5IX8A

Crystal structure of sugar abc transport system, substrate-binding protein from bordetella parapertussis 12822
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
318
structure length
318
Chain Sequence
b'DRLQGIVEPIVARQPLKLGVTVVHLLDNFYKGIAYGIVDEARRSNVEVVQVAVAGAYGNVQQQFAQLQSFKTLGVDYAVLSPAAYSGYDPVVADLARSGIKTISAGIPVNSDKIAFGVLQDDTLIGKVLGKALCDDGAQGKQVIVVPGAAGLEWPRLRYEGFKEVASACGAKLTPAAFRGEMSLADGMAQTQDLLMRTPDAEYVFTPVTFLGIGAVRAARQANRPVKVLTSAMVKENEAMIREGRLLAVASEPGVIMGRLIVQYAIREHEGLPMPPLDKPTRSVPYPHFNVPITVVDKSNVDTHPYAFYDYPPQGWSI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative sugar ABC transport system, substrate-binding prote
molecule tags Transport protein
source organism Bordetella parapertussis (strain 12822 / atcc baa-587 / nctc 13253)
publication title Crystal structure of sugar ABC transport system, substrate-binding protein from Bordetella parapertussis 12822
rcsb
total genus 112
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ix8A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ix8A01
2HQBA 4IMIB 1Y1LA 1ABFA 5HKOA 4LZLA 4OG2A 1QNLA 1ABEA 3VNBA 1JDNA 1URPA 3MIZA 4UHJA 5F64A 3DGEC 4G97A 2RDMA 3HV2A 3EULA 1Z13A 1DRJA 3OMWA 4MS4B 5EWLB 1EWTA 3CS3A 5GQSA 4Z9AA 1BDIA 2FKAA 1U2PA 1FFSA 4RV5A 1FQWA 4RU1A 4WXEA 1E2BA 2HJ9A 3I45A 4GNRA 1P6QA 3GBVA 4YWHA 3RVMA 2OQRA 1E6KA 1W9HA 3A0UA 4Z4EA 3QX8A 4YLEA 2FEWB 2L18A 2VK2A 4JB2A 4MAAA 1ZAYA 4FE4A 3QK7A 2ZWMA 5EWMB 1BAPA 3O2QB 5JS2A 3H5WA 3H5IA 1RZRD 2F8SA 2FW0A 3NBMA 2JCGA 3QEKA 2M98A 4G0MA 1NXVA 5TQ2A 4YR7A 1YIOA 4MQEB 3RVOA 2WY2D 5TQ0A 3BREA 3URMA 4MR8A 3EODA 1TJYA 2RJOA 1LBHA 3KG2A 3Q7RA 3T95A 3NHZA 4P98A 4RK7A 2FXIA 2ID9A 3NNSA 4ZJPA 5JNTA 4MQFA 4RZSA 2GWRA 1JFSA 2FLWA 3O2SB 2PAFA 3CU5A 1DP4A 2FSPA 3KS9A 2E4YA 2L19A 5FWXA 3RVRA 3RVNA 1DBQA 2QXYA 3H1EA 4QYMA 2PUBA 1M2FA 3CG4A 1JFVA 3HS3A 1SXGA 1F4VA 4G0QA 2GI4A 1GUBA 5IUKC 1IIBA 1MB0A 3EQZA 1ISRA 1Z26A 2FQXA 4RKRA 3VNAA 1QP4A 1CYEA 4WT7A 3FFWA 3HUUA 1LBIA 2P4UA 4JB0A 4HNQA 4LDZA 2E4XA 2A9QA 1ZGGA 3T38A 4Z4HA 2WWVD 4P1ZA 4KPYA 5ABPA 3CFYA 2FEPA 4ZPJA 4H60A 4MRMB 3OM1A 4H3KB 4W5NA 3A0RB 5JNWA 9ABPA 1OXBB 1L5YA 1QPZA 1W25A 4LDAA 1LJLA 1EHCA 1P8AA 5JNRA 3BILA 1ZHHA 1XWWA 3B2NA 2PL9A 3N75A 4RY9A 2H3HA 5EWJA 3KLNA 1E6MA 2NZUG 1QQAA 4OBBA 4YO7A 1KGSA 5EWJB 5KQMA 3HXMA 3CTPA 1NTRA 3E61A 3I5AA 1L5ZA 3H5VA 3CZ5A 2PUEA 1K68A 4RK4A 3GT7A 4MR7A 5KQGA 2VUHB 3C3MA 3FFTA 2FN9A 3W9SA 1ZH2A 2HSGA 4DN6A 4EYGA 2JBAB 2ZAYA 3IDOA 4IMJB 2FMHA 3C3KA 2W42A 3TO5A 3F73A 4RK6A 3CZCA 3LUJA 3HO1A 4XFKA 4MLDA 3QLVA 4NICA 1JHZA 4KK3A 1TVMA 4N03A 1MVOA 1Z15A 4TLMB 4ETIA 2QSJA 4EYKA 1LK0A 1BA2A 2MSWA 3JPYA 1RXIA 3HCWA 2CHEA 1P6UA 1ZN2A 1DCKA 1M2EA 3I42A 1YK1A 2MSKA 3LUDA 4KQ9A 4RKQA 4QYWA 5TPWA 4ML3A 2NT3A 4EVSA 3RVLA 3Q7SA 3RVKA 4EYQA 1EWVA 1YS6A 1GCAA 2JRLA 4Q7EA 4D6XA 4S05A 4LX8A 3GWGA 3LUFA 4OLBA 4KQCA 5CNKA 4N47A 3EQ2A 4GPAA 4RXMA 2FEKA 2LUOA 1DG9A 2IOYA 4N0PA 3D02A 1A0OA 3P9YA 5FBHA 3BRQA 3QLTA 1NATA 3CKMA 1DJMA 4MQEA 2AYXA 3C97A 3M9WA 4L85A 3ILYA 4W5RA 1WETA 5BRAA 5KC9A 1JYEA 2A9OA 2B1JA 3MQ4A 5TPZA 4Z4CA 4YV7A 1DCMA 3LUHA 2YHAA 2MYUA 3F6PA 4RY8A 1PEAA 4MS1B 1DZ3A 4RXUA 3LFTA 4O5AA 4ZYLA 2PUAA 3DLHA 4MS1A 3SAJA 5KI6A 4Z4FA 1MB3A 3KLOA 1U2QA 3OLYA 4EVRA 2PL1A 3JS5A 4G0PA 3SNKA 3CLKA 4Y9TA 4NV3A 2A9PA 2GBPA 2GX6A 2QU7A 4B09A 1USKA 3QEMA 1SXHA 3O75A 4FE7A 5CNJA 1RZRA 1FFGA 4IILA 4RY0A 3QEMB 4KMRA 1Z16A 1ZY2A 1NXXA 5DGCA 3G1WA 4HNRA 1I3CA 2L2QA 4E7PA 3MA0A 1GCGA 4IRXA 2FVYA 4F8JA 1JDPA 1RPJA 4KVFA 5JNVA 2RGYA 5DCLA 1YMUA 5IEBA 1ZVVA 1PUXA 3O1JC 4G0XA 5KC8A 2PUGA 4OATA 1SD5A 3HDGA 2LP4Y 3LTEA 5FWYB 1NXWA 3CRNA 5BRJA 4WXMA 2TMYA 4WWHA 5B3JA 4JAVC 1DBPA 3ILHA 5HSGA 3N0XA 3NHMA 5BQ3A 2RJNA 4Z4GA 3IP9A 3F6CA 1DRKA 3KCNA 1B00A 4FB4A 3KJXA 2H0AA 4ZMRA 3JTEA 2E4UA 2IDMA 1D1PA 4RK5A 3RH0A 5HM6A 1NXOA 1USGA 4PEVA 3N0RA 3HM9A 3S99A 2OENG 1JYFA 3OQOA 2FN8A 3EAFA 3DZDA 2N9UA 4NCAA 3C3WA 4XXHA 4EYOA 2IYNA 3JVIA 4MPTA 3OO0A 5IBQA 2WJWA 2VYCA 4MS3B 3SY8A 4S04A 1YTUA 5TPZD 3GYBA 4PICA 4KREA 4OLAA 1MAVA 2MSLA 3H5OA 3OO1A 5DKFA 4XARA 4F12A 5IUNC 3HDVA 4MS3A 3EJWA 2E4WA 3LMKA 5TE9A 3QLVC 1D1QA 4MS4A 5D2CA 4EGSA 1A04A 1PHRA 3H75A 2CD7A 5DLEA 1YK0A 4LE1A 4ZMSA 1VPWA 1RNLA 4PE5B 3QELA 4RS3A 5KQPA 1XHEA 4F3TA 1S8NA 1ISSA 1Z2DA 3KYJB 1USIA 4LRQA 5EWLA 1LJUA 4RSMA 1JX6A 5TPWB 4M88A 7ABPA 3KTOA 4DQDA 2HQOA 5EWMA 1JBEA 3HJFA 1HEYA 3GBPA 2JK1A 3FDFA 3H1GA 1ZDMA 3E3MA 4IGAA 1P2FA 4YCSA 2JVKA 5C5EA 4KFCA 1FSPA 5GOTA 4O1HA 4JP1A 1PNTA 2QR3A 4MLCA 2IPAB 2NUBA 1C4WA 2PMCA 2AYZA 2QVGA 3OM0A 1SXIA 2VUIB 5TQ2B 1RXEA 1PNRA 4L4UA 3OQNA 1A2OA 3DGFC 3FGZA 3IPAA 4WUTA 4MR9B 2FQWA 4W5QA 1Z2EA 5CNMA 1M5UA 4PZ0A 3HZHA 3RVQA 4MR9A 4HNSA 1DCFA 4YRZA 1QQBA 4G0ZA 5FWXB 3SM9A 2P9HA 3OLVA 2IPMA 1UDRA 1YMVA 4KZKA 2FMKA 3M9XA 4MR8B 4Z4IA 3A10A 1R8JA 1QP0A 5JNUA 3BRSA 6ABPA 3D8UA 3G85A 3N53A 5JS1A 4IF4A 1EAYA 4XASA 2QV0A 4TN5A 2IKSA 3LUAA 4Q6WA 3LOPA 1D4ZA 1MIHA 1EFAA 2FQYA 3C6QA 3SG0A 2QW1A 2WMYA 3ROTA 4LE2A 8ABPA 3O21A 1BDHA 3N0WA 2E4VA 3T8YA 4CBVA 3Q41A 1CEYA 1KMIY 1AB6A 2PUDA 3K9CA 1YS7A 4RDCA 2V0NA 3F7NA 1JF8A 3LUKA 3QX9A 1M5TA 4MRMA 3HUTA 3GL9A 1QP7A 2LBPA 1AB5A 3QLUC 3JY6A 5FWYA 3NNNA 2O20A 4NCBA 1VRVA 4TLLB 4EY3A 5T7BA 3RVPA 1JH9A 4Z0NA 3T6KA 1JWLA 3LKBA 3MMNA 2WB4A 2MYNA 2IPLA 3O2JA 3RVJA 1XHFA 1H9CA 2HPHA 4KRFA 3MF4A 3N6VA 2R4QA 2R47A 4MR7B 1APBA 3KSMA 2XDYA 4W5TA 2DRIA 4YGXB 3I09A 2QVCA 4D6YA 5FBKA 4KNYA 2L17A 1NXSA 1K66A 4NQRA 1JL3A 1QKKA 5ED4A 1YVUA 2JVJA 3R0JA 4N0QA 5IULC 4RXTA 1EWKA 1JLKA 2NT4A 5IX8A 2R25B 2JBAA 3JPWA 3UK0A 2CHFA 2FMFA 4RK1A 2FMIA 5B3JC 2R48A 4F11A 5KQLA 3GA5A 4YP9A 1TM2A 3NNDA 4UHKA 3FFXA 2Q5CA 3FMVA 1VLZA 4G0OA 3GRCA 4H3HB 4D74A 2IPNA 2LIVA 1FFWA 4ETMA 5HQJA 1D2AA 4G0YA 3O1IC 4OTZA 6CHYA 2WJAA 4W5OA 1BDJA 2CWDA 3UUGA 1DC8A 3LUCA 3QELB 3DLBA 2M1ZA 1J56A 1U0SY 3RVSA 2MYPA 3LKVA 1QO0A 3SQNA 4MGEA 1F51E 3L6UA 3HSYA 2PUFA 2JB9A 3IPCA 5I4CA 1Z25A 4E7OA 1VKRA 4JOQA 3K4HA 4RK0A 4PYRA 3KYIB 3O74A 5TQ0B 3IP7A 2LPMA 3QLUA 1GUDA 2PE5A 3IP5A 4WZZA 5BR1A 1JFTA 4MQFB 3O1HB 3TMYA 1CHNA 1TLFA 5CHYA 1D5WA 5PNTA 4DADA 3A3KA 2MYTA 4YS6A 2NZVG 2E4ZA 1E6LA 4G86A 4HYEA 3H6GA 2F8TA 1NY5A 3OMXA 3ROFA 1BVHA 3OQMA 1Z17A 2B4AA 3Q15C 4Q6BA 4MYRA 5KWSA 1U04A 1OXKB 5TQJA 4O1IA 4QICA 2WRZA 2J48A 3N8IA 5C5CA 2X7XA 3CHYA 4QPJC 3H1FA 3TX6A 2HQRA 3KKEA 3H6HA 1NXPA 1PEYA 1SRRA 3H5TA 4LE0A 5JNSA 3UKJA 2ID7A 1Z12A 5IEJA 4XAQA 2GKGA 3OLWA 3OLZA 1ZITA 4JA2A 5E3JA 4EVQA 4F06A 5IUJC 5CNIA 1DBWA 4TMYA 5DTEA 1DC7A 2FLKA 3M6MD 4XLTA 2YHBA 3OLXA 4N41A 2KYRA 3L49A 3DBIA 3EDCA 1QMPA 2FTKE 1KRWA 1T34A 1C0EA 3LUGA 2PUCA 1ZH4A 3CG0A 1TMYA 3HVRA 2QZJA 1GLGA 2JVIA 4RWEA 3RQIA 1ZGZA 1U8TA 4ETNA 3IP6A 4JASB 2BGGA 2PLNA 1QO0D 3JVDA 4KV7A 2PKXA 3BBLA 3H5LA 3HEBA 1Z18A 4EUKA 4N76A 3CNBA 2A9RA 3Q9SA 4KK4A 5T3YA 1KRXA 3GV0A 2I6FA 1ZESA 1NXTA 2PJUA 3Q7TA 3MYYA 3TD9A 4Z99A 3MM4A 5IC5A 3TB6A 3HK2A 3KHTA 3EGCA 4Z9BA
chains in the Genus database with same CATH superfamily
1A96A 4V1CB 4R8VA 3ETHA 1FZQA 1JR4A 4QWWA 4OG2A 2V7WA 4F4FA 1EDBA 1IBLB 3UNXA 4NECA 4W7SA 4BIMA 1N33B 2D54A 1HKHA 3Q0EA 2ZT8A 3V34A 3WNBA 1TCVA 5A3SA 3LY5A 4O4HB 4EBFA 4Z0PA 2HNAA 2PKCA 3OMWA 1ZG3A 2B6NA 3ROZA 1Q1ZA 1X8XA 1F0PA 3ZWWA 2ZYIA 5FWNA 4LYFA 5DCYA 3NBFA 4KR2A 1QRAA 1KI7A 2EEPA 4GNRA 1P6QA 1GAWA 1F17A 1GLNA 3GBVA 3BS4A 4HD8A 1DAPA 2H2WA 4UAJA 2Z6VA 2QM0A 2JLUA 5FP0A 3INTA 3OQPA 2VEDA 1TFRA 4FHCA 3EEYA 3MWEA 1E3EA 1DJPA 4DXDA 4F93B 5I4KA 1C9NA 1V4NA 2KM1A 4UTPA 2DR3A 2JLCA 3IBFA 1Y5RA 3EZYA 1MO3A 1D6MA 2PGIA 4D45A 3QF7A 2ORVA 4MWSA 3WWEA 3I9V6 4CQMA 2YZNA 2FH5B 4WTOA 2ZJAA 1TA0A 2VJMB 2YXNA 4ZQHA 1ADJA 4A16A 1OOEA 2VXYA 2EYUA 1T2AA 3DR5A 1VHDA 2BPOA 3PE3A 4GUAA 1MRZA 4H4DA 4CJXA 1JIJA 4J1QA 3RVOA 2VYND 4LYHA 1C9YA 3HFSA 4IQ8A 3WLOA 4DQUA 3A37A 2RONA 3URMA 4H0NA 3NC1C 4YJFA 2G6TA 3C2QA 2JFHA 1DTSA 1H66A 4M36A 4MITA 1W1UA 4HSGA 3ZY4A 3NNSA 4LBWA 3DF9A 1ZJ4A 4C4OA 2OQIA 2VFAA 4UU7A 2X0NA 5ALDA 1ADFA 5FWXA 5JFOA 2R0QC 1ONOA 2Z6QA 4BO0A 2FW9A 4O2AA 4Y6RA 2FYTA 5K6RA 2IHKA 1A8HA 4AJOA 1Q1QA 4A5OA 1U5BA 3C3EA 1OYWA 3I73A 5KBYA 5D51S 4K9DA 2QTVB 5T57A 4MP6A 4BQEA 3USES 2QBYB 1KYQA 2C2MA 3QTBA 3SIPA 4LXQA 3B6IA 3TQFA 3CFYA 2FEPA 4R2XA 4R54A 1N0HA 1SUEA 1DQPA 1ZUHA 4HRVA 3L6CA 5AM1A 1JR3E 1DKLA 4Y0VA 3PGKA 5F9HA 1Q0RA 2IXAA 5B4UA 4PAOA 3GLGB 2KE5A 4ZAXA 1M6HA 5B58C 1IDN1 1EFHA 2OR3A 1DDGA 2O7VA 5JIBA 4KN6A 3H2BA 1P91A 2WKPA 2ZROA 3BILA 4Z3OA 3LVFO 3B2NA 3P9PA 3LX5A 1LRLA 4QRDA 4A4DA 4E03A 4QUKA 1UDBA 2FFHA 3IMGA 2AB0A 1NQTA 2ZRDA 3HXQA 3KYBA 3OAAD 3HDJA 2Q0XA 1PSZA 1BO6A 2FPGB 3CW8X 1U1GA 2FF7A 4RMHA 4HXEB 4RX1A 2E5FA 1M67A 2JGDB 1AG9A 1UP7A 2CYAA 2WSSA 1UPBA 3A6FA 3H8JA 3K8QA 2YWJA 3KVYA 4R05A 4CM4A 1OZFA 3E61A 3I04M 1L5ZA 2WA1A 3H5VA 4UVDA 4DB2A 4QPNA 2UXDB 3S2UA 3BSYA 1Z0UA 1OU0A 2HMTA 1CZOA 1JEYB 1KVUA 1SB9A 2CV2A 2QM7A 4HI0E 3CNHA 1VG8A 3QE4A 4GP6A 2WYUA 2J4CA 4QG7A 4ZQFA 4D9CA 3WHKA 3Q5DA 3OIVA 4Q12A 1YB2A 1EX1A 4LXIA 4KN8A 5EJ6A 1RQNA 3BGOS 3I2FA 4RSRA 3V4SA 1AU9A 3HYLA 3OIWA 1G0OA 1Z29A 1A77A 4INJA 4KXXA 4TLMB 3S7TA 1U0OC 5KTRA 1NVTA 3NP9A 4MIKA 2E5LB 3WA7A 3ULKA 2Z1DA 2D62A 1XDSA 1QYCA 1A9XB 1Z4KA 3EMKA 4BQNA 3C4VA 3TBHA 4B33A 4BX2A 3PXAA 4U7DA 1BXGA 2UYGA 1HORA 5KWJA 3EY9A 5G3YA 4WKOA 3FWKA 2B7LA 4L2IB 4WD3A 3ZJ4A 3L77A 1AQJA 3INGA 2A84A 1E8DA 1RHMA 3PEFA 5H16A 1ORIA 2IH4A 1XRMA 3NIFB 2C8JA 2XYRA 1T36A 4GI1A 4KAFA 3UCEA 4B3CA 4YCCA 1Q84A 1CE8B 3PWSA 2I91A 5DN6A 1XEWX 3ELYA 1GT6A 4C76A 4G0WA 5A04A 4BQRA 1NBAA 2QLLA 3MXOA 4Y2GA 4Q9HA 1BNCA 3R8FA 1RJ9B 5AKIA 3WXMA 2H7VA 2OM2A 4B32A 2PSEA 3E70C 2O5CA 2FEKA 3BWDD 5EAIA 4L5AA 1DG9A 3V9AA 3ZWOA 1VJ5A 2XGOA 2A5JA 2RHOA 3EPHA 2BEVA 1UBMS 5EUMA 2HNBA 2LNDA 4PLTA 1D4OA 2JFPA 1DJMA 4HYYA 1RWNA 4RHTA 5T6MA 3KQUA 1WDWB 3K1AB 3LL7A 1V11B 4M1ZA 1PWZA 2EATA 3FHTA 3N2LA 3W2EA 1X1BA 1ZXLA 1SKAA 3D3JA 1JYEA 3SJUA 1DCMA 4IGIA 4QULA 3UMSA 5F33A 3RFCA 2I4TA 4IYJA 4IICA 3KB1A 3F6PA 1E92A 5EEHA 4JYZA 4JQYA 1QMGA 2ZRIA 5K3DA 2PUAA 1MJFA 1YHZA 2X5JO 4R1NA 3T3DA 4BKRA 5FFMA 1CRQA 3CXUA 2UXBB 3T4UA 2J9ZB 2FP3A 4W6QA 2VWQA 3T7IA 1T43A 2G8LA 2V7QD 5FULA 1RAIA 2BEJA 2CUTA 4FXOA 3FGOA 1P29A 3I2YX 3LQQA 4JQCA 2YVAA 3FSRA 3BB1A 3H3XA 3SS8A 1GJRA 4FI3C 5HM8A 2OLJA 1N8KA 1SEPA 3GUYA 3I28A 1MABB 3QA3E 3SE7A 3D6VA 4WNYA 1SHZA 1J5PA 2PH1A 1B93A 5HEKA 4LXGA 1IXSB 4Z3KA 3Q72A 1KJYA 2ROQA 2XE7A 1MABA 3ENVA 2FVYA 4J0QA 4QPDA 3AEZA 3DZJA 2Y0EA 3FKQA 5IHPA 2PT7A 3LJKA 1GT91 3WKCA 4GPBA 3F49S 3T7JA 1CJSA 3A9CA 1JXMA 3HP1A 4W8GA 4MV1A 1QG6A 1RAFA 3PDCA 4C4SA 4I5IA 4GYJA 1QK5A 5KNBA 1JG1A 1E3WA 2R8YA 1GSHA 3NHMA 2A5YB 2OWDA 2VLIA 4M9SA 5EVCA 1HR0B 2WIGA 3JWPA 4R8RA 2IP2A 1GKUB 1P8JA 3DZKA 4FJ0A 4AO6A 2SKEA 1JAHA 3FCOA 3NTOA 3C41J 3N0RA 1AHNA 5B1YA 2ZPTX 3DE7X 1S3GA 1PNVA 2P27A 3U6BA 4AJ9A 3WGHA 4B5KA 2Z4SA 4H7KA 5L3QB 2X4DA 4H27A 4KZPA 5SZHB 4QEKA 2C0CA 4MS3B 4PLPA 4W5WA 4EB3A 4C0XA 1TKBA 2HY7A 3GNTA 2O8CA 2BBOA 3AJ8A 1B8UA 2VJBA 3D3WA 4L0CA 4UVIA 4IOJA 1WNFA 3KPUA 1N4DA 2E4WA 3EGDA 3QU5A 4MX8A 2IHJA 1JLSA 1Z2OX 5FA6A 4ZYZA 3R5JA 5JC8A 2YDXA 3DJFA 4CMBA 5F2NA 3LY9A 5FUYA 4GS5A 1MC5A 2IU6A 2A94A 4W1RA 5C7YA 5A62A 1M2NA 1XHEA 1A5TA 2HV8A 2O2SA 4JVSB 2R7AA 4OHZA 3TIFA 4EHHA 4RD3A 4EF6A 5E1DA 3IMFA 4RULA 1A3CA 2B20A 2R7LA 4IG9A 1TIBA 1D2CA 3CO0S 4CXMA 4IYRA 1K8ZB 4JODA 1T25A 2JVKA 1Y5LA 3LC7O 1NE2A 2QSYA 1PNTA 2BFDA 4QNNA 2Y2UA 3MCVA 2WAXA 1F20A 5DRTA 2HWWA 4NL4H 2OQVA 2Q50A 4MVJD 4D43A 3Q8LA 2AD5A 3JD1A 1A2OA 1W75A 2G77B 3H9CA 4YJFB 4X3CA 4YASA 1C4KA 3WWDA 1E32A 4R8KA 3SF8B 1YL7A 2VJYA 3O4IA 1ZC4A 3INYA 4PZ0A 1KR5A 3OT1B 1E1RA 2Q3MA 3A4IA 1Z6YA 3OZRA 5JHHB 1U7WA 1RAEA 4Y2SA 1T5SA 1PT5A 1VHQA 1W8DA 2ST1A 1KFBB 2H3EA 1UDRA 3QVSA 4JYPA 4FGUA 5IASA 3VNVA 4WQMA 4PQYA 4JBXA 2J4FA 5JDIA 2OZKA 1VMAA 2RHMA 4KTVE 3QOYA 5GM2A 3G85A 3Q40A 1XMPA 1Q7BA 1MG5A 2BKVA 5E6SA 4YP7A 3RHZA 4G5YA 1A7AA 1EAYA 3ZHYA 4GBGA 1G55A 1VRWA 1RVDA 2IKSA 3NASA 1E9DA 3WY9A 3IAM1 5HOEA 3N86A 1T2NA 2P9QA 2VAMA 3O82A 3AYZB 3FDZA 3PXEA 1G8SA 4Q9IA 5CU7A 3ROTA 1NC1A 4CHGA 2A9JA 3BDVA 3CH5A 2E4VA 5T3UA 1NVMB 5ALWA 2VTDA 1UK8A 5H3CA 1D0SA 3IPXA 1K98A 2ZRHA 4OK6A 5ALEA 1OTYA 2LRHA 2XOKD 1NNI1 3G2OA 1Z88A 3NNNA 3AONB 4K05A 4EY8A 9LDTA 4TLLB 3AF6A 2GPSA 2GS9A 2FUCA 2JIZD 3M4ZA 1PT7A 4NU0A 1DPFA 3UANA 4E94A 3PJFA 1JH9A 4CLRA 1U4OA 1RWOA 2G40A 4OKIA 4X1YA 4ZAFA 4ZCSA 1ZSYA 4RHXA 3BXHA 2J4DA 2QGZA 1Y1KE 2WVHA 2JLZA 1XHFA 4QDTA 4YRIA 2AKEA 4MA4A 3W8EA 1K0UA 3A4LA 3O8OB 2RGXA 2XDYA 3QH4A 4AECA 1NBEA 3TVTA 1NX9A 4YGXB 2C04A 4W9NA 1GAQA 4FW8A 4CQLB 1PP4A 3Q3HA 4K6CA 1UDAA 2P1RA 4I8XA 1YE3A 1Z82A 4U2CA 4XTCS 3T34A 2DFPA 1OV6A 1GARA 4O1MA 4PC3A 1ZA1A 2H59A 4X92A 5F73A 5H5JA 1RJWA 3U3ZA 3AKCA 1Y8AA 2AOUB 4FONA 4MYSA 4KBGA 4DMKA 3BCSA 3DL7A 2FSUA 4GLBA 1MFPA 1W581 4B7XA 1WQ3A 2P2DA 2WE7A 2N1MA 1X94A 3TRIA 3T1OA 2H00A 1IN1A 4MQLA 1SCAA 5BWNA 1OBOA 3QU2A 5EJ2A 4C07A 4U9IS 5UKDA 3U13A 3WDSA 2WSBA 2YBEA 3U17A 1VE3A 3ZIUA 4CVNA 3QSYA 1J06A 3KQQA 4H3HB 2CJWA 3D1VA 3RUPA 4F6LA 4LNAA 4TYWA 4L8GA 3QBEA 2O0LA 3L6RA 3FVRA 3OPQA 2IZ1A 4M0PA 2GT1A 5DHSA 1DKRA 3EF0A 3KZKA 4YX9A 1GNSA 2HPVA 1I9CA 4R9RA 4ZTUB 1YAJA 4OGKA 1YHNA 2POCA 2XQFA 3KZCA 4FT2A 4LY0A 3DLBA 4JVMA 1G4UR 2WT8A 3KQSA 4TZKA 5KYUB 3KX2A 2MYPA 3GW8A 4L72A 4MGEA 5E8JA 1O96A 3G6WA 3CW2A 1P9OA 1GFZA 3H84A 3ZX4A 4OAPA 3VXKA 3IPCA 1TVCA 5KTTA 2B0CA 1GA1A 1EBFA 4PLVA 2HDHA 3B3AA 1RDFA 1FMFA 3AHHA 3K4HA 4XWGA 3PNSA 5DHUA 3VYSB 4LJSA 1PX2A 2IVZA 4K8RB 1LQ2A 5KDLA 3H11B 2XVZA 3RJZA 2NZXA 2PL5A 5JYCA 5AM5A 4DLKA 1LFDB 4XH9B 4P0QB 2YY5A 1NTOA 3M82A 4F9TA 1CJTC 1T9GR 1XDDA 2AF4C 1IB0A 4MP8A 1W34A 3JQBC 4YS6A 2G9UA 3MFYA 2W6QA 5FOXA 1ZH0A 5CFQA 1C0IA 4RLFA 3NHYA 2CN1A 4JKIA 1XKQA 2C99A 4HQ6A 4DNQA 3VOAA 1XZMA 5CLGA 4ZPXA 5LBUA 3TWOA 2CBXA 2J32A 3D4NA 4J9UE 5ALPA 2B4AA 5AXAA 3N2EA 3H42B 2WLSA 3KQNA 3JV7A 1JJFA 4E0BA 3DXXA 1EBUA 3AXSA 1XL1A 4IZHA 4HX2A 2HJGA 2CEAA 1J5XA 3N87A 2R79A 1T0HB 2QN6A 1W2HA 1OTXA 2DLCX 1W1IA 1ISGA 2PFSA 2BM8A 1FL9A 1Y1SA 1H6AA 1I30A 3I9V1 4UUBA 3VHLB 5ES4B 1ZLYA 2CL5A 4BAGA 4S0ZA 4A03A 3PUIA 3ZHCA 5DULA 1DKPA 2QRHA 1DC7A 5M3BA 3WGLA 4C20A 1K86A 2HGSA 1QH8B 2HOQA 1J4AA 3KQMA 3KJZA 3WBFA 2QM3A 3O4RA 3ZVNA 2C4TA 4E1AA 4ARIA 1CPYA 2XNJA 2RB4A 3AVUA 2ZULA 1M73E 1GLGA 4EKIA 1T1GA 4CMEA 1YE5A 3QW2A 3KQVA 2XQKA 4IV8A 5T41A 3SYLA 1P4AA 3L7OA 2NTNA 2NQTA 3BMXA 3D0RA 3VR3A 4Q05A 4QDZA 2DH5A 4PC6A 5TRTA 3VFDA 2CXXA 3WWZA 4AUMA 5LDDC 1E2QA 1SCUA 3E7FA 4IFEA 4CIVA 2UYCA 2QLFA 1C3LA 2YS6A 2I6FA 4GU5A 1QRDA 1N2CE 1QZXA 3SC3A 4UZFA 1SCUB 2WTBA 2XUZA 2YWEA 2ZPUA 3EISA 3PHGA 4OJMX 4H7IA 4TKLA 4DIUA 3MYYA 4UVGA 4BO3A 3FIJA 4PYNA 4LQDA 2CV0A 1E3IA 3QITA 2OGTA 2EZ4A 3JARB 3PXXA 4RMIA 4IV0A 3LXXA 4HPWA 1HG1A 1A9XA 1KGDA 2J0UB 3GUHA 1PN3A 4Z9FA 3TQCA 5J3JA 3U40A 3IKTA 4B43A 4JEMA 3K0EA 4C1BA 4OQXA 4GP9A 3FOFC 2RDMA 1TD9A 4G6ZA 2ILTA 2GA9A 1L5MA 2UUOA 3BGSA 3R5XA 2A4MA 3DOJA 1D8TA 2CDBA 5GQSA 3UWKA 4D92A 1CY1A 4QXMA 1PS9A 3UMYA 3H19A 1QG0A 3FVQA 3TS1A 3P7MA 1JT9A 1JLLA 5MGNA 2QUKA 1OVGA 1SU8A 4CF4A 4WKBA 2QAGC 4B3FX 3FDXA 1JLLB 2FB9A 1K5HA 2FW1A 2MR5A 2ZZKA 4GC5A 4YLEA 4YBZA 3OZEA 1HE3A 2WIKA 2YWBA 2C5LA 3V1NA 3WTBA 1FFEA 3DEKA 3W6UA 5KTYA 1N2EA 2JIDA 4Q47A 5CJPA 1YUNA 1N2ZA 2HW8A 2YOFA 4YRRA 2A92A 4GL2A 3B1WA 3DV2A 3KUDA 1IY8A 3E22A 1AKRA 3V1LA 3ZD9A 2JCGA 1AKNA 3M5DA 4I50B 1L4MA 4F5EA 8AT1A 2UZAA 3DBLA 3NG1A 4RQTA 3W5HA 3ZGLA 1Q0ZA 3VDRA 2PZJA 3GOQA 5DGTA 4BE7B 5EZ6B 3H86A 3NDJA 3ZKWA 1E89A 2WD7B 3AWIA 2ZWVA 3CH7A 3EZGA 4RK7A 4NBRA 2OA0A 3SM3A 3PITA 4LFCB 1JALA 1OXUA 1VBFA 3V33A 4ZJPA 16PKA 4LIPD 2RC5A 3R5FA 1GTSA 4EYEA 3H1EA 4HQNA 3FCEA 1QIGA 3EIEA 1S1MA 1E94E 1H9AA 2ZB3A 3IEUA 2XMSA 1PGPA 5CFOA 3O8CA 3ER6A 1XRPA 3OCWA 4RKRA 1TKAA 1QP4A 2I6XA 4ONEA 4WT7A 5IN4A 2WTNA 3H5AA 3N8DA 4NR0A 4MV7A 3LNTA 1KO7A 2OCKA 4H60A 1D7OA 5KQRA 1R0BA 2QAJA 2ONZA 4LTDA 5CA0F 5HUHA 3D2BA 2ZETA 3PYXA 1PYOA 4FMDB 3O73A 1BU8A 3FMIA 3I05A 1A71A 1GL7A 4IXNA 4EGQA 5JOQA 2YW9A 2DGDA 1N2OA 1YVRA 3U62A 3WGYA 4N65A 1ULUA 5DW3A 5F3DA 3X1DA 1TX4B 1M6VA 4A10A 1KFJB 2O1SA 1X77A 1Q0UA 1MEEA 1ZAKA 2GD1O 2H4JA 3JSAA 3D31A 1XP5A 1ZCZA 3CSSA 3GEHA 3JTMA 1Z6GA 3LH5A 3BFPA 4G1VA 5ALKA 3TPCA 1SQFA 1ZJ6A 1Z5ZA 3CTPA 1P1KA 3PFHA 3Q11A 1IJFA 3K35A 2H2IA 3L3BA 3P9QA 2Y77A 3L0PA 4OSPA 3FFBA 4ZOLB 3WJ2A 3NALA 2GN6A 5FCDA 5H8WA 1WW8A 4QOHA 3NGLA 4DN6A 3M1AA 2CLKB 4GOJA 2P67A 1POXA 1W19A 4EL5A 2FMHA 2G07A 1XFAA 3UWPA 2GJ4A 2O4CA 1E96A 1OU4A 1Q7RA 3PF8A 4Q1DA 3TFWA 3V6MA 4YRMA 3CNLA 5DN6D 5HGXA 1JQBA 3CJRA 3IT2A 1IY1A 4FFOA 1E5XA 3V7YA 1J6UA 1R9JA 2D1SA 2LCIA 4Y2RA 3MCAA 5M34A 4I1UA 1SD1A 1U28C 5D7NA 4PQEA 3VZCA 1LK0A 4ADSG 1DAMA 2LD4A 4BDTA 3UBTA 2G06A 2ZLBA 3T4EA 2ZS8A 4IWNA 2CHEA 3AUJB 4JUFA 5F4BA 2QL9A 4HQFA 4DM4A 5CB8A 4HQKA 4KXQA 3I04A 4WJKB 3TK1A 2QP9X 5IAEA 1YK1A 3HVJA 4QARA 3SMVA 2G7MC 2REXB 1W36D 4P3KA 3WL3A 5JR3A 3R5SA 2NMVA 7MHTA 1UBUS 4CF6A 1IBSA 2W98A 1KEZA 2ATEA 3OUUA 2DETA 4G0NA 4LNHA 5CD1A 2DG2A 2QI9C 3CW9A 4ZYYA 3GDGA 3K8YA 4NZOA 2G36A 1VSBA 4ZVRA 5K6AC 3GWGA 5IKXA 2IU4A 4TTIA 3PWZA 1GKIA 1L5SA 1ZI8A 3IXMA 4KODA 4R6XA 1IVSA 1TTPB 4W82A 4HB0A 1L7DA 4N0PA 1LLCA 4NBLA 1B15A 4I1RA 4OJKA 3T52A 3CKMA 3BTOA 1B76A 2PWBA 3M6WA 1S3IA 3RWMB 4WASA 1Q19A 2GBCA 4BAUA 4EBBA 1OD6A 1D1SA 4GWLA 4JBLA 4OI1A 5C81A 2JJ8A 1C30B 1T4DA 3DAGA 3UV6A 4JP5A 2O2GA 4HQRA 1NLMA 2VH1A 2DU8A 4I55A 3ER8A 2PEZA 2O2DA 1KS9A 3G8DA 2AN9A 4G5XA 1XZEA 5CXUA 3E2MA 5K8CA 1Q7CA 3TW8A 3FJYA 4LMPA 4MB6A 3AY0A 3NJRA 2RGUA 5BWLA 1PZHA 5IZCA 4JJAA 3RUFA 4NBUA 2M6SA 3GGOA 5LA6A 4Q82A 1CHDA 3RJ9A 5KI6A 4DE5A 3SZ3A 1DTWA 4WE3A 2ZB2A 5M2QA 4JVNA 4BNTA 1GRNA 1NLZA 2GH1A 4COOA 4EHKA 4FB5A 4AKHA 3NEYA 4QOGA 2C83A 1CF9A 1X86B 4LPSA 2QORA 4M0MA 5C80A 4FCTA 4FE7A 4YI3A 3BWCA 2PJZA 5KINB 3PX7A 2Q3BA 1V9LA 1P2UA 1N32B 3GCGA 721PA 1R6XA 3MTDA 3PLAE 3KT8A 4ZGWA 4LZZA 4U9UA 3IAXA 5JMPA 3OBIA 1X9HA 2JFXA 1D7AA 5DGCA 4HNRA 1RU3A 1SIWA 3N2KA 3SJ7A 3T1VA 1D03A 3IULA 3ROEA 3OSUA 3ON5A 4RGQA 5LMNB 3OM8A 3TSWA 1P19A 1CZKA 3AKEA 1KVSA 2JA1A 3PGA1 1E77A 1X7WA 1YC2A 3WKAA 1J0XO 1H2AS 5EE0A 2C4UA 3ZWDA 4BKQA 4TTAA 2Z6AA 4EY6A 1ULSA 2TMYA 3E9EA 2BD0A 4MMYB 1DBPA 1JI3A 3R6GA 4Y1GA 1AURA 3N0XA 3OU7A 3UB3A 1L0BA 5KNDA 3QEOA 1XD8A 2RGBA 4BMYA 3KJHA 2GA8A 5ILGA 1L8LA 2H0AA 3DFKA 3PP8A 4NMXB 4BV9A 3R9KA 5JWOA 4YRJA 3VPCA 3QI2A 4Y67A 2AT1A 4PG8A 3KR9A 1YFKA 1IG0A 1N6OA 3LT1A 3UAVA 3UV7A 3V7WA 5EJ5A 5BQ5A 4IF6A 3AJDA 1W88B 4RM2A 1U02A 2FPPB 5A7HA 5FORA 3TEFA 3VR4D 5K6AA 5KNBH 1YTUA 3JQ8A 2NYVA 3GMIA 1W88A 2JJ1A 4J94A 2XRFA 3RD5A 4D82A 3OO1A 2B9VA 2DHEA 3AUUA 4R1MA 2Z98A 3MTJA 3IHWA 3MJHA 2YV5A 3PT5A 3R8CA 4MDHA 3RSSA 2P8JA 5CW2A 3PFFA 2QL6A 2EJCA 1Y8RA 3UAYA 1XKXA 1BXRB 3QU9A 4HNAA 3CR8A 1EM8B 4Q7JB 2D0DA 2PR7A 4XEUA 4HRXA 1PJ2A 2IYXA 4Q4DA 1VPLA 5KQPA 1WSWA 4JLMA 1EXDA 2EFDB 4PHFA 5TMBA 4X24A 3AY6A 5A3VA 5AKJA 4B9AA 4KQEA 2JLSA 2BUCA 4BMNA 3K96A 3GBPA 1SCQA 3GEBA 3E3MA 4BBJA 5ADUS 1KDOA 1RCFA 1TT5B 3FMFA 4PXAA 5EJGA 3ST7A 4LSGA 3THWA 5L3SB 1R3UA 2JGJA 4FYVA 4C6TA 2OXFA 4PZDA 4D3SA 5EJ9A 4PFKA 3UYKA 1LSOA 1Q83A 3G0DA 4LXYA 5F1YA 1K06A 4CV1A 2RMKA 4RSHA 4HN4B 4Z5XA 5TQ2B 2VSQA 1PNRA 4XR9A 1KSFX 1JHRA 2EERA 4C0BA 2HAEA 1YZNA 3IVGA 3IPAA 4JWTA 1WEKA 4BJHB 4G4SP 4JHLA 1SUDA 2HSZA 2H8KA 3R3HA 3ZCPA 4DNOA 2YHUA 1U9ZA 2O1XA 2JD1A 1A27A 1N5IA 3JSXA 4B74A 1W30A 2AC2A 4IW3B 2QAGB 4HNTA 3WSVA 4AYTA 1QV7A 3ANXA 5CIWA 1QHSA 1R8JA 2LXNA 1V39A 3DL0A 3F9IA 4J16C 4NULA 3UGQA 4ENUA 2OFWA 5JSFA 5KDDA 1VLHA 2V9ZA 4X95A 3K1ZA 5JJIA 5H02A 1ZBQA 5B6PA 4Y2QA 5JS1A 1YVEI 4IF4A 4XASA 1N5LA 3W2HA 5HRCA 5EE3A 3PB3A 2ZSFA 3GT0A 1QHFA 3OIUA 4UEQA 1GVHA 1RRMA 1CNEA 3NXKA 1ZK1A 2I1WA 4Z49A 1W4ZA 3IALA 2QS9A 3AO0B 1JKJA 1F8UA 1BDHA 2G80A 2CVFA 3OUTA 3PPXA 2DUNA 4C4RA 1BU5A 4F45A 4I50F 1AS0A 1HDZA 5LOVA 3ADKA 3DAYA 1JF8A 1X7ZA 2X8LA 4AJKA 4KMSA 3BOSA 5IARA 4DUGD 2BGIA 1XO1A 4N7JA 1NI5A 4E5MA 1ZYUA 1Y4ZA 2XKAA 1KIAA 4PIVA 3FETA 5E4TA 1KI9A 4EY3A 5ESXA 4ASUD 5I7FA 5JV5A 2F3RA 5AI6A 4YONB 3AEUA 5LXTF 1CQIB 1ZD4A 4K2HA 4BGIA 4FR2A 3LQYA 4NARA 3G5MA 5L40A 2DPYA 2MYNA 4BVEA 4HJRA 4D4GA 2H4XA 2ADMA 1PFGA 2KPOA 1K5DA 1O5IA 2UDPA 5EJ4A 1PLKA 4U7GA 2CXRA 3KSMA 4UCWA 1QGAA 2CFCA 3LO8A 4LHWA 2AJTA 3COYA 4TXJA 4UPEA 1JMYA 4J0GA 4O08A 3WAJA 4MVJP 2R1TA 5EE1A 1BE1A 1XN4A 2HGZA 2XV1A 1C41A 4L0QA 1NMZA 5ED4A 4WN9B 4CMHA 2XRMA 1P81A 1RABA 2X2EA 4N0QA 1MGOA 1X6VA 4CKZA 5IX8A 4RKWA 5EPOA 2F3TA 2AX4A 5E4JA 4WZBB 3RK4A 3ND9A 3DDUA 2Q3HA 2CHVA 2QYOA 4KO3S 1G291 2DWPA 2HDOA 4CT5A 4PPYA 4YPOA 2Z8XA 4AS2A 2GDZA 2VHYA 4AIIA 3WGQA 1YCHA 2PSJA 5F4ZA 1BVUA 2ODBA 2Q4DA 1CR0A 3WIBA 1MJNA 1HLDA 4PANA 4A0FA 4E07A 3FMVA 1JU9A 3V80A 1CUDA 1PD1A 3EZ7A 4DA9A 3H3JA 1S7CA 3NHRA 1C2YA 1D2AA 2R5NA 4G0YA 1NBMD 1G1AA 4IDDA 1ZGBA 2GCGA 4RDIA 1QHEA 3UK7A 3IO5A 3ZW7A 4NZMA 4AMYA 1SO8A 4TXLA 3OX1A 4EA7A 4A15A 2BUAA 1QZZA 2HMYB 3CNEA 4B45A 4OJYA 2VT6A 1G21E 1RYDA 1WF3A 1OIXA 2O0HA 2VYVD 2BFCA 1QO0A 3L4SO 1A4IA 2B98A 4GLLA 4NSNA 2QG6A 4ZP1A 5BQOA 3DZ8A 4D9JA 1MO6A 5C2JB 1JHMA 4IFIA 3HYRA 2DWOA 5ALYA 5DGIA 3HKDB 4YJHB 3ROMA 1Z33A 1OT5A 4PYRA 2X8JA 3KYIB 2O9JA 5EN4A 4XYMA 3JQ9A 4DV1B 3BHNA 4YDSA 2NM0A 5J2UB 2J87A 1I14A 4X93A 3UUFA 1DDIA 1E3DA 2JH9A 4S35A 2VK4A 4TLCA 4EG4A 4ZI7F 1P18A 2H9AA 3PGXA 4MW9A 1JFTA 2QVXX 5CHYA 1FFHA 2X9QA 3A1CA 1HK7A 3A3KA 3AGQA 3H1TA 4DCJA 4M83A 2VP2A 3I4LA 1EUDB 4N6GA 5J47A 4IIYA 4BQFA 3H6GA 2WT4A 1LEHA 5FX2A 1XXHA 2H1CA 2WE8A 2YV3A 4INOA 4XFDA 3BQMB 3GJ7A 3HDTA 4Q6BA 3IHTA 5FI3A 1U04A 1NULA 4QICA 9LDBA 2WRZA 4FKZA 3ICVA 2OXTA 2PD4A 3LK7A 2I67A 1KAQA 2YTZA 4QPJC 1L5LA 1V8OA 4MAMA 2Z95A 2JAPA 3ZGXA 4XCVA 1IJKA 1HETA 1XCJA 2JI4A 1V25A 2QL5A 1FTYA 3I1IA 3NOQA 1MJGM 1P0QA 2G70A 1YASA 2X4LA 5F5LA 3ZQUA 4IQ4A 1J70A 1CCWA 1FYDA 3OKCA 2WOOA 4G4JA 3STVA 1KK2A 1Z0AA 2P9FA 4P4UA 5FNVA 4F7DA 5JAMA 4DJDC 5KEIA 2PJRA 3A3OA 2O2EA 1ZLXA 4MHTA 3WQSB 4J03A 3E18A 4ZWNA 3ORRA 1V3QE 5HGJA 1X92A 4D42A 3DTVA 2EP5A 1IAVA 1YKGA 3JZAA 4FNAA 4HZUB 3BEDA 4J1TC 1VP9A 1IOLA 4BC0A 2PLFA 2YJ6A 1JB1A 1RWQA 3JD4A 3LUGA 4PLGA 5AJZA 3TCKA 4C7KA 4A8PA 1ZOIA 5HCIA 3RQIA 1QIHA 1SC4A 2OBMA 4E4TA 4DBVO 2A3NA 3IURA 5J2UF 1T9CA 1K3FA 2IZ0A 4EUKA 1V1MA 2KJQA 4AJJA 2A9RA 3PD1A 1V47A 3ODPA 1F38A 3PUYA 3MGCA 1XYYA 1H5QA 3LP6A 3UMBA 1TZ2A 1HNWB 1ULZA 3DH0A 1SCJA 4DIFA 4YNBA 2PSHA 5G02A 4ZT7A 1SA0B 3QV2A 3NRBA 1EQAA 1K92A 3TUIC 3ZYZA 5AW8A 2RHJA 1KYZA 1SULA 1KMCA 1XN1A 4X8MA 2C07A 4XD7D 5I9BA 4UMDA 3GEDA 4FFWA 4IMIB 4JC5A 3C6YA 1NPTO 1E1KA 4RH1A 2DQYA 5HKOA 1Y8QA 4ARZA 4BRZA 1AQ6A 4E2XA 1GKKA 2QG4A 1ISPA 2IW1A 3RC7A 3HEMA 4UJ3A 3L43A 2M2IA 4UHHA 3NV9A 4JBYA 1TW3A 4P7JA 3V4RA 3LY7A 3HV2A 4RKEA 3ASUA 4GBJA 3PD0A 1R8XA 3IKLA 4O0MA 3IUQA 3NMUF 1M34B 3PQFA 1T6BY 3FD8A 2NAPA 1U3CA 2VYVA 2WVGA 2GTHA 3NCTA 2ATXA 2XB4A 1DL5A 2EV9A 1WCIB 3G7SA 3IUPA 3CIOA 1O95C 3HA7A 3OX3A 4L5YA 1BKSB 3IHKA 4YWHA 3BQ9A 1ODJA 5DYYA 3ZHBA 1RRCA 2AZ4A 2UZ0A 3LGAA 2FEWB 4XGIA 4LSWA 5IHXA 1NIPA 3HXTA 1CR2A 4B83A 4ZVKA 1C1HA 2VBIA 4BEWA 4F3RA 1IPEA 2ZRGA 3F5MA 3JWIA 3MSCA 2ZWIA 1YB1A 1CZLA 2ASEA 2VUTA 3E3LA 2XTMA 2RAPA 4WAUA 3B9QA 2J07A 4G0MA 4ZYXA 3TQTA 1PF7E 2AFVA 2GCIA 2QRMA 5CDTA 5JE8A 4Y1RA 5BNFA 1ORRA 1GPLA 2HJRA 3EODA 2IOHA 3R0XA 3K6RA 3K6JA 2Z5FA 2R1VA 3KHUA 2B5VA 1UBJS 1VL2A 3KG2A 2GAIA 4YMLA 4P98A 2OP0A 4BNXA 4L73A 3FZYA 4LWZA 4HWPA 1BMDA 2GWRA 4Q1AA 4RZSA 1CB0A 4YACA 5CVUA 2ZE5A 1AX9A 3ECCA 1ECBA 1FP4B 1KC3A 2IQIA 4IIXA 4PX9A 3CISA 1XB2A 2LCFA 2OHXA 3PL1A 1SXGA 1TIPA 3EZ2A 5I5GA 1PNOA 1DEKA 3ZJ5A 1O03A 1IZ8A 2QTGA 3QJGA 4KITB 2CNKA 3DVRX 4OXYA 4URHA 2VKQA 3K0HA 5ITZB 1XCBA 4Q4LA 2P4UA 2HC9A 5HKAA 5CUQA 4FIDA 5EJFA 3T9AA 2ZE8A 1JR3D 5CT9A 4DEXA 5CA1A 2CUNA 2ZYHA 1UC9A 3LXRA 4G5OA 4D46A 3AVXA 4WERA 3GJZA 3IB3A 1P45A 4KLRA 4HSEA 3IBYA 2JGEA 1VKZA 2GPTA 2DERA 4FZ5A 4QTTB 1GRRA 2J5BA 3JYPA 4O4LB 3AEUB 1P8AA 5FOVA 1HDGO 2ZI6A 4MWTA 1JJIA 1IM2A 1IU9A 5FOUA 1OGJA 3N2KB 3HY3A 5HX7A 3AFOA 5EMJA 3ZV5A 3IILA 3S2YA 3I9JA 5F51A 1KARA 4Y0NA 4YMVA 3WL5A 1GUYA 1SCNE 4YO7A 3GVHA 1USWA 4XOIA 1Z6AA 4TVSA 1NUQA 5CLFA 1PVVA 4Q24A 1NTRA 4WKNA 3EIFA 5TB5A 3VHQA 2HLPA 4RL6A 4ZV7A 5ISMA 4RQBA 3AKDA 4J7AA 1JEYA 2QPLA 4NG5A 2NUPA 2Y1DA 4XVRA 3W3ZB 2CBZA 3QWHA 3R3VA 5LZ2A 5JJKA 1VGRA 4DSZA 5AKGA 2D1RA 3KQTA 4WNAB 1Q20A 3SHOA 1QVAA 3SR3A 5HUQA 5HF9A 3C3KA 5HDBB 3WL6A 4TQUS 1ANKA 4IIHA 3GQBB 2Z58A 3EG5A 3G68A 2XKKA 2YZ2A 1GTG1 2ZR7A 1REQB 1TUEA 5JBQA 5IDXA 3C8MA 4NICA 2O8FA 1YR6A 2A57A 1TVMA 3LQKA 1R16A 1XVTA 3QMWA 5J5AA 4EJ6A 3AY3A 2G25A 5GZ6A 1HQDA 1PR3A 4PSKA 3BHIA 1GPJA 3GR6A 1IVYA 3TZCA 3Q8KA 5FDFA 3JQPA 3HKBB 4U2EA 3EA5A 3P9RA 4UFNA 4YROA 3ZWAA 4Z54A 5C7IO 2CSXA 4HR7A 1R00A 3C39A 5D86A 3SHFA 2ZRKA 5CFRA 5EJ8A 3HKBA 1O58A 4HAVA 3WOHA 4IVPA 2V5UA 1M2HA 3ZE6A 1C1XA 2AK2A 1HF3A 3A1WA 2PFKA 4PRKA 3RVLA 3BIOA 4EVSA 5IJ0A 1QM5A 3KOZA 3CBGA 5AI4A 3R8XA 5CB4A 4ZO7A 1CF2O 5F78A 4FW9A 4YP5A 5ENDA 1M0TA 1ACJA 1NYTA 3WGGA 3U4HA 1CUSA 1SKUA 4C6TB 3E81A 4CCWA 5HK8A 2CJFA 2ACWA 4WCDA 3LT5A 4UKDA 1PSWA 3EHEA 1VKJA 4J07A 4RHFA 2VP9A 1O95D 4JP3A 1O1YA 2BELA 1NW5A 1XZHA 3ZE9A 2GB4A 5IDYA 4MJXA 4DM7A 5AKHA 3TLGB 3OWHA 2OV2A 4B48A 2BOVA 5THXA 4H18A 3LSYA 3AINA 1SJ9A 5E3HA 1Z7EA 1R6AA 5L95A 4F4IA 2OFOA 4WKGA 3K0FA 4JJZA 4IKPA 2YHAA 3JCZA 4Q1VA 4FWBA 1XALA 3O8QB 1DZ3A 4GLOA 4QQFA 1EHIA 3K0FB 2WWGA 3F3SA 4LJ8A 1V5EA 2PRJA 3DLHA 4R68A 1E64A 1P61B 4DLUA 4MMZB 4OUKX 1BE6A 4QTZA 4S1OA 1X7DA 2BGNA 3TSYA 1YB7A 2HRZA 4FZ3A 3P5BA 1W35A 5GV7A 2VNJA 1UINA 1G6KA 1W49A 4B9EA 4DR5B 3FNRA 3MWDA 2VJKA 4B73A 2WKQA 4JENA 4M9QA 3K0AB 1R74A 4L95C 3ZW9A 2OD2A 4GOKA 1JXQA 1EGQA 1V7QA 4QT0A 4FZJA 1RYMA 4OHMA 3AM5A 3NYWA 4FKBA 4R7ZA 3GUCA 3SBXA 4HVAA 5KTOA 3QG5A 1CR6A 1E1MA 2H16A 4FCCA 4MW4A 3M0EA 2X8AA 4TYMA 1I3CA 2BTEA 3QY0A 3RBAA 3AR2A 3EJ6A 4D79A 1LZKA 3FKSA 2X8BA 3HWRA 4P22A 2XCRB 1VMDA 2C4WA 4D3DA 2VTVA 4LN1A 1RJFA 1YWGO 3B1JA 3PCRB 4KH1A 1K8RA 2PIAA 3NM6B 4RVHA 1ZGJA 1DLIA 2IW3A 1AT1A 4NU8X 2EXXA 5HSGA 3VZSA 5B1HA 5K3BA 1PK9A 1QO9A 2C7OA 1VM6A 3MGAA 3UOGA 1JG2A 3HJUA 3E9ZA 1N34B 3GNLA 1VFNA 4RK5A 3VRHA 1I7SB 3RH0A 2UXCB 1N0VC 5FPQA 5DNWA 4PEVA 4DQLA 1F1BA 2A3RA 4KFRA 1B7GO 4MUNA 3T1TA 5AUNB 2Y4NA 4UUAA 2PRZA 4ZDJA 5LLTA 1E58A 4C04A 4EHBA 1RRPA 2SHKA 4WFIA 1NP7A 2IYNA 2EIXA 3DWFA 1ESMA 4MPTA 3DB1A 3B5IA 5FBWB 3U3MA 3WLQA 3TEMA 2O1WA 1P3Y1 1QYIA 1X9GA 3H99A 3SY8A 5ALMA 2QYHA 5FPYA 5L3QA 2HMUA 2QZZA 2WZBA 3LC1O 2JGKA 5J2TF 2FZKA 2C9MA 4ZU3A 4B82A 2AEJA 2PPVA 4XPIB 5DYTA 4HGNA 2C3UA 1G3RA 1QZ3A 1ECPA 2Y67A 3H75A 3NHPA 2D8AA 3OPVA 4PINA 3V4PB 5FAKA 3SBEA 4EATA 3COJA 1CUBA 3KALA 5ICGA 5C8YF 1WCIA 2VYFA 1Z0ZA 1KMQA 2O52A 3RTGA 3X2SA 1FTWA 2A0FA 2F64A 2RHGB 1AN9A 3AESB 4BGUA 5I4BA 4N1AA 1I10A 4DUPA 3VKVA 1KZ1A 5FO1A 7ABPA 5A4KA 1SURA 3VU8A 1BFKA 1T9GS 2QU8A 3SR0A 5AJUA 1SIOA 1J2JA 4OBEA 3P2OA 3RODA 2FCRA 4CKXA 2A0KA 2GK3A 1P2FA 2I2DA 2VDRB 3QMPA 5JEEA 2PMDA 4B2PA 4JP1A 1NAIA 5EGSA 1LF0A 5K0CA 4H1TA 1UJBA 4PIMA 4Z1MA 5CX1B 3ANTA 5EUQB 3ZU3A 1J23A 1HZJA 2CYBA 1M8KA 4WGFA 3NX4A 3FROA 4XX1A 1KE1A 4KNVA 4P9NA 4ANFA 3F5SA 4BS9A 4F9GA 2C31A 2XCUA 2JFOA 3G9ZA 4B7AA 1YVPA 5E0KB 1HG0A 3K9GA 1G7TA 4X7MA 3RG8A 4F97A 3RSQA 2WHPB 4EGCB 4AS1A 2QN7A 3LF2A 1W44A 1N9GB 2EEZA 1EVZA 1E2PA 2ESRA 1HQYE 1WWKA 1YDMA 2UKDA 2BM1A 3EVBA 1SEVA 2NPIA 4G0ZA 5DHFA 5BQFA 5FWXB 3IQXA 3VTKA 4QPPA 1YJQA 1VLLA 3F1LA 1NN1A 4F9EA 1QP0A 4KR0A 1YAHA 2XJ9A 5JATA 2O2XA 2WK1A 3HB4X 4JLSA 1IBRA 4XWYA 5REQA 1MPXA 5T6BA 2D5LA 1PL6A 4BP1A 2BDUA 1RLJA 1XZBA 2P30A 1UM9A 2XIQA 2ZYUX 3DOHA 3Q10A 4R3WA 3AFNA 121PA 1N8TA 2EKZA 1FDWA 3QUTA 4M46A 5EP1A 3WGKA 3GLIB 4TUYA 1WSBA 4ICIA 2ZYGA 2BFWA 4CBVA 3RPEA 2G4LA 1JQ3A 3GLIA 2Q4TA 3TMAA 3VAZA 2H0QA 2VTEA 4PQFA 3GGPA 1P9RA 1LK5A 5J5VA 2HEIA 3WOVA 3BSFA 3ZK8A 4P08A 2N42A 3TUZC 3UA4A 4D0RA 1NRWA 1ZZEA 3F5FA 1EFDN 2CDCA 2FPGA 4DLTA 1VMEA 2CMDA 4MRNA 4U5XA 5IM4F 1CYDA 3HCCA 5KNDD 1W0KA 1L5FA 5KYXB 1ACMA 4K88A 4ZZ0A 1J2RA 5K05A 1WP4A 4H3SA 3BBPA 3FUXA 1OH5A 4DARA 3IR6A 2PUVA 4I66A 3KU4A 4INZA 1P0CA 4MQ4A 4XGNA 1SOMA 1N0IA 5FJJA 2VHJA 3C8ZA 3KEMA 4JYMA 4ZYUA 3L6DA 3BIWA 4RE6A 5A1JA 2R44A 5KYNA 1I2MA 1AGYA 3KC2A 1DHRA 1K66A 2JFNA 2ZRNA 2NV2B 2JJ1D 4CKBA 4MPPA 2YWXA 2FZLA 4QBKA 5DCWA 5FTLA 1P60A 5KMGB 4UEOA 3JQ7A 1IRIA 1C0PA 1ZISA 1CUHA 1N7HA 1QE0A 2CYCA 2JBAA 2VHEA 3BGIA 3BDAA 5HPYB 5KU7A 2MR6A 2IEYA 1PVOA 3GZNA 4QEZA 3STHA 2FOLA 1E2GA 4ES6A 1HT2E 1LC3A 4LC1A 4MVJI 1NJSA 2HK8A 1I2AA 4I4LA 3ZYCA 4I55F 4O02B 4PRYA 3V2UA 4AZ0A 3P96A 2BTOA 2CJWB 4EO7A 2NTJA 5CFLA 3RIMA 1OXTA 3LPAA 4N7RA 3DKKA 4L1KA 2QUZA 1RLOA 2O6LA 5DU2A 2J3KA 1PR6A 2BI7A 3AFHA 3P5SA 1U0SY 1UBLS 4XQ9A 5GM1A 3DUFB 3IUEA 3IQZA 4NBVA 5EUCA 1FVHA 1XA0A 3B1XA 4K87A 3L6UA 4DNPA 5C8VA 4NMWA 4C0QC 4REOA 5CTAA 1U0NA 2PUHA 2QVBA 4TYQA 1MW8X 5K8UA 3D54D 1FEZA 3QVKA 4YRAA 2F90A 1VPTA 2FSFA 4OA5A 1N3BA 4OFWA 3I6MA 3WB2A 2I7CA 4K26A 1G42A 2CCJA 1W2GA 1W6UA 3HLTA 3QPBA 2J9FA 2V55B 4LMAA 2QQ0A 2CK3A 4ZVUA 3ZXUB 4A8TA 5JS7A 3NU1A 3IP7A 1JV2B 1EVEA 1TF7A 5AWFC 2DPMA 2XQGA 2D5AA 2ZIVB 1GUDA 2B8NA 4JEIA 4KYVA 3AB7A 2IYPA 4JXKA 4N39A 1UQTA 3IP5A 4XWOA 5JSQA 5DIFA 3SKYA 1GAEO 4BP3A 4FMCB 1Q11A 3ZCUA 1SG9A 1WMBA 5CB0A 4ZOEA 1SMKA 4LFBB 5ALUA 1E6LA 2OB2A 1YE8A 1XRJA 4PLWA 2YIMA 1MENA 1FRZA 5LU8A 1OPXA 1T8SA 2NUTB 4YMSA 4E09A 4V3CA 5FEMA 5BSEA 521PA 4EH1A 5ALQA 2NACA 2QP4A 1IFXA 3GF4A 3I58A 2RKOA 2C4KA 3HCFA 2X0JA 2WG1A 4RWZA 1EESA 1UL1X 2QMOA 3BC1A 2OMKA 4DUGA 3PSAA 1DTWB 3RU3A 1BFUA 4TMTA 4YT4A 4XWWA 4PPQA 5JNSA 4A23A 1C50A 2JGFA 2N0SA 5JD3A 1X7ZB 4GOLD 4QASA 4B6GA 4UEKA 5CB4F 2NU7B 3U7RA 1NLFA 2HCJB 1U6JA 3FF1A 1V35A 2HCRA 3LG2A 4EVQA 2R8RA 4WMLA 3ME5A 1C14A 1X80B 5ILQA 1CETA 1D2RA 5ECGC 1JDUA 3A6LA 1UBGA 2RGAA 3HGMA 4YEDA 1UM8A 3UY4A 1EE9A 3GLUA 1K6MA 1VJCA 2FTKE 2ZU6A 1T34A 4HFRA 1TE2A 3G1TA 4CM4B 3W8DA 1QH8A 2HJHA 2HWUA 5CXXA 1N3IA 5GOZA 1F48A 1P7CA 4BNMA 5IG2A 4ETNA 4B3TB 2EF1A 4LJYA 2BWJA 4JASB 2SECE 1O57A 3IQWA 4MGYR 5BMOA 3HYCA 3BBLA 4KCGA 3O9ZA 3HEBA 3G1UA 1FTGA 5D3QA 2GJAA 2QY9A 4N5NA 2OV8A 4UASA 1O94C 4DJEC 1XE3A 5CBKA 3PC8A 5LP6F 1XVIA 5ECDA 4R83A 2DE0X 3FRJA 1XPRA 3QEBZ 2VPTA 3EA4A 2P6RA 3R6DA 1FFCA 4MARA 3T5AA 2WIFA 1E7RA 3ZEAA 1J49A 2RGEA 5HA5A 1TYCA 2XA9A 2XX3A 3A1VA 3OZXA 2ACKA 4UCQA 4LRYA 1JDNA 3MILA 2FRDA 1RTKA 3CX4A 3K5WA 1L7OA 3FNFA 4KP7A 1T2VA 2OHOA 1FUKA 2QTCA 5ALTA 4DMFA 3MRSA 4RA6B 4KPGA 3R0QA 2K2QB 2J30A 3PPIA 1I1QB 1E4OA 4LDRA 2VAWA 1YOVA 1IEXA 2R60A 4FC6A 1O4WA 1ZN9A 3WIDA 1RCUA 2H31A 2MSDB 3A25A 1QHNA 3U49A 5K01A 5KOJA 4OHUA 3P52A 3I12A 1M72A 1S01A 3JALA 3HGTA 4TS3A 2B25A 2DY0A 4U2FA 2O5VA 3H9JA 3U3XA 4JB2A 4U7TB 1UIRA 5FBLB 3GP8A 3ZV6A 1K6JA 1XRRA 4LSMA 3PFGA 1KJ8A 1Y89A 3KUCA 3QKIA 2R86A 3O2QB 4O29A 3E22B 5HXAA 1U7HA 2HU2A 2IZ6A 3CF4A 5K0FA 1EFCA 2R85A 1JECA 1Y6GA 3ZY5A 3P2MA 4INPA 4JT4A 3RU7A 3NBMA 4CUZA 3AR5A 3C43A 3Q3VA 3W4JA 4IJQA 3ORSA 3T7SA 1GGEA 2P11A 1Z38A 1RXCA 4L08A 4ENTA 1H94A 1H05A 2VA9A 3B48A 1BWRA 1FE8A 2CNWD 3TZQA 4WIAA 2HHAA 2HZBA 4RD4A 1JDJA 2AS0A 1Q57A 5G40A 4MQFA 1A72A 2BF4A 4FYJA 2FPRA 3M6AA 5CPFA 3RVRA 5EPEA 4PN3A 2QXYA 2V6JA 2KQUA 1PJZA 3E1SA 3ORQA 2WJGA 1O6ZA 4X6YA 4MV6A 5EMNA 1MH9A 2CHQA 2D2XA 2GI4A 3DBRA 4CG0A 1T6NA 3ELUA 2IHNA 1WCYA 3LWNA 5DX8A 5DEIA 1L4HA 1VLVA 4D9IA 3IV9A 2KWIA 2X77A 3LT0A 4Z4HA 3BD6A 3S5UA 2ZXUA 4RANA 3H9EO 1CJKC 2PZFA 2WJ4A 3HJCA 1TCCA 1LU9A 3QPAA 5B2EA 4OI4A 3L0ZA 4AZ3B 2YWHA 4GSLA 2W6JA 5BW8A 1JUDA 1L5YA 4GW3A 4RPHA 4ISBA 4K86A 4D41A 3N6RA 1V1RB 5LQUA 1P5HA 3QV1A 3FPEA 4I99A 1MO5A 1RBQA 1ZRMA 2ZWOA 4J0HA 4NH0A 4TMVA 4UNNA 1YI1A 2B69A 5CRIA 1FLAA 3T3MB 4B3SB 2AMVA 2QQEA 4CKYA 4L3OA 1MAHA 3PR3A 1H2BA 4ENRA 2NYRA 4FZRA 2XXAA 4I4TB 4YRSA 5DYIA 3HQ4O 1CQIA 4CNBA 1GQRA 1RQ7A 2CXNA 3CSUA 2WIAA 4UUMA 4F4UA 4E5DA 3HRIA 3H5RA 4JR2A 1MB9A 1Z68A 5CVVA 1N2CA 4ED9A 1UZUA 1DAOA 3LBHA 5IS2A 2BGJA 4Q34A 4BVKA 2OK8A 3KQOA 4RJLA 4ND6A 4LOKA 3M7IA 2IPXA 3TTWA 2GPAA 4NRDA 2Q4OA 4DVGA 3I34X 1BKDR 2AJ8A 4YPVA 4MJLA 1ETHA 3FCUB 3COZA 1HUQA 2GZRA 2BFFA 3M83A 3M89A 2PZAA 4HX5A 1QS0A 1DIRA 2DKOA 3C6ZA 5L7WA 3S7ZA 1A9TA 2E85A 3MWGA 4DT1B 2HK9A 3W6ZA 1UPCA 1I4DD 4NABA 1Y42X 4ZYVA 1RWKA 1I4TD 1YZLA 5HZHA 4EYKA 3LS2A 2DTEA 1BCRB 1XEFA 3PGMA 4MNTA 4ZVSA 2EX0A 3OA0A 1DJLA 3RARA 2NVBA 1H2YA 3K72B 1G9XA 1XQWA 2GWHA 2VHCA 3HBMA 4RKQA 1DZIA 4BZWA 4F4JA 5JQGB 4QYWA 2PH5A 2XF8A 3DPSA 3QMMA 5A1TA 1HE4A 1E3MA 3WJ7A 2ZDQA 3D4LA 2J0QA 1L3CA 4L8YA 1Q95A 1E5DA 1OROA 1RQLA 5I7HA 3MINA 4WA7A 4QQNA 1SU6A 2UYHA 5FF9A 3LCRA 4MI6A 3WV5A 3KKOA 4XX0B 2RJ3A 4BY9E 2BFDB 2FPKA 1H1DA 1HTTA 3ZVRA 2EL7A 5IXYA 4CKWB 4GI3A 4J0FA 5HR5A 4NENB 1CQXA 3KJNA 4I36A 4Q3DA 2EIHA 1DHTA 1WE2A 3K09A 4NDAA 2DWQA 4XX0A 1NC3A 5LBIA 2JCVA 1GNTA 5CK4A 1V5FA 3BAFA 4PG6A 1E8NA 4A0SA 1W2WB 2VBCA 3EXFB 1RYBA 3OJ0A 2XMRA 2YXPX 1GNQA 1HLFA 1RQGA 4MUBA 4Y1RB 5ITVA 2GPYA 4QZVA 2WJ3A 3TE7A 2Q3JA 3IEIA 4IFTA 5DH9A 1SU7A 1LWNA 3GRAA 3VHRA 2B1JA 1O89A 4QUAA 1RACA 4JCOA 1Y6JA 1NJ5A 2ZWPA 4UVHA 2QN1A 1D2MA 1C30A 3P4XA 4UM9D 1T8TA 2PT5A 3R76A 1Y3FE 4E21A 1TUBB 2IEAA 1SZJG 1QNFA 2DQZA 2BKEA 2C4NA 1SNYA 2OO5A 2YWCA 4BFTA 4XTRA 4EPWA 3B38A 4XJTA 4C4PA 1G8JA 1LVHA 4L78A 4BZPA 2G71A 3GGDA 4TMKA 4HFNA 4Z7OB 4EVRA 3DZIA 4G0PA 3ZVLA 1FX0A 2BONA 2QVYX 1AZSC 3AR6A 4X85A 3T1QA 3I6BA 4LC0A 3OTWA 3BJRA 4IHAA 4F46A 4I6EA 3JQFC 3OCXA 1N5KA 4MPRA 2O6HA 5E2BA 2ORIA 2X9VA 3KTAA 2WNSA 5JROA 1T0UA 2Y4OA 4Y6QA 4F1KA 4RHUA 2GDJA 4W9MC 3AM3A 3ISVA 1H1LA 1A9PA 1EZZA 3P26A 4H08A 5T4HA 3M4NA 1UXIA 4Y9UA 1RLIA 3F5QA 1J20A 1DWUA 1VE7A 1DC4A 3SQLA 1QUFA 4HS9A 3LV8A 1EQ2A 5B2ZA 1YMUA 2H0RA 1US8B 2GILA 3JQDA 4V0RA 1HYBA 1QH1A 2I6UA 3URKA 5I8PA 1TMKA 2ZJBA 1DX9A 1NXWA 2GN4A 4DSNA 1P5JA 1KJIA 2WICA 2PX8A 3EEOA 3LBIA 4G5SA 2OTCA 5HF6A 2B92A 3REFA 4HUQB 1ND5A 5TF0A 5BR7A 2YMMA 1UMDA 1XZKA 5CPBA 4A8JA 4KR9A 5CDGA 3UHJA 5CYFA 1RMTA 2C59A 4QU5A 4ENVA 1M75A 4ZOBA 1UJ6A 4KNWA 2HO4A 4OQDA 4YMIA 2W6PA 1MJGA 3GJYA 5LP6B 1U80A 5HFNA 4WXYB 2Z09A 1N7JA 1W8IA 3D2LA 3DC2A 2W2XA 4PLFA 5AVQA 1L6IA 4R1QA 4G0VA 3NATA 4LXUA 2O8FB 2VDPB 4N3CA 4WJLA 1YRHA 3C3WA 3H7AA 1FC0A 1Y63A 1VHTA 3V00A 2AFRA 3UF0A 5GZ1A 5IBQA 4NNJA 4JJFA 1ZW1A 1V5WA 4OYHA 1AA6A 3B9RA 3R24A 3DKPA 1PFUA 4I81A 4JVOA 2C97A 1Y8RB 1AMNA 1R9NA 4WXHA 3MLAA 1U1FA 4R8MA 4P86A 5BYBA 4BFCA 1E4EA 2AHRA 3RADC 3I8OA 1AGNA 5JS8A 2IWHA 2FR1A 1Z45A 1C80A 2PWZA 2DOKA 4X8OA 4CLHA 1RNLA 1RYFA 2HA0A 1F8XA 1MQ9A 4ZOLF 4L76A 1F7VA 2J33A 3KYJB 1USIA 2B8TA 2I29A 4CFZA 1DEXA 3ZZUA 5KWIA 3T3GA 1Y6ZA 2JLVA 3PFCA 2PIDA 1VMIA 1CP3A 3WHIA 2QJFA 3EARA 1LQUA 2PKEA 3BE4A 5AHKA 3UJ3X 1CZHA 3ZV7A 3A9SA 4NEQA 1Q22A 5A7GA 1JEAA 4F6CA 1L3BA 4TRNA 1FSPA 4EMSA 4MW0A 4KGVA 2GR9A 4O1HA 3H9UA 4RIFA 4CKEB 1GAJA 2NUBA 4OXKA 4XQCA 3RBZA 4EFMA 2EWVA 4YT8A 1SXIA 4N3GA 5KYVA 2H4HA 4AAYA 1RWBA 2CL0X 4FOLA 3NFRA 2PVPA 4H35A 4DNXA 4NE2A 2ONJA 2IH2A 1F2UB 2FPIB 2HLDA 2PX6A 4FS3A 4TZTA 2JI8A 2ADOA 3Q3JB 1UBHS 3VTFA 1F9AA 1NP3A 4IS3A 5EKXA 2IOFK 5KTSA 3RVQA 5DP2A 1GCOA 4S2EA 5T8KA 2GJKA 1LFAA 1W5AA 1NVVR 1OH8A 1TQ8A 2BDEA 1CLEA 2QAIA 2UU9B 2XZDA 4EPTA 2EBUA 1I1HA 4J3FA 2BGMA 1XRLA 3BRSA 1EDEA 4FDLA 5DBOA 1N36B 4L57A 2GTPA 3H4VA 3VBCA 3FTQA 3I4FA 1X1TA 1IEQA 3PC4A 4LZWA 3NEAA 1SKQA 1YS4A 3AYXB 3CPHA 1CJCA 1QP8A 3TSCA 4JELA 3M9LA 1KP2A 1YR3A 4FOTA 4KVZA 4C7MA 2AYYA 1KL7A 1D4ZA 1V4VA 1IN6A 3ANNA 3QW4B 2EW1A 5T64A 1DQYA 4EENA 1UDCA 4EI8A 2XCOA 3SXUB 3O21A 2BISA 1NQXA 3E7WA 1FZTA 5KSWB 1OLSA 1G7SA 1P5ZB 4BNDA 3D4PA 1NSFA 4OAQA 1RR6A 3KYDB 1MW9X 5AIBA 2XADA 5FEUA 4JUAA 3WB1A 1AB5A 5AM4A 5KJ6A 3C6MA 3ZHRA 4BXOA 2PKWA 2PL3A 5T7BA 2H29A 2P1ZA 1VBMA 3CLRD 1PDWA 3CUUA 4RESA 5DE3A 2IYTA 5KVQA 1U3WA 2WTXA 3GVIA 3OT4A 1ODCA 4KLCA 2ZXEA 3HRKA 3O2JA 2HLHA 2XTAA 3CLVA 4NMLA 6AT1A 4OXQA 2OHVA 1RYYA 5IRCD 1M6NA 1W4RA 5C3MA 5E2IA 1SIUA 3CUYA 3M3HA 2R4QA 3ZEIA 4WRRA 1OWMA 3GRFA 3AM4A 3WWYA 4BEJA 1DKUA 5IJWA 3IA2A 4XCXA 1U9YA 3VKGA 1E5LA 1XTKA 3IKJA 3RU2A 4CF3A 3V2HA 3WG9A 4R0MA 4RLHA 4WFQA 3PNOA 3D7NA 3DTTA 2HPZA 4HH0A 1M33A 4MRVA 4LF6B 3QXGA 4KOEC 2FDXA 5JFTA 1OASA 4L22A 1UOQA 4JEHA 1STOA 4H1WA 1Z8NA 1V3UA 1IQPA 4XYLA 5K0GA 4JI7B 3VAYA 2IX3A 2NIPA 1QVWA 1TU4A 2XHEA 3LGXA 1MF7A 4ALNA 3I0ZA 3N0TA 1H6CA 4JI1B 4DLLA 2IBTA 1ORVA 5HIIA 4E5YA 3GDWA 2GCOA 1WVIA 1XYGA 3LX4A 3QUSA 5JH7A 5JXGA 4EY7A 2EWMA 5D00A 2C3YA 3DLTA 5LDHA 4LZOA 4CQMD 3AUKA 5KO2A 3UMMA 3L1JA 3THOA 5K99A 2P7HA 4D4KA 3CN9A 3EWSA 3PQ3A 4I4TF 2IPNA 1W5SA 5DJ5A 1OA1A 2LIVA 3E0QA 4X8HA 3K70D 2O8CB 1FQKA 3LPDA 3AESA 4BFZA 2QLBA 2X1LA 3CA8A 3NZEA 4DV6B 2WJAA 4JGGA 4K46A 1BDJA 3FKJA 3NWJA 3VPAA 4M0UA 2Y1FA 3MOIA 1T4MA 1M6YA 1U3GA 4CT0A 5I7UA 1B23P 5FI1B 4M8IA 2OCPA 2V7UA 3E9DA 5AXDA 3RVSA 4BB0A 2C5BA 4GPZA 4OHCA 4OMCA 3H87A 3SQNA 1WOYA 4N9QA 4F04A 1HTWA 3DFFA 2TYSB 4Y2PA 3AIIA 1JYSA 5AKZA 3ANYB 2EGUA 3GRKA 2R6CA 3H8VA 4TTJA 4CUJA 4YUXA 3QE3A 3WMEA 2O2IA 4DJFC 4BNJA 2BKLA 3KTFA 4FMPA 4PRLA 4G5FA 2DY1A 1DO8A 1JPNA 4JNKA 1EWRA 1FXWF 1GUZA 4Q37A 3RUEA 1CQWA 2ETXA 2I65A 1AQYA 4AKTA 3IB6A 3MJRA 1E2LA 2Q41A 1V8DA 2YWFA 3HB0A 3ROKA 3U26A 4F2HA 4MDFA 4ZK6A 5ULLA 1SBIA 2LW7A 2RBKA 3LUPA 1X2BA 4A1OA 2WFLB 1QCCA 3GLSA 4ZICA 2H4ZA 4RD0A 3IR7A 4U6QA 1G3IA 1M10A 1OX6A 4GC9A 4PYKA 3PNKA 4BLPA 1Z73A 2OXRA 3QRWA 4RVGA 1QH9A 1U0EA 2IZZA 2O2CA 2LKCA 2RGGA 1HSZA 4GPIB 4P0TA 4BBPA 3B78A 3N8IA 3AP2A 3UH0A 2C29D 2WU4A 3IMKA 2GESA 1YBHA 4MW5A 3H1FA 4WUVA 4B80A 3IS3A 4FLMA 4MWBA 2VDMB 4QXPA 2C94A 3H6HA 3TX6A 4B81A 4CLXA 5I6DA 1PEYA 1I8TA 2WT9A 1GTL1 2A9FA 1A2BA 2B8WA 3S70A 3R0ZA 1D2EA 1TJPB 3MJVA 2IIBA 1SAYA 4NJMA 1AKVA 3VJLA 3IESA 4L8LA 4L4RA 3UW1A 4IIVA 2Y99A 1SHJA 4PSCA 4IOKA 5FHQA 1T5OA 4CTNA 4DV7B 5CLIA 5JSYA 5IXJA 5K1ZA 5HE8A 1YNSA 3F9RA 4PCLA 3BJZA 1CUIA 3FCSB 4N41A 1QQTA 5AKYA 2WD8A 1G5HA 3GJQA 4A2CA 1L7MA 4V38A 4DXHA 2Z5VA 2JVIA 5HKBA 1Y7LA 1AOXA 3WGUA 5AI9A 1NG1A 5L9AA 2BGGA 2Q0HA 1QX3A 1XTTA 3BXXA 5EI5A 3SJAA 4W99A 2XXAB 4KV7A 1CXZA 1YFLA 4FILA 3CNOA 3NIDB 2FK8A 4AC9A 5AJWA 1K4KA 1E0DA 1YZGA 3ZD6A 1MX3A 3IE0A 4NBSA 1X19A 1QHXA 2KHZA 3DDZX 3I52A 1W85A 2Y1EA 3ACCA 4HBGA 1CR4A 1Q3HA 1QFMA 1AS2A 1COWD 2O7SA 3EGOA 3QQ5A 4KC0A 5K3EA 1ZWKA 2REOA 2F2TA 2H63A 5I9NA 2ZBGA 1EFVB 4XWKA 2XB2A 1IUNA 1VPVA 3VYUB 1NYRA 2PX5A 2NO4A 3DNMA 3CRQA 4GLFA 4NKRA 5HFJA 2ES4A 2ZT7A 1TADA 2AR7A 2HA5A 4POOA 3EOBI 3M49A 2HMVA 1FYWA 1CK4A 2V65A 4K81B 2WTMA 2NU6B 3VR3D 5B30A 4B76A 5JZBA 1X7GA 4RETA 5CH3A 1YSCA 1Q44A 2F17A 5HIKA 4FMCF 3WYAA 4ENPA 1VECA 3UXMA 3SC2B 1ACLA 5KHLB 5ES3A 3BXOA 3RRNA 1QB7A 4G8BA 4E32A 2OG2A 1KY4A 3L1VA 1MZPA 1KH1A 1MNQA 4TTVA 3UN1A 1QHIA 2ZT6A 1OLXB 3W1WA 4DCMA 1E6EA 1UKYA 2VF2A 4H17A 1NQAO 5JXHA 4RACA 2Y6UA 3QK7A 2O8EA 3PNBA 2FEAA 3BJMA 1BX1A 2QEQA 3MTEA 1V16B 4FYXA 1LPSA 4RELA 2Z6UA 2JD2A 3NAZA 2M98A 1P7WA 2JLWA 2R87A 4NZNA 3UJNA 2NUAA 2PVSA 1T15A 4IQ0A 4RAQA 2XB6A 3EC2A 1AY0A 1T1EA 1WV1A 5K0JA 5L7TA 3GCZA 3ZTTA 1T6ZA 3Q7RA 4EO9A 3ICWA 3DMTC 3KVOA 4E5KA 2P35A 2UVDA 1WMFA 4MA0A 4QEDA 3RVNA 2JAUA 2E4YA 4BX8A 4UDYX 1OXXK 1K9SA 3II6X 1U5BB 1JFVA 1XCMA 1E0SA 1KYXA 4QOSA 4EKEA 3U4QA 2IXEA 4FOOA 1UXHA 2PXXA 4OUDA 1CUJA 1L8OA 4DR6B 3H2HA 1BCSA 3MERA 3MT9A 2HHHB 1K75A 3AIKA 4H1HA 2G88A 4PRZA 1T2CA 3VGPA 4TXHA 3AF3A 1MP0A 3D6AA 2WWVD 1WUTA 2GPNA 4AWAA 2C9BA 2ISQA 1UZMA 2C92A 4FM9A 3BFJA 2H51A 1KMMA 2EKDA 3CJQA 2P4SA 3T0FA 1Y3HA 1NOIA 1OXBB 3FWZA 2CT8A 1JVSA 2ZR8A 1R5OA 3O3CA 4JLAA 1KSHA 2EHDA 1H8HD 1QBKC 3OPYI 3L8ZA 4WOCA 2O8VA 3RYCA 1JIXA 3IUNA 3LBFA 3U44B 3RKSA 1C7ZA 2PL9A 1IQ0A 4TKVA 2H3HA 5TARA 3L79A 4CYMA 2J3IA 3KL4A 3WRXC 1F14A 4WH0A 4TLAA 2AN5A 1T8UA 3FZNA 4OF4A 4DDWA 3TDKA 1F6WA 4KQKA 4L4ZA 3HXMA 1FVFA 1AUXA 3UW3A 2R1UA 3F5DA 2ZUEA 4MVCA 1R6TA 2JGDA 3DOUA 3H17A 3V8EA 2L42A 5L45A 1K68A 2HA3A 4AJNA 5JUWA 1ZCFA 4MR7A 2W2TA 2I8CA 3AIOA 5AVXA 4P4SA 2VDQB 3F6BX 4ZYTA 2PO5A 3ZE1B 5D85A 2HSGA 4BWGA 1N6RA 4MYTA 4PHTA 4P4SB 5B37A 5JRJA 3OEHA 3L01A 2LCQA 1GU1A 3HO1A 2CXHA 3DOFA 3SMQA 2ZIAA 4OV6B 3HMKA 3OEWA 1WBDA 2GM9A 2B5OA 2QTMA 3O92A 4N03A 1K1EA 2GMWA 4BMDA 4P0PB 1C1DA 2RI1A 2QT1A 1E62A 1E4EB 2XDWA 2XSZD 3CEMA 1N1EA 3H2GA 4HAUA 4FYWA 4MVJE 1NQUA 1ZK2A 3PQ7A 1TRHA 1TYZA 5G0VA 4URZR 2FVXA 2VNHA 4B34A 4DWVA 3W2GA 1XZJA 4MV9A 2EG9A 2O8BB 3GGGA 2RI0A 1QG2A 2VH2A 4V0QA 1FSZA 4G1FA 4ML3A 4YJ3F 2J0EA 3SWWA 4RUKA 5MDHA 5JYBA 1I94B 2PGJA 4K9NA 4AX4A 4BVHA 3Q7EA 1V2HE 3KQPA 2ZTSA 4UZEA 2VF8A 3LXMA 4DIBA 3QKWA 2G04A 2ZSUA 1C7IA 3GZ4A 1FUUA 4DV2B 2BGWA 3BICA 1UR5A 4HF7A 5JPIA 1N57A 3AI1A 3WZ2A 4DANA 1P31A 1IK6A 1N6PA 3OWXA 2NQ2C 2QZPA 1NBOA 2DR0A 2Q9AA 4JB3A 4PZ9A 2AZXA 2F7SA 1RYEA 1WXEA 4JP8A 2OV4A 5FBHA 4KXFB 4NJOA 5L51A 1IBKB 1TO2E 1VIVA 3ZTYA 3O03A 1NATA 3QLTA 3HP7A 3GCWA 3C97A 1RXVA 2H2DA 3CBQA 3ILYA 4RKYA 2X86A 3OD1A 2J9FB 3A26A 1T13A 2OXIA 2XGSA 2PLWA 2ZB8A 4LVNA 2A9OA 4IHJB 4MUGA 2XT9A 5ALVA 1KA9H 3EVCA 1NUAA 6REQB 1QF7A 1W76A 3A4VA 5THQA 5JD4A 1SRQA 1SVOA 1QFYA 1BC5A 2F9FA 3JAWA 3PC3A 4E88A 1YR9A 5BQXA 4LJ6A 2W2MA 4CR8A 5FBQB 3RTCA 3PRKE 4KYIB 4ND2A 3UWMA 4HGYA 2GPWA 3QUCA 5LSAA 4P84A 1GTMA 3RM3A 1TCBA 1P33A 1UBOS 1IQRA 4P54A 4QKQA 1IXYA 5F7JA 2XDAA 5BV8A 1WS6A 4GZ6A 4OFBA 2IDJA 3CEAA 1GD1O 3HWWA 3MLBA 3C0KA 4LDJA 1H1TA 2F1OA 3TTUA 5U1PA 4JI4B 4YP1A 2CF6A 1KSGA 5HE9A 2QT0A 3NGMA 3UT5A 2FR8A 4B09A 2UVPB 1FRFS 3QPDA 3NOOA 3JZDA 4Y9DA 4BU0A 1LPMA 4MUAA 1RZRA 2R3SA 1ESZA 3W3AD 2VTBA 2ET6A 1UF9A 2DQKA 3QEMB 1Z16A 4MA5A 5J59A 4EHIA 4FUQA 5DYGA 2VK1A 4NMHA 1FTNA 2EZ9A 2NU7A 1JIVA 3HO6A 2W2LD 3N9IA 4WZBE 4YREA 2WHXA 2PUJA 4NIMA 3C6XA 1ODLA 2IODA 1HNNA 3IIIA 3HDGA 1VKNA 4X1KA 1E3WB 3SZOA 3CRNA 4O4JA 5EGNA 1AKUA 3H3FA 4QJ4A 2KBFA 2LZ0A 3NBXX 4JAVC 3RFUA 3WKDA 4CM7A 2CE2X 3UATA 2HL6A 1JW9B 4Y2YA 1DDOA 4AQYB 1Y1TA 2YNMD 2K7ZA 1FDOA 2YX1A 1EGMB