH topology
 4ZAH A;  4GEB A;  4XJP A;  4ADB A;  1DJ9 A;  4UHO A;  3B8X A;  2BIE A;  1MGV A;  1ART A;  3ASA A;  4AH3 A;  2ZJG A;  1O69 A;  4R8D A;  2X3L A;  3CQ6 A;  3F6T A;  1AAW A;  1MAQ A;  1BJO A;  1MAP A;  1D2F A;  3P1T A;  2VLH A;  3FDB A;  3BB8 A;  3I4J A;  2GB3 A;  1GEY A;  2ZY2 A;  2XBN A;  3ZRP A;  1IJI A;  2AEU A;  4ZSY A;  3GZC A;  3E2Y A;  1CQ8 A;  1N31 A;  1WYU A;  3G0T A;  4FFC A;  1BS0 A;  1OHW A;  1AHG A;  3BN1 A;  1AKA A;  3FZ6 A;  3VK3 A;  3AEM A;  1SF2 A;  1LC5 A;  4KXK A;  3AAT A;  2O1B A;  3OKS A;  3HLM A;  4J5U A;  1DJE A;  3BWN A;  4U2H A;  1RV3 A;  4ZAS A;  1AY5 A;  2OAT A;  2YOB A;  2YRR A;  1CL2 A;  4RKD A;  5AX8 A;  4FL0 A;  5HHY A;  3R9A A;  3ATH A;  5G09 A;  3NRA A;  3PDX A;  3N7N A;  4LW4 A;  4OC9 A;  1XEY A;  2JJF A;  3KE3 A;  4A0F A;  2O0R A;  2HOR A;  2O7C A;  1M6S A;  2CH1 A;  1ZC9 A;  2YCT A;  3VK2 A;  5I92 A;  3NNK A;  3A8U X;  3KGW A;  5M4D A;  3P6K A;  1M0Q A;  3AEM C;  4XK1 A;  1AX4 A;  1J32 A;  3R4T A;  1U08 A;  3WCO A;  1AJS B;  4BMK A;  4TV7 A;  2V0Y A;  2HUF A;  1O4S A;  3BWN C;  3EI5 A;  3NTJ A;  3FVX A;  4BA4 A;  1BJ4 A;  4JEV A;  3DYD A;  2DKB A;  2HP1 A;  1OXO A;  2ORD A;  3FKD A;  2R5E A;  4PFF A;  1W7M A;  3N4R A;  1BT4 A;  1GDE A;  4CXR A;  3GSB A;  2HZP A;  5DB5 A;  4JEW A;  5LH9 A;  2D7Z A;  1ASA A;  3LVK A;  4WXB A;  3UAK A;  4F5G A;  1GD9 A;  4EMY A;  2AY3 A;  2D5Y A;  4ZSW A;  3ZZK A;  1ARS A;  4H51 A;  4ISY A;  3W1H A;  4ATP A;  5HXX A;  1B4X A;  2EPJ A;  1QIS A;  4AZJ A;  2AY9 A;  3D6K A;  3ECD A;  3NX3 A;  1IX7 A;  2EH6 A;  3ASB A;  3A9Y A;  4LNL A;  4RM1 A;  2BIA A;  3NYU A;  4R5Z A;  3COG A;  1AJR A;  2CST A;  2W8T A;  4A72 A;  4EU1 A;  4K2M A;  3N4X A;  1E5E A;  2CH2 A;  1OAT A;  2VGU A;  2VMU A;  3NYS A;  1ARH A;  4M2J A;  2OQX A;  3AEP A;  3QBO A;  4O6Z A;  1D7R A;  2DKJ A;  3KKI A;  3QI6 A;  1M0P A;  2BHX A;  2VMY A;  3CQ4 A;  2CB1 A;  4WLJ A;  3TFT A;  1JF9 A;  2Z20 A;  1AAM A;  2Z67 A;  2GSA A;  4ZDO A;  1CL1 A;  2R5C B;  1LC8 A;  2YCN A;  1TPL A;  3NDN A;  1PMM A;  4RLG A;  4F4E A;  4H63 Q;  2V1P A;  3B1C A;  1ASG A;  4OT8 A;  4KYO A;  1DJU A;  2W8W A;  3F0H A;  2BWP A;  3B1D A;  4A0R A;  2EZ1 A;  1IUG A;  4PFN A;  2FN6 A;  2VMR A;  3AV7 A;  4GRX A;  1LC7 A;  3NUB A;  1TAS A;  2DGL A;  3DZZ A;  1CZC A;  1CJ0 A;  4XQ2 A;  4WB0 B;  4U1T A;  2BYL A;  1D7U A;  1ELQ A;  1V2D A;  3FFH A;  2W7H A;  1W7N A;  1ASN A;  1LW4 A;  2VGV A;  2W8V A;  2WB6 A;  3ACZ A;  4A0H A;  1I48 A;  5EUE A;  1VEF A;  1JG8 A;  2CJH A;  2WK7 A;  1JS3 A;  3PD6 B;  3I5T A;  4ITG A;  4AZK A;  2ZUK A;  1WYT A;  3RBL A;  5IWQ A;  4B98 A;  2BWN A;  2W7D A;  4WP0 A;  5G4J A;  4A00 A;  1X29 A;  2KFP A;  4W1X A;  1YIZ A;  1AHY A;  2FYF A;  2EZ2 A;  5M49 A;  3MEB A;  2ZC0 A;  5BJ4 A;  2QA3 A;  1DGE A;  1C0N A;  2YKU A;  4Y0D A;  5EIG A;  4IYO B;  1O61 A;  1KKJ A;  3JWA A;  3WCN A;  1C9C A;  3AOW A;  4GE9 A;  1ASM A;  3E2Z A;  3MAD A;  2E7J A;  1EJI A;  3FD0 A;  4K2B A;  9AAT A;  3DXW A;  2G6W A;  3MC6 C;  4W1W A;  4LNM A;  1YJZ A;  4OMA A;  3DC1 A;  1TAT A;  4PIW A;  2OKJ A;  2W7J A;  2C44 A;  2QLR A;  4F5K A;  3GWP A;  2DGK A;  2DOU A;  1UKJ A;  4ZDP A;  2W7K A;  1BQA A;  4DQ6 A;  3VOM A;  3EI7 A;  2AEV A;  2CY8 A;  3G8M A;  3FZ7 A;  1YNU A;  3HT4 A;  1VJO A;  5E4Z A;  5G4I A;  3VK4 A;  1KMK A;  4RIT A;  1M4N A;  4E1O A;  4ZWM A;  1MDZ A;  1SVV A;  1UU0 A;  3N75 A;  4JF1 A;  4ADE A;  4F5M A;  1B5P A;  3GZD C;  5M46 A;  3QGU A;  1Z7D A;  2AAT A;  4JF0 A;  4W5K A;  4UHM A;  3NU7 A;  4XAU A;  3WX9 A;  1BKG A;  1SFF A;  3MBB A;  2PO3 A;  4IX8 A;  3IF2 A;  4JEY A;  3E77 A;  3MKJ A;  4MKJ A;  2VGW A;  2BKW A;  1BJO B;  2QB3 A;  3PA9 A;  2JGT A;  3N0L A;  3MAF A;  3CQ5 A;  3HVY A;  1WYU B;  3JWB A;  4WYG A;  3VAX A;  3GET A;  1CS1 A;  2AY2 A;  4MQP A;  1AIA A;  1LKC A;  2HP2 A;  1SZS A;  3AEN A;  3LVJ A;  1H0C A;  1GEW A;  1S09 A;  1SPA A;  3EIA A;  3F9T A;  4RJ0 A;  2VI8 A;  1Z3Z A;  1ZOD A;  1DKA A;  3FRK A;  4RAE A;  4TN4 A;  5EUN A;  4BQ0 A;  2Q7W A;  1M0N A;  2E54 A;  2NMP A;  2Z9X A;  3E9K A;  3FDD A;  2WKA A;  3JU7 A;  1Y4I A;  2FKI A;  1T3I A;  2EYQ A;  1ASD A;  2FNU A;  1S06 A;  1QIT A;  3LG0 A;  1AHX A;  4BA5 A;  5C6U A;  2HOX A;  5F9S A;  2YCP A;  1FC4 A;  2ZY4 A;  2OGA A;  3EIB A;  3K28 A;  5M4B A;  2FQ6 A;  4UOY A;  1AKC A;  2C0R A;  3HBX A;  3FVS A;  1KKP A;  2VGS A;  5DJ9 A;  1C7G A;  4DGT A;  3NU8 A;  1ORD A;  3HDO A;  3GR9 A;  2XH1 A;  1G4X A;  4OBU A;  3WGB A;  1TOE A;  3L8A A;  1ARG A;  1MLZ A;  4CBR A;  4F5I A;  2QBT A;  3LY1 A;  2ZYJ A;  1SZK A;  3GBX A;  1ELU A;  2JG2 A;  4MGR A;  2W7M A;  1UU2 A;  1V2E A;  2AY8 A;  3M5U A;  5JAY A;  3WZF A;  3DR4 A;  1G7X A;  1GC0 A;  2DGM A;  1S08 A;  1ASB A;  3DXV A;  1DFO A;  5FT6 A;  4JE5 A;  4RKC A;  4F5H A;  1GEX A;  5D95 A;  3RI6 A;  1MDX A;  2A1V A;  2HOY A;  2ZSM A;  4GDY A;  2BYJ A;  5E5I A;  4A6U A;  4ZLV A;  1I43 A;  2R5C A;  3GJU A;  1X0M A;  4WXF A;  1AHE A;  1WYV A;  4Y0I A;  8AAT A;  1YJS A;  2AY7 A;  3B46 A;  3LWS A;  2JJG A;  1BJW A;  1N8P A;  3W1J A;  3L44 A;  2FM1 A;  4WYA A;  3TCM A;  2W7E A;  3N5M A;  4MY5 A;  2D65 A;  1B5O A;  1V72 A;  3FCR A;  4IW7 A;  2ZY5 A;  1PMO A;  1P3W A;  1M32 A;  3N4S A;  2F8J A;  2PB0 A;  3T32 A;  3A9X A;  3ELE A;  3FFR A;  1ASC A;  1ASL A;  1WST A;  3H9X A;  4LC3 A;  2CJD A;  2GMU A;  4R2N A;  1WKG A;  3EI9 A;  5HDM A;  4IXZ A;  3MC6 A;  5D5S A;  3HQT A;  1XI9 A;  2BWO A;  4QGR A;  3AEJ A;  3JZL A;  3FSL A;  4Q31 A;  4ADC A;  2Z9U A;  1QGN A;  4UQV A;  4Y0H A;  2W7F A;  3E6G A;  1W3U A;  1QJ5 A;  3ZZJ A;  2QSR A;  1YIY A;  4R5F A;  3K7Y A;  2RFV A;  5FT4 A;  1OHV A;  3H7F A;  2VMN A;  3II0 A;  1RVU A;  3QN6 A;  4IYO A;  1IAX A;  5EAV A;  3UE8 A;  3BWO A;  2VMW A;  4IXS A;  4P7Y A;  3K40 A;  2Z9V A;  3RCH B;  5DX5 A;  4OCA A;  3W1I A;  4A6T A;  3PPL A;  1AMQ A;  3TFU A;  1WYT B;  2X5F A;  3AEJ C;  4ITX A;  2W7I A;  5BJ3 A;  1VP4 A;  1W23 A;  3GZD A;  4AOA A;  1AMR A;  4LNJ A;  4P3M A;  1GC4 A;  4JEZ A;  4K2I A;  2GMS A;  2W7L A;  4F5J A;  3WKR A;  4N0W A;  2W8U A;  4NOG A;  1OHY A;  2C7T A;  5G0A A;  3PDB B;  2YKY A;  1BQD A;  5EIG B;  3AOV A;  4UHN A;  4XEW A;  2VIB A;  3WY7 A;  4GE7 A;  1JS6 A;  1QZ9 A;  2Z1Z A;  2EO5 A;  2VI9 A;  4Q6R A;  4WD2 A;  2AY6 A;  1I29 A;  3LVL B;  3PIU A;  1KAF A;  1TOI A;  2CAN A;  2CJG A;  1O62 A;  4GSA A;  4WXG A;  4W91 A;  1E5F A;  2G7J A;  3CAI A;  3QHX A;  4IY7 A;  3KGX A;  1GC2 A;  2FNI A;  1DTY A;  4I8A A;  2WK8 A;  4F5L A;  1H1C A;  3PJ0 A;  4BHD A;  2VMX A;  1AHF A;  3ZRQ A;  4J8L A;  2X5D A;  1S07 A;  1G7W A;  1YAA A;  3JTX A;  1KL2 A;  1QJ3 A;  4PVF A;  5TF5 A;  2YKV A;  4M2M A;  3FQA A;  2JIS A;  5EFS A;  3BS8 A;  3H14 A;  4A6R A;  2ZSL A;  2PB2 A;  4ZM4 A;  2Z9W A;  1AY4 A;  2VMZ A;  4RIZ A;  3Q8N A;  1CQ6 A;  2AY5 A;  1BJN A;  3FTB A;  1AJS A;  1GCK A;  4JE5 D;  2HUI A;  4OTL A;  1IAY A;  1M7Y A;  2VMQ A;  1ASE A;  4CXQ A;  2ZY3 A;  1IBJ A;  2JJE A;  3FVU A;  1TOK A;  1B8G A;  1C7N A;  2E7U A;  3FQ8 A;  3JW9 A;  2D63 A;  4RJY A;  5EAA A;  5KTB A;  1D7S A;  4MSO A;  2E7I A;  2BI2 A;  2VMT A;  3MAF B;  2YHK A;  3EZ1 A;  1AIB A;  3AEN B;  3WKS A;  1C7O A;  1TAR A;  1I41 A;  4XJL A;  3RUY A;  1LK9 A;  4WYE A;  3VP6 A;  3WLX A;  3BCB A;  5F8V A;  4HF8 A;  3EI6 A;  3G7Q A;  1S0A A;  1X28 A;  2HUU A;  2Z61 A;  1W7L A;  3FZ8 A;  4F5F A;  2C81 A;  2YRI A;  3OP7 A;  1FG3 A;  3FQ7 A;  3LV2 A;  4WYF A;  1ECX A;  3QM2 A;  1GC3 A;  4M2K A;  3DR7 A;  1RV4 A;  4W1V A;  4JEX A;  2GQN A;  2Z1Y A;  4HVK A;  1IVR A;  1ARI A;  5E3K A;  3PGY A;  2D66 A;  2JJH A;  2AY4 A;  4GE4 A;  4ZWV A;  3DRD A;  3QPG A;  2VGT A;  3TAT A;  1D7V A;  4WLH A;  4Q75 A;  1ZOB A;  2OGE A;  1ASF A;  7AAT A;  2BI9 A;  1BW0 A;  2BI3 A;  2R2N A;  5EQC A;  1AMA A;  3DOD A;  4E3R A;  2X8U A;  2VMS A;  3B1E A;  5G2P A;  4IXO A;  3DU4 A;  3WGC A;  1IX8 A;  4A0G A;  3RQ1 A;  5J8Q A;  3NYT A;  2D7Y A;  1B9H A;  2VMV A;  4L0O A;  1DGD A;  4MQQ A;  4ZDL A;  4E3Q A;  4K05 A;  2EGY A;  3I16 A;  4WBT A;  1QIR A;  3USF A;  1MDO A;  1V2F A;  5EUD A;  3CBF A;  2QB2 A;  2W7G A;  3BV0 A;  4WYD A;  1RVY A;  1IX6 A;  3MAU A;  2W8J A;  2VIA A;  2VMP A;  1PG8 A;  4WB0 A;  1CZE A;  3UWC A;  4CBS A;  1YOO A;  2QMA A;  1AY8 A;  2DR1 A;  2VYC A;  3ZRR A;  1G4V A;  1WKH A;  4ATQ A;  1WYV B;  2BI1 A;  3AEL A;  3ELP A;  3NUI A;  4OYT A;  4XJO A;  3BCX A;  3PD6 A;  1MLY A;  1AIC A;  2CIN A;  1OXP A;  4WYC A;  5G2Q A;  1EG5 A;  2VGZ A;  4EB5 A;  2YKX A;  4TMR A;  3LVM A;  4XJM A;  4EFF A;  3EUC A;  3E2F A;  4ADD A;  3HL2 A;  2D61 A;  3ISL A;  5FT8 A;  3RBF A;  3BCA A;  1J04 A;  3HMU A;  2VLF A;  4MQR A;  2WK9 A;  3PAA A;  1TOG A;  2TPL A;  3EI8 A;  3IHJ A;  3TQX A;  2R0T A;  2VMO A;  1AMS A;  3RCH A;  4ZM3 A;  3EZS A;  1LW5 A;  4CVQ A;  1TOJ A;  1B9I A;  4KAM A;  3A9Z A;  1PFF A;  4B9B A;  1C4K A;  3BC8 A;  5DJ1 A;  1KL1 A;  2HOZ A;  1X2A A;  1YJY A;  1AKB A;  4W8I A;  3PDB A;  2CTZ A;  4EB7 A;  1CQ7 A;  1LS3 A;  4LW2 A;  1M0O A;  3E2Z B;  5FT5 A;  3A2B A;  2ZP7 A;  5K8B A;  2OKK A;  1GBN A;  4AO9 A;  4E77 A;  4N0B A;  4Q76 A;  4DBC A;  5LHA A;  2BI5 A;  1UU1 A;  2BIG A;  2AY1 A;  1EQB A;  2D64 A;  2CFB A;  4AO4 A;  1KMJ A;  4MKK A;  1N2T A;  1FG7 A;  1SZU A;  3AEO A;  4OBV A; 
#chains in the Genus database with same CATH homology
 4ZAH A;  4GEB A;  4XJP A;  4ADB A;  1DJ9 A;  4UHO A;  3B8X A;  2BIE A;  1MGV A;  1ART A;  3ASA A;  4AH3 A;  2ZJG A;  1O69 A;  4R8D A;  2X3L A;  3CQ6 A;  3F6T A;  1AAW A;  1MAQ A;  1BJO A;  1MAP A;  1D2F A;  3P1T A;  2VLH A;  3FDB A;  3BB8 A;  3I4J A;  2GB3 A;  1GEY A;  2ZY2 A;  2XBN A;  3ZRP A;  1IJI A;  2AEU A;  4ZSY A;  3GZC A;  3E2Y A;  1CQ8 A;  1N31 A;  1WYU A;  3G0T A;  4FFC A;  1BS0 A;  1OHW A;  1AHG A;  3BN1 A;  1AKA A;  3FZ6 A;  3VK3 A;  3AEM A;  1SF2 A;  1LC5 A;  4KXK A;  3AAT A;  2O1B A;  3OKS A;  3HLM A;  4J5U A;  1DJE A;  3BWN A;  4U2H A;  1RV3 A;  4ZAS A;  1AY5 A;  2OAT A;  2YOB A;  2YRR A;  1CL2 A;  4RKD A;  5AX8 A;  4FL0 A;  5HHY A;  3R9A A;  3ATH A;  5G09 A;  3NRA A;  3PDX A;  3N7N A;  4LW4 A;  4OC9 A;  1XEY A;  2JJF A;  3KE3 A;  4A0F A;  2O0R A;  2HOR A;  2O7C A;  1M6S A;  2CH1 A;  1ZC9 A;  2YCT A;  3VK2 A;  5I92 A;  3NNK A;  3A8U X;  3KGW A;  5M4D A;  3P6K A;  1M0Q A;  3AEM C;  4XK1 A;  1AX4 A;  1J32 A;  3R4T A;  1U08 A;  3WCO A;  1AJS B;  4BMK A;  4TV7 A;  2V0Y A;  2HUF A;  1O4S A;  3BWN C;  3EI5 A;  3NTJ A;  3FVX A;  4BA4 A;  1BJ4 A;  4JEV A;  3DYD A;  2DKB A;  2HP1 A;  1OXO A;  2ORD A;  3FKD A;  2R5E A;  4PFF A;  1W7M A;  3N4R A;  1BT4 A;  1GDE A;  4CXR A;  3GSB A;  2HZP A;  5DB5 A;  4JEW A;  5LH9 A;  2D7Z A;  1ASA A;  3LVK A;  4WXB A;  3UAK A;  4F5G A;  1GD9 A;  4EMY A;  2AY3 A;  2D5Y A;  4ZSW A;  3ZZK A;  1ARS A;  4H51 A;  4ISY A;  3W1H A;  4ATP A;  5HXX A;  1B4X A;  2EPJ A;  1QIS A;  4AZJ A;  2AY9 A;  3D6K A;  3ECD A;  3NX3 A;  1IX7 A;  2EH6 A;  3ASB A;  3A9Y A;  4LNL A;  4RM1 A;  2BIA A;  3NYU A;  4R5Z A;  3COG A;  1AJR A;  2CST A;  2W8T A;  4A72 A;  4EU1 A;  4K2M A;  3N4X A;  1E5E A;  2CH2 A;  1OAT A;  2VGU A;  2VMU A;  3NYS A;  1ARH A;  4M2J A;  2OQX A;  3AEP A;  3QBO A;  4O6Z A;  1D7R A;  2DKJ A;  3KKI A;  3QI6 A;  1M0P A;  2BHX A;  2VMY A;  3CQ4 A;  2CB1 A;  4WLJ A;  3TFT A;  1JF9 A;  2Z20 A;  1AAM A;  2Z67 A;  2GSA A;  4ZDO A;  1CL1 A;  2R5C B;  1LC8 A;  2YCN A;  1TPL A;  3NDN A;  1PMM A;  4RLG A;  4F4E A;  4H63 Q;  2V1P A;  3B1C A;  1ASG A;  4OT8 A;  4KYO A;  1DJU A;  2W8W A;  3F0H A;  2BWP A;  3B1D A;  4A0R A;  2EZ1 A;  1IUG A;  4PFN A;  2FN6 A;  2VMR A;  3AV7 A;  4GRX A;  1LC7 A;  3NUB A;  1TAS A;  2DGL A;  3DZZ A;  1CZC A;  1CJ0 A;  4XQ2 A;  4WB0 B;  4U1T A;  2BYL A;  1D7U A;  1ELQ A;  1V2D A;  3FFH A;  2W7H A;  1W7N A;  1ASN A;  1LW4 A;  2VGV A;  2W8V A;  2WB6 A;  3ACZ A;  4A0H A;  1I48 A;  5EUE A;  1VEF A;  1JG8 A;  2CJH A;  2WK7 A;  1JS3 A;  3PD6 B;  3I5T A;  4ITG A;  4AZK A;  2ZUK A;  1WYT A;  3RBL A;  5IWQ A;  4B98 A;  2BWN A;  2W7D A;  4WP0 A;  5G4J A;  4A00 A;  1X29 A;  2KFP A;  4W1X A;  1YIZ A;  1AHY A;  2FYF A;  2EZ2 A;  5M49 A;  3MEB A;  2ZC0 A;  5BJ4 A;  2QA3 A;  1DGE A;  1C0N A;  2YKU A;  4Y0D A;  5EIG A;  4IYO B;  1O61 A;  1KKJ A;  3JWA A;  3WCN A;  1C9C A;  3AOW A;  4GE9 A;  1ASM A;  3E2Z A;  3MAD A;  2E7J A;  1EJI A;  3FD0 A;  4K2B A;  9AAT A;  3DXW A;  2G6W A;  3MC6 C;  4W1W A;  4LNM A;  1YJZ A;  4OMA A;  3DC1 A;  1TAT A;  4PIW A;  2OKJ A;  2W7J A;  2C44 A;  2QLR A;  4F5K A;  3GWP A;  2DGK A;  2DOU A;  1UKJ A;  4ZDP A;  2W7K A;  1BQA A;  4DQ6 A;  3VOM A;  3EI7 A;  2AEV A;  2CY8 A;  3G8M A;  3FZ7 A;  1YNU A;  3HT4 A;  1VJO A;  5E4Z A;  5G4I A;  3VK4 A;  1KMK A;  4RIT A;  1M4N A;  4E1O A;  4ZWM A;  1MDZ A;  1SVV A;  1UU0 A;  3N75 A;  4JF1 A;  4ADE A;  4F5M A;  1B5P A;  3GZD C;  5M46 A;  3QGU A;  1Z7D A;  2AAT A;  4JF0 A;  4W5K A;  4UHM A;  3NU7 A;  4XAU A;  3WX9 A;  1BKG A;  1SFF A;  3MBB A;  2PO3 A;  4IX8 A;  3IF2 A;  4JEY A;  3E77 A;  3MKJ A;  4MKJ A;  2VGW A;  2BKW A;  1BJO B;  2QB3 A;  3PA9 A;  2JGT A;  3N0L A;  3MAF A;  3CQ5 A;  3HVY A;  1WYU B;  3JWB A;  4WYG A;  3VAX A;  3GET A;  1CS1 A;  2AY2 A;  4MQP A;  1AIA A;  1LKC A;  2HP2 A;  1SZS A;  3AEN A;  3LVJ A;  1H0C A;  1GEW A;  1S09 A;  1SPA A;  3EIA A;  3F9T A;  4RJ0 A;  2VI8 A;  1Z3Z A;  1ZOD A;  1DKA A;  3FRK A;  4RAE A;  4TN4 A;  5EUN A;  4BQ0 A;  2Q7W A;  1M0N A;  2E54 A;  2NMP A;  2Z9X A;  3E9K A;  3FDD A;  2WKA A;  3JU7 A;  1Y4I A;  2FKI A;  1T3I A;  2EYQ A;  1ASD A;  2FNU A;  1S06 A;  1QIT A;  3LG0 A;  1AHX A;  4BA5 A;  5C6U A;  2HOX A;  5F9S A;  2YCP A;  1FC4 A;  2ZY4 A;  2OGA A;  3EIB A;  3K28 A;  5M4B A;  2FQ6 A;  4UOY A;  1AKC A;  2C0R A;  3HBX A;  3FVS A;  1KKP A;  2VGS A;  5DJ9 A;  1C7G A;  4DGT A;  3NU8 A;  1ORD A;  3HDO A;  3GR9 A;  2XH1 A;  1G4X A;  4OBU A;  3WGB A;  1TOE A;  3L8A A;  1ARG A;  1MLZ A;  4CBR A;  4F5I A;  2QBT A;  3LY1 A;  2ZYJ A;  1SZK A;  3GBX A;  1ELU A;  2JG2 A;  4MGR A;  2W7M A;  1UU2 A;  1V2E A;  2AY8 A;  3M5U A;  5JAY A;  3WZF A;  3DR4 A;  1G7X A;  1GC0 A;  2DGM A;  1S08 A;  1ASB A;  3DXV A;  1DFO A;  5FT6 A;  4JE5 A;  4RKC A;  4F5H A;  1GEX A;  5D95 A;  3RI6 A;  1MDX A;  2A1V A;  2HOY A;  2ZSM A;  4GDY A;  2BYJ A;  5E5I A;  4A6U A;  4ZLV A;  1I43 A;  2R5C A;  3GJU A;  1X0M A;  4WXF A;  1AHE A;  1WYV A;  4Y0I A;  8AAT A;  1YJS A;  2AY7 A;  3B46 A;  3LWS A;  2JJG A;  1BJW A;  1N8P A;  3W1J A;  3L44 A;  2FM1 A;  4WYA A;  3TCM A;  2W7E A;  3N5M A;  4MY5 A;  2D65 A;  1B5O A;  1V72 A;  3FCR A;  4IW7 A;  2ZY5 A;  1PMO A;  1P3W A;  1M32 A;  3N4S A;  2F8J A;  2PB0 A;  3T32 A;  3A9X A;  3ELE A;  3FFR A;  1ASC A;  1ASL A;  1WST A;  3H9X A;  4LC3 A;  2CJD A;  2GMU A;  4R2N A;  1WKG A;  3EI9 A;  5HDM A;  4IXZ A;  3MC6 A;  5D5S A;  3HQT A;  1XI9 A;  2BWO A;  4QGR A;  3AEJ A;  3JZL A;  3FSL A;  4Q31 A;  4ADC A;  2Z9U A;  1QGN A;  4UQV A;  4Y0H A;  2W7F A;  3E6G A;  1W3U A;  1QJ5 A;  3ZZJ A;  2QSR A;  1YIY A;  4R5F A;  3K7Y A;  2RFV A;  5FT4 A;  1OHV A;  3H7F A;  2VMN A;  3II0 A;  1RVU A;  3QN6 A;  4IYO A;  1IAX A;  5EAV A;  3UE8 A;  3BWO A;  2VMW A;  4IXS A;  4P7Y A;  3K40 A;  2Z9V A;  3RCH B;  5DX5 A;  4OCA A;  3W1I A;  4A6T A;  3PPL A;  1AMQ A;  3TFU A;  1WYT B;  2X5F A;  3AEJ C;  4ITX A;  2W7I A;  5BJ3 A;  1VP4 A;  1W23 A;  3GZD A;  4AOA A;  1AMR A;  4LNJ A;  4P3M A;  1GC4 A;  4JEZ A;  4K2I A;  2GMS A;  2W7L A;  4F5J A;  3WKR A;  4N0W A;  2W8U A;  4NOG A;  1OHY A;  2C7T A;  5G0A A;  3PDB B;  2YKY A;  1BQD A;  5EIG B;  3AOV A;  4UHN A;  4XEW A;  2VIB A;  3WY7 A;  4GE7 A;  1JS6 A;  1QZ9 A;  2Z1Z A;  2EO5 A;  2VI9 A;  4Q6R A;  4WD2 A;  2AY6 A;  1I29 A;  3LVL B;  3PIU A;  1TOI A;  2CAN A;  2CJG A;  1O62 A;  4GSA A;  4WXG A;  4W91 A;  1E5F A;  2G7J A;  3CAI A;  3QHX A;  4IY7 A;  3KGX A;  1GC2 A;  2FNI A;  1DTY A;  4I8A A;  2WK8 A;  4F5L A;  1H1C A;  3PJ0 A;  4BHD A;  2VMX A;  1AHF A;  3ZRQ A;  4J8L A;  2X5D A;  1S07 A;  1G7W A;  1YAA A;  3JTX A;  1KL2 A;  1QJ3 A;  4PVF A;  5TF5 A;  2YKV A;  4M2M A;  3FQA A;  2JIS A;  5EFS A;  3BS8 A;  3H14 A;  4A6R A;  2ZSL A;  2PB2 A;  4ZM4 A;  2Z9W A;  1AY4 A;  2VMZ A;  4RIZ A;  3Q8N A;  1CQ6 A;  2AY5 A;  1BJN A;  3FTB A;  1AJS A;  1GCK A;  4JE5 D;  2HUI A;  4OTL A;  1IAY A;  1M7Y A;  2VMQ A;  1ASE A;  4CXQ A;  2ZY3 A;  1IBJ A;  2JJE A;  3FVU A;  1TOK A;  1B8G A;  1C7N A;  2E7U A;  3FQ8 A;  3JW9 A;  2D63 A;  4RJY A;  5EAA A;  5KTB A;  1D7S A;  4MSO A;  2E7I A;  2BI2 A;  2VMT A;  3MAF B;  2YHK A;  3EZ1 A;  1AIB A;  3AEN B;  3WKS A;  1C7O A;  1TAR A;  1I41 A;  4XJL A;  3RUY A;  1LK9 A;  4WYE A;  3VP6 A;  3WLX A;  3BCB A;  5F8V A;  4HF8 A;  3EI6 A;  3G7Q A;  1S0A A;  1X28 A;  2HUU A;  2Z61 A;  1W7L A;  3FZ8 A;  4F5F A;  2C81 A;  2YRI A;  3OP7 A;  1FG3 A;  3FQ7 A;  3LV2 A;  4WYF A;  1ECX A;  3QM2 A;  1GC3 A;  4M2K A;  3DR7 A;  1RV4 A;  4W1V A;  4JEX A;  2GQN A;  2Z1Y A;  4HVK A;  1IVR A;  1ARI A;  5E3K A;  3PGY A;  2D66 A;  2JJH A;  2AY4 A;  4GE4 A;  4ZWV A;  3DRD A;  3QPG A;  2VGT A;  3TAT A;  1D7V A;  4WLH A;  4Q75 A;  1ZOB A;  2OGE A;  1ASF A;  7AAT A;  2BI9 A;  1BW0 A;  2BI3 A;  2R2N A;  5EQC A;  1AMA A;  3DOD A;  4E3R A;  2X8U A;  2VMS A;  3B1E A;  5G2P A;  4IXO A;  3DU4 A;  3WGC A;  1IX8 A;  4A0G A;  3RQ1 A;  5J8Q A;  3NYT A;  2D7Y A;  1B9H A;  2VMV A;  4L0O A;  1DGD A;  4MQQ A;  4ZDL A;  4E3Q A;  4K05 A;  2EGY A;  3I16 A;  4WBT A;  1QIR A;  3USF A;  1MDO A;  1V2F A;  5EUD A;  3CBF A;  2QB2 A;  2W7G A;  3BV0 A;  4WYD A;  1RVY A;  1IX6 A;  3MAU A;  2W8J A;  2VIA A;  2VMP A;  1PG8 A;  4WB0 A;  1CZE A;  3UWC A;  4CBS A;  1YOO A;  2QMA A;  1AY8 A;  2DR1 A;  2VYC A;  3ZRR A;  1G4V A;  1WKH A;  4ATQ A;  1WYV B;  2BI1 A;  3AEL A;  3ELP A;  3NUI A;  4OYT A;  4XJO A;  3BCX A;  3PD6 A;  1MLY A;  1AIC A;  2CIN A;  1OXP A;  4WYC A;  5G2Q A;  1EG5 A;  2VGZ A;  4EB5 A;  2YKX A;  4TMR A;  3LVM A;  4XJM A;  4EFF A;  3EUC A;  3E2F A;  4ADD A;  3HL2 A;  2D61 A;  3ISL A;  5FT8 A;  3RBF A;  3BCA A;  1J04 A;  3HMU A;  2VLF A;  4MQR A;  2WK9 A;  3PAA A;  1TOG A;  2TPL A;  3EI8 A;  3IHJ A;  3TQX A;  2R0T A;  2VMO A;  1AMS A;  3RCH A;  4ZM3 A;  3EZS A;  1LW5 A;  4CVQ A;  1TOJ A;  1B9I A;  4KAM A;  3A9Z A;  1PFF A;  4B9B A;  1C4K A;  3BC8 A;  5DJ1 A;  1KL1 A;  2HOZ A;  1X2A A;  1YJY A;  1AKB A;  4W8I A;  3PDB A;  2CTZ A;  4EB7 A;  1CQ7 A;  1LS3 A;  4LW2 A;  1M0O A;  3E2Z B;  5FT5 A;  3A2B A;  2ZP7 A;  5K8B A;  2OKK A;  1GBN A;  4AO9 A;  4E77 A;  4N0B A;  4Q76 A;  4DBC A;  5LHA A;  2BI5 A;  1UU1 A;  2BIG A;  2AY1 A;  1EQB A;  2D64 A;  2CFB A;  4AO4 A;  1KMJ A;  4MKK A;  1N2T A;  1FG7 A;  1SZU A;  3AEO A;  4OBV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...