5IXFA

Solution structure of the stam2 sh3 with amsh derived peptide complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
68
structure length
68
Chain Sequence
EIQLNNKVARKVRALYDFEAVEDNELTFKHGEIIIVLDDSDANWWKGENHRGIGLFPSDFVTTNLNIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Signal transducing adapter molecule 2
publication title NMR Reveals the Interplay among the AMSH SH3 Binding Motif, STAM2, and Lys63-Linked Diubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 10
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF02809 UIM Ubiquitin interaction motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5ixfA00
2V1RA 2PZ1A 1PRMC 1UECA 3VS3A 4FSSA 1YN8A 2EYXA 2RQRA 1X2KA 4J9GA 1S1NA 1W1FA 2L2PA 2V1QA 1LCKA 3RNJA 1U5SA 2J6OA 1ARKA 1X69A 3GBQA 3EG1A 4RTYA 1BBZA 1QCFA 5EC7A 1GCQA 4HVUA 2EGEA 2EW3A 1E6GA 1MV0B 5IHIA 3VS0A 3VS7A 2RQTA 4E6RA 2RPNA 1PWTA 1PNJA 3SHWA 2JW4A 3UA7A 2DE0X 1ABQA 2FPEA 3I5SA 1UG1A 3I5RA 2RQVA 2BZXA 2L3QA 4AFSC 1RLPC 3QWYA 2W0ZA 5FWCA 2LQNA 2DM1A 2DA9A 1YWPA 2CSQA 2HBWA 1QKWA 4WCIA 1TUDA 4RTVA 5IHKA 2O88A 1HD3A 2KXCA 1YP5A 2EPDA 3R6NA 1ZBJA 3REAB 4J9FA 2D1XA 1PRLC 1UJ0A 5FW9A 2RN8A 2QDLA 2CH4A 4AFUC 1M3BA 3VRZA 1K4US 3VS5A 2HEQA 2CSIA 1KJWA 4DEXA 4D8KA 1SRLA 3UA6A 3IQLA 1FYNA 5FWBA 2M51A 4ORZA 1WXUA 1SRMA 2EGCA 3RBBB 2DJQA 2AZVA 2KXDA 4OMQA 2LX7A 2K9GA 1GRIA 4AFQC 2JT4A 1Y0MA 2C0TA 2NUZA 4LN2A 5ECAA 1SEMA 1RI9A 1WXTA 1ZSGA 1ZX6A 1T0JA 2JMAA 4IIMA 1K0XA 2GTJA 2W10A 1J3TA 1GCPA 2MOXA 2L3SA 1M30A 2DILA 1GCQC 3PVQA 2CUDA 2LCSA 1GBQA 5GJWB 2SRCA 2ED0A 4J9EA 2F2XA 2DL5A 1AOJA 2AK5A 2CT4A 4K11A 2YT6A 1CKBA 5IH2A 4EIKA 5GJVB 1U3OA 4RUGA 2YUOA 2DL7A 2JXBA 1M8MA 1W6XA 1X43A 3UF4A 4OMMA 1Y57A 1GFDA 1VYVA 2DNUA 2RF0A 2ABLA 2EYZA 1AVZC 1WLPB 2JM9A 3PVLA 1NYGA 3O5ZA 2O31A 1BK2A 2FPFA 3EGUA 1SHGA 1Z9QA 2KRSA 2FRWA 2CT3A 4OMLA 4OMPA 1M27C 3REBB 1ZUYA 3TSWA 1UJYA 4IIOA 2CH4W 1YNZA 1JU5C 2J6FA 2O9SA 2YUQA 4A63B 1PKSA 2LP5A 1WX6A 3KFVA 1WA7A 4JPBW 1U06A 1ABOA 3VS4A 4DEYA 1RLQC 2K79A 1BU1A 2KRNA 1G83A 4RTWA 4J9HA 2O9VA 3UATA 1WFWA 1I07A 4RTUA 3TVTA 5HCKA 1UFFA 1X6GA 2FPDA 2J06A 2D0NA 1I1JA 2KROA 4HCKA 1YCSB 2JMCA 1OPLA 2RNAA 2GBQA 2KYBA 1K0SA 2CUBA 1VYUA 2OAWA 2DVJA 1X6BA 2CDTA 2FO0A 3THKA 2GTOA 2CREA 2KE9A 1WDXA 1QWEA 1NEBA 2YUPA 3ZL7C 2DRKA 2EYWA 4JJDA 1ZLMA 1SPKA 2JS2A 4CC7A 4RTZA 1ZUKA 1MV3A 1Z9ZA 4HXJA 2JS0A 2ROTA 1NG2A 2A36A 1AZGB 2ROLA 1OV3A 2XMFA 3EG3A 2KT8A 4LNPA 2A37A 2F2WA 2RQWA 4X1VA 2K2MA 2KBTA 3NMZC 2EBPA 4JZ3A 1NEGA 5IXFA 1MUZA 5IXBA 1T0HA 2JM8A 2M0YA 4RTXA 4F17A 2EYYA 2EVRA 1WXBA 1GBRA 1W70A 2LJ3A 1AWWA 1QKXA 3EHRA 3M0PA 2DL4A 4AG1C 1AD5A 2LJ1A 1B3QA 2J7IA 2KNBB 2AKLA 2O2OA 4Z8AA 1K76A 1V1CA 2GQIA 2E5KA 3I35A 3PE0A 2ED1A 1WYXA 1SSHA 2ESWA 3M0TA 1UHCA 1PKTA 2VWFA 2FG0A 1B07A 2ECZA 2P4RA 3FJ5A 2BZYA 3H0FA 3M0SA 4ESRA 5I22A 3EHQA 1TG0A 3NGPA 2MIOA 3H0IA 2JTEA 2BZ8A 1BB9A 1GFCA 4J9DA 4F14A 1YWOA 4GBQA 3C0CA 3VRYA 4F16A 1KSWA 1T3LA 2OJ2A 2D8HA 2AZSA 2X3WD 1HJDA 3LH5A 4RTTA 2I0NA 2DLPA 4LUDA 1NLPC 2MCNA 2LNHB 2FRYA 1JXMA 2HDAA 2AKKA 2DBMA 1NLOC 1VA7A 1K1ZA 2LJ0A 2LMJA 2K6DA 2KYMA 1FMKA 3NPFA 5IHNA 4J9BA 4JJBA 1WI7A 2RQUA 4J9IA 2HCKA 3NHNA 1IO6A 1A0NB 4JJCA 1H3HA 1AWJA 1JEGA 5I11A 2GNCA 1JXOA 3CQTA 2IIMA 3VS2A 1E6HA 2X3XD 1EFNA 1G2BA 4JZ4A 3M0RA 4AFZC 2YSQA 1QWFA 1CSKA 2G6FX 4HVVA 1AEYA 1XOVA 2K3BA 1KFZA 2K7AA 3U23A 1AWOA 2DRMA 2C0OA 2L0AA 1AZEA 2A08A 2DL8A 4LE9A 2DBKA 2DX1A 2GGRA 3QWXX 2PTKA 1HSQA 2KGTA 3M0UA 4ZNXA 1M3CA 2LQWA 2VVKA 1JO8A 4M4ZA 1VYTA 2D8JA 2LZ6B 4HVWA 1UHFA 2VKNA 4GLMA 3VS1A 2H8HA 3M0QA 2KT1A 1M3AA 4J9CA 1NM7A 4R0KA 4Y92A 1KIKA 1JQQA 1UDLA 3H0HA 1I0CA 1RUWA 1UUEA 1PHTA 1UTIA 1OEBA 4CC2A 4QT7A 3TSZA 2HSPA 2OI3A 2EGAA 2J05A 1T3SA 2EQIA 1NYFA 3EG2A 2ENMA 3ULRB 1E7OA 5L23A 1OPKA 2FEIA 1QLYA 2B86A 2KRMA 1UGVA 2NWMA 2KEAA 1H92A 2F2VA 1X27A 2C0IA 4OMNA 1AWXA 1H8KA 4D8DA 1N5ZA 3A98A 1GL5A 2BTTA 3VS6A 1WIEA 1OOTA 1K9AA 4LUEA 3EG0A 1UE9A 4AG2C 4CC3A 4OMOA 2DF6A 1TUCA 3H41A 2EKHA 3I9QA 2YDLA 3JV3A 1SHFA 4Z89A 2SEMA 2L3PA 2RMOA 2YUNA 2DMOA 2KR3A 3SEMA 2A28A 2J6KA 1X2QA 1CKAA 2DL3A 2PNIA 4Z88A 4CC4B 2DYBA 1ZUUA 4KRTA
chains in the Genus database with same CATH superfamily
2V1RA 2X4WA 2PUKB 4CRIA 2CZ6B 1OI1A 5FU7B 2RQRA 2VGNA 1X2KA 4C5IA 1W1FA 2EQUA 1SF9A 4OB3B 1X69A 3GBQA 2HZYA 3G6EQ 4LDXA 3V7CA 3VS7A 1PWTA 1RAHB 1PM3A 2F5TX 2FPEA 4QQGA 1UG1A 3UDCA 1IXDA 2BZXA 4PLIA 1I5OB 2KI7A 5CCAA 4EDUA 1QKWA 4WCIA 1LJOA 1TUDA 5HK3A 2EPDA 3R6NA 4J9FA 2D1XA 1RI0A 4PFOA 3GLXA 3I55Q 2RN8A 3JCMJ 4AFUC 2PVDB 2X9HA 4KUIA 3I56Q 4V2SA 1OULA 2CSIA 4AMCA 3OW2A 2Z0WA 4DEXA 3UA6A 2GQVA 3IQLA 5FWBA 3S3NA 2M51A 4M7DF 4ORZA 1SRMA 2EGCA 3RBBB 5LJ5d 3QKJA 2HSEB 4DQ2A 2KSSA 3OMCA 1KD1C 3P8DA 3HRUA 2NLUA 4M77E 4C8QF 5GAN2 2BE7D 1VQNA 1Y0MA 1RI9A 3CCMT 2RHYA 1T0JA 2KY9A 1PD1A 1VQ5Q 4C0FA 1J3TA 1GCPA 1ZA1B 3KXTA 2DILA 2M02A 3QHSA 5KYWA 2SRCA 2ED0A 2QQSA 3RKWA 4J9EA 4C92A 2JN0A 1VQPQ 2AIRB 1QVGA 2DL5A 2XDDA 1AOJA 4FIBA 1BI2A 5KYUA 2X4YA 1VQ8A 4OMFB 5GJVB 2HNIA 2EQMA 4J8OA 4N0AA 2RK1A 1M8MA 1WHJA 4PKCC 4PJOF 1VQOA 3SWNC 3UF4A 4BE2A 4OMMA 5LJ5j 1N6AA 1GFDA 1VYVA 3QJYA 2DNUA 3L2WA 3BFMA 2ABLA 1WLPB 3PVLA 2XI9A 3RMSA 3G71T 3O5ZA 4RCBA 3SD4A 1P92A 2JUFA 1B34A 1SHGA 3FC3A 3M55A 3O8VA 2CT3A 4IUPA 4OMPA 3V8KA 2EFIA 2E5QA 4M78G 4IIOA 2J6FA 2LP5A 1WX6A 4XU3A 3FLGA 4BACA 1U06A 5GAOp 1ABOA 4QQDA 3JCMf 1RLQC 2K79A 5KE3A 2AT1B 2KRNA 3M9QA 4J9HA 2BIVA 3X20B 2LTOA 1GXIE 2KROA 5GANj 1ZHIA 3CCEA 3PMIA 3EFOA 4MDWA 1KC8R 3V7RA 3HHTB 3CMEA 1I5LA 2C06A 1K0SA 1VYUA 2CDTA 4L5GA 3FB9A 2D0QB 3OYFA 2P0QA 1ZSZA 1XQHA 3CXCP 1QWEA 1Q86C 4M7DB 3ZBDA 4JJDA 4YTLA 1ZLMA 2JS2A 1KC8U 3CCJT 3JCMe 4PNOA 5CAIA 2DZ9A 4C8QB 2ZZDA 3RMQA 2ROTA 1Y96A 2A36A 2X4JA 1QP3A 3EG3A 1WJSA 3QBYA 1VQLA 2MWOA 2R5MA 3PT9A 4X1VA 1N27A 3OYNA 1LPLA 1X6OA 4PK4A 2KBTA 4NL3A 1KQSP 1IRXA 1BI0A 4NL2A 3OBYA 2XDBA 4F17A 1S72T 2EVRA 1WXBA 2O01E 2QGGA 1M1KR 1VQ6Q 4XTUA 3C95A 1YFNA 4AG1C 4M75F 9ATCB 2AKLA 3LGLA 1MMGA 2O2OA 2COYA 3PIPA 2QA4T 2H3JA 4M7AG 4TVRA 4PJOB 3PE0A 3OSVA 3OSSC 2KK4A 3M0TA 4JLGA 1M1KU 1PKTA 3E9GA 3H0FA 3OYGA 1BI1A 3NGPA 2MIOA 2QDYB 3H0IA 5J3BA 5FRMA 2JTEA 3VU3C 1M90R 3MEUA 3G1JA 5DLQE 4F14A 3JCMc 1YJWA 1KSWA 1T3LA 3MEVA 2YRCA 5GANh 3OS2A 3CC4A 3CEYA 2MCNA 4FYXB 1M90U 2CP0A 1RAGB 2FRYA 4Z02A 2HDAA 1VQ4Q 1NJIR 1NLOC 4ZGEB 3BDUA 1VA7A 2DFUA 2DZCA 4A53A 1FMKA 3OYEA 1YITA 2DVEA 2F1LA 1MNDA 2KDSA 5GANg 5D6WA 5A0LA 1IO6A 1NJIU 2QQRA 4M78C 2A7YA 5I11A 2GNCA 5C0MA 3CQTA 2IIMA 1W2BA 1VQ9T 4KBMB 2DTIA 1E6HA 4JZ4A 3M56A 3OYHA 4A4EA 2VASA 3I56T 2DAQA 4JS4A 3F70A 1CSKA 4ANJA 3OYJA 1RAEB 2DTHA 2K3BA 1C1AA 5I21A 5KCHA 1R8OB 4E7JA 3CD6A 2DRMA 5CR2A 4M77F 2A08A 3CBPA 2CP2A 3EH2A 4LE9A 5A0GA 1VQ5T 3CCLA 1ZBXA 2PTKA 3X24B 2KGTA 2MPXC 3RERA 3JB9F 2DXUA 2DD4A 1IGQA 4OB0B 3DKMA 1VQPT 4KULA 3GF5A 1NM7A 2XHCA 5KH6A 3N5BB 1OYXA 3JCMP 3L2UA 3J80E 4R0KA 4RG2A 3H0HA 1UUEA 1OEBA 4M75B 4CC2A 3LH0A 3VUZA 4EMKB 2QG9B 1YJNA 1K8AR 3TSZA 4HT9A 2FYKA 5L23A 4VUBA 2E1HA 2RA2A 5LJ3h 1E7OA 3ULRB 4FYVB 5LJ3f 3VJPA 4A4HA 3CCMQ 4J6XA 2KRMA 4FL6A 2BUDA 2QTVA 3BY7A 4JRKA 4C92E 1YI2T 1H92A 2E12A 3HTRA 1X27A 5CVIA 1MMDA 1K8AU 4M7DD 2JOYA 1ZSZC 2BTTA 1I8FA 2VUBA 5LJ3g 1WIEA 1OOTA 4LUEA 1UE9A 5D6YA 5CKBA 4C8QD 5CO7A 2E65A 4C0DB 4M7AC 2M0OA 3H41A 3I9QA 2K3YA 1FWZA 2YDLA 2PVOB 1RAFB 4Z89A 1FMVA 2SEMA 5LJ3e 2RMOA 2DMOA 2KR3A 1JB0E 3SEMA 3CCUQ 1ZUUA 2CKKA 1WPYA 4KRTA 1BKBA 2CP6A 1UECA 5CKHA 3VS3A 5HY6A 1UGSB 1S1NA 4XTZA 2QASA 1G8XA 2IG0A 3MP8A 2B8AA 4PJOD 3EG1A 3QDFA 2NUTB 5J26A 1OU8A 4QVCA 1N8RU 2EGEA 2EW3A 5CQYA 3VS0A 4E7IA 3HSBA 5GAN6 4E6RA 3JRZA 4ZN1A 2XKOC 1ABQA 4C5HA 5GAN5 3I5RA 2RQVA 1VIFA 1Q81C 1RAIB 1RLPC 3CCQT 2W0ZA 2NYSA 5FWCA 3FDRA 2LQNA 4HKEA 5GMKj 2O4XB 3E1SA 5L8RE 4EMHA 1K73C 4LXCA 4RTVA 1HD3A 2A3LA 2OTLQ 1PRLC 3WVDB 1G3SA 2CH4A 1KD1R 1M3BA 3QYGB 5AT1B 3VS5A 2HEQA 1H641 1KJWA 3DLLA 4D8KA 1M5Q1 1SRLA 2E6NA 1VQ6T 2E70A 2Y90A 3QDRB 1MNEA 2COZA 2LX7A 3LWHA 3CCMA 2H3EB 3H8ZA 1GRIA 4A4GA 4AFQC 1KD1U 3ME9A 1WXTA 2BE9B 4KH0B 3PIOA 4BY6B 3QG1A 4A4KA 2GTJA 1AHJB 1LOJA 4OB2B 1PSEA 2MOXA 1NPRA 2DKGA 1M30A 4XU2A 2XIDA 1SKUB 2CUDA 2ZPGB 2LCSA 1NZ9A 3CC7A 2DXTA 2F2XA 1JJ2S 1U1TA 1M4ZA 1W2BP 2QK0A 3V8LA 3CC2T 2CT4A 4K11A 1S72Q 1CKBA 4XTWA 5GAOm 2WSEE 3CCRA 4IUQA 4RUGA 2L5QA 4J83A 3G4SA 4LDVA 1W4SA 3A8LB 1W6XA 4E47A 2CP5A 1VQ4T 3DB3A 1OX8A 3L2VA 4L6V5 1LVKA 2QA4Q 1V76A 1C6VX 1QW1A 1XJWB 3G71A 2QEXA 5HK0A 2O31A 2FPFA 5CKFA 3C12A 5GAOr 4M75D 1Z9QA 3TCJA 3JB9H 5GMKh 1WGSA 3A8MB 3M53A 3OMGA 2EQKA 1UJYA 2CH4W 2ZCFB 5FU6B 3KFVA 1Y7XA 4DBFA 1WA7A 1O9SA 4JPBW 1VQ7Q 4KGXB 1WHMA 3JCMd 1BU1A 4IUTA 1WHHA 3MP1A 4EMGA 3LX7A 1WFWA 1UFFA 2D0NA 1I1JA 1Q86R 2YRVA 1KG1A 2RNAA 4J5YA 3X28B 2CUBA 5D6XA 2OAWA 2DVJA 3EFSA 2FO0A 4F7UB 2RI2A 2GTOA 1VQ9Q 2EJGA 2RD1A 4FYWB 1BCMA 1MMNA 4B9XA 1NEBA 2YUPA 3CCJA 1Q86U 4QW2A 2XG8D 1SPKA 4J6WA 3VV0A 2EAYA 5CK9A 1Z9ZA 5FLXE 2JS0A 1NG2A 3HFNA 1Q82C 2V8IA 1KQ2A 2XICA 1OV3A 3FEOA 2K2MA 3OYCA 2QI2A 3LYIA 4ELYC 1G5VA 2RHUA 2EJFA 4C92F 2D6FA 1MUZA 2QGFB 3PTAA 3CBOA 2EYYA 1X75C 3MCAB 3VYGA 3EHRA 3MEWA 1M2VA 2Y4YA 3HRTA 2DL4A 3QUIA 3G7ZA 4PJLA 2LJ1A 1B3QA 4M78A 2RM4A 2DXBA 2KNBB 2YLCA 2DERA 2MYSA 1TTHB 2L89A 5FU7C 1PCXA 2L3RA 2ZPEB 3NTKA 1K9MC 4B6MA 5C6SA 2E4HA 3JB9D 2VWFA 4FT2A 1ZA2B 2P4RA 5HKCA 2BZYA 3CCUT 3EGXB 1YI2Q 5KE2A 2PVGB 1I81A 4ZN3A 1YIJT 3C0CA 3VRYA 3EGDA 4JUVA 3UPUA 2RH2A 2D8HA 3QSUA 4M7DG 1H3ZA 2AZSA 4P5NA 2PU9B 3MKDA 3G6EA 3LH5A 4RTTA 2I0NA 2DLPA 1NLPC 3QPHA 2LNHB 1WJQA 1N9SA 4PJOA 4C8QG 1JXMA 2A0FB 3CMAQ 3CPWS 2QTXA 2LJ0A 2YXYA 4BE0A 3NPFA 4PL6A 5IHNA 3ZEHA 3M4YA 2RQUA 3GP8A 1R0CB 2BKDN 4KGZB 3LW5E 4N4GA 2ZPHB 4HCZA 3EH1A 3I55A 2DO3A 1JEGA 1JXOA 2OTLT 1PG5B 3VS2A 3I56A 2X3XD 4C0ZA 1NPPA 1RAAB 1QWFA 3ZFJA 2G6FX 3H9NA 4PJOG 4PFPA 1WZOA 1KFZA 1TH7A 1YHQQ 2OAUA 4N4IA 2L0AA 3OYKA 2RHXA 3OY9A 2LNVA 1VQ5A 5GAN4 4M7AA 2DL8A 3CCQQ 2DBKA 3GIBA 1UB4A 3X26B 2EWNA 3QWXX 2RK2A 4ZNXA 3L2RA 3CXCS 2VVKA 1UGRB 1VYTA 2LZ6B 2FVUA 5KYWB 1VQPA 1UHFA 1XTDA 4PLLA 1RL2A 2VKNA 2KT1A 3X25B 5LJ5h 1M3AA 4E7KA 4KT0E 5LJ5f 3EG9B 1IZ6A 2MWPA 3VKIA 1JQQA 4RG8A 1PHTA 1UTIA 4QT7A 1KQSS 1Q7YC 3SB2A 2EKOA 1Y07A 2QQBA 2EGAA 2EQIA 3S3MA 1NYFA 2ENMA 1NBEB 3JCMW 2LCCA 3PMTA 5LJ5g 1QLYA 3A1PA 2E3HA 3SFMA 2RJFA 1QVFS 1YJ9Q 2PQWA 2F2VA 2FZCB 8ATCB 1V29B 4KH1B 4OMNA 3LGFA 1AWXA 1MMAA 1VOMA 4XAXB 4L59A 4D8DA 1B34B 1N5ZA 1WHLA 2CYZB 2HL3A 1UEBA 4PJMA 5LJ5e 1VQ8T 4AG2C 3CC2Q 1D3BA 2DF6A 1FMWA 3OW2P 3JV3A 5GANf 1SHFA 3RUXA 5A2QE 4DOWA 1VQ7T 2DEUA 4JLIA 1BIAA 3J7AF 1CKAA 1EIFA 2IPOB 4XTVA 4Y91A 2CZ7B 2OTJQ 3JCMb 5GAMd 2PZ1A 3QYHB 4M7DC 2QYZA 4IURA 3EFOB 3E2UA 1QCNA 1YN8A 2EYXA 4FSSA 3D7SB 4GLKA 8AT1B 3OYLA 2GFAA 2L2PA 1LCKA 1R77A 4MMKA 2J6OA 3RNJA 4C8QC 2NUPB 3MP6A 4M75G 3UWNA 2KMTA 1QVGP 1D1BA 1JJ2A 4HVUA 4CI0C 5IHIA 1E6GA 5GANe 2RQTA 5DLOA 4PFZA 2RPNA 4LDYA 4PJJA 4FCYA 1K73R 3SDZA 2JW4A 3SHWA 3I5SA 2VXFA 4A54A 4AFSC 3QWYA 3M58A 1JBMA 4ZTJA 2DA9A 3OYBA 2CSQA 5KYXB 2RJCA 2HBWA 3CCET 3OB9A 2V8KA 5IHKA 2KXCA 1YP5A 1K73U 1ZBJA 3CMET 1UJ0A 2M16A 3RKXA 3BE3A 3VRZA 4OB1B 1K4US 4PJOC 5GAMj 4E7LA 3TEEA 1VQ6A 3V7SA 4E7HA 1WXUA 2CP3A 2DJQA 2AZVA 4OMQA 1M2OA 4RMOA 4C5EA 2K9GA 4LN2A 5ECAA 1ZSGA 1D0XA 3S6WA 3CBMA 5GAN3 1HYOA 1XNIA 1QVPA 2VC8A 2RHZA 1GCQC 3MO8A 3PVQA 5GJWB 3A5ZB 2AHJB 3H6ZA 3FRNA 4BDYA 2AK5A 4M78E 4C8QE 2GCXA 5IH2A 1QCOA 2EIFA 1VQMQ 1VQKQ 2CS7A 2YUOA 3FIFA 4LDUA 4RCCA 4ZGJB 2DL7A 2LX9A 3MPUB 2P4TA 1VQ4A 2JXBA 3EFRA 1X43A 4E7ZA 3CMAT 4Y28E 1N9RA 1Y57A 2MMPA 4GY5A 3E9FA 2MF2A 4HA8A 2RF0A 2EYZA 5D7UA 3OS0A 1AVZC 1M1GA 1NYGA 3JB9G 3OS5A 3CCVQ 1AT1B 3OYIA 2P84A 3GNFB 2P0PA 1M1FA 2RI5A 1YIJQ 4ME7A 2M1HA 4PJOE 4O5VA 1ZUYA 1X01A 3QIIA 1YNZA 4X9DA 1JU5C 1D09B 2O9SA 2YUQA 5LL6S 4FU6A 3LWIA 4ZTFA 2EJ9A 3OS1A 5GAMh 4MZPA 3BW1A 1YHQT 1YITT 1NJIC 1KHCA 3UATA 1I07A 3TVTA 5HCKA 2LT1A 2XDPA 1X6GA 2FPDA 2K5LA 3CCSQ 1FX7A 4M77B 4BE1A 2D9TA 4HCKA 2K2VA 1VIEA 3C4SA 4M75C 4QKUA 1YCSB 4EMKC 1OPLA 5GAMg 2GBQA 2HL5C 3THKA 4IUUA 3INZA 1UGPB 3META 3URGA 1Q82R 4J7FA 2JZ2A 3ZL7C 2HQXA 2I2LA 2JNGA 4RTZA 1ZUKA 1RACB 4M7AE 1RADB 4LDWA 4HXJA 1AZGB 2ROLA 3TU4K 1SG5A 4LNPA 4XTXA 2KT8A 3LLRA 2A37A 1Q82U 2F2WA 2COWA 2L8DA 3CPWA 1OZ2A 4C0DC 1YJ9T 2M9UA 4II1A 4JZ3A 1NEGA 5IXFA 4KUDK 4F7UA 2M0YA 4D6WA 1QP2A 3HL8A 5GAOl 1GBRA 4BB7A 1OQKA 1QKXA 1K9MR 3OBWA 3RIRA 1AD5A 1JJ2P 4OP0A 2FB7A 3NTIA 3JSCA 4FW2A 4Z8AA 2R57A 2GQIA 1VQNQ 2ED1A 2RO0A 4WTOB 3ER0A 1K9MU 3CCUA 1K8AC 2FG0A 2FHDA 1JRIA 1TG0A 1YIJA 2OTJT 1OZ3A 1GFCA 4F7UG 4M75E 1YWOA 2KAFA 3CXCA 2LRQA 2K5FA 3NTHA 1TWBA 1VQ8Q 4NS5A 4LUDA 2HKNA 3UT1A 3E19A 2MI6A 2AKKA 2DBMA 2VXEA 3ASKA 4FW1A 4EPCA 5KYYB 1VQOQ 1U1SA 5GAOq 2KYMA 3EGXA 2OX7A 1KQSA 2GFUA 1WI7A 2LC4A 2HQEA 3AHUA 2V8JA 2WSCE 1A0NB 4JJNK 3SWNB 1KQ1A 2OTLA 1AWJA 1H3HA 3KUFA 1QVFA 4FSXA 2ZPBB 3TQ7P 1N8RC 2Y4XA 3WVEB 4BY6C 3HFOA 2XU8A 4JDSA 1QMCA 2IVWA 5GMKe 3DB4A 3M0RA 3GPLA 3JCMQ 2EYQA 2ZPIB 2R58A 2DTOA 2E6ZA 4HVVA 3HRSA 5EG2A 1XOVA 3M59A 2R5AA 3U23A 2DK3A 5GAN8 5CKEA 1BIBA 5IN1A 4R55A 5DM7R 2FZKB 1HSQA 3M0UA 2LQWA 3CCEQ 4M4ZA 1Q7YR 4QVDA 3CMEQ 2QQ9A 4GLMA 3VS1A 2H8HA 1S72A 2HAXA 4HCBA 3WXMB 2G3RA 1Y71A 4M78F 4Y92A 1IREB 4M7DA 1VQMT 1UDLA 1I0CA 1VQKT 4M77D 1Q7YU 4C8QA 3EG2A 2QA4A 4BI4A 3KBGA 4BDZA 4FM4B 4XU1A 1VQLQ 1PC0A 2E64A 1YCYA 2C0IA 3CC7T 1BCOA 5FU6C 3CCVT 1PD0A 2K5IA 3EG9A 1BYMA 4UC4A 1HK9A 1D1CA 4CC3A 1YBYA 3CCRT 4BD3A 1G3WA 4OMOA 3G4ST 4DBRA 5GANd 1VQ7A 4JS5A 2F69A 3OYDA 1M8VA 3M57A 2L3PA 5AYFA 1C0MA 3JCMX 2J6KA 1X2QA 2PNIA 2QEXT 2DYBA 4C5GA 3CPWP 1VUBA 2YWWA 4C92G 3CCST 1PRMC 1G3TA 4FYYB 4O6JA 5CIUA 4J9GA 1YJWQ 1WQ7A 2V1QA 3P8BB 1VQ9A 1U5SA 1ARKA 1LNXA 3JAME 4RTYA 3VYHB 1BBZA 4FT4A 1QCFA 5EC7A 1GCQA 3CC4Q 3JCMh 1IGUA 4BI3A 1MV0B 3Q1JA 1RABB 2P0KA 3A8HB 3MEAA 3QO3A 1PNJA 3FJPA 3UA7A 2DE0X 5J39A 4QQ6A 2YLBA 2L3QA 4M7AF 2VGMA 2CGHA 2DM1A 1YITQ 1YWPA 3R6OA 5GAOn 3RESA 3L42A 2X51A 5A0DA 1TSFA 1M9SA 3JCMg 2XK0A 2O88A 3REAB 2NUPA 5FW9A 2DJZA 2QDLA 4C92B 3OYAA 1FYNA 1BI3A 1M2VB 3QZ9B 5KYUB 2KXDA 4M78B 2LQKA 1F1BB 2MK5A 1ACMB 2JT4A 2C0TA 2NUZA 1SEMA 2HKQB 2VV5A 1EX4A 1HXDA 1ZX6A 2JMAA 3OQ5A 4XU0A 5KYXA 4IIMA 3CD6Q 1VQNT 2VB6A 1K0XA 2RI3A 4OVAA 2W10A 2L3SA 5LJ3d 5FRNA 4F7UE 3CCLQ 2K3XA 1YI2A 1I4K1 1GBQA 2PUOB 1QVFP 3DLMA 3EGDB 2DIQA 3T9NA 5KCOA 4XQ3A 2YT6A 1DJ7B 4ELZC 4EIKA 3HPWA 4OGEA 2E3IA 1U3OA 4M75A 2JTMA 3JCMV 4EMKA 1TU0B 3CMAA 2HMAA 5IAYA 1YJNQ 4MZMA 1VQOT 4DA4A 2DXCA 5KYNA 3TREA 1O75A 3MJXA 1MHNA 2E10A 2JM9A 3JB9J 2E41A 5CQXA 4RKUE 3OW2S 1BK2A 4X9CA 1WNLA 3EGUA 2KRSA 2FRWA 3BDLA 2HD0A 5LJ3j 4MDXA 1D0ZA 4OMLA 2RB6A 1M27C 3G6ET 3REBB 3TSWA 3A8OB 4E7SA 4A63B 3AT1B 1PKSA 1Q81R 4A4FA 1ZSZB 1YHQA 4QVZA 1TXQA 2YRDA 3VS4A 2VYTA 4DEYA 5GAN7 4MMLA 4C92C 3EAEA 5I2SA 3M54A 1G83A 3CCQA 4RTWA 2O9VA 5M9OA 1D1AA 4M7AB 1EZZB 3PNWC 4RTUA 2J06A 1Q81U 5CKDA 1QVGS 1Y96B 5I2MA 3I55T 3CPFA 4N0AC 2JMCA 4PJNA 2KYBA 3A8GB 3P8HA 4KGVB 2RHIA 1X6BA 2NUTA 2CREA 2KE9A 1WDXA 2DRKA 2EYWA 1KC8C 4CC7A 2DEQA 2DIGA 1WQWA 1MV3A 3QJ6A 1OU9A 2YHTA 4M77A 2XMFA 2CZ1B 1TUGB 2RQWA 4MZTA 1YJ9A 2O4XA 4OF1A 1VQLT 1WHGA 2FZGB 3NMZC 2EBPA 4J6YA 5IXBA 1T0HA 1WJRA 2JM8A 4RTXA 2CP7A 4M7DE 1W70A 2HQHA 3CC2A 2LJ3A 1AWWA 3M0PA 2HBPA 2RJDA 1D3BB 7AT1B 2RJEA 3GOXA 1MGQA 2J7IA 3RKYA 3JB9I 4XK8E 2MAMA 2FL7A 3OYMA 1K76A 1V1CA 2E5KA 3I35A 1FXXA 1M1KC 1WYXA 1SSHA 2ESWA 1PSFA 2F5KA 1UHCA 2XD0A 4M77G 1B07A 2ECZA 3FJ5A 3M0SA 3PGGA 4ESRA 5I22A 3EHQA 2OTJA 4C92D 4BUGA 4JRQA 2BZ8A 1BB9A 4J9DA 2JTFA 3CC7Q 4M78D 4GBQA 4F16A 2OJ2A 1YJWT 3HKSA 2QQAA 2X3WD 1KHIA 4Q5WA 1HJDA 2ZAEA 2QAZA 2JJ9A 1M90C 4ZGDB 3PFSA 3CCRQ 2DETA 1TS9A 3VUBA 3CC4T 3OYYA 3G4SQ 3RR6A 2LDMA 1R0BG 2WACA 1TOVA 2DYIA 2LT4A 1K1ZA 3QZ5B 2DD5A 2LMJA 5FROA 2K6DA 4NOYA 3GNGA 1G3YA 5GAMf 4J9BA 4JJBA 1N8RR 4LD9K 4E2FB 2QXFA 1D0YA 4J9IA 4IKFA 2HCKA 3G71Q 1KK7A 4WF2A 2QEXQ 3NHNA 4JJCA 3L1AA 4DBQA 4F04B 2K4YA 2DPPB 2ZPFB 1EFNA 1G2BA 1UGQB 4AFZC 2YSQA 2ZGWA 4ATOA 2V26A 5KYYA 1AEYA 1IHVA 1WHKA 2K7AA 3RDVA 5IT9E 1U8RA 1AWOA 2C0OA 4JRPA 4HCCA 1AZEA 3M5AA 5GAMe 3HP9A 3CD6T 2LQ8A 2DX1A 3SWNA 4N4HA 1QQJA 2GGRA 1M3CA 3CCLT 1JO8A 4F7UF 2D8JA 4B9WA 4J7IA 2CZ0B 4HVWA 5GMKl 4OGCA 4IUVA 3V8JA 1ZQ1A 3M4GA 3S3OA 3M0QA 4J9CA 1VQMA 1VQKA 5GMKm 2KQWA 2LCLA 4C0GA 1KIKA 4M7AD 1RUWA 3CCJQ 2WSFE 2HSPA 2OI3A 5DY9A 2J05A 1T3SA 2KVQG 2GF7A 1B7TA 1YJNT 4R56A 1OPKA 2FEIA 4X34A 3NFCA 2B86A 1UGVA 2NWMA 6AT1B 2KEAA 4XTYA 4AT1B 1OX9A 3J81E 1W2BS 3CCVA 4HT8A 1IHWA 1H8KA 1SSFA 2X35A 2LVMA 3A98A 1GL5A 3C94A 3VS6A 1K9AA 3EG0A 2EQJA 2JVVA 4LD6A 3L2QA 4DOVA 1Q95G 3MHXA 4JRIA 3OA6A 1TUCA 2EKHA 2K57A 4M77C 2ATCB 4BI8B 4DBHA 2YUNA 5GMKi 2A28A 2X4XA 1NE8A 2DL3A 3QXEB 4CC4B 4Z88A 1IB8A 3L2ZA 3CCSA
chains in the Genus database with same CATH topology
2V1RA 2PZ1A 1PRMC 1UECA 3VS3A 4FSSA 1YN8A 2EYXA 2RQRA 1X2KA 4J9GA 1S1NA 1W1FA 2L2PA 2V1QA 1LCKA 3RNJA 1U5SA 2J6OA 1ARKA 1X69A 3GBQA 3EG1A 4RTYA 1BBZA 1QCFA 5EC7A 1GCQA 4HVUA 2EGEA 2EW3A 1E6GA 1MV0B 5IHIA 3VS0A 3VS7A 2RQTA 4E6RA 2RPNA 1PWTA 1PNJA 3SHWA 2JW4A 3UA7A 2DE0X 1ABQA 2FPEA 3I5SA 1UG1A 3I5RA 2RQVA 2BZXA 2L3QA 4AFSC 1RLPC 3QWYA 2W0ZA 5FWCA 2LQNA 2DM1A 2DA9A 1YWPA 2CSQA 2HBWA 1QKWA 4WCIA 1TUDA 4RTVA 5IHKA 2O88A 1HD3A 2KXCA 1YP5A 2EPDA 3R6NA 1ZBJA 3REAB 4J9FA 2D1XA 1PRLC 1UJ0A 5FW9A 2RN8A 2QDLA 2CH4A 4AFUC 1M3BA 3VRZA 1K4US 3VS5A 2HEQA 2CSIA 1KJWA 4DEXA 4D8KA 1SRLA 3UA6A 3IQLA 1FYNA 5FWBA 2M51A 4ORZA 1WXUA 1SRMA 2EGCA 3RBBB 2DJQA 2AZVA 2KXDA 4OMQA 2LX7A 2K9GA 1GRIA 4AFQC 2JT4A 1Y0MA 2C0TA 2NUZA 4LN2A 5ECAA 1SEMA 1RI9A 1WXTA 1ZSGA 1ZX6A 1T0JA 2JMAA 4IIMA 1K0XA 2GTJA 2W10A 1J3TA 1GCPA 2MOXA 2L3SA 1M30A 2DILA 1GCQC 3PVQA 2CUDA 2LCSA 1GBQA 5GJWB 2SRCA 2ED0A 4J9EA 2F2XA 2DL5A 1AOJA 2AK5A 2CT4A 4K11A 2YT6A 1CKBA 5IH2A 4EIKA 5GJVB 1U3OA 4RUGA 2YUOA 2DL7A 2JXBA 1M8MA 1W6XA 1X43A 3UF4A 4OMMA 1Y57A 1GFDA 1VYVA 2DNUA 2RF0A 2ABLA 2EYZA 1AVZC 1WLPB 2JM9A 3PVLA 1NYGA 3O5ZA 2O31A 1BK2A 2FPFA 3EGUA 1SHGA 1Z9QA 2KRSA 2FRWA 2CT3A 4OMLA 4OMPA 1M27C 3REBB 1ZUYA 3TSWA 1UJYA 4IIOA 2CH4W 1YNZA 1JU5C 2J6FA 2O9SA 2YUQA 4A63B 1PKSA 2LP5A 1WX6A 3KFVA 1WA7A 4JPBW 1U06A 1ABOA 3VS4A 4DEYA 1RLQC 2K79A 1BU1A 2KRNA 1G83A 4RTWA 4J9HA 2O9VA 3UATA 1WFWA 1I07A 4RTUA 3TVTA 5HCKA 1UFFA 1X6GA 2FPDA 2J06A 2D0NA 1I1JA 2KROA 4HCKA 1YCSB 2JMCA 1OPLA 2RNAA 2GBQA 2KYBA 1K0SA 2CUBA 1VYUA 2OAWA 2DVJA 1X6BA 2CDTA 2FO0A 3THKA 2GTOA 2CREA 2KE9A 1WDXA 1QWEA 1NEBA 2YUPA 3ZL7C 2DRKA 2EYWA 4JJDA 1ZLMA 1SPKA 2JS2A 4CC7A 4RTZA 1ZUKA 1MV3A 1Z9ZA 4HXJA 2JS0A 2ROTA 1NG2A 2A36A 1AZGB 2ROLA 1OV3A 2XMFA 3EG3A 2KT8A 4LNPA 2A37A 2F2WA 2RQWA 4X1VA 2K2MA 2KBTA 3NMZC 2EBPA 4JZ3A 1NEGA 5IXFA 1MUZA 5IXBA 1T0HA 2JM8A 2M0YA 4RTXA 4F17A 2EYYA 2EVRA 1WXBA 1GBRA 1W70A 2LJ3A 1AWWA 1QKXA 3EHRA 3M0PA 2DL4A 4AG1C 1AD5A 2LJ1A 1B3QA 2J7IA 2KNBB 2AKLA 2O2OA 4Z8AA 1K76A 1V1CA 2GQIA 2E5KA 3I35A 3PE0A 2ED1A 1WYXA 1SSHA 2ESWA 3M0TA 1UHCA 1PKTA 2VWFA 2FG0A 1B07A 2ECZA 2P4RA 3FJ5A 2BZYA 3H0FA 3M0SA 4ESRA 5I22A 3EHQA 1TG0A 3NGPA 2MIOA 3H0IA 2JTEA 2BZ8A 1BB9A 1GFCA 4J9DA 4F14A 1YWOA 4GBQA 3C0CA 3VRYA 4F16A 1KSWA 1T3LA 2OJ2A 2D8HA 2AZSA 2X3WD 1HJDA 3LH5A 4RTTA 2I0NA 2DLPA 4LUDA 1NLPC 2MCNA 2LNHB 2FRYA 1JXMA 2HDAA 2AKKA 2DBMA 1NLOC 1VA7A 1K1ZA 2LJ0A 2LMJA 2K6DA 2KYMA 1FMKA 3NPFA 5IHNA 4J9BA 4JJBA 1WI7A 2RQUA 4J9IA 2HCKA 3NHNA 1IO6A 1A0NB 4JJCA 1H3HA 1AWJA 1JEGA 5I11A 2GNCA 1JXOA 3CQTA 2IIMA 3VS2A 1E6HA 2X3XD 1EFNA 1G2BA 4JZ4A 3M0RA 4AFZC 2YSQA 1QWFA 1CSKA 2G6FX 4HVVA 1AEYA 1XOVA 2K3BA 1KFZA 2K7AA 3U23A 1AWOA 2DRMA 2C0OA 2L0AA 1AZEA 2A08A 2DL8A 4LE9A 2DBKA 2DX1A 2GGRA 3QWXX 2PTKA 1HSQA 2KGTA 3M0UA 4ZNXA 1M3CA 2LQWA 2VVKA 1JO8A 4M4ZA 1VYTA 2D8JA 2LZ6B 4HVWA 1UHFA 2VKNA 4GLMA 3VS1A 2H8HA 3M0QA 2KT1A 1M3AA 4J9CA 1NM7A 4R0KA 4Y92A 1KIKA 1JQQA 1UDLA 3H0HA 1I0CA 1RUWA 1UUEA 1PHTA 1UTIA 1OEBA 4CC2A 4QT7A 3TSZA 2HSPA 2OI3A 2EGAA 2J05A 1T3SA 2EQIA 1NYFA 3EG2A 2ENMA 3ULRB 1E7OA 5L23A 1OPKA 2FEIA 1QLYA 2B86A 2KRMA 1UGVA 2NWMA 2KEAA 1H92A 2F2VA 1X27A 2C0IA 4OMNA 1AWXA 1H8KA 4D8DA 1N5ZA 3A98A 1GL5A 2BTTA 3VS6A 1WIEA 1OOTA 1K9AA 4LUEA 3EG0A 1UE9A 4AG2C 4CC3A 4OMOA 2DF6A 1TUCA 3H41A 2EKHA 3I9QA 2YDLA 3JV3A 1SHFA 4Z89A 2SEMA 2L3PA 2RMOA 2YUNA 2DMOA 2KR3A 3SEMA 2A28A 2J6KA 1X2QA 1CKAA 2DL3A 2PNIA 4Z88A 4CC4B 2DYBA 1ZUUA 4KRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V1R A;  2PZ1 A;  1PRM C;  1UEC A;  3VS3 A;  4FSS A;  1YN8 A;  2EYX A;  2RQR A;  1X2K A;  4J9G A;  1S1N A;  1W1F A;  2L2P A;  2V1Q A;  1LCK A;  3RNJ A;  1U5S A;  2J6O A;  1ARK A;  1X69 A;  3GBQ A;  3EG1 A;  4RTY A;  1BBZ A;  1QCF A;  5EC7 A;  1GCQ A;  4HVU A;  2EGE A;  2EW3 A;  1E6G A;  1MV0 B;  5IHI A;  3VS0 A;  3VS7 A;  2RQT A;  4E6R A;  2RPN A;  1PWT A;  1PNJ A;  3SHW A;  2JW4 A;  3UA7 A;  2DE0 X;  1ABQ A;  2FPE A;  3I5S A;  1UG1 A;  3I5R A;  2RQV A;  2BZX A;  2L3Q A;  4AFS C;  1RLP C;  3QWY A;  2W0Z A;  5FWC A;  2LQN A;  2DM1 A;  2DA9 A;  1YWP A;  2CSQ A;  2HBW A;  1QKW A;  4WCI A;  1TUD A;  4RTV A;  5IHK A;  2O88 A;  1HD3 A;  2KXC A;  1YP5 A;  2EPD A;  3R6N A;  1ZBJ A;  3REA B;  4J9F A;  2D1X A;  1PRL C;  1UJ0 A;  5FW9 A;  2RN8 A;  2QDL A;  2CH4 A;  4AFU C;  1M3B A;  3VRZ A;  1K4U S;  3VS5 A;  2HEQ A;  2CSI A;  1KJW A;  4DEX A;  4D8K A;  1SRL A;  3UA6 A;  3IQL A;  1FYN A;  5FWB A;  2M51 A;  4ORZ A;  1WXU A;  1SRM A;  2EGC A;  3RBB B;  2DJQ A;  2AZV A;  2KXD A;  4OMQ A;  2LX7 A;  2K9G A;  1GRI A;  4AFQ C;  2JT4 A;  1Y0M A;  2C0T A;  2NUZ A;  4LN2 A;  5ECA A;  1SEM A;  1RI9 A;  1WXT A;  1ZSG A;  1ZX6 A;  1T0J A;  2JMA A;  4IIM A;  1K0X A;  2GTJ A;  2W10 A;  1J3T A;  1GCP A;  2MOX A;  2L3S A;  1M30 A;  2DIL A;  1GCQ C;  3PVQ A;  2CUD A;  2LCS A;  1GBQ A;  5GJW B;  2SRC A;  2ED0 A;  4J9E A;  2F2X A;  2DL5 A;  1AOJ A;  2AK5 A;  2CT4 A;  4K11 A;  2YT6 A;  1CKB A;  5IH2 A;  4EIK A;  5GJV B;  1U3O A;  4RUG A;  2YUO A;  2DL7 A;  2JXB A;  1M8M A;  1W6X A;  1X43 A;  3UF4 A;  4OMM A;  1Y57 A;  1GFD A;  1VYV A;  2DNU A;  2RF0 A;  2ABL A;  2EYZ A;  1AVZ C;  1WLP B;  2JM9 A;  3PVL A;  1NYG A;  3O5Z A;  2O31 A;  1BK2 A;  2FPF A;  3EGU A;  1SHG A;  1Z9Q A;  2KRS A;  2FRW A;  2CT3 A;  4OML A;  4OMP A;  1M27 C;  3REB B;  1ZUY A;  3TSW A;  1UJY A;  4IIO A;  2CH4 W;  1YNZ A;  1JU5 C;  2J6F A;  2O9S A;  2YUQ A;  4A63 B;  1PKS A;  2LP5 A;  1WX6 A;  3KFV A;  1WA7 A;  4JPB W;  1U06 A;  1ABO A;  3VS4 A;  4DEY A;  1RLQ C;  2K79 A;  1BU1 A;  2KRN A;  1G83 A;  4RTW A;  4J9H A;  2O9V A;  3UAT A;  1WFW A;  1I07 A;  4RTU A;  3TVT A;  5HCK A;  1UFF A;  1X6G A;  2FPD A;  2J06 A;  2D0N A;  1I1J A;  2KRO A;  4HCK A;  1YCS B;  2JMC A;  1OPL A;  2RNA A;  2GBQ A;  2KYB A;  1K0S A;  2CUB A;  1VYU A;  2OAW A;  2DVJ A;  1X6B A;  2CDT A;  2FO0 A;  3THK A;  2GTO A;  2CRE A;  2KE9 A;  1WDX A;  1QWE A;  1NEB A;  2YUP A;  3ZL7 C;  2DRK A;  2EYW A;  4JJD A;  1ZLM A;  1SPK A;  2JS2 A;  4CC7 A;  4RTZ A;  1ZUK A;  1MV3 A;  1Z9Z A;  4HXJ A;  2JS0 A;  2ROT A;  1NG2 A;  2A36 A;  1AZG B;  2ROL A;  1OV3 A;  2XMF A;  3EG3 A;  2KT8 A;  4LNP A;  2A37 A;  2F2W A;  2RQW A;  4X1V A;  2K2M A;  2KBT A;  3NMZ C;  2EBP A;  4JZ3 A;  1NEG A;  5IXF A;  1MUZ A;  5IXB A;  1T0H A;  2JM8 A;  2M0Y A;  4RTX A;  4F17 A;  2EYY A;  2EVR A;  1WXB A;  1GBR A;  1W70 A;  2LJ3 A;  1AWW A;  1QKX A;  3EHR A;  3M0P A;  2DL4 A;  4AG1 C;  1AD5 A;  2LJ1 A;  1B3Q A;  2J7I A;  2KNB B;  2AKL A;  2O2O A;  4Z8A A;  1K76 A;  1V1C A;  2GQI A;  2E5K A;  3I35 A;  3PE0 A;  2ED1 A;  1WYX A;  1SSH A;  2ESW A;  3M0T A;  1UHC A;  1PKT A;  2VWF A;  2FG0 A;  1B07 A;  2ECZ A;  2P4R A;  3FJ5 A;  2BZY A;  3H0F A;  3M0S A;  4ESR A;  5I22 A;  3EHQ A;  1TG0 A;  3NGP A;  2MIO A;  3H0I A;  2JTE A;  2BZ8 A;  1BB9 A;  1GFC A;  4J9D A;  4F14 A;  1YWO A;  4GBQ A;  3C0C A;  3VRY A;  4F16 A;  1KSW A;  1T3L A;  2OJ2 A;  2D8H A;  2AZS A;  2X3W D;  1HJD A;  3LH5 A;  4RTT A;  2I0N A;  2DLP A;  4LUD A;  1NLP C;  2MCN A;  2LNH B;  2FRY A;  1JXM A;  2HDA A;  2AKK A;  2DBM A;  1NLO C;  1VA7 A;  1K1Z A;  2LJ0 A;  2LMJ A;  2K6D A;  2KYM A;  1FMK A;  3NPF A;  5IHN A;  4J9B A;  4JJB A;  1WI7 A;  2RQU A;  4J9I A;  2HCK A;  3NHN A;  1IO6 A;  1A0N B;  4JJC A;  1H3H A;  1AWJ A;  1JEG A;  5I11 A;  2GNC A;  1JXO A;  3CQT A;  2IIM A;  3VS2 A;  1E6H A;  2X3X D;  1EFN A;  1G2B A;  4JZ4 A;  3M0R A;  4AFZ C;  2YSQ A;  1QWF A;  1CSK A;  2G6F X;  4HVV A;  1AEY A;  1XOV A;  2K3B A;  1KFZ A;  2K7A A;  3U23 A;  1AWO A;  2DRM A;  2C0O A;  2L0A A;  1AZE A;  2A08 A;  2DL8 A;  4LE9 A;  2DBK A;  2DX1 A;  2GGR A;  3QWX X;  2PTK A;  1HSQ A;  2KGT A;  3M0U A;  4ZNX A;  1M3C A;  2LQW A;  2VVK A;  1JO8 A;  4M4Z A;  1VYT A;  2D8J A;  2LZ6 B;  4HVW A;  1UHF A;  2VKN A;  4GLM A;  3VS1 A;  2H8H A;  3M0Q A;  2KT1 A;  1M3A A;  4J9C A;  1NM7 A;  4R0K A;  4Y92 A;  1KIK A;  1JQQ A;  1UDL A;  3H0H A;  1I0C A;  1RUW A;  1UUE A;  1PHT A;  1UTI A;  1OEB A;  4CC2 A;  4QT7 A;  3TSZ A;  2HSP A;  2OI3 A;  2EGA A;  2J05 A;  1T3S A;  2EQI A;  1NYF A;  3EG2 A;  2ENM A;  3ULR B;  1E7O A;  5L23 A;  1OPK A;  2FEI A;  1QLY A;  2B86 A;  2KRM A;  1UGV A;  2NWM A;  2KEA A;  1H92 A;  2F2V A;  1X27 A;  2C0I A;  4OMN A;  1AWX A;  1H8K A;  4D8D A;  1N5Z A;  3A98 A;  1GL5 A;  2BTT A;  3VS6 A;  1WIE A;  1OOT A;  1K9A A;  4LUE A;  3EG0 A;  1UE9 A;  4AG2 C;  4CC3 A;  4OMO A;  2DF6 A;  1TUC A;  3H41 A;  2EKH A;  3I9Q A;  2YDL A;  3JV3 A;  1SHF A;  4Z89 A;  2SEM A;  2L3P A;  2RMO A;  2YUN A;  2DMO A;  2KR3 A;  3SEM A;  2A28 A;  2J6K A;  1X2Q A;  1CKA A;  2DL3 A;  2PNI A;  4Z88 A;  4CC4 B;  2DYB A;  1ZUU A;  4KRT A; 
#chains in the Genus database with same CATH topology
 2V1R A;  2X4W A;  2PUK B;  4CRI A;  2CZ6 B;  1OI1 A;  5FU7 B;  2RQR A;  2VGN A;  1X2K A;  4C5I A;  1W1F A;  2EQU A;  1SF9 A;  4OB3 B;  1X69 A;  3GBQ A;  2HZY A;  3G6E Q;  4LDX A;  3V7C A;  3VS7 A;  1PWT A;  1RAH B;  1PM3 A;  2F5T X;  2FPE A;  4QQG A;  1UG1 A;  3UDC A;  1IXD A;  2BZX A;  4PLI A;  1I5O B;  2KI7 A;  5CCA A;  4EDU A;  1QKW A;  4WCI A;  1LJO A;  1TUD A;  5HK3 A;  2EPD A;  3R6N A;  4J9F A;  2D1X A;  1RI0 A;  4PFO A;  3GLX A;  3I55 Q;  2RN8 A;  3JCM J;  4AFU C;  2PVD B;  2X9H A;  4KUI A;  3I56 Q;  4V2S A;  1OUL A;  2CSI A;  4AMC A;  3OW2 A;  2Z0W A;  4DEX A;  3UA6 A;  2GQV A;  3IQL A;  5FWB A;  3S3N A;  2M51 A;  4M7D F;  4ORZ A;  1SRM A;  2EGC A;  3RBB B;  5LJ5 d;  3QKJ A;  2HSE B;  4DQ2 A;  2KSS A;  3OMC A;  1KD1 C;  3P8D A;  3HRU A;  2NLU A;  4M77 E;  4C8Q F;  5GAN 2;  2BE7 D;  1VQN A;  1Y0M A;  1RI9 A;  3CCM T;  2RHY A;  1T0J A;  2KY9 A;  1PD1 A;  1VQ5 Q;  4C0F A;  1J3T A;  1GCP A;  1ZA1 B;  3KXT A;  2DIL A;  2M02 A;  3QHS A;  5KYW A;  2SRC A;  2ED0 A;  2QQS A;  3RKW A;  4J9E A;  4C92 A;  2JN0 A;  1VQP Q;  2AIR B;  1QVG A;  2DL5 A;  2XDD A;  1AOJ A;  4FIB A;  1BI2 A;  5KYU A;  2X4Y A;  1VQ8 A;  4OMF B;  5GJV B;  2HNI A;  2EQM A;  4J8O A;  4N0A A;  2RK1 A;  1M8M A;  1WHJ A;  4PKC C;  4PJO F;  1VQO A;  3SWN C;  3UF4 A;  4BE2 A;  4OMM A;  5LJ5 j;  1N6A A;  1GFD A;  1VYV A;  3QJY A;  2DNU A;  3L2W A;  3BFM A;  2ABL A;  1WLP B;  3PVL A;  2XI9 A;  3RMS A;  3G71 T;  3O5Z A;  4RCB A;  3SD4 A;  1P92 A;  2JUF A;  1B34 A;  1SHG A;  3FC3 A;  3M55 A;  3O8V A;  2CT3 A;  4IUP A;  4OMP A;  3V8K A;  2EFI A;  2E5Q A;  4M78 G;  4IIO A;  2J6F A;  2LP5 A;  1WX6 A;  4XU3 A;  3FLG A;  4BAC A;  1U06 A;  5GAO p;  1ABO A;  4QQD A;  3JCM f;  1RLQ C;  2K79 A;  5KE3 A;  2AT1 B;  2KRN A;  3M9Q A;  4J9H A;  2BIV A;  3X20 B;  2LTO A;  1GXI E;  2KRO A;  5GAN j;  1ZHI A;  3CCE A;  3PMI A;  3EFO A;  4MDW A;  1KC8 R;  3V7R A;  3HHT B;  3CME A;  1I5L A;  2C06 A;  1K0S A;  1VYU A;  2CDT A;  4L5G A;  3FB9 A;  2D0Q B;  3OYF A;  2P0Q A;  1ZSZ A;  1XQH A;  3CXC P;  1QWE A;  1Q86 C;  4M7D B;  3ZBD A;  4JJD A;  4YTL A;  1ZLM A;  2JS2 A;  1KC8 U;  3CCJ T;  3JCM e;  4PNO A;  5CAI A;  2DZ9 A;  4C8Q B;  2ZZD A;  3RMQ A;  2ROT A;  1Y96 A;  2A36 A;  2X4J A;  1QP3 A;  3EG3 A;  1WJS A;  3QBY A;  1VQL A;  2MWO A;  2R5M A;  3PT9 A;  4X1V A;  1N27 A;  3OYN A;  1LPL A;  1X6O A;  4PK4 A;  2KBT A;  4NL3 A;  1KQS P;  1IRX A;  1BI0 A;  4NL2 A;  3OBY A;  2XDB A;  4F17 A;  1S72 T;  2EVR A;  1WXB A;  2O01 E;  2QGG A;  1M1K R;  1VQ6 Q;  4XTU A;  3C95 A;  1YFN A;  4AG1 C;  4M75 F;  9ATC B;  2AKL A;  3LGL A;  1MMG A;  2O2O A;  2COY A;  3PIP A;  2QA4 T;  2H3J A;  4M7A G;  4TVR A;  4PJO B;  3PE0 A;  3OSV A;  3OSS C;  2KK4 A;  3M0T A;  4JLG A;  1M1K U;  1PKT A;  3E9G A;  3H0F A;  3OYG A;  1BI1 A;  3NGP A;  2MIO A;  2QDY B;  3H0I A;  5J3B A;  5FRM A;  2JTE A;  3VU3 C;  1M90 R;  3MEU A;  3G1J A;  5DLQ E;  4F14 A;  3JCM c;  1YJW A;  1KSW A;  1T3L A;  3MEV A;  2YRC A;  5GAN h;  3OS2 A;  3CC4 A;  3CEY A;  2MCN A;  4FYX B;  1M90 U;  2CP0 A;  1RAG B;  2FRY A;  4Z02 A;  2HDA A;  1VQ4 Q;  1NJI R;  1NLO C;  4ZGE B;  3BDU A;  1VA7 A;  2DFU A;  2DZC A;  4A53 A;  1FMK A;  3OYE A;  1YIT A;  2DVE A;  2F1L A;  1MND A;  2KDS A;  5GAN g;  5D6W A;  5A0L A;  1IO6 A;  1NJI U;  2QQR A;  4M78 C;  2A7Y A;  5I11 A;  2GNC A;  5C0M A;  3CQT A;  2IIM A;  1W2B A;  1VQ9 T;  4KBM B;  2DTI A;  1E6H A;  4JZ4 A;  3M56 A;  3OYH A;  4A4E A;  2VAS A;  3I56 T;  2DAQ A;  4JS4 A;  3F70 A;  1CSK A;  4ANJ A;  3OYJ A;  1RAE B;  2DTH A;  2K3B A;  1C1A A;  5I21 A;  5KCH A;  1R8O B;  4E7J A;  3CD6 A;  2DRM A;  5CR2 A;  4M77 F;  2A08 A;  3CBP A;  2CP2 A;  3EH2 A;  4LE9 A;  5A0G A;  1VQ5 T;  3CCL A;  1ZBX A;  2PTK A;  3X24 B;  2KGT A;  2MPX C;  3RER A;  3JB9 F;  2DXU A;  2DD4 A;  1IGQ A;  4OB0 B;  3DKM A;  1VQP T;  4KUL A;  3GF5 A;  1NM7 A;  2XHC A;  5KH6 A;  3N5B B;  1OYX A;  3JCM P;  3L2U A;  3J80 E;  4R0K A;  4RG2 A;  3H0H A;  1UUE A;  1OEB A;  4M75 B;  4CC2 A;  3LH0 A;  3VUZ A;  4EMK B;  2QG9 B;  1YJN A;  1K8A R;  3TSZ A;  4HT9 A;  2FYK A;  5L23 A;  4VUB A;  2E1H A;  2RA2 A;  5LJ3 h;  1E7O A;  3ULR B;  4FYV B;  5LJ3 f;  3VJP A;  4A4H A;  3CCM Q;  4J6X A;  2KRM A;  4FL6 A;  2BUD A;  2QTV A;  3BY7 A;  4JRK A;  4C92 E;  1YI2 T;  1H92 A;  2E12 A;  3HTR A;  1X27 A;  5CVI A;  1MMD A;  1K8A U;  4M7D D;  2JOY A;  1ZSZ C;  2BTT A;  1I8F A;  2VUB A;  5LJ3 g;  1WIE A;  1OOT A;  4LUE A;  1UE9 A;  5D6Y A;  5CKB A;  4C8Q D;  5CO7 A;  2E65 A;  4C0D B;  4M7A C;  2M0O A;  3H41 A;  3I9Q A;  2K3Y A;  1FWZ A;  2YDL A;  2PVO B;  1RAF B;  4Z89 A;  1FMV A;  2SEM A;  5LJ3 e;  2RMO A;  2DMO A;  2KR3 A;  1JB0 E;  3SEM A;  3CCU Q;  1ZUU A;  2CKK A;  1WPY A;  4KRT A;  1BKB A;  2CP6 A;  1UEC A;  5CKH A;  3VS3 A;  5HY6 A;  1UGS B;  1S1N A;  4XTZ A;  2QAS A;  1G8X A;  2IG0 A;  3MP8 A;  2B8A A;  4PJO D;  3EG1 A;  3QDF A;  2NUT B;  5J26 A;  1OU8 A;  4QVC A;  1N8R U;  2EGE A;  2EW3 A;  5CQY A;  3VS0 A;  4E7I A;  3HSB A;  5GAN 6;  4E6R A;  3JRZ A;  4ZN1 A;  2XKO C;  1ABQ A;  4C5H A;  5GAN 5;  3I5R A;  2RQV A;  1VIF A;  1Q81 C;  1RAI B;  1RLP C;  3CCQ T;  2W0Z A;  2NYS A;  5FWC A;  3FDR A;  2LQN A;  4HKE A;  5GMK j;  2O4X B;  3E1S A;  5L8R E;  4EMH A;  1K73 C;  4LXC A;  4RTV A;  1HD3 A;  2A3L A;  2OTL Q;  1PRL C;  3WVD B;  1G3S A;  2CH4 A;  1KD1 R;  1M3B A;  3QYG B;  5AT1 B;  3VS5 A;  2HEQ A;  1H64 1;  1KJW A;  3DLL A;  4D8K A;  1M5Q 1;  1SRL A;  2E6N A;  1VQ6 T;  2E70 A;  2Y90 A;  3QDR B;  1MNE A;  2COZ A;  2LX7 A;  3LWH A;  3CCM A;  2H3E B;  3H8Z A;  1GRI A;  4A4G A;  4AFQ C;  1KD1 U;  3ME9 A;  1WXT A;  2BE9 B;  4KH0 B;  3PIO A;  4BY6 B;  3QG1 A;  4A4K A;  2GTJ A;  1AHJ B;  1LOJ A;  4OB2 B;  1PSE A;  2MOX A;  1NPR A;  2DKG A;  1M30 A;  4XU2 A;  2XID A;  1SKU B;  2CUD A;  2ZPG B;  2LCS A;  1NZ9 A;  3CC7 A;  2DXT A;  2F2X A;  1JJ2 S;  1U1T A;  1M4Z A;  1W2B P;  2QK0 A;  3V8L A;  3CC2 T;  2CT4 A;  4K11 A;  1S72 Q;  1CKB A;  4XTW A;  5GAO m;  2WSE E;  3CCR A;  4IUQ A;  4RUG A;  2L5Q A;  4J83 A;  3G4S A;  4LDV A;  1W4S A;  3A8L B;  1W6X A;  4E47 A;  2CP5 A;  1VQ4 T;  3DB3 A;  1OX8 A;  3L2V A;  4L6V 5;  1LVK A;  2QA4 Q;  1V76 A;  1C6V X;  1QW1 A;  1XJW B;  3G71 A;  2QEX A;  5HK0 A;  2O31 A;  2FPF A;  5CKF A;  3C12 A;  5GAO r;  4M75 D;  1Z9Q A;  3TCJ A;  3JB9 H;  5GMK h;  1WGS A;  3A8M B;  3M53 A;  3OMG A;  2EQK A;  1UJY A;  2CH4 W;  2ZCF B;  5FU6 B;  3KFV A;  1Y7X A;  4DBF A;  1WA7 A;  1O9S A;  4JPB W;  1VQ7 Q;  4KGX B;  1WHM A;  3JCM d;  1BU1 A;  4IUT A;  1WHH A;  3MP1 A;  4EMG A;  3LX7 A;  1WFW A;  1UFF A;  2D0N A;  1I1J A;  1Q86 R;  2YRV A;  1KG1 A;  2RNA A;  4J5Y A;  3X28 B;  2CUB A;  5D6X A;  2OAW A;  2DVJ A;  3EFS A;  2FO0 A;  4F7U B;  2RI2 A;  2GTO A;  1VQ9 Q;  2EJG A;  2RD1 A;  4FYW B;  1BCM A;  1MMN A;  4B9X A;  1NEB A;  2YUP A;  3CCJ A;  1Q86 U;  4QW2 A;  2XG8 D;  1SPK A;  4J6W A;  3VV0 A;  2EAY A;  5CK9 A;  1Z9Z A;  5FLX E;  2JS0 A;  1NG2 A;  3HFN A;  1Q82 C;  2V8I A;  1KQ2 A;  2XIC A;  1OV3 A;  3FEO A;  2K2M A;  3OYC A;  2QI2 A;  3LYI A;  4ELY C;  1G5V A;  2RHU A;  2EJF A;  4C92 F;  2D6F A;  1MUZ A;  2QGF B;  3PTA A;  3CBO A;  2EYY A;  1X75 C;  3MCA B;  3VYG A;  3EHR A;  3MEW A;  1M2V A;  2Y4Y A;  3HRT A;  2DL4 A;  3QUI A;  3G7Z A;  4PJL A;  2LJ1 A;  1B3Q A;  4M78 A;  2RM4 A;  2DXB A;  2KNB B;  2YLC A;  2DER A;  2MYS A;  1TTH B;  2L89 A;  5FU7 C;  1PCX A;  2L3R A;  2ZPE B;  3NTK A;  1K9M C;  4B6M A;  5C6S A;  2E4H A;  3JB9 D;  2VWF A;  4FT2 A;  1ZA2 B;  2P4R A;  5HKC A;  2BZY A;  3CCU T;  3EGX B;  1YI2 Q;  5KE2 A;  2PVG B;  1I81 A;  4ZN3 A;  1YIJ T;  3C0C A;  3VRY A;  3EGD A;  4JUV A;  3UPU A;  2RH2 A;  2D8H A;  3QSU A;  4M7D G;  1H3Z A;  2AZS A;  4P5N A;  2PU9 B;  3MKD A;  3G6E A;  3LH5 A;  4RTT A;  2I0N A;  2DLP A;  1NLP C;  3QPH A;  2LNH B;  1WJQ A;  1N9S A;  4PJO A;  4C8Q G;  1JXM A;  2A0F B;  3CMA Q;  3CPW S;  2QTX A;  2LJ0 A;  2YXY A;  4BE0 A;  3NPF A;  4PL6 A;  5IHN A;  3ZEH A;  3M4Y A;  2RQU A;  3GP8 A;  1R0C B;  2BKD N;  4KGZ B;  3LW5 E;  4N4G A;  2ZPH B;  4HCZ A;  3EH1 A;  3I55 A;  2DO3 A;  1JEG A;  1JXO A;  2OTL T;  1PG5 B;  3VS2 A;  3I56 A;  2X3X D;  4C0Z A;  1NPP A;  1RAA B;  1QWF A;  3ZFJ A;  2G6F X;  3H9N A;  4PJO G;  4PFP A;  1WZO A;  1KFZ A;  1TH7 A;  1YHQ Q;  2OAU A;  4N4I A;  2L0A A;  3OYK A;  2RHX A;  3OY9 A;  2LNV A;  1VQ5 A;  5GAN 4;  4M7A A;  2DL8 A;  3CCQ Q;  2DBK A;  3GIB A;  1UB4 A;  3X26 B;  2EWN A;  3QWX X;  2RK2 A;  4ZNX A;  3L2R A;  3CXC S;  2VVK A;  1UGR B;  1VYT A;  2LZ6 B;  2FVU A;  5KYW B;  1VQP A;  1UHF A;  1XTD A;  4PLL A;  1RL2 A;  2VKN A;  2KT1 A;  3X25 B;  5LJ5 h;  1M3A A;  4E7K A;  4KT0 E;  5LJ5 f;  3EG9 B;  1IZ6 A;  2MWP A;  3VKI A;  1JQQ A;  4RG8 A;  1PHT A;  1UTI A;  4QT7 A;  1KQS S;  1Q7Y C;  3SB2 A;  2EKO A;  1Y07 A;  2QQB A;  2EGA A;  2EQI A;  3S3M A;  1NYF A;  2ENM A;  1NBE B;  3JCM W;  2LCC A;  3PMT A;  5LJ5 g;  1QLY A;  3A1P A;  2E3H A;  3SFM A;  2RJF A;  1QVF S;  1YJ9 Q;  2PQW A;  2F2V A;  2FZC B;  8ATC B;  1V29 B;  4KH1 B;  4OMN A;  3LGF A;  1AWX A;  1MMA A;  1VOM A;  4XAX B;  4L59 A;  4D8D A;  1B34 B;  1N5Z A;  1WHL A;  2CYZ B;  2HL3 A;  1UEB A;  4PJM A;  5LJ5 e;  1VQ8 T;  4AG2 C;  3CC2 Q;  1D3B A;  2DF6 A;  1FMW A;  3OW2 P;  3JV3 A;  5GAN f;  1SHF A;  3RUX A;  5A2Q E;  4DOW A;  1VQ7 T;  2DEU A;  4JLI A;  1BIA A;  3J7A F;  1CKA A;  1EIF A;  2IPO B;  4XTV A;  4Y91 A;  2CZ7 B;  2OTJ Q;  3JCM b;  5GAM d;  2PZ1 A;  3QYH B;  4M7D C;  2QYZ A;  4IUR A;  3EFO B;  3E2U A;  1QCN A;  1YN8 A;  2EYX A;  4FSS A;  3D7S B;  4GLK A;  8AT1 B;  3OYL A;  2GFA A;  2L2P A;  1LCK A;  1R77 A;  4MMK A;  2J6O A;  3RNJ A;  4C8Q C;  2NUP B;  3MP6 A;  4M75 G;  3UWN A;  2KMT A;  1QVG P;  1D1B A;  1JJ2 A;  4HVU A;  4CI0 C;  5IHI A;  1E6G A;  5GAN e;  2RQT A;  5DLO A;  4PFZ A;  2RPN A;  4LDY A;  4PJJ A;  4FCY A;  1K73 R;  3SDZ A;  2JW4 A;  3SHW A;  3I5S A;  2VXF A;  4A54 A;  4AFS C;  3QWY A;  3M58 A;  1JBM A;  4ZTJ A;  2DA9 A;  3OYB A;  2CSQ A;  5KYX B;  2RJC A;  2HBW A;  3CCE T;  3OB9 A;  2V8K A;  5IHK A;  2KXC A;  1YP5 A;  1K73 U;  1ZBJ A;  3CME T;  1UJ0 A;  2M16 A;  3RKX A;  3BE3 A;  3VRZ A;  4OB1 B;  1K4U S;  4PJO C;  5GAM j;  4E7L A;  3TEE A;  1VQ6 A;  3V7S A;  4E7H A;  1WXU A;  2CP3 A;  2DJQ A;  2AZV A;  4OMQ A;  1M2O A;  4RMO A;  4C5E A;  2K9G A;  4LN2 A;  5ECA A;  1ZSG A;  1D0X A;  3S6W A;  3CBM A;  5GAN 3;  1HYO A;  1XNI A;  1QVP A;  2VC8 A;  2RHZ A;  1GCQ C;  3MO8 A;  3PVQ A;  5GJW B;  3A5Z B;  2AHJ B;  3H6Z A;  3FRN A;  4BDY A;  2AK5 A;  4M78 E;  4C8Q E;  2GCX A;  5IH2 A;  1QCO A;  2EIF A;  1VQM Q;  1VQK Q;  2CS7 A;  2YUO A;  3FIF A;  4LDU A;  4RCC A;  4ZGJ B;  2DL7 A;  2LX9 A;  3MPU B;  2P4T A;  1VQ4 A;  2JXB A;  3EFR A;  1X43 A;  4E7Z A;  3CMA T;  4Y28 E;  1N9R A;  1Y57 A;  2MMP A;  4GY5 A;  3E9F A;  2MF2 A;  4HA8 A;  2RF0 A;  2EYZ A;  5D7U A;  3OS0 A;  1AVZ C;  1M1G A;  1NYG A;  3JB9 G;  3OS5 A;  3CCV Q;  1AT1 B;  3OYI A;  2P84 A;  3GNF B;  2P0P A;  1M1F A;  2RI5 A;  1YIJ Q;  4ME7 A;  2M1H A;  4PJO E;  4O5V A;  1ZUY A;  1X01 A;  3QII A;  1YNZ A;  4X9D A;  1JU5 C;  1D09 B;  2O9S A;  2YUQ A;  5LL6 S;  4FU6 A;  3LWI A;  4ZTF A;  2EJ9 A;  3OS1 A;  5GAM h;  4MZP A;  3BW1 A;  1YHQ T;  1YIT T;  1NJI C;  1KHC A;  3UAT A;  1I07 A;  3TVT A;  5HCK A;  2LT1 A;  2XDP A;  1X6G A;  2FPD A;  2K5L A;  3CCS Q;  1FX7 A;  4M77 B;  4BE1 A;  2D9T A;  4HCK A;  2K2V A;  1VIE A;  3C4S A;  4M75 C;  4QKU A;  1YCS B;  4EMK C;  1OPL A;  5GAM g;  2GBQ A;  2HL5 C;  3THK A;  4IUU A;  3INZ A;  1UGP B;  3MET A;  3URG A;  1Q82 R;  4J7F A;  2JZ2 A;  3ZL7 C;  2HQX A;  2I2L A;  2JNG A;  4RTZ A;  1ZUK A;  1RAC B;  4M7A E;  1RAD B;  4LDW A;  4HXJ A;  1AZG B;  2ROL A;  3TU4 K;  1SG5 A;  4LNP A;  4XTX A;  2KT8 A;  3LLR A;  2A37 A;  1Q82 U;  2F2W A;  2COW A;  2L8D A;  3CPW A;  1OZ2 A;  4C0D C;  1YJ9 T;  2M9U A;  4II1 A;  4JZ3 A;  1NEG A;  5IXF A;  4KUD K;  4F7U A;  2M0Y A;  4D6W A;  1QP2 A;  3HL8 A;  5GAO l;  1GBR A;  4BB7 A;  1OQK A;  1QKX A;  1K9M R;  3OBW A;  3RIR A;  1AD5 A;  1JJ2 P;  4OP0 A;  2FB7 A;  3NTI A;  3JSC A;  4FW2 A;  4Z8A A;  2R57 A;  2GQI A;  1VQN Q;  2ED1 A;  2RO0 A;  4WTO B;  3ER0 A;  1K9M U;  3CCU A;  1K8A C;  2FG0 A;  2FHD A;  1JRI A;  1TG0 A;  1YIJ A;  2OTJ T;  1OZ3 A;  1GFC A;  4F7U G;  4M75 E;  1YWO A;  2KAF A;  3CXC A;  2LRQ A;  2K5F A;  3NTH A;  1TWB A;  1VQ8 Q;  4NS5 A;  4LUD A;  2HKN A;  3UT1 A;  3E19 A;  2MI6 A;  2AKK A;  2DBM A;  2VXE A;  3ASK A;  4FW1 A;  4EPC A;  5KYY B;  1VQO Q;  1U1S A;  5GAO q;  2KYM A;  3EGX A;  2OX7 A;  1KQS A;  2GFU A;  1WI7 A;  2LC4 A;  2HQE A;  3AHU A;  2V8J A;  2WSC E;  1A0N B;  4JJN K;  3SWN B;  1KQ1 A;  2OTL A;  1AWJ A;  1H3H A;  3KUF A;  1QVF A;  4FSX A;  2ZPB B;  3TQ7 P;  1N8R C;  2Y4X A;  3WVE B;  4BY6 C;  3HFO A;  2XU8 A;  4JDS A;  1QMC A;  2IVW A;  5GMK e;  3DB4 A;  3M0R A;  3GPL A;  3JCM Q;  2EYQ A;  2ZPI B;  2R58 A;  2DTO A;  2E6Z A;  4HVV A;  3HRS A;  5EG2 A;  1XOV A;  3M59 A;  2R5A A;  3U23 A;  2DK3 A;  5GAN 8;  5CKE A;  1BIB A;  5IN1 A;  4R55 A;  5DM7 R;  2FZK B;  1HSQ A;  3M0U A;  2LQW A;  3CCE Q;  4M4Z A;  1Q7Y R;  4QVD A;  3CME Q;  2QQ9 A;  4GLM A;  3VS1 A;  2H8H A;  1S72 A;  2HAX A;  4HCB A;  3WXM B;  2G3R A;  1Y71 A;  4M78 F;  4Y92 A;  1IRE B;  4M7D A;  1VQM T;  1UDL A;  1I0C A;  1VQK T;  4M77 D;  1Q7Y U;  4C8Q A;  3EG2 A;  2QA4 A;  4BI4 A;  3KBG A;  4BDZ A;  4FM4 B;  4XU1 A;  1VQL Q;  1PC0 A;  2E64 A;  1YCY A;  2C0I A;  3CC7 T;  1BCO A;  5FU6 C;  3CCV T;  1PD0 A;  2K5I A;  3EG9 A;  1BYM A;  4UC4 A;  1HK9 A;  1D1C A;  4CC3 A;  1YBY A;  3CCR T;  4BD3 A;  1G3W A;  4OMO A;  3G4S T;  4DBR A;  5GAN d;  1VQ7 A;  4JS5 A;  2F69 A;  3OYD A;  1M8V A;  3M57 A;  2L3P A;  5AYF A;  1C0M A;  3JCM X;  2J6K A;  1X2Q A;  2PNI A;  2QEX T;  2DYB A;  4C5G A;  3CPW P;  1VUB A;  2YWW A;  4C92 G;  3CCS T;  1PRM C;  1G3T A;  4FYY B;  4O6J A;  5CIU A;  4J9G A;  1YJW Q;  1WQ7 A;  2V1Q A;  3P8B B;  1VQ9 A;  1U5S A;  1ARK A;  1LNX A;  3JAM E;  4RTY A;  3VYH B;  1BBZ A;  4FT4 A;  1QCF A;  5EC7 A;  1GCQ A;  3CC4 Q;  3JCM h;  1IGU A;  4BI3 A;  1MV0 B;  3Q1J A;  1RAB B;  2P0K A;  3A8H B;  3MEA A;  3QO3 A;  1PNJ A;  3FJP A;  3UA7 A;  2DE0 X;  5J39 A;  4QQ6 A;  2YLB A;  2L3Q A;  4M7A F;  2VGM A;  2CGH A;  2DM1 A;  1YIT Q;  1YWP A;  3R6O A;  5GAO n;  3RES A;  3L42 A;  2X51 A;  5A0D A;  1TSF A;  1M9S A;  3JCM g;  2XK0 A;  2O88 A;  3REA B;  2NUP A;  5FW9 A;  2DJZ A;  2QDL A;  4C92 B;  3OYA A;  1FYN A;  1BI3 A;  1M2V B;  3QZ9 B;  5KYU B;  2KXD A;  4M78 B;  2LQK A;  1F1B B;  2MK5 A;  1ACM B;  2JT4 A;  2C0T A;  2NUZ A;  1SEM A;  2HKQ B;  2VV5 A;  1EX4 A;  1HXD A;  1ZX6 A;  2JMA A;  3OQ5 A;  4XU0 A;  5KYX A;  4IIM A;  3CD6 Q;  1VQN T;  2VB6 A;  1K0X A;  2RI3 A;  4OVA A;  2W10 A;  2L3S A;  5LJ3 d;  5FRN A;  4F7U E;  3CCL Q;  2K3X A;  1YI2 A;  1I4K 1;  1GBQ A;  2PUO B;  1QVF P;  3DLM A;  3EGD B;  2DIQ A;  3T9N A;  5KCO A;  4XQ3 A;  2YT6 A;  1DJ7 B;  4ELZ C;  4EIK A;  3HPW A;  4OGE A;  2E3I A;  1U3O A;  4M75 A;  2JTM A;  3JCM V;  4EMK A;  1TU0 B;  3CMA A;  2HMA A;  5IAY A;  1YJN Q;  4MZM A;  1VQO T;  4DA4 A;  2DXC A;  5KYN A;  3TRE A;  1O75 A;  3MJX A;  1MHN A;  2E10 A;  2JM9 A;  3JB9 J;  2E41 A;  5CQX A;  4RKU E;  3OW2 S;  1BK2 A;  4X9C A;  1WNL A;  3EGU A;  2KRS A;  2FRW A;  3BDL A;  2HD0 A;  5LJ3 j;  4MDX A;  1D0Z A;  4OML A;  2RB6 A;  1M27 C;  3G6E T;  3REB B;  3TSW A;  3A8O B;  4E7S A;  4A63 B;  3AT1 B;  1PKS A;  1Q81 R;  4A4F A;  1ZSZ B;  1YHQ A;  4QVZ A;  1TXQ A;  2YRD A;  3VS4 A;  2VYT A;  4DEY A;  5GAN 7;  4MML A;  4C92 C;  3EAE A;  5I2S A;  3M54 A;  1G83 A;  3CCQ A;  4RTW A;  2O9V A;  5M9O A;  1D1A A;  4M7A B;  1EZZ B;  3PNW C;  4RTU A;  2J06 A;  1Q81 U;  5CKD A;  1QVG S;  1Y96 B;  5I2M A;  3I55 T;  3CPF A;  4N0A C;  2JMC A;  4PJN A;  2KYB A;  3A8G B;  3P8H A;  4KGV B;  2RHI A;  1X6B A;  2NUT A;  2CRE A;  2KE9 A;  1WDX A;  2DRK A;  2EYW A;  1KC8 C;  4CC7 A;  2DEQ A;  2DIG A;  1WQW A;  1MV3 A;  3QJ6 A;  1OU9 A;  2YHT A;  4M77 A;  2XMF A;  2CZ1 B;  1TUG B;  2RQW A;  4MZT A;  1YJ9 A;  2O4X A;  4OF1 A;  1VQL T;  1WHG A;  2FZG B;  3NMZ C;  2EBP A;  4J6Y A;  5IXB A;  1T0H A;  1WJR A;  2JM8 A;  4RTX A;  2CP7 A;  4M7D E;  1W70 A;  2HQH A;  3CC2 A;  2LJ3 A;  1AWW A;  3M0P A;  2HBP A;  2RJD A;  1D3B B;  7AT1 B;  2RJE A;  3GOX A;  1MGQ A;  2J7I A;  3RKY A;  3JB9 I;  4XK8 E;  2MAM A;  2FL7 A;  3OYM A;  1K76 A;  1V1C A;  2E5K A;  3I35 A;  1FXX A;  1M1K C;  1WYX A;  1SSH A;  2ESW A;  1PSF A;  2F5K A;  1UHC A;  2XD0 A;  4M77 G;  1B07 A;  2ECZ A;  3FJ5 A;  3M0S A;  3PGG A;  4ESR A;  5I22 A;  3EHQ A;  2OTJ A;  4C92 D;  4BUG A;  4JRQ A;  2BZ8 A;  1BB9 A;  4J9D A;  2JTF A;  3CC7 Q;  4M78 D;  4GBQ A;  4F16 A;  2OJ2 A;  1YJW T;  3HKS A;  2QQA A;  2X3W D;  1KHI A;  4Q5W A;  1HJD A;  2ZAE A;  2QAZ A;  2JJ9 A;  1M90 C;  4ZGD B;  3PFS A;  3CCR Q;  2DET A;  1TS9 A;  3VUB A;  3CC4 T;  3OYY A;  3G4S Q;  3RR6 A;  2LDM A;  1R0B G;  2WAC A;  1TOV A;  2DYI A;  2LT4 A;  1K1Z A;  3QZ5 B;  2DD5 A;  2LMJ A;  5FRO A;  2K6D A;  4NOY A;  3GNG A;  1G3Y A;  5GAM f;  4J9B A;  4JJB A;  1N8R R;  4LD9 K;  4E2F B;  2QXF A;  1D0Y A;  4J9I A;  4IKF A;  2HCK A;  3G71 Q;  1KK7 A;  4WF2 A;  2QEX Q;  3NHN A;  4JJC A;  3L1A A;  4DBQ A;  4F04 B;  2K4Y A;  2DPP B;  2ZPF B;  1EFN A;  1G2B A;  1UGQ B;  4AFZ C;  2YSQ A;  2ZGW A;  4ATO A;  2V26 A;  5KYY A;  1AEY A;  1IHV A;  1WHK A;  2K7A A;  3RDV A;  5IT9 E;  1U8R A;  1AWO A;  2C0O A;  4JRP A;  4HCC A;  1AZE A;  3M5A A;  5GAM e;  3HP9 A;  3CD6 T;  2LQ8 A;  2DX1 A;  3SWN A;  4N4H A;  1QQJ A;  2GGR A;  1M3C A;  3CCL T;  1JO8 A;  4F7U F;  2D8J A;  4B9W A;  4J7I A;  2CZ0 B;  4HVW A;  5GMK l;  4OGC A;  4IUV A;  3V8J A;  1ZQ1 A;  3M4G A;  3S3O A;  3M0Q A;  4J9C A;  1VQM A;  1VQK A;  5GMK m;  2KQW A;  2LCL A;  4C0G A;  1KIK A;  4M7A D;  1RUW A;  3CCJ Q;  2WSF E;  2HSP A;  2OI3 A;  5DY9 A;  2J05 A;  1T3S A;  2KVQ G;  2GF7 A;  1B7T A;  1YJN T;  4R56 A;  1OPK A;  2FEI A;  4X34 A;  3NFC A;  2B86 A;  1UGV A;  2NWM A;  6AT1 B;  2KEA A;  4XTY A;  4AT1 B;  1OX9 A;  3J81 E;  1W2B S;  3CCV A;  4HT8 A;  1IHW A;  1H8K A;  1SSF A;  2X35 A;  2LVM A;  3A98 A;  1GL5 A;  3C94 A;  3VS6 A;  1K9A A;  3EG0 A;  2EQJ A;  2JVV A;  4LD6 A;  3L2Q A;  4DOV A;  1Q95 G;  3MHX A;  4JRI A;  3OA6 A;  1TUC A;  2EKH A;  2K57 A;  4M77 C;  2ATC B;  4BI8 B;  4DBH A;  2YUN A;  5GMK i;  2A28 A;  2X4X A;  1NE8 A;  2DL3 A;  3QXE B;  4CC4 B;  4Z88 A;  1IB8 A;  3L2Z A;  3CCS A; 
#chains in the Genus database with same CATH homology
 2V1R A;  2PZ1 A;  1PRM C;  1UEC A;  3VS3 A;  4FSS A;  1YN8 A;  2EYX A;  2RQR A;  1X2K A;  4J9G A;  1S1N A;  1W1F A;  2L2P A;  2V1Q A;  1LCK A;  3RNJ A;  1U5S A;  2J6O A;  1ARK A;  1X69 A;  3GBQ A;  3EG1 A;  4RTY A;  1BBZ A;  1QCF A;  5EC7 A;  1GCQ A;  4HVU A;  2EGE A;  2EW3 A;  1E6G A;  1MV0 B;  5IHI A;  3VS0 A;  3VS7 A;  2RQT A;  4E6R A;  2RPN A;  1PWT A;  1PNJ A;  3SHW A;  2JW4 A;  3UA7 A;  2DE0 X;  1ABQ A;  2FPE A;  3I5S A;  1UG1 A;  3I5R A;  2RQV A;  2BZX A;  2L3Q A;  4AFS C;  1RLP C;  3QWY A;  2W0Z A;  5FWC A;  2LQN A;  2DM1 A;  2DA9 A;  1YWP A;  2CSQ A;  2HBW A;  1QKW A;  4WCI A;  1TUD A;  4RTV A;  5IHK A;  2O88 A;  1HD3 A;  2KXC A;  1YP5 A;  2EPD A;  3R6N A;  1ZBJ A;  3REA B;  4J9F A;  2D1X A;  1PRL C;  1UJ0 A;  5FW9 A;  2RN8 A;  2QDL A;  2CH4 A;  4AFU C;  1M3B A;  3VRZ A;  1K4U S;  3VS5 A;  2HEQ A;  2CSI A;  1KJW A;  4DEX A;  4D8K A;  1SRL A;  3UA6 A;  3IQL A;  1FYN A;  5FWB A;  2M51 A;  4ORZ A;  1WXU A;  1SRM A;  2EGC A;  3RBB B;  2DJQ A;  2AZV A;  2KXD A;  4OMQ A;  2LX7 A;  2K9G A;  1GRI A;  4AFQ C;  2JT4 A;  1Y0M A;  2C0T A;  2NUZ A;  4LN2 A;  5ECA A;  1SEM A;  1RI9 A;  1WXT A;  1ZSG A;  1ZX6 A;  1T0J A;  2JMA A;  4IIM A;  1K0X A;  2GTJ A;  2W10 A;  1J3T A;  1GCP A;  2MOX A;  2L3S A;  1M30 A;  2DIL A;  1GCQ C;  3PVQ A;  2CUD A;  2LCS A;  1GBQ A;  5GJW B;  2SRC A;  2ED0 A;  4J9E A;  2F2X A;  2DL5 A;  1AOJ A;  2AK5 A;  2CT4 A;  4K11 A;  2YT6 A;  1CKB A;  5IH2 A;  4EIK A;  5GJV B;  1U3O A;  4RUG A;  2YUO A;  2DL7 A;  2JXB A;  1M8M A;  1W6X A;  1X43 A;  3UF4 A;  4OMM A;  1Y57 A;  1GFD A;  1VYV A;  2DNU A;  2RF0 A;  2ABL A;  2EYZ A;  1AVZ C;  1WLP B;  2JM9 A;  3PVL A;  1NYG A;  3O5Z A;  2O31 A;  1BK2 A;  2FPF A;  3EGU A;  1SHG A;  1Z9Q A;  2KRS A;  2FRW A;  2CT3 A;  4OML A;  4OMP A;  1M27 C;  3REB B;  1ZUY A;  3TSW A;  1UJY A;  4IIO A;  2CH4 W;  1YNZ A;  1JU5 C;  2J6F A;  2O9S A;  2YUQ A;  4A63 B;  1PKS A;  2LP5 A;  1WX6 A;  3KFV A;  1WA7 A;  4JPB W;  1U06 A;  1ABO A;  3VS4 A;  4DEY A;  1RLQ C;  2K79 A;  1BU1 A;  2KRN A;  1G83 A;  4RTW A;  4J9H A;  2O9V A;  3UAT A;  1WFW A;  1I07 A;  4RTU A;  3TVT A;  5HCK A;  1UFF A;  1X6G A;  2FPD A;  2J06 A;  2D0N A;  1I1J A;  2KRO A;  4HCK A;  1YCS B;  2JMC A;  1OPL A;  2RNA A;  2GBQ A;  2KYB A;  1K0S A;  2CUB A;  1VYU A;  2OAW A;  2DVJ A;  1X6B A;  2CDT A;  2FO0 A;  3THK A;  2GTO A;  2CRE A;  2KE9 A;  1WDX A;  1QWE A;  1NEB A;  2YUP A;  3ZL7 C;  2DRK A;  2EYW A;  4JJD A;  1ZLM A;  1SPK A;  2JS2 A;  4CC7 A;  4RTZ A;  1ZUK A;  1MV3 A;  1Z9Z A;  4HXJ A;  2JS0 A;  2ROT A;  1NG2 A;  2A36 A;  1AZG B;  2ROL A;  1OV3 A;  2XMF A;  3EG3 A;  2KT8 A;  4LNP A;  2A37 A;  2F2W A;  2RQW A;  4X1V A;  2K2M A;  2KBT A;  3NMZ C;  2EBP A;  4JZ3 A;  1NEG A;  5IXF A;  1MUZ A;  5IXB A;  1T0H A;  2JM8 A;  2M0Y A;  4RTX A;  4F17 A;  2EYY A;  2EVR A;  1WXB A;  1GBR A;  1W70 A;  2LJ3 A;  1AWW A;  1QKX A;  3EHR A;  3M0P A;  2DL4 A;  4AG1 C;  1AD5 A;  2LJ1 A;  1B3Q A;  2J7I A;  2KNB B;  2AKL A;  2O2O A;  4Z8A A;  1K76 A;  1V1C A;  2GQI A;  2E5K A;  3I35 A;  3PE0 A;  2ED1 A;  1WYX A;  1SSH A;  2ESW A;  3M0T A;  1UHC A;  1PKT A;  2VWF A;  2FG0 A;  1B07 A;  2ECZ A;  2P4R A;  3FJ5 A;  2BZY A;  3H0F A;  3M0S A;  4ESR A;  5I22 A;  3EHQ A;  1TG0 A;  3NGP A;  2MIO A;  3H0I A;  2JTE A;  2BZ8 A;  1BB9 A;  1GFC A;  4J9D A;  4F14 A;  1YWO A;  4GBQ A;  3C0C A;  3VRY A;  4F16 A;  1KSW A;  1T3L A;  2OJ2 A;  2D8H A;  2AZS A;  2X3W D;  1HJD A;  3LH5 A;  4RTT A;  2I0N A;  2DLP A;  4LUD A;  1NLP C;  2MCN A;  2LNH B;  2FRY A;  1JXM A;  2HDA A;  2AKK A;  2DBM A;  1NLO C;  1VA7 A;  1K1Z A;  2LJ0 A;  2LMJ A;  2K6D A;  2KYM A;  1FMK A;  3NPF A;  5IHN A;  4J9B A;  4JJB A;  1WI7 A;  2RQU A;  4J9I A;  2HCK A;  3NHN A;  1IO6 A;  1A0N B;  4JJC A;  1H3H A;  1AWJ A;  1JEG A;  5I11 A;  2GNC A;  1JXO A;  3CQT A;  2IIM A;  3VS2 A;  1E6H A;  2X3X D;  1EFN A;  1G2B A;  4JZ4 A;  3M0R A;  4AFZ C;  2YSQ A;  1QWF A;  1CSK A;  2G6F X;  4HVV A;  1AEY A;  1XOV A;  2K3B A;  1KFZ A;  2K7A A;  3U23 A;  1AWO A;  2DRM A;  2C0O A;  2L0A A;  1AZE A;  2A08 A;  2DL8 A;  4LE9 A;  2DBK A;  2DX1 A;  2GGR A;  3QWX X;  2PTK A;  1HSQ A;  2KGT A;  3M0U A;  4ZNX A;  1M3C A;  2LQW A;  2VVK A;  1JO8 A;  4M4Z A;  1VYT A;  2D8J A;  2LZ6 B;  4HVW A;  1UHF A;  2VKN A;  4GLM A;  3VS1 A;  2H8H A;  3M0Q A;  2KT1 A;  1M3A A;  4J9C A;  1NM7 A;  4R0K A;  4Y92 A;  1KIK A;  1JQQ A;  1UDL A;  3H0H A;  1I0C A;  1RUW A;  1UUE A;  1PHT A;  1UTI A;  1OEB A;  4CC2 A;  4QT7 A;  3TSZ A;  2HSP A;  2OI3 A;  2EGA A;  2J05 A;  1T3S A;  2EQI A;  1NYF A;  3EG2 A;  2ENM A;  3ULR B;  1E7O A;  5L23 A;  1OPK A;  2FEI A;  1QLY A;  2B86 A;  2KRM A;  1UGV A;  2NWM A;  2KEA A;  1H92 A;  2F2V A;  1X27 A;  2C0I A;  4OMN A;  1AWX A;  1H8K A;  4D8D A;  1N5Z A;  3A98 A;  1GL5 A;  2BTT A;  3VS6 A;  1WIE A;  1OOT A;  1K9A A;  4LUE A;  3EG0 A;  1UE9 A;  4AG2 C;  4CC3 A;  4OMO A;  2DF6 A;  1TUC A;  3H41 A;  2EKH A;  3I9Q A;  2YDL A;  3JV3 A;  1SHF A;  4Z89 A;  2SEM A;  2L3P A;  2RMO A;  2YUN A;  2DMO A;  2KR3 A;  3SEM A;  2A28 A;  2J6K A;  1X2Q A;  1CKA A;  2DL3 A;  2PNI A;  4Z88 A;  4CC4 B;  2DYB A;  1ZUU A;  4KRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...