5IXFA

Solution structure of the stam2 sh3 with amsh derived peptide complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
68
structure length
68
Chain Sequence
b'EIQLNNKVARKVRALYDFEAVEDNELTFKHGEIIIVLDDSDANWWKGENHRGIGLFPSDFVTTNLNIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Signal transducing adapter molecule 2
publication title NMR Reveals the Interplay among the AMSH SH3 Binding Motif, STAM2, and Lys63-Linked Diubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 10
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF02809 UIM Ubiquitin interaction motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5ixfA00
3CQTA 1I07A 3TSWA 2ESWA 2HCKA 3KFVA 2KRSA 4RTZA 1NLOC 1X43A 1SPKA 1VYUA 2GGRA 4LE9A 1YN8A 2KXDA 4ORZA 2CSIA 1UJ0A 2EYYA 1KSWA 4J9BA 2B86A 2VKNA 3REBB 2DLPA 1U5SA 2JXBA 5GJWB 3UATA 2W0ZA 3REAB 2C0IA 3FJ5A 1WX6A 4HCKA 2YUOA 2W10A 1EFNA 2ROLA 2DILA 1XOVA 2I0NA 2DL7A 5FW9A 4EIKA 1QLYA 2EGCA 1NLPC 2LQWA 2MCNA 2RQWA 2ABLA 3EG1A 1PNJA 1UHFA 1G83A 5I22A 3PVLA 2F2WA 4OMLA 2JT4A 3VS6A 4JJCA 2YUQA 2KGTA 2J6FA 2ED0A 3VRYA 1AZGB 2BZYA 2H8HA 1KJWA 3VS3A 1AZEA 2KT1A 1K0SA 1SRMA 1YCSB 3PE0A 2X3WD 2K9GA 1OPLA 2C0TA 4J9HA 2J05A 2L0AA 2LQNA 1JXMA 1PKSA 2DMOA 2DL8A 2DE0X 3NGPA 2NWMA 5EC7A 3I35A 1X27A 2C0OA 4CC2A 2DJQA 1WYXA 3EG2A 5IXBA 3UA7A 3VS7A 2BZXA 2EGAA 1M27C 1UECA 1AWWA 1WXUA 1NEBA 4JJBA 2LCSA 2KYBA 2EYXA 4GBQA 3RNJA 3M0SA 1UFFA 1U3OA 2KR3A 3NPFA 3VS0A 1ZUYA 1W1FA 2K6DA 1X2KA 1JQQA 1KIKA 4OMNA 3H0IA 4DEYA 1MUZA 1UHCA 5IHNA 1GL5A 1W6XA 4CC4B 2FPEA 1NM7A 4WCIA 2M51A 1UUEA 1H8KA 2LJ3A 2L2PA 2EQIA 4J9IA 2J6OA 2FPDA 1JU5C 3I5SA 2X3XD 2SEMA 2A37A 1OEBA 2KE9A 2RPNA 1FYNA 2DL3A 1JXOA 2EBPA 2DNUA 1BK2A 5IHIA 2DBKA 5IH2A 1VYVA 4IIOA 2D8JA 2P4RA 2K3BA 1QKWA 2AKLA 2D0NA 1AD5A 3EGUA 1M3BA 2GTOA 1RLQC 1J3TA 2QDLA 3M0TA 1GBQA 1U06A 1H3HA 4RTTA 4D8KA 4RTYA 4CC3A 2A08A 1ZX6A 4J9EA 1Y0MA 1KFZA 1NYGA 5HCKA 2KRMA 3EHRA 2OAWA 1H92A 4JZ3A 1YWPA 1E6HA 4CC7A 2CDTA 5I11A 2CREA 2LZ6B 1T3SA 2IIMA 2F2XA 4DEXA 2CT3A 3JV3A 4J9CA 2JM8A 3VS4A 1B07A 1ZUUA 4Y92A 5GJVB 2ENMA 3C0CA 2LJ1A 4OMOA 2MIOA 1AEYA 2VVKA 1K4US 4F16A 2KXCA 1I1JA 1RLPC 4Z89A 1UDLA 2OJ2A 1BBZA 2E5KA 2D8HA 2YUPA 1OOTA 2DL4A 1IO6A 4AFSC 1PWTA 4J9DA 4F14A 1E7OA 2OI3A 1UE9A 1WXBA 1I0CA 1OV3A 1TUDA 2CH4A 2F2VA 1HJDA 4A63B 1QCFA 4HVVA 2FRWA 2RMOA 3VRZA 2J6KA 5IHKA 1OPKA 2DVJA 2A36A 2PNIA 4JPBW 3VS1A 4D8DA 4KRTA 2AK5A 1GFCA 1GBRA 1T0HA 2VWFA 4OMPA 3LH5A 1ZBJA 1AVZC 2PTKA 2RQUA 1WDXA 1ZLMA 2M0YA 1MV3A 1E6GA 2CUBA 2L3SA 1B3QA 1K9AA 2PZ1A 2ECZA 4X1VA 4ESRA 2G6FX 1WFWA 3H0HA 3I9QA 4Z8AA 2DRMA 1K76A 4AFQC 2EW3A 2J06A 2JTEA 2HEQA 2YSQA 2BZ8A 2O31A 4M4ZA 4J9GA 2AZVA 2DL5A 1QWEA 2KNBB 4LUDA 3EG0A 4OMMA 5ECAA 2KBTA 1YWOA 2D1XA 1CKAA 4HXJA 2V1QA 3R6NA 4ZNXA 1A0NB 1K1ZA 1AWXA 3PVQA 1JEGA 1PHTA 3M0RA 1CKBA 4RTUA 3H41A 3UF4A 4HVUA 4HVWA 2L3PA 1SHGA 1ZSGA 1AWJA 2RQVA 3H0FA 2V1RA 3NMZC 2KT8A 1PRMC 1GCQC 2RQTA 2HDAA 1Z9ZA 1GCQA 4FSSA 2RN8A 3IQLA 2HSPA 2ED1A 2FO0A 1UGVA 2YT6A 1SRLA 1QKXA 1VYTA 1QWFA 4GLMA 4JJDA 3GBQA 2J7IA 1CSKA 1M3AA 2LP5A 2O9SA 4E6RA 1GFDA 2A28A 1HSQA 2O88A 3ULRB 1GRIA 4K11A 2CSQA 2SRCA 2DX1A 1SEMA 1RUWA 1G2BA 2KYMA 4LNPA 3A98A 2GNCA 2CUDA 2LNHB 2FPFA 4RTVA 2JS0A 1TUCA 1T3LA 4JZ4A 2CH4W 2JMAA 2KEAA 1WXTA 1NEGA 1PRLC 2KROA 3M0PA 3TSZA 2MOXA 4AFZC 5FWBA 1M3CA 3EG3A 2DYBA 3VS2A 4AFUC 4RUGA 3SEMA 1LCKA 2ROTA 1GCPA 4RTWA 1W70A 2EYZA 2DM1A 3U23A 1M8MA 2EKHA 4J9FA 2FEIA 3EHQA 1ZUKA 3VS5A 2DA9A 1AWOA 1X69A 2K79A 2EVRA 3M0QA 2DBMA 1ARKA 1SHFA 2K7AA 2JS2A 2JMCA 1WA7A 1BU1A 2NUZA 5L23A 2LJ0A 1YP5A 2RQRA 1NYFA 2K2MA 2FG0A 1N5ZA 1WIEA 1AOJA 1NG2A 5FWCA 3RBBB 1PKTA 1FMKA 2O9VA 2EYWA 1UTIA 1X6BA 1VA7A 2DRKA 3O5ZA 3M0UA 4IIMA 1T0JA 3THKA 1ABOA 2GQIA 1Z9QA 2DF6A 2HBWA 1BB9A 1WLPB 1K0XA 1X6GA 2EPDA 2GTJA 3SHWA 3TVTA 4LUEA 2XMFA 2YDLA 4RTXA 1S1NA 5IXFA 2O2OA 1X2QA 2BTTA 4OMQA 4F17A 3ZL7C 1RI9A 2AZSA 2LX7A 4R0KA 4Z88A 2RF0A 1Y57A 2AKKA 2YUNA 1YNZA 1MV0B 2EGEA 2CT4A 2FRYA 3QWYA 1M30A 1TG0A 1SSHA 3QWXX 4AG1C 1UG1A 3NHNA 2JW4A 3I5RA 2LMJA 4LN2A 1V1CA 2JM9A 2L3QA 2KRNA 4QT7A 1UJYA 2RNAA 2GBQA 1WI7A 1ABQA 1HD3A 1JO8A 4AG2C 3UA6A
chains in the Genus database with same CATH superfamily
1R8OB 1PG5B 2P0QA 3TSWA 1Q82R 2ESWA 2KRSA 4C8QG 1X43A 2EYQA 4LE9A 1YN8A 2XDPA 3BFMA 2DKGA 4ZGJB 3M9QA 5CVIA 2B86A 2Y4YA 2YLBA 2JXBA 1U5SA 4OGCA 4PKCC 4QQDA 4V2SA 2LT4A 1Q7YC 1WX6A 2E70A 1VQNT 1EFNA 4JRKA 4PL6A 2ZPHB 3H9NA 2K4YA 3GNGA 1RAHB 2RHIA 4EMKC 2YLCA 4EIKA 1QLYA 2YXYA 2CP3A 3SD4A 1TUGB 2MCNA 4IUTA 3HFNA 1PNJA 1UHFA 5I22A 3RKXA 2JT4A 4JDSA 2XK0A 1AZGB 4FYYB 2MMPA 1KJWA 1M4ZA 5KYNA 1M90U 2KT1A 3CCSA 1YITA 1S72A 2RK2A 2MWOA 3BW1A 3CBOA 5CAIA 2VXEA 4A53A 1G8XA 2RO0A 2J05A 2L0AA 1JXMA 2CP0A 2CS7A 2DE0X 2MK5A 3NGPA 3SFMA 3J80E 2GF7A 1X01A 2M02A 5CIUA 2ZZDA 3G6ET 2DD5A 4E7KA 4CC2A 5IXBA 4PJOE 1ZSZA 1PSFA 1QW1A 1M27C 2JNGA 2R5AA 3OMGA 4JJBA 3DKMA 2KYBA 4GBQA 3RNJA 4M77A 3M0SA 3JCMb 3VS0A 1X2KA 4JLIA 2L89A 5C6SA 3EAEA 3CCLQ 3ER0A 5GMKm 1MNEA 4M78D 1W6XA 4CC4B 3UPUA 2FYKA 4IUVA 2DO3A 5GAN5 1Q81R 1KD1R 4MZTA 4FT2A 4XTXA 1UUEA 4C0ZA 2RHXA 2E3IA 3HKSA 2J6OA 1YJ9Q 4F7UB 5DLQE 2WACA 1JXOA 2EBPA 4BE0A 2BE9B 3JCMW 4M7AE 1ZHIA 2D8JA 2P4RA 1QKWA 4GLKA 4F7UG 3EGUA 1M3BA 3CMAT 4HCZA 4ATOA 4BI3A 3C12A 3LW5E 2RB6A 4DBQA 1BI0A 4XU0A 5GANf 2A08A 2I2LA 2YRVA 1KFZA 1NYGA 2EKOA 4DOWA 5HCKA 1IZ6A 2KRMA 3EHRA 2OAWA 2RHUA 4JZ3A 3JB9J 1E6HA 1WPYA 3JCMf 1PSEA 1T3SA 2CKKA 4C92B 5I21A 2PVGB 1F1BB 3WVDB 4C0FA 4OB1B 4Y92A 2LNVA 3EFOB 2PVDB 4Q5WA 3A8OB 2E5QA 1ZQ1A 4RG2A 1VQKA 3MP6A 4C92G 3CXCS 1I1JA 1H641 2E41A 2HQEA 1Q7YR 3CCVA 4Z89A 4MMKA 2OJ2A 1BBZA 2FL7A 1X6OA 2D8HA 3QJ6A 2P0KA 1OZ2A 4P5NA 3RERA 3WVEB 7AT1B 2K5LA 2OI3A 2CZ0B 1WXBA 1OV3A 3H8ZA 3BE3A 2QTVA 4FYXB 2FRWA 5IHKA 1OPKA 3EFRA 2A36A 2PNIA 3VS1A 2CGHA 4D8DA 3CCMA 4XTWA 2BIVA 3JCMe 4OMPA 3LH5A 4B6MA 1VQ7T 1KC8U 1QVFA 3JCMc 1ZLMA 4KH1B 2DFUA 4LD9K 2KQWA 4C8QA 1VQMT 3JCMX 3F70A 4X1VA 4ESRA 4PFPA 4FW2A 3HRUA 3H0HA 1C6VX 1JB0E 3I9QA 5J26A 2YHTA 2K57A 4NOYA 2PQWA 4J5YA 4J9GA 4E7ZA 1GXIE 4OMMA 1RAAB 2MF2A 2E6ZA 3M5AA 3V8LA 1YWOA 4ZNXA 1QCNA 1VIEA 2V8IA 1I5LA 2R57A 2ZGWA 2OTLT 1AWXA 2XU8A 2HAXA 2QGGA 3M56A 1CKBA 4RTUA 3QZ5B 1WJRA 3JSCA 4LDXA 4JRPA 2V1RA 4OGEA 1H3ZA 2O01E 1GCQC 2RQTA 2DXTA 3RESA 1ZBXA 3VUZA 4II1A 4PJMA 5KYYB 3CBMA 2FO0A 3CMAQ 1WNLA 2KY9A 1I81A 1KQ2A 4FW1A 2YWWA 3A1PA 3FC3A 1KHIA 2LP5A 2O9SA 1IREB 2A28A 2VB6A 1M1FA 1QVGA 2EWNA 1GRIA 3KUFA 5KYWB 1SEMA 1UGQB 4RMOA 4LNPA 3HRSA 3OS5A 2DJZA 2CUDA 2RJEA 4RTVA 5GAMg 3MP8A 3DB4A 1I8FA 3TQ7P 2C06A 2DZ9A 2Z0WA 2KEAA 5CO7A 4XTZA 3TSZA 1NJIU 4M75E 4BB7A 3OYAA 5FWBA 2PUKB 1M3CA 1MMDA 1LCKA 2ROTA 4RTWA 3QG1A 3CPWS 1VQ6Q 1IHVA 5KE2A 1MMNA 3G71A 4OB3B 2K79A 2EVRA 1QMCA 1ARKA 1SHFA 4XK8E 1WA7A 1BU1A 2NUZA 2DXUA 3CC7T 4M75C 3JB9D 2LJ0A 5GANg 3INZA 2FG0A 1VQMQ 4DBRA 3CPWP 4MMLA 3PTAA 3OA6A 1NG2A 3MJXA 3RBBB 2VGNA 3L2UA 4CRIA 3M0UA 3THKA 4M78F 1ABOA 2DF6A 2IG0A 4A4HA 2PVOB 4QVCA 2XHCA 5HY6A 3S6WA 2NUTB 3OS1A 4J6XA 3TVTA 2OTLQ 4E7LA 5GAMh 2DZCA 1YBYA 4JLGA 4XU2A 2WSCE 3E1SA 2RJDA 1YJWQ 2O2OA 1Q86C 4R0KA 2AZSA 2LX7A 4Z88A 1Y57A 2X4YA 2RH2A 1MV0B 3OW2A 2FRYA 3E2UA 1M30A 4OB2B 3FJPA 3EGDB 3NHNA 4IUQA 3I5RA 2P84A 3OYIA 3X20B 1FX7A 2L3QA 1QVPA 1RAGB 2EQMA 3ZEHA 4QT7A 4XU3A 2VUBA 1YHQT 2RJFA 1ABQA 3A5ZB 2CZ7B 1OULA 2XIDA 2VC8A 3DB3A 2RHYA 3VJPA 2FVUA 1Q82U 5GANh 1NLOC 1R77A 4PLLA 2LVMA 1SSFA 4KUDK 2CP7A 5GMKh 2DYIA 5CKBA 2QEXA 1M2VA 4N4HA 3REAB 1M1GA 4HCBA 5A2QE 2W10A 2ROLA 4M7DB 1U1TA 3I56T 1K9MC 5CKHA 5C0MA 2EGCA 4DOVA 5GAMd 2X4JA 4M7DG 5GAOq 2JJ9A 3CMEA 9ATCB 4ELZC 2DETA 1BI1A 4OMLA 3VS6A 1W2BS 1G3YA 2KGTA 3VRYA 4ZN1A 3BDUA 2HKQB 4M7DE 3LX7A 2E64A 2MI6A 1K0SA 1SRMA 1D1CA 1X75C 3CC7Q 2K9GA 2F5KA 6AT1B 5KYYA 3G4ST 3MEAA 1LNXA 5KYUB 3I55T 1PKSA 1BYMA 3X25B 1VOMA 4J6YA 2FZCB 1VQ4T 1VQ9A 4RCBA 4A4FA 1WZOA 3V7CA 1W2BP 2PU9B 2DJQA 1G3TA 2JTMA 1YCYA 1D3BB 4M7DC 5GANd 1VQ8A 1N6AA 1UECA 1WXUA 1N9SA 1YJ9A 4AMCA 2LCSA 3X26B 2QA4Q 1U3OA 2WSEE 2LTOA 1ZUYA 3CCLT 4OMNA 3M4YA 3A8HB 1UHCA 5IHNA 1GL5A 1TXQA 3RKYA 2ATCB 4WCIA 1Q81U 1KD1U 2MAMA 4EMKB 2XICA 1AT1B 2KMTA 3C94A 4J9IA 2OTJT 2BUDA 1JU5C 3NTKA 2E10A 2SEMA 3R6OA 1Q86R 2A37A 2RPNA 1YIJT 1BK2A 2DBKA 2LCLA 4IIOA 2AKLA 2EQUA 2DIGA 4NL2A 1VQNA 3EG9B 2GTOA 3FLGA 4ZGEB 2QDLA 1LJOA 3QIIA 3M0TA 1GBQA 3M57A 4RTTA 4D8KA 4RTYA 1U8RA 4CC3A 4J9EA 1Y0MA 3L2ZA 2CP6A 3J81E 1H92A 3E9FA 1UGSB 3M55A 2CDTA 5J39A 2CREA 5LJ5f 3L2VA 2RHZA 2DTHA 4DEXA 2CT3A 2HQHA 4YTLA 4FSXA 2JM8A 3OMCA 3VS4A 3CCEA 3CCQA 4PJNA 1SKUB 4OF1A 5GJVB 1VQPQ 4X34A 2ENMA 5I2MA 3I56Q 2CZ1B 3S3OA 1AEYA 2DD4A 2VVKA 1K4US 5KYXA 2KXCA 2CP2A 5FU7B 2ZCFB 3VYGA 5KCHA 3G6EA 2RI5A 2YUPA 4PJJA 3EH2A 4F14A 3QO3A 1TS9A 2X51A 1TUDA 2LDMA 2K5FA 2CH4A 4HVVA 4PJOB 3G7ZA 3CCRT 4A4EA 1VQLT 2DVJA 2HQXA 3EGDA 4KRTA 4A54A 3G4SQ 1GBRA 1T0HA 5GAOn 2OX7A 3I55Q 4PJOG 4ZTJA 1VQ4Q 1WHGA 4E2FB 1XJWB 2CUBA 1B34B 1M1KU 1K9AA 3GPLA 2G6FX 1Y96B 4FIBA 1K76A 1NPPA 4AFQC 4NL3A 4M77F 1UEBA 2HEQA 1JRIA 2O31A 4M4ZA 4QKUA 5GAMf 3GF5A 1WQ7A 2AZVA 5FU7C 1HK9A 2Y4XA 3X24B 1TH7A 4M7AB 5CK9A 4UC4A 1EZZB 5HK0A 3PT9A 1SG5A 5CQYA 3CMAA 3X28B 4C92D 4N4GA 4VUBA 4PJOC 1UB4A 4M7AG 4HVUA 4E7SA 3H0FA 4LDYA 4N0AC 2OTJQ 3JAME 1PRMC 3SWNB 3VU3C 3OYJA 1YIJQ 1FWZA 4FSSA 5FU6B 2RN8A 3IQLA 3QZ9B 2AHJB 3TU4K 1UGVA 1SRLA 3LWHA 4GLMA 4A4GA 2D6FA 5GAMe 2J7IA 5D6YA 3A8GB 2DAQA 1BKBA 3QUIA 4E6RA 1HSQA 2Y90A 3ULRB 2K2VA 4JRQA 4K11A 1RUWA 3OS2A 3CXCA 4IKFA 2RM4A 3RMSA 4M7AC 2VV5A 1IGQA 4EMHA 2X4WA 3OSSC 2FPFA 1D3BA 3OS0A 1TUCA 2QQBA 3RR6A 2JMAA 1FMWA 1NEGA 1PRLC 4JRIA 2KROA 1Y7XA 3M0PA 3VS2A 1VQ7A 4BDZA 4RUGA 1NPRA 3SWNC 2FZKB 1WQWA 1NBEB 4HT8A 1VQ6T 3GIBA 5FU6C 2DM1A 4HA8A 5GANe 3FB9A 3U23A 4J9FA 1BCOA 1Q95G 3CCRQ 1AWOA 1VQLQ 5GMKe 2JMCA 4M78E 3CXCP 4C8QF 3EGXA 5L23A 1KC8C 1XQHA 3P8BB 3UWNA 3G1JA 1WHHA 3BY7A 3OYEA 2OTLA 3OYBA 4EDUA 4QQ6A 5A0DA 1PKTA 1VQKT 4BI4A 1M5Q1 1O9SA 2O9VA 5LJ5g 2NUPB 1UTIA 3LWIA 1OI1A 2QTXA 4IIMA 1JJ2S 4L59A 5GAOp 2AIRB 1O75A 3V8JA 1Z9QA 4M78C 2X9HA 1BB9A 2DK3A 4JUVA 3CCSQ 1JBMA 2GTJA 2DEUA 4ANJA 4FCYA 1K73C 2QYZA 5GAOl 2NLUA 3PNWC 1YJWT 5AYFA 4ME7A 1S1NA 2M0OA 8ATCB 1X2QA 2BTTA 3BDLA 4OMQA 4D6WA 5FRMA 1BCMA 3CC4T 2RF0A 4AT1B 2O4XB 4XAXB 2EJFA 5GMKl 3OYFA 4BE1A 2AKKA 1V76A 1YI2T 3JCMJ 5IAYA 5A0LA 4HKEA 2LMJA 2EJGA 4Y28E 2QASA 3QDFA 2KRNA 1UJYA 4M75B 2JUFA 4JS4A 2G3RA 3M4GA 4LXCA 3UA6A 3CQTA 2HCKA 1MGQA 1SPKA 3TREA 4M75G 2GGRA 2KXDA 2ZPGB 4ORZA 3CPWA 3CCJT 2CSIA 4J9BA 3REBB 2R5MA 3RMQA 1OQKA 2DLPA 2R58A 5GJWB 5LJ5h 2W0ZA 5CKFA 3CCUT 3VKIA 1NJIC 4HCKA 2YUOA 3CC7A 2X35A 3EH1A 4KUIA 1XOVA 2I0NA 5IN1A 4KH0B 5FW9A 1NLPC 3D7SB 1RAEB 2RQWA 2FHDA 5LJ3g 2ABLA 4F7UF 3EG1A 1FXXA 1G83A 3P8HA 2F2WA 5KCOA 4DA4A 1M9SA 4F7UA 3JCMQ 2E3HA 1WJSA 2X4XA 4ZN3A 2H8HA 4ZGDB 2F69A 1ACMB 1YCSB 1Y71A 3AT1B 4C0DB 4BUGA 4RCCA 2DXCA 3MP1A 2DL8A 2HL5C 4BY6C 4E47A 1VQKQ 4IUUA 4E7HA 1KC8R 1LOJA 4HCCA 4XTUA 3V7RA 1VQ5T 1X27A 2VGMA 1RABB 5CR2A 4MZMA 4C92F 2DIQA 1YJNA 3VS7A 2BZXA 2MPXC 2EGAA 1AWWA 4C92A 2QA4T 1IXDA 1NEBA 1K8AC 2EYXA 4FM4B 1UFFA 3EFOA 3GNFB 1W1FA 2JOYA 2K6DA 5LJ5d 3H0IA 2HD0A 1KQSS 1C0MA 1YHQA 1MUZA 2JZ2A 3MEVA 4M7DD 2FPEA 3CC4Q 1K73R 2JN0A 1I4K1 3A8MB 5CCAA 4C5EA 1YI2Q 4C0DC 2LJ3A 3M58A 5GAMj 3I5SA 4FYVB 2X3XD 3OYKA 3VUBA 1OEBA 2HBPA 2KE9A 1Q86U 5LJ3h 3CEYA 2E65A 2DNUA 4PJLA 5IH2A 4PNOA 2M16A 2D0NA 1AD5A 2QG9B 1KQSP 3LYIA 4LD6A 1RLQC 3N5BB 1HXDA 1J3TA 4QQGA 3A8LB 2KI7A 5DY9A 3VV0A 4NS5A 3I56A 2E12A 1H3HA 2D0QB 3META 1ZX6A 3L2RA 4R56A 3GLXA 2GCXA 3CCJQ 1G3SA 1KQ1A 2LZ6B 1ZSZB 3CCUQ 4KGZB 2F2XA 3JV3A 4QW2A 1VQPT 4J9CA 1W2BA 2E1HA 1ZUUA 5GANj 4M77B 1TTHB 2XKOC 3G4SA 1D0YA 3JB9I 3C0CA 4OMOA 2MIOA 2XDDA 3I55A 5GMKj 1VQ4A 4N4IA 2LCCA 2DEQA 2E5KA 1OOTA 3CD6T 2DL4A 4AFSC 3LLRA 1E7OA 1I5OB 4A4KA 2GFUA 4M77E 2F2VA 4A63B 1QCFA 1RAIB 4OP0A 4LDWA 4KGXB 1GFCA 4HT9A 1TOVA 3URGA 4MDXA 3KXTA 5LJ3d 3CCLA 2PTKA 1XNIA 5GAN2 2RQUA 1WDXA 1PM3A 1U1SA 3VYHB 4KULA 3QSUA 1VUBA 1VQ5Q 1B3QA 3RIRA 2PZ1A 2ECZA 5KYWA 2RA2A 1ZSZC 2DVEA 3C95A 5D7UA 1IGUA 2QQ9A 1SF9A 2DRMA 2J06A 3CMET 4BE2A 4M77C 4FU6A 3CBPA 3G71Q 3MKDA 2KDSA 4JJNK 1IB8A 3ASKA 2KNBB 4LUDA 3J7AF 3EG0A 3OB9A 3ZFJA 3UT1A 1G5VA 5ECAA 2KBTA 1CKAA 4HXJA 2V1QA 3R6NA 3OYMA 1BIBA 1K1ZA 1A0NB 5CKEA 1N8RC 2A7YA 1K8AR 3PVQA 3GOXA 2XG8D 3H41A 3UDCA 4HVWA 1ZSGA 4EPCA 1AWJA 1VQ9T 1QCOA 2KT8A 3CPFA 4B9WA 3PMTA 2L3RA 2DPPB 2ED1A 2F5TX 2YT6A 1QWFA 4FL6A 4PJOD 1XTDA 4JJDA 2YRDA 2XD0A 1CSKA 1QQJA 3CC2T 2VASA 1GFDA 2O88A 4J7FA 4C8QB 2DX1A 4C5GA 2KYMA 1VQOT 3A98A 3QBYA 1D0ZA 5GAN4 2GNCA 2COYA 2LNHB 3PIPA 2JS0A 1QP3A 1T3LA 2EQJA 2KAFA 3CCRA 5FROA 2EFIA 4JZ4A 5GMKi 2CH4W 1VQLA 3S3MA 2NUTA 2COZA 3P8DA 1WXTA 3NFCA 4C8QE 1Q7YU 4AFZC 1LPLA 2B8AA 2DYBA 2H3JA 3SEMA 5AT1B 1GCPA 3JB9F 4M7AD 2HMAA 2NYSA 1K9MR 3CD6Q 2KSSA 1M90C 4Y91A 2EKHA 1OX9A 3EHQA 3HPWA 1ZUKA 3VS5A 2DA9A 4B9XA 3FEOA 2LQ8A 5LJ5e 5FRNA 5DLOA 3OYGA 2QEXQ 4C8QC 1ZA2B 2DERA 4BDYA 2LQKA 1EX4A 2COWA 3M59A 1D1AA 1M1KC 2JVVA 3CCET 5KE3A 1NYFA 3CCQT 2RJCA 3OYYA 1N5ZA 3RDVA 4CI0C 1WIEA 1QP2A 1WJQA 2QAZA 4QVZA 1FMKA 8AT1B 1M8VA 3CMEQ 2JTFA 2A0FB 3E9GA 3SB2A 3QXEB 1X6BA 2DRKA 4L6V5 1T0JA 3LGFA 2GQIA 2H3EB 4GY5A 3CCST 1YITT 4PLIA 1S72T 1WLPB 4M7DF 1K0XA 3L42A 1X6GA 2IVWA 4OVAA 4MZPA 5GAOr 2EQKA 4M7DA 2IPOB 2D9TA 3SHWA 5GAOm 1BI3A 2XMFA 4FT4A 2HNIA 1DJ7B 5GAN8 1VQ9Q 4DQ2A 5LJ3f 1RI9A 1N8RR 1KK7A 1N9RA 2YUNA 1OU8A 1YNZA 2EGEA 2A3LA 3QHSA 3O8VA 2K3YA 1SSHA 1VQ8Q 4C5HA 2L8DA 3QWXX 4AG1C 1UG1A 3QPHA 3MEUA 2JW4A 5KYUA 5HKCA 2JM9A 3CC2Q 4DBFA 5CQXA 1WI7A 1HD3A 1FMVA 2LT1A 4C0GA 1VQ6A 3FRNA 1VQOQ 1I07A 2GFAA 3KFVA 4RTZA 3OBWA 1VYUA 4F7UE 3SDZA 1KHCA 3L2WA 2EYYA 1UJ0A 1KSWA 4OMFB 5LJ3e 2VKNA 1VIFA 2RD1A 3UATA 2ZAEA 3JCMV 2C0IA 3FJ5A 2QQRA 5LL6S 4M78B 1KG1A 2FB7A 2XI9A 5I2SA 2HKNA 5KH6A 2MWPA 1VQNQ 3TEEA 2DILA 1VQMA 1MHNA 3JRZA 1G3WA 1WHLA 2DL7A 4M78G 2M1HA 3OYNA 2BKDN 2QQAA 2LQWA 4XTYA 5CKDA 2E4HA 4EMKA 4XU1A 3PVLA 3NTIA 2RK1A 4JJCA 2YUQA 2J6FA 2ED0A 2BZYA 3VS3A 4ELYC 1M90R 3MPUB 4C92E 1AZEA 5J3BA 3PE0A 2X3WD 2F1LA 3EG9A 1OPLA 1JJ2A 4PK4A 2C0TA 1HYOA 4J9HA 3CCEQ 3CCQQ 3OYHA 2LQNA 3JCMP 2DMOA 1PD1A 1YJWA 3CCVT 2NWMA 5EC7A 1D09B 3I35A 1IHWA 2C0OA 1M1KR 3C4SA 3G6EQ 4R55A 4M75D 3CC4A 1WYXA 3EG2A 4BACA 1YITQ 3UA7A 4C92C 1YI2A 1S72Q 2PUOB 3M53A 3WXMB 5GAN6 1QVFS 2RI2A 3CCMT 1BI2A 3NTHA 1YFNA 1PCXA 2EAYA 2KR3A 3NPFA 1M2VB 3HP9A 3MEWA 1PC0A 2QDYB 1JQQA 1KIKA 2CP5A 4DEYA 1JJ2P 1NM7A 1K73U 3PFSA 2M51A 4PJOF 1H8KA 2L2PA 2EQIA 1B7TA 2FPDA 4PJOA 2EIFA 1RL2A 1QVFP 4J8OA 1IRXA 3CCJA 4JS5A 3OYLA 2OAUA 1FYNA 3OQ5A 2DL3A 2EJ9A 4J83A 4O5VA 4N0AA 5IHIA 4KBMB 1VYVA 3OY9A 3CCUA 1WHMA 2K3BA 2HL3A 3ME9A 1B34A 1U06A 4QVDA 3HTRA 1Y96A 4BY6B 2CYZB 3QKJA 4F04B 3T9NA 3E19A 4X9DA 1YWPA 5I11A 4CC7A 3OSVA 3QYGB 2KK4A 4O6JA 5EG2A 3JB9H 1OX8A 4M7AF 2IIMA 1TU0B 3QYHB 4M7AA 2YRCA 1B07A 1QVGS 2LJ1A 4PFZA 5A0GA 2QQSA 5L8RE 3GP8A 4XQ3A 4F16A 3HRTA 5D6XA 1RLPC 1UDLA 5LJ5j 1VQ5A 1IO6A 1PWTA 4J9DA 2FZGB 3SWNA 4BD3A 1UE9A 2DXBA 1I0CA 4DBHA 3OYCA 1HJDA 2HZYA 2P0PA 4WTOB 1WGSA 3VRZA 2RMOA 2J6KA 2V8KA 4RG8A 2QA4A 2AT1B 4LDUA 4JPBW 2P4TA 1QVGP 4IURA 2AK5A 2RI3A 3RKWA 2VWFA 2VXFA 5FLXE 1UGPB 1ZBJA 1AVZC 4Z02A 1R0CB 2M0YA 1MV3A 3CCVQ 1E6GA 1VQ7Q 1V29B 2L3SA 2LC4A 1D1BA 1WFWA 1WHJA 3L1AA 4Z8AA 2DTIA 1KQSA 1ZA1B 2EW3A 2JTEA 4ZTFA 2YSQA 3JCMg 3G71T 4MDWA 2BZ8A 3CCMQ 3AHUA 2DL5A 1QWEA 4WF2A 4TVRA 1RI0A 3PIOA 3MHXA 2D1XA 4M78A 3V7SA 4LDVA 4OB0B 2CZ6B 1JEGA 1PHTA 1K8AU 4M77D 5KYXB 3M0RA 3M54A 3UF4A 2L3PA 1SHGA 4J7IA 4BI8B 3DLMA 2RQVA 3NMZC 1MMGA 3QDRB 1TSFA 3HL8A 4E7JA 3V8KA 2HDAA 1Z9ZA 1GCQA 1NZ9A 1YJNT 4J6WA 2HSPA 2K3XA 1VQPA 1OZ3A 2BE7D 3LH0A 1QKXA 1VYTA 5DM7R 3GBQA 3JB9G 1Q82C 4FYWB 1M3AA 2QXFA 3OW2S 3PMIA 5LJ3j 4EMGA 2CSQA 2NUPA 2SRCA 5GAN3 1G2BA 1LVKA 3CD6A 2ZPBB 4KT0E 2HSEB 4PFOA 1AHJB 4C5IA 3FDRA 1TWBA 2DTOA 3JCMh 4IUPA 1NJIR 4E7IA 2MOXA 4M77G 3EG3A 3OW2P 4AFUC 1RACB 3RUXA 4KGVB 2VYTA 3FIFA 1W70A 1K9MU 2EYZA 2O4XA 3PGGA 1M8MA 5GAN7 2FEIA 1W4SA 5D6WA 4X9CA 1X69A 3DLLA 2V26A 3M0QA 2DBMA 2QEXT 2K7AA 2JS2A 2QI2A 1D0XA 2QGFB 2V8JA 1UGRB 2L5QA 4M75F 2K5IA 5HK3A 1YP5A 2RQRA 4M75A 2K2MA 3OBYA 1OU9A 3HFOA 1AOJA 1MMAA 5FWCA 5M9OA 3KBGA 1NE8A 2ZPFB 2EYWA 2OTJA 2MYSA 1VA7A 3O5ZA 1RAFB 4C8QD 3OYDA 1YIJA 2GQVA 3QJYA 2HBWA 1BIAA 3ZBDA 1PD0A 2EPDA 2QK0A 3HHTB 4XTVA 1Y07A 1Q81C 1KD1C 2WSFE 4LUEA 2LRQA 2YDLA 3CC2A 4RTXA 3JCMd 5IXFA 3MO8A 3Q1JA 1RADB 3EFSA 4F17A 3HSBA 1WHKA 3ZL7C 1N8RU 1VQOA 1N27A 2KVQG 3H6ZA 2ZPIB 4L5GA 2CT4A 1VQ8T 3QWYA 3L2QA 1YJNQ 5IT9E 1TG0A 1YJ9T 1P92A 4RKUE 3TCJA 2M9UA 3MCAB 3EGXB 4LN2A 2LX9A 1V1CA 3S3NA 1M2OA 1R0BG 1MNDA 1OYXA 3LGLA 2RNAA 2GBQA 2XDBA 2E6NA 1EIFA 1JO8A 1C1AA 4AG2C 1YHQQ 2ZPEB
chains in the Genus database with same CATH topology
3CQTA 1I07A 3TSWA 2ESWA 2HCKA 3KFVA 2KRSA 4RTZA 1NLOC 1X43A 1SPKA 1VYUA 2GGRA 4LE9A 1YN8A 2KXDA 4ORZA 2CSIA 1UJ0A 2EYYA 1KSWA 4J9BA 2B86A 2VKNA 3REBB 2DLPA 1U5SA 2JXBA 5GJWB 3UATA 2W0ZA 3REAB 2C0IA 3FJ5A 1WX6A 4HCKA 2YUOA 2W10A 1EFNA 2ROLA 2DILA 1XOVA 2I0NA 2DL7A 5FW9A 4EIKA 1QLYA 2EGCA 1NLPC 2LQWA 2MCNA 2RQWA 2ABLA 3EG1A 1PNJA 1UHFA 1G83A 5I22A 3PVLA 2F2WA 4OMLA 2JT4A 3VS6A 4JJCA 2YUQA 2KGTA 2J6FA 2ED0A 3VRYA 1AZGB 2BZYA 2H8HA 1KJWA 3VS3A 1AZEA 2KT1A 1K0SA 1SRMA 1YCSB 3PE0A 2X3WD 2K9GA 1OPLA 2C0TA 4J9HA 2J05A 2L0AA 2LQNA 1JXMA 1PKSA 2DMOA 2DL8A 2DE0X 3NGPA 2NWMA 5EC7A 3I35A 1X27A 2C0OA 4CC2A 2DJQA 1WYXA 3EG2A 5IXBA 3UA7A 3VS7A 2BZXA 2EGAA 1M27C 1UECA 1AWWA 1WXUA 1NEBA 4JJBA 2LCSA 2KYBA 2EYXA 4GBQA 3RNJA 3M0SA 1UFFA 1U3OA 2KR3A 3NPFA 3VS0A 1ZUYA 1W1FA 2K6DA 1X2KA 1JQQA 1KIKA 4OMNA 3H0IA 4DEYA 1MUZA 1UHCA 5IHNA 1GL5A 1W6XA 4CC4B 2FPEA 1NM7A 4WCIA 2M51A 1UUEA 1H8KA 2LJ3A 2L2PA 2EQIA 4J9IA 2J6OA 2FPDA 1JU5C 3I5SA 2X3XD 2SEMA 2A37A 1OEBA 2KE9A 2RPNA 1FYNA 2DL3A 1JXOA 2EBPA 2DNUA 1BK2A 5IHIA 2DBKA 5IH2A 1VYVA 4IIOA 2D8JA 2P4RA 2K3BA 1QKWA 2AKLA 2D0NA 1AD5A 3EGUA 1M3BA 2GTOA 1RLQC 1J3TA 2QDLA 3M0TA 1GBQA 1U06A 1H3HA 4RTTA 4D8KA 4RTYA 4CC3A 2A08A 1ZX6A 4J9EA 1Y0MA 1KFZA 1NYGA 5HCKA 2KRMA 3EHRA 2OAWA 1H92A 4JZ3A 1YWPA 1E6HA 4CC7A 2CDTA 5I11A 2CREA 2LZ6B 1T3SA 2IIMA 2F2XA 4DEXA 2CT3A 3JV3A 4J9CA 2JM8A 3VS4A 1B07A 1ZUUA 4Y92A 5GJVB 2ENMA 3C0CA 2LJ1A 4OMOA 2MIOA 1AEYA 2VVKA 1K4US 4F16A 2KXCA 1I1JA 1RLPC 4Z89A 1UDLA 2OJ2A 1BBZA 2E5KA 2D8HA 2YUPA 1OOTA 2DL4A 1IO6A 4AFSC 1PWTA 4J9DA 4F14A 1E7OA 2OI3A 1UE9A 1WXBA 1I0CA 1OV3A 1TUDA 2CH4A 2F2VA 1HJDA 4A63B 1QCFA 4HVVA 2FRWA 2RMOA 3VRZA 2J6KA 5IHKA 1OPKA 2DVJA 2A36A 2PNIA 4JPBW 3VS1A 4D8DA 4KRTA 2AK5A 1GFCA 1GBRA 1T0HA 2VWFA 4OMPA 3LH5A 1ZBJA 1AVZC 2PTKA 2RQUA 1WDXA 1ZLMA 2M0YA 1MV3A 1E6GA 2CUBA 2L3SA 1B3QA 1K9AA 2PZ1A 2ECZA 4X1VA 4ESRA 2G6FX 1WFWA 3H0HA 3I9QA 4Z8AA 2DRMA 1K76A 4AFQC 2EW3A 2J06A 2JTEA 2HEQA 2YSQA 2BZ8A 2O31A 4M4ZA 4J9GA 2AZVA 2DL5A 1QWEA 2KNBB 4LUDA 3EG0A 4OMMA 5ECAA 2KBTA 1YWOA 2D1XA 1CKAA 4HXJA 2V1QA 3R6NA 4ZNXA 1A0NB 1K1ZA 1AWXA 3PVQA 1JEGA 1PHTA 3M0RA 1CKBA 4RTUA 3H41A 3UF4A 4HVUA 4HVWA 2L3PA 1SHGA 1ZSGA 1AWJA 2RQVA 3H0FA 2V1RA 3NMZC 2KT8A 1PRMC 1GCQC 2RQTA 2HDAA 1Z9ZA 1GCQA 4FSSA 2RN8A 3IQLA 2HSPA 2ED1A 2FO0A 1UGVA 2YT6A 1SRLA 1QKXA 1VYTA 1QWFA 4GLMA 4JJDA 3GBQA 2J7IA 1CSKA 1M3AA 2LP5A 2O9SA 4E6RA 1GFDA 2A28A 1HSQA 2O88A 3ULRB 1GRIA 4K11A 2CSQA 2SRCA 2DX1A 1SEMA 1RUWA 1G2BA 2KYMA 4LNPA 3A98A 2GNCA 2CUDA 2LNHB 2FPFA 4RTVA 2JS0A 1TUCA 1T3LA 4JZ4A 2CH4W 2JMAA 2KEAA 1WXTA 1NEGA 1PRLC 2KROA 3M0PA 3TSZA 2MOXA 4AFZC 5FWBA 1M3CA 3EG3A 2DYBA 3VS2A 4AFUC 4RUGA 3SEMA 1LCKA 2ROTA 1GCPA 4RTWA 1W70A 2EYZA 2DM1A 3U23A 1M8MA 2EKHA 4J9FA 2FEIA 3EHQA 1ZUKA 3VS5A 2DA9A 1AWOA 1X69A 2K79A 2EVRA 3M0QA 2DBMA 1ARKA 1SHFA 2K7AA 2JS2A 2JMCA 1WA7A 1BU1A 2NUZA 5L23A 2LJ0A 1YP5A 2RQRA 1NYFA 2K2MA 2FG0A 1N5ZA 1WIEA 1AOJA 1NG2A 5FWCA 3RBBB 1PKTA 1FMKA 2O9VA 2EYWA 1UTIA 1X6BA 1VA7A 2DRKA 3O5ZA 3M0UA 4IIMA 1T0JA 3THKA 1ABOA 2GQIA 1Z9QA 2DF6A 2HBWA 1BB9A 1WLPB 1K0XA 1X6GA 2EPDA 2GTJA 3SHWA 3TVTA 4LUEA 2XMFA 2YDLA 4RTXA 1S1NA 5IXFA 2O2OA 1X2QA 2BTTA 4OMQA 4F17A 3ZL7C 1RI9A 2AZSA 2LX7A 4R0KA 4Z88A 2RF0A 1Y57A 2AKKA 2YUNA 1YNZA 1MV0B 2EGEA 2CT4A 2FRYA 3QWYA 1M30A 1TG0A 1SSHA 3QWXX 4AG1C 1UG1A 3NHNA 2JW4A 3I5RA 2LMJA 4LN2A 1V1CA 2JM9A 2L3QA 2KRNA 4QT7A 1UJYA 2RNAA 2GBQA 1WI7A 1ABQA 1HD3A 1JO8A 4AG2C 3UA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQT A;  1I07 A;  3TSW A;  2ESW A;  2HCK A;  3KFV A;  2KRS A;  4RTZ A;  1NLO C;  1X43 A;  1SPK A;  1VYU A;  2GGR A;  4LE9 A;  1YN8 A;  2KXD A;  4ORZ A;  2CSI A;  1UJ0 A;  2EYY A;  1KSW A;  4J9B A;  2B86 A;  2VKN A;  3REB B;  2DLP A;  1U5S A;  2JXB A;  5GJW B;  3UAT A;  2W0Z A;  3REA B;  2C0I A;  3FJ5 A;  1WX6 A;  4HCK A;  2YUO A;  2W10 A;  1EFN A;  2ROL A;  2DIL A;  1XOV A;  2I0N A;  2DL7 A;  5FW9 A;  4EIK A;  1QLY A;  2EGC A;  1NLP C;  2LQW A;  2MCN A;  2RQW A;  2ABL A;  3EG1 A;  1PNJ A;  1UHF A;  1G83 A;  5I22 A;  3PVL A;  2F2W A;  4OML A;  2JT4 A;  3VS6 A;  4JJC A;  2YUQ A;  2KGT A;  2J6F A;  2ED0 A;  3VRY A;  1AZG B;  2BZY A;  2H8H A;  1KJW A;  3VS3 A;  1AZE A;  2KT1 A;  1K0S A;  1SRM A;  1YCS B;  3PE0 A;  2X3W D;  2K9G A;  1OPL A;  2C0T A;  4J9H A;  2J05 A;  2L0A A;  2LQN A;  1JXM A;  1PKS A;  2DMO A;  2DL8 A;  2DE0 X;  3NGP A;  2NWM A;  5EC7 A;  3I35 A;  1X27 A;  2C0O A;  4CC2 A;  2DJQ A;  1WYX A;  3EG2 A;  5IXB A;  3UA7 A;  3VS7 A;  2BZX A;  2EGA A;  1M27 C;  1UEC A;  1AWW A;  1WXU A;  1NEB A;  4JJB A;  2LCS A;  2KYB A;  2EYX A;  4GBQ A;  3RNJ A;  3M0S A;  1UFF A;  1U3O A;  2KR3 A;  3NPF A;  3VS0 A;  1ZUY A;  1W1F A;  2K6D A;  1X2K A;  1JQQ A;  1KIK A;  4OMN A;  3H0I A;  4DEY A;  1MUZ A;  1UHC A;  5IHN A;  1GL5 A;  1W6X A;  4CC4 B;  2FPE A;  1NM7 A;  4WCI A;  2M51 A;  1UUE A;  1H8K A;  2LJ3 A;  2L2P A;  2EQI A;  4J9I A;  2J6O A;  2FPD A;  1JU5 C;  3I5S A;  2X3X D;  2SEM A;  2A37 A;  1OEB A;  2KE9 A;  2RPN A;  1FYN A;  2DL3 A;  1JXO A;  2EBP A;  2DNU A;  1BK2 A;  5IHI A;  2DBK A;  5IH2 A;  1VYV A;  4IIO A;  2D8J A;  2P4R A;  2K3B A;  1QKW A;  2AKL A;  2D0N A;  1AD5 A;  3EGU A;  1M3B A;  2GTO A;  1RLQ C;  1J3T A;  2QDL A;  3M0T A;  1GBQ A;  1U06 A;  1H3H A;  4RTT A;  4D8K A;  4RTY A;  4CC3 A;  2A08 A;  1ZX6 A;  4J9E A;  1Y0M A;  1KFZ A;  1NYG A;  5HCK A;  2KRM A;  3EHR A;  2OAW A;  1H92 A;  4JZ3 A;  1YWP A;  1E6H A;  4CC7 A;  2CDT A;  5I11 A;  2CRE A;  2LZ6 B;  1T3S A;  2IIM A;  2F2X A;  4DEX A;  2CT3 A;  3JV3 A;  4J9C A;  2JM8 A;  3VS4 A;  1B07 A;  1ZUU A;  4Y92 A;  5GJV B;  2ENM A;  3C0C A;  2LJ1 A;  4OMO A;  2MIO A;  1AEY A;  2VVK A;  1K4U S;  4F16 A;  2KXC A;  1I1J A;  1RLP C;  4Z89 A;  1UDL A;  2OJ2 A;  1BBZ A;  2E5K A;  2D8H A;  2YUP A;  1OOT A;  2DL4 A;  1IO6 A;  4AFS C;  1PWT A;  4J9D A;  4F14 A;  1E7O A;  2OI3 A;  1UE9 A;  1WXB A;  1I0C A;  1OV3 A;  1TUD A;  2CH4 A;  2F2V A;  1HJD A;  4A63 B;  1QCF A;  4HVV A;  2FRW A;  2RMO A;  3VRZ A;  2J6K A;  5IHK A;  1OPK A;  2DVJ A;  2A36 A;  2PNI A;  4JPB W;  3VS1 A;  4D8D A;  4KRT A;  2AK5 A;  1GFC A;  1GBR A;  1T0H A;  2VWF A;  4OMP A;  3LH5 A;  1ZBJ A;  1AVZ C;  2PTK A;  2RQU A;  1WDX A;  1ZLM A;  2M0Y A;  1MV3 A;  1E6G A;  2CUB A;  2L3S A;  1B3Q A;  1K9A A;  2PZ1 A;  2ECZ A;  4X1V A;  4ESR A;  2G6F X;  1WFW A;  3H0H A;  3I9Q A;  4Z8A A;  2DRM A;  1K76 A;  4AFQ C;  2EW3 A;  2J06 A;  2JTE A;  2HEQ A;  2YSQ A;  2BZ8 A;  2O31 A;  4M4Z A;  4J9G A;  2AZV A;  2DL5 A;  1QWE A;  2KNB B;  4LUD A;  3EG0 A;  4OMM A;  5ECA A;  2KBT A;  1YWO A;  2D1X A;  1CKA A;  4HXJ A;  2V1Q A;  3R6N A;  4ZNX A;  1A0N B;  1K1Z A;  1AWX A;  3PVQ A;  1JEG A;  1PHT A;  3M0R A;  1CKB A;  4RTU A;  3H41 A;  3UF4 A;  4HVU A;  4HVW A;  2L3P A;  1SHG A;  1ZSG A;  1AWJ A;  2RQV A;  3H0F A;  2V1R A;  3NMZ C;  2KT8 A;  1PRM C;  1GCQ C;  2RQT A;  2HDA A;  1Z9Z A;  1GCQ A;  4FSS A;  2RN8 A;  3IQL A;  2HSP A;  2ED1 A;  2FO0 A;  1UGV A;  2YT6 A;  1SRL A;  1QKX A;  1VYT A;  1QWF A;  4GLM A;  4JJD A;  3GBQ A;  2J7I A;  1CSK A;  1M3A A;  2LP5 A;  2O9S A;  4E6R A;  1GFD A;  2A28 A;  1HSQ A;  2O88 A;  3ULR B;  1GRI A;  4K11 A;  2CSQ A;  2SRC A;  2DX1 A;  1SEM A;  1RUW A;  1G2B A;  2KYM A;  4LNP A;  3A98 A;  2GNC A;  2CUD A;  2LNH B;  2FPF A;  4RTV A;  2JS0 A;  1TUC A;  1T3L A;  4JZ4 A;  2CH4 W;  2JMA A;  2KEA A;  1WXT A;  1NEG A;  1PRL C;  2KRO A;  3M0P A;  3TSZ A;  2MOX A;  4AFZ C;  5FWB A;  1M3C A;  3EG3 A;  2DYB A;  3VS2 A;  4AFU C;  4RUG A;  3SEM A;  1LCK A;  2ROT A;  1GCP A;  4RTW A;  1W70 A;  2EYZ A;  2DM1 A;  3U23 A;  1M8M A;  2EKH A;  4J9F A;  2FEI A;  3EHQ A;  1ZUK A;  3VS5 A;  2DA9 A;  1AWO A;  1X69 A;  2K79 A;  2EVR A;  3M0Q A;  2DBM A;  1ARK A;  1SHF A;  2K7A A;  2JS2 A;  2JMC A;  1WA7 A;  1BU1 A;  2NUZ A;  5L23 A;  2LJ0 A;  1YP5 A;  2RQR A;  1NYF A;  2K2M A;  2FG0 A;  1N5Z A;  1WIE A;  1AOJ A;  1NG2 A;  5FWC A;  3RBB B;  1PKT A;  1FMK A;  2O9V A;  2EYW A;  1UTI A;  1X6B A;  1VA7 A;  2DRK A;  3O5Z A;  3M0U A;  4IIM A;  1T0J A;  3THK A;  1ABO A;  2GQI A;  1Z9Q A;  2DF6 A;  2HBW A;  1BB9 A;  1WLP B;  1K0X A;  1X6G A;  2EPD A;  2GTJ A;  3SHW A;  3TVT A;  4LUE A;  2XMF A;  2YDL A;  4RTX A;  1S1N A;  5IXF A;  2O2O A;  1X2Q A;  2BTT A;  4OMQ A;  4F17 A;  3ZL7 C;  1RI9 A;  2AZS A;  2LX7 A;  4R0K A;  4Z88 A;  2RF0 A;  1Y57 A;  2AKK A;  2YUN A;  1YNZ A;  1MV0 B;  2EGE A;  2CT4 A;  2FRY A;  3QWY A;  1M30 A;  1TG0 A;  1SSH A;  3QWX X;  4AG1 C;  1UG1 A;  3NHN A;  2JW4 A;  3I5R A;  2LMJ A;  4LN2 A;  1V1C A;  2JM9 A;  2L3Q A;  2KRN A;  4QT7 A;  1UJY A;  2RNA A;  2GBQ A;  1WI7 A;  1ABQ A;  1HD3 A;  1JO8 A;  4AG2 C;  3UA6 A; 
#chains in the Genus database with same CATH topology
 1R8O B;  1PG5 B;  2P0Q A;  3TSW A;  1Q82 R;  2ESW A;  2KRS A;  4C8Q G;  1X43 A;  2EYQ A;  4LE9 A;  1YN8 A;  2XDP A;  3BFM A;  2DKG A;  4ZGJ B;  3M9Q A;  5CVI A;  2B86 A;  2Y4Y A;  2YLB A;  2JXB A;  1U5S A;  4OGC A;  4PKC C;  4QQD A;  4V2S A;  2LT4 A;  1Q7Y C;  1WX6 A;  2E70 A;  1VQN T;  1EFN A;  4JRK A;  4PL6 A;  2ZPH B;  3H9N A;  2K4Y A;  3GNG A;  1RAH B;  2RHI A;  4EMK C;  2YLC A;  4EIK A;  1QLY A;  2YXY A;  2CP3 A;  3SD4 A;  1TUG B;  2MCN A;  4IUT A;  3HFN A;  1PNJ A;  1UHF A;  5I22 A;  3RKX A;  2JT4 A;  4JDS A;  2XK0 A;  1AZG B;  4FYY B;  2MMP A;  1KJW A;  1M4Z A;  5KYN A;  1M90 U;  2KT1 A;  3CCS A;  1YIT A;  1S72 A;  2RK2 A;  2MWO A;  3BW1 A;  3CBO A;  5CAI A;  2VXE A;  4A53 A;  1G8X A;  2RO0 A;  2J05 A;  2L0A A;  1JXM A;  2CP0 A;  2CS7 A;  2DE0 X;  2MK5 A;  3NGP A;  3SFM A;  3J80 E;  2GF7 A;  1X01 A;  2M02 A;  5CIU A;  2ZZD A;  3G6E T;  2DD5 A;  4E7K A;  4CC2 A;  5IXB A;  4PJO E;  1ZSZ A;  1PSF A;  1QW1 A;  1M27 C;  2JNG A;  2R5A A;  3OMG A;  4JJB A;  3DKM A;  2KYB A;  4GBQ A;  3RNJ A;  4M77 A;  3M0S A;  3JCM b;  3VS0 A;  1X2K A;  4JLI A;  2L89 A;  5C6S A;  3EAE A;  3CCL Q;  3ER0 A;  5GMK m;  1MNE A;  4M78 D;  1W6X A;  4CC4 B;  3UPU A;  2FYK A;  4IUV A;  2DO3 A;  5GAN 5;  1Q81 R;  1KD1 R;  4MZT A;  4FT2 A;  4XTX A;  1UUE A;  4C0Z A;  2RHX A;  2E3I A;  3HKS A;  2J6O A;  1YJ9 Q;  4F7U B;  5DLQ E;  2WAC A;  1JXO A;  2EBP A;  4BE0 A;  2BE9 B;  3JCM W;  4M7A E;  1ZHI A;  2D8J A;  2P4R A;  1QKW A;  4GLK A;  4F7U G;  3EGU A;  1M3B A;  3CMA T;  4HCZ A;  4ATO A;  4BI3 A;  3C12 A;  3LW5 E;  2RB6 A;  4DBQ A;  1BI0 A;  4XU0 A;  5GAN f;  2A08 A;  2I2L A;  2YRV A;  1KFZ A;  1NYG A;  2EKO A;  4DOW A;  5HCK A;  1IZ6 A;  2KRM A;  3EHR A;  2OAW A;  2RHU A;  4JZ3 A;  3JB9 J;  1E6H A;  1WPY A;  3JCM f;  1PSE A;  1T3S A;  2CKK A;  4C92 B;  5I21 A;  2PVG B;  1F1B B;  3WVD B;  4C0F A;  4OB1 B;  4Y92 A;  2LNV A;  3EFO B;  2PVD B;  4Q5W A;  3A8O B;  2E5Q A;  1ZQ1 A;  4RG2 A;  1VQK A;  3MP6 A;  4C92 G;  3CXC S;  1I1J A;  1H64 1;  2E41 A;  2HQE A;  1Q7Y R;  3CCV A;  4Z89 A;  4MMK A;  2OJ2 A;  1BBZ A;  2FL7 A;  1X6O A;  2D8H A;  3QJ6 A;  2P0K A;  1OZ2 A;  4P5N A;  3RER A;  3WVE B;  7AT1 B;  2K5L A;  2OI3 A;  2CZ0 B;  1WXB A;  1OV3 A;  3H8Z A;  3BE3 A;  2QTV A;  4FYX B;  2FRW A;  5IHK A;  1OPK A;  3EFR A;  2A36 A;  2PNI A;  3VS1 A;  2CGH A;  4D8D A;  3CCM A;  4XTW A;  2BIV A;  3JCM e;  4OMP A;  3LH5 A;  4B6M A;  1VQ7 T;  1KC8 U;  1QVF A;  3JCM c;  1ZLM A;  4KH1 B;  2DFU A;  4LD9 K;  2KQW A;  4C8Q A;  1VQM T;  3JCM X;  3F70 A;  4X1V A;  4ESR A;  4PFP A;  4FW2 A;  3HRU A;  3H0H A;  1C6V X;  1JB0 E;  3I9Q A;  5J26 A;  2YHT A;  2K57 A;  4NOY A;  2PQW A;  4J5Y A;  4J9G A;  4E7Z A;  1GXI E;  4OMM A;  1RAA B;  2MF2 A;  2E6Z A;  3M5A A;  3V8L A;  1YWO A;  4ZNX A;  1QCN A;  1VIE A;  2V8I A;  1I5L A;  2R57 A;  2ZGW A;  2OTL T;  1AWX A;  2XU8 A;  2HAX A;  2QGG A;  3M56 A;  1CKB A;  4RTU A;  3QZ5 B;  1WJR A;  3JSC A;  4LDX A;  4JRP A;  2V1R A;  4OGE A;  1H3Z A;  2O01 E;  1GCQ C;  2RQT A;  2DXT A;  3RES A;  1ZBX A;  3VUZ A;  4II1 A;  4PJM A;  5KYY B;  3CBM A;  2FO0 A;  3CMA Q;  1WNL A;  2KY9 A;  1I81 A;  1KQ2 A;  4FW1 A;  2YWW A;  3A1P A;  3FC3 A;  1KHI A;  2LP5 A;  2O9S A;  1IRE B;  2A28 A;  2VB6 A;  1M1F A;  1QVG A;  2EWN A;  1GRI A;  3KUF A;  5KYW B;  1SEM A;  1UGQ B;  4RMO A;  4LNP A;  3HRS A;  3OS5 A;  2DJZ A;  2CUD A;  2RJE A;  4RTV A;  5GAM g;  3MP8 A;  3DB4 A;  1I8F A;  3TQ7 P;  2C06 A;  2DZ9 A;  2Z0W A;  2KEA A;  5CO7 A;  4XTZ A;  3TSZ A;  1NJI U;  4M75 E;  4BB7 A;  3OYA A;  5FWB A;  2PUK B;  1M3C A;  1MMD A;  1LCK A;  2ROT A;  4RTW A;  3QG1 A;  3CPW S;  1VQ6 Q;  1IHV A;  5KE2 A;  1MMN A;  3G71 A;  4OB3 B;  2K79 A;  2EVR A;  1QMC A;  1ARK A;  1SHF A;  4XK8 E;  1WA7 A;  1BU1 A;  2NUZ A;  2DXU A;  3CC7 T;  4M75 C;  3JB9 D;  2LJ0 A;  5GAN g;  3INZ A;  2FG0 A;  1VQM Q;  4DBR A;  3CPW P;  4MML A;  3PTA A;  3OA6 A;  1NG2 A;  3MJX A;  3RBB B;  2VGN A;  3L2U A;  4CRI A;  3M0U A;  3THK A;  4M78 F;  1ABO A;  2DF6 A;  2IG0 A;  4A4H A;  2PVO B;  4QVC A;  2XHC A;  5HY6 A;  3S6W A;  2NUT B;  3OS1 A;  4J6X A;  3TVT A;  2OTL Q;  4E7L A;  5GAM h;  2DZC A;  1YBY A;  4JLG A;  4XU2 A;  2WSC E;  3E1S A;  2RJD A;  1YJW Q;  2O2O A;  1Q86 C;  4R0K A;  2AZS A;  2LX7 A;  4Z88 A;  1Y57 A;  2X4Y A;  2RH2 A;  1MV0 B;  3OW2 A;  2FRY A;  3E2U A;  1M30 A;  4OB2 B;  3FJP A;  3EGD B;  3NHN A;  4IUQ A;  3I5R A;  2P84 A;  3OYI A;  3X20 B;  1FX7 A;  2L3Q A;  1QVP A;  1RAG B;  2EQM A;  3ZEH A;  4QT7 A;  4XU3 A;  2VUB A;  1YHQ T;  2RJF A;  1ABQ A;  3A5Z B;  2CZ7 B;  1OUL A;  2XID A;  2VC8 A;  3DB3 A;  2RHY A;  3VJP A;  2FVU A;  1Q82 U;  5GAN h;  1NLO C;  1R77 A;  4PLL A;  2LVM A;  1SSF A;  4KUD K;  2CP7 A;  5GMK h;  2DYI A;  5CKB A;  2QEX A;  1M2V A;  4N4H A;  3REA B;  1M1G A;  4HCB A;  5A2Q E;  2W10 A;  2ROL A;  4M7D B;  1U1T A;  3I56 T;  1K9M C;  5CKH A;  5C0M A;  2EGC A;  4DOV A;  5GAM d;  2X4J A;  4M7D G;  5GAO q;  2JJ9 A;  3CME A;  9ATC B;  4ELZ C;  2DET A;  1BI1 A;  4OML A;  3VS6 A;  1W2B S;  1G3Y A;  2KGT A;  3VRY A;  4ZN1 A;  3BDU A;  2HKQ B;  4M7D E;  3LX7 A;  2E64 A;  2MI6 A;  1K0S A;  1SRM A;  1D1C A;  1X75 C;  3CC7 Q;  2K9G A;  2F5K A;  6AT1 B;  5KYY A;  3G4S T;  3MEA A;  1LNX A;  5KYU B;  3I55 T;  1PKS A;  1BYM A;  3X25 B;  1VOM A;  4J6Y A;  2FZC B;  1VQ4 T;  1VQ9 A;  4RCB A;  4A4F A;  1WZO A;  3V7C A;  1W2B P;  2PU9 B;  2DJQ A;  1G3T A;  2JTM A;  1YCY A;  1D3B B;  4M7D C;  5GAN d;  1VQ8 A;  1N6A A;  1UEC A;  1WXU A;  1N9S A;  1YJ9 A;  4AMC A;  2LCS A;  3X26 B;  2QA4 Q;  1U3O A;  2WSE E;  2LTO A;  1ZUY A;  3CCL T;  4OMN A;  3M4Y A;  3A8H B;  1UHC A;  5IHN A;  1GL5 A;  1TXQ A;  3RKY A;  2ATC B;  4WCI A;  1Q81 U;  1KD1 U;  2MAM A;  4EMK B;  2XIC A;  1AT1 B;  2KMT A;  3C94 A;  4J9I A;  2OTJ T;  2BUD A;  1JU5 C;  3NTK A;  2E10 A;  2SEM A;  3R6O A;  1Q86 R;  2A37 A;  2RPN A;  1YIJ T;  1BK2 A;  2DBK A;  2LCL A;  4IIO A;  2AKL A;  2EQU A;  2DIG A;  4NL2 A;  1VQN A;  3EG9 B;  2GTO A;  3FLG A;  4ZGE B;  2QDL A;  1LJO A;  3QII A;  3M0T A;  1GBQ A;  3M57 A;  4RTT A;  4D8K A;  4RTY A;  1U8R A;  4CC3 A;  4J9E A;  1Y0M A;  3L2Z A;  2CP6 A;  3J81 E;  1H92 A;  3E9F A;  1UGS B;  3M55 A;  2CDT A;  5J39 A;  2CRE A;  5LJ5 f;  3L2V A;  2RHZ A;  2DTH A;  4DEX A;  2CT3 A;  2HQH A;  4YTL A;  4FSX A;  2JM8 A;  3OMC A;  3VS4 A;  3CCE A;  3CCQ A;  4PJN A;  1SKU B;  4OF1 A;  5GJV B;  1VQP Q;  4X34 A;  2ENM A;  5I2M A;  3I56 Q;  2CZ1 B;  3S3O A;  1AEY A;  2DD4 A;  2VVK A;  1K4U S;  5KYX A;  2KXC A;  2CP2 A;  5FU7 B;  2ZCF B;  3VYG A;  5KCH A;  3G6E A;  2RI5 A;  2YUP A;  4PJJ A;  3EH2 A;  4F14 A;  3QO3 A;  1TS9 A;  2X51 A;  1TUD A;  2LDM A;  2K5F A;  2CH4 A;  4HVV A;  4PJO B;  3G7Z A;  3CCR T;  4A4E A;  1VQL T;  2DVJ A;  2HQX A;  3EGD A;  4KRT A;  4A54 A;  3G4S Q;  1GBR A;  1T0H A;  5GAO n;  2OX7 A;  3I55 Q;  4PJO G;  4ZTJ A;  1VQ4 Q;  1WHG A;  4E2F B;  1XJW B;  2CUB A;  1B34 B;  1M1K U;  1K9A A;  3GPL A;  2G6F X;  1Y96 B;  4FIB A;  1K76 A;  1NPP A;  4AFQ C;  4NL3 A;  4M77 F;  1UEB A;  2HEQ A;  1JRI A;  2O31 A;  4M4Z A;  4QKU A;  5GAM f;  3GF5 A;  1WQ7 A;  2AZV A;  5FU7 C;  1HK9 A;  2Y4X A;  3X24 B;  1TH7 A;  4M7A B;  5CK9 A;  4UC4 A;  1EZZ B;  5HK0 A;  3PT9 A;  1SG5 A;  5CQY A;  3CMA A;  3X28 B;  4C92 D;  4N4G A;  4VUB A;  4PJO C;  1UB4 A;  4M7A G;  4HVU A;  4E7S A;  3H0F A;  4LDY A;  4N0A C;  2OTJ Q;  3JAM E;  1PRM C;  3SWN B;  3VU3 C;  3OYJ A;  1YIJ Q;  1FWZ A;  4FSS A;  5FU6 B;  2RN8 A;  3IQL A;  3QZ9 B;  2AHJ B;  3TU4 K;  1UGV A;  1SRL A;  3LWH A;  4GLM A;  4A4G A;  2D6F A;  5GAM e;  2J7I A;  5D6Y A;  3A8G B;  2DAQ A;  1BKB A;  3QUI A;  4E6R A;  1HSQ A;  2Y90 A;  3ULR B;  2K2V A;  4JRQ A;  4K11 A;  1RUW A;  3OS2 A;  3CXC A;  4IKF A;  2RM4 A;  3RMS A;  4M7A C;  2VV5 A;  1IGQ A;  4EMH A;  2X4W A;  3OSS C;  2FPF A;  1D3B A;  3OS0 A;  1TUC A;  2QQB A;  3RR6 A;  2JMA A;  1FMW A;  1NEG A;  1PRL C;  4JRI A;  2KRO A;  1Y7X A;  3M0P A;  3VS2 A;  1VQ7 A;  4BDZ A;  4RUG A;  1NPR A;  3SWN C;  2FZK B;  1WQW A;  1NBE B;  4HT8 A;  1VQ6 T;  3GIB A;  5FU6 C;  2DM1 A;  4HA8 A;  5GAN e;  3FB9 A;  3U23 A;  4J9F A;  1BCO A;  1Q95 G;  3CCR Q;  1AWO A;  1VQL Q;  5GMK e;  2JMC A;  4M78 E;  3CXC P;  4C8Q F;  3EGX A;  5L23 A;  1KC8 C;  1XQH A;  3P8B B;  3UWN A;  3G1J A;  1WHH A;  3BY7 A;  3OYE A;  2OTL A;  3OYB A;  4EDU A;  4QQ6 A;  5A0D A;  1PKT A;  1VQK T;  4BI4 A;  1M5Q 1;  1O9S A;  2O9V A;  5LJ5 g;  2NUP B;  1UTI A;  3LWI A;  1OI1 A;  2QTX A;  4IIM A;  1JJ2 S;  4L59 A;  5GAO p;  2AIR B;  1O75 A;  3V8J A;  1Z9Q A;  4M78 C;  2X9H A;  1BB9 A;  2DK3 A;  4JUV A;  3CCS Q;  1JBM A;  2GTJ A;  2DEU A;  4ANJ A;  4FCY A;  1K73 C;  2QYZ A;  5GAO l;  2NLU A;  3PNW C;  1YJW T;  5AYF A;  4ME7 A;  1S1N A;  2M0O A;  8ATC B;  1X2Q A;  2BTT A;  3BDL A;  4OMQ A;  4D6W A;  5FRM A;  1BCM A;  3CC4 T;  2RF0 A;  4AT1 B;  2O4X B;  4XAX B;  2EJF A;  5GMK l;  3OYF A;  4BE1 A;  2AKK A;  1V76 A;  1YI2 T;  3JCM J;  5IAY A;  5A0L A;  4HKE A;  2LMJ A;  2EJG A;  4Y28 E;  2QAS A;  3QDF A;  2KRN A;  1UJY A;  4M75 B;  2JUF A;  4JS4 A;  2G3R A;  3M4G A;  4LXC A;  3UA6 A;  3CQT A;  2HCK A;  1MGQ A;  1SPK A;  3TRE A;  4M75 G;  2GGR A;  2KXD A;  2ZPG B;  4ORZ A;  3CPW A;  3CCJ T;  2CSI A;  4J9B A;  3REB B;  2R5M A;  3RMQ A;  1OQK A;  2DLP A;  2R58 A;  5GJW B;  5LJ5 h;  2W0Z A;  5CKF A;  3CCU T;  3VKI A;  1NJI C;  4HCK A;  2YUO A;  3CC7 A;  2X35 A;  3EH1 A;  4KUI A;  1XOV A;  2I0N A;  5IN1 A;  4KH0 B;  5FW9 A;  1NLP C;  3D7S B;  1RAE B;  2RQW A;  2FHD A;  5LJ3 g;  2ABL A;  4F7U F;  3EG1 A;  1FXX A;  1G83 A;  3P8H A;  2F2W A;  5KCO A;  4DA4 A;  1M9S A;  4F7U A;  3JCM Q;  2E3H A;  1WJS A;  2X4X A;  4ZN3 A;  2H8H A;  4ZGD B;  2F69 A;  1ACM B;  1YCS B;  1Y71 A;  3AT1 B;  4C0D B;  4BUG A;  4RCC A;  2DXC A;  3MP1 A;  2DL8 A;  2HL5 C;  4BY6 C;  4E47 A;  1VQK Q;  4IUU A;  4E7H A;  1KC8 R;  1LOJ A;  4HCC A;  4XTU A;  3V7R A;  1VQ5 T;  1X27 A;  2VGM A;  1RAB B;  5CR2 A;  4MZM A;  4C92 F;  2DIQ A;  1YJN A;  3VS7 A;  2BZX A;  2MPX C;  2EGA A;  1AWW A;  4C92 A;  2QA4 T;  1IXD A;  1NEB A;  1K8A C;  2EYX A;  4FM4 B;  1UFF A;  3EFO A;  3GNF B;  1W1F A;  2JOY A;  2K6D A;  5LJ5 d;  3H0I A;  2HD0 A;  1KQS S;  1C0M A;  1YHQ A;  1MUZ A;  2JZ2 A;  3MEV A;  4M7D D;  2FPE A;  3CC4 Q;  1K73 R;  2JN0 A;  1I4K 1;  3A8M B;  5CCA A;  4C5E A;  1YI2 Q;  4C0D C;  2LJ3 A;  3M58 A;  5GAM j;  3I5S A;  4FYV B;  2X3X D;  3OYK A;  3VUB A;  1OEB A;  2HBP A;  2KE9 A;  1Q86 U;  5LJ3 h;  3CEY A;  2E65 A;  2DNU A;  4PJL A;  5IH2 A;  4PNO A;  2M16 A;  2D0N A;  1AD5 A;  2QG9 B;  1KQS P;  3LYI A;  4LD6 A;  1RLQ C;  3N5B B;  1HXD A;  1J3T A;  4QQG A;  3A8L B;  2KI7 A;  5DY9 A;  3VV0 A;  4NS5 A;  3I56 A;  2E12 A;  1H3H A;  2D0Q B;  3MET A;  1ZX6 A;  3L2R A;  4R56 A;  3GLX A;  2GCX A;  3CCJ Q;  1G3S A;  1KQ1 A;  2LZ6 B;  1ZSZ B;  3CCU Q;  4KGZ B;  2F2X A;  3JV3 A;  4QW2 A;  1VQP T;  4J9C A;  1W2B A;  2E1H A;  1ZUU A;  5GAN j;  4M77 B;  1TTH B;  2XKO C;  3G4S A;  1D0Y A;  3JB9 I;  3C0C A;  4OMO A;  2MIO A;  2XDD A;  3I55 A;  5GMK j;  1VQ4 A;  4N4I A;  2LCC A;  2DEQ A;  2E5K A;  1OOT A;  3CD6 T;  2DL4 A;  4AFS C;  3LLR A;  1E7O A;  1I5O B;  4A4K A;  2GFU A;  4M77 E;  2F2V A;  4A63 B;  1QCF A;  1RAI B;  4OP0 A;  4LDW A;  4KGX B;  1GFC A;  4HT9 A;  1TOV A;  3URG A;  4MDX A;  3KXT A;  5LJ3 d;  3CCL A;  2PTK A;  1XNI A;  5GAN 2;  2RQU A;  1WDX A;  1PM3 A;  1U1S A;  3VYH B;  4KUL A;  3QSU A;  1VUB A;  1VQ5 Q;  1B3Q A;  3RIR A;  2PZ1 A;  2ECZ A;  5KYW A;  2RA2 A;  1ZSZ C;  2DVE A;  3C95 A;  5D7U A;  1IGU A;  2QQ9 A;  1SF9 A;  2DRM A;  2J06 A;  3CME T;  4BE2 A;  4M77 C;  4FU6 A;  3CBP A;  3G71 Q;  3MKD A;  2KDS A;  4JJN K;  1IB8 A;  3ASK A;  2KNB B;  4LUD A;  3J7A F;  3EG0 A;  3OB9 A;  3ZFJ A;  3UT1 A;  1G5V A;  5ECA A;  2KBT A;  1CKA A;  4HXJ A;  2V1Q A;  3R6N A;  3OYM A;  1BIB A;  1K1Z A;  1A0N B;  5CKE A;  1N8R C;  2A7Y A;  1K8A R;  3PVQ A;  3GOX A;  2XG8 D;  3H41 A;  3UDC A;  4HVW A;  1ZSG A;  4EPC A;  1AWJ A;  1VQ9 T;  1QCO A;  2KT8 A;  3CPF A;  4B9W A;  3PMT A;  2L3R A;  2DPP B;  2ED1 A;  2F5T X;  2YT6 A;  1QWF A;  4FL6 A;  4PJO D;  1XTD A;  4JJD A;  2YRD A;  2XD0 A;  1CSK A;  1QQJ A;  3CC2 T;  2VAS A;  1GFD A;  2O88 A;  4J7F A;  4C8Q B;  2DX1 A;  4C5G A;  2KYM A;  1VQO T;  3A98 A;  3QBY A;  1D0Z A;  5GAN 4;  2GNC A;  2COY A;  2LNH B;  3PIP A;  2JS0 A;  1QP3 A;  1T3L A;  2EQJ A;  2KAF A;  3CCR A;  5FRO A;  2EFI A;  4JZ4 A;  5GMK i;  2CH4 W;  1VQL A;  3S3M A;  2NUT A;  2COZ A;  3P8D A;  1WXT A;  3NFC A;  4C8Q E;  1Q7Y U;  4AFZ C;  1LPL A;  2B8A A;  2DYB A;  2H3J A;  3SEM A;  5AT1 B;  1GCP A;  3JB9 F;  4M7A D;  2HMA A;  2NYS A;  1K9M R;  3CD6 Q;  2KSS A;  1M90 C;  4Y91 A;  2EKH A;  1OX9 A;  3EHQ A;  3HPW A;  1ZUK A;  3VS5 A;  2DA9 A;  4B9X A;  3FEO A;  2LQ8 A;  5LJ5 e;  5FRN A;  5DLO A;  3OYG A;  2QEX Q;  4C8Q C;  1ZA2 B;  2DER A;  4BDY A;  2LQK A;  1EX4 A;  2COW A;  3M59 A;  1D1A A;  1M1K C;  2JVV A;  3CCE T;  5KE3 A;  1NYF A;  3CCQ T;  2RJC A;  3OYY A;  1N5Z A;  3RDV A;  4CI0 C;  1WIE A;  1QP2 A;  1WJQ A;  2QAZ A;  4QVZ A;  1FMK A;  8AT1 B;  1M8V A;  3CME Q;  2JTF A;  2A0F B;  3E9G A;  3SB2 A;  3QXE B;  1X6B A;  2DRK A;  4L6V 5;  1T0J A;  3LGF A;  2GQI A;  2H3E B;  4GY5 A;  3CCS T;  1YIT T;  4PLI A;  1S72 T;  1WLP B;  4M7D F;  1K0X A;  3L42 A;  1X6G A;  2IVW A;  4OVA A;  4MZP A;  5GAO r;  2EQK A;  4M7D A;  2IPO B;  2D9T A;  3SHW A;  5GAO m;  1BI3 A;  2XMF A;  4FT4 A;  2HNI A;  1DJ7 B;  5GAN 8;  1VQ9 Q;  4DQ2 A;  5LJ3 f;  1RI9 A;  1N8R R;  1KK7 A;  1N9R A;  2YUN A;  1OU8 A;  1YNZ A;  2EGE A;  2A3L A;  3QHS A;  3O8V A;  2K3Y A;  1SSH A;  1VQ8 Q;  4C5H A;  2L8D A;  3QWX X;  4AG1 C;  1UG1 A;  3QPH A;  3MEU A;  2JW4 A;  5KYU A;  5HKC A;  2JM9 A;  3CC2 Q;  4DBF A;  5CQX A;  1WI7 A;  1HD3 A;  1FMV A;  2LT1 A;  4C0G A;  1VQ6 A;  3FRN A;  1VQO Q;  1I07 A;  2GFA A;  3KFV A;  4RTZ A;  3OBW A;  1VYU A;  4F7U E;  3SDZ A;  1KHC A;  3L2W A;  2EYY A;  1UJ0 A;  1KSW A;  4OMF B;  5LJ3 e;  2VKN A;  1VIF A;  2RD1 A;  3UAT A;  2ZAE A;  3JCM V;  2C0I A;  3FJ5 A;  2QQR A;  5LL6 S;  4M78 B;  1KG1 A;  2FB7 A;  2XI9 A;  5I2S A;  2HKN A;  5KH6 A;  2MWP A;  1VQN Q;  3TEE A;  2DIL A;  1VQM A;  1MHN A;  3JRZ A;  1G3W A;  1WHL A;  2DL7 A;  4M78 G;  2M1H A;  3OYN A;  2BKD N;  2QQA A;  2LQW A;  4XTY A;  5CKD A;  2E4H A;  4EMK A;  4XU1 A;  3PVL A;  3NTI A;  2RK1 A;  4JJC A;  2YUQ A;  2J6F A;  2ED0 A;  2BZY A;  3VS3 A;  4ELY C;  1M90 R;  3MPU B;  4C92 E;  1AZE A;  5J3B A;  3PE0 A;  2X3W D;  2F1L A;  3EG9 A;  1OPL A;  1JJ2 A;  4PK4 A;  2C0T A;  1HYO A;  4J9H A;  3CCE Q;  3CCQ Q;  3OYH A;  2LQN A;  3JCM P;  2DMO A;  1PD1 A;  1YJW A;  3CCV T;  2NWM A;  5EC7 A;  1D09 B;  3I35 A;  1IHW A;  2C0O A;  1M1K R;  3C4S A;  3G6E Q;  4R55 A;  4M75 D;  3CC4 A;  1WYX A;  3EG2 A;  4BAC A;  1YIT Q;  3UA7 A;  4C92 C;  1YI2 A;  1S72 Q;  2PUO B;  3M53 A;  3WXM B;  5GAN 6;  1QVF S;  2RI2 A;  3CCM T;  1BI2 A;  3NTH A;  1YFN A;  1PCX A;  2EAY A;  2KR3 A;  3NPF A;  1M2V B;  3HP9 A;  3MEW A;  1PC0 A;  2QDY B;  1JQQ A;  1KIK A;  2CP5 A;  4DEY A;  1JJ2 P;  1NM7 A;  1K73 U;  3PFS A;  2M51 A;  4PJO F;  1H8K A;  2L2P A;  2EQI A;  1B7T A;  2FPD A;  4PJO A;  2EIF A;  1RL2 A;  1QVF P;  4J8O A;  1IRX A;  3CCJ A;  4JS5 A;  3OYL A;  2OAU A;  1FYN A;  3OQ5 A;  2DL3 A;  2EJ9 A;  4J83 A;  4O5V A;  4N0A A;  5IHI A;  4KBM B;  1VYV A;  3OY9 A;  3CCU A;  1WHM A;  2K3B A;  2HL3 A;  3ME9 A;  1B34 A;  1U06 A;  4QVD A;  3HTR A;  1Y96 A;  4BY6 B;  2CYZ B;  3QKJ A;  4F04 B;  3T9N A;  3E19 A;  4X9D A;  1YWP A;  5I11 A;  4CC7 A;  3OSV A;  3QYG B;  2KK4 A;  4O6J A;  5EG2 A;  3JB9 H;  1OX8 A;  4M7A F;  2IIM A;  1TU0 B;  3QYH B;  4M7A A;  2YRC A;  1B07 A;  1QVG S;  2LJ1 A;  4PFZ A;  5A0G A;  2QQS A;  5L8R E;  3GP8 A;  4XQ3 A;  4F16 A;  3HRT A;  5D6X A;  1RLP C;  1UDL A;  5LJ5 j;  1VQ5 A;  1IO6 A;  1PWT A;  4J9D A;  2FZG B;  3SWN A;  4BD3 A;  1UE9 A;  2DXB A;  1I0C A;  4DBH A;  3OYC A;  1HJD A;  2HZY A;  2P0P A;  4WTO B;  1WGS A;  3VRZ A;  2RMO A;  2J6K A;  2V8K A;  4RG8 A;  2QA4 A;  2AT1 B;  4LDU A;  4JPB W;  2P4T A;  1QVG P;  4IUR A;  2AK5 A;  2RI3 A;  3RKW A;  2VWF A;  2VXF A;  5FLX E;  1UGP B;  1ZBJ A;  1AVZ C;  4Z02 A;  1R0C B;  2M0Y A;  1MV3 A;  3CCV Q;  1E6G A;  1VQ7 Q;  1V29 B;  2L3S A;  2LC4 A;  1D1B A;  1WFW A;  1WHJ A;  3L1A A;  4Z8A A;  2DTI A;  1KQS A;  1ZA1 B;  2EW3 A;  2JTE A;  4ZTF A;  2YSQ A;  3JCM g;  3G71 T;  4MDW A;  2BZ8 A;  3CCM Q;  3AHU A;  2DL5 A;  1QWE A;  4WF2 A;  4TVR A;  1RI0 A;  3PIO A;  3MHX A;  2D1X A;  4M78 A;  3V7S A;  4LDV A;  4OB0 B;  2CZ6 B;  1JEG A;  1PHT A;  1K8A U;  4M77 D;  5KYX B;  3M0R A;  3M54 A;  3UF4 A;  2L3P A;  1SHG A;  4J7I A;  4BI8 B;  3DLM A;  2RQV A;  3NMZ C;  1MMG A;  3QDR B;  1TSF A;  3HL8 A;  4E7J A;  3V8K A;  2HDA A;  1Z9Z A;  1GCQ A;  1NZ9 A;  1YJN T;  4J6W A;  2HSP A;  2K3X A;  1VQP A;  1OZ3 A;  2BE7 D;  3LH0 A;  1QKX A;  1VYT A;  5DM7 R;  3GBQ A;  3JB9 G;  1Q82 C;  4FYW B;  1M3A A;  2QXF A;  3OW2 S;  3PMI A;  5LJ3 j;  4EMG A;  2CSQ A;  2NUP A;  2SRC A;  5GAN 3;  1G2B A;  1LVK A;  3CD6 A;  2ZPB B;  4KT0 E;  2HSE B;  4PFO A;  1AHJ B;  4C5I A;  3FDR A;  1TWB A;  2DTO A;  3JCM h;  4IUP A;  1NJI R;  4E7I A;  2MOX A;  4M77 G;  3EG3 A;  3OW2 P;  4AFU C;  1RAC B;  3RUX A;  4KGV B;  2VYT A;  3FIF A;  1W70 A;  1K9M U;  2EYZ A;  2O4X A;  3PGG A;  1M8M A;  5GAN 7;  2FEI A;  1W4S A;  5D6W A;  4X9C A;  1X69 A;  3DLL A;  2V26 A;  3M0Q A;  2DBM A;  2QEX T;  2K7A A;  2JS2 A;  2QI2 A;  1D0X A;  2QGF B;  2V8J A;  1UGR B;  2L5Q A;  4M75 F;  2K5I A;  5HK3 A;  1YP5 A;  2RQR A;  4M75 A;  2K2M A;  3OBY A;  1OU9 A;  3HFO A;  1AOJ A;  1MMA A;  5FWC A;  5M9O A;  3KBG A;  1NE8 A;  2ZPF B;  2EYW A;  2OTJ A;  2MYS A;  1VA7 A;  3O5Z A;  1RAF B;  4C8Q D;  3OYD A;  1YIJ A;  2GQV A;  3QJY A;  2HBW A;  1BIA A;  3ZBD A;  1PD0 A;  2EPD A;  2QK0 A;  3HHT B;  4XTV A;  1Y07 A;  1Q81 C;  1KD1 C;  2WSF E;  4LUE A;  2LRQ A;  2YDL A;  3CC2 A;  4RTX A;  3JCM d;  5IXF A;  3MO8 A;  3Q1J A;  1RAD B;  3EFS A;  4F17 A;  3HSB A;  1WHK A;  3ZL7 C;  1N8R U;  1VQO A;  1N27 A;  2KVQ G;  3H6Z A;  2ZPI B;  4L5G A;  2CT4 A;  1VQ8 T;  3QWY A;  3L2Q A;  1YJN Q;  5IT9 E;  1TG0 A;  1YJ9 T;  1P92 A;  4RKU E;  3TCJ A;  2M9U A;  3MCA B;  3EGX B;  4LN2 A;  2LX9 A;  1V1C A;  3S3N A;  1M2O A;  1R0B G;  1MND A;  1OYX A;  3LGL A;  2RNA A;  2GBQ A;  2XDB A;  2E6N A;  1EIF A;  1JO8 A;  1C1A A;  4AG2 C;  1YHQ Q;  2ZPE B; 
#chains in the Genus database with same CATH homology
 3CQT A;  1I07 A;  3TSW A;  2ESW A;  2HCK A;  3KFV A;  2KRS A;  4RTZ A;  1NLO C;  1X43 A;  1SPK A;  1VYU A;  2GGR A;  4LE9 A;  1YN8 A;  2KXD A;  4ORZ A;  2CSI A;  1UJ0 A;  2EYY A;  1KSW A;  4J9B A;  2B86 A;  2VKN A;  3REB B;  2DLP A;  1U5S A;  2JXB A;  5GJW B;  3UAT A;  2W0Z A;  3REA B;  2C0I A;  3FJ5 A;  1WX6 A;  4HCK A;  2YUO A;  2W10 A;  1EFN A;  2ROL A;  2DIL A;  1XOV A;  2I0N A;  2DL7 A;  5FW9 A;  4EIK A;  1QLY A;  2EGC A;  1NLP C;  2LQW A;  2MCN A;  2RQW A;  2ABL A;  3EG1 A;  1PNJ A;  1UHF A;  1G83 A;  5I22 A;  3PVL A;  2F2W A;  4OML A;  2JT4 A;  3VS6 A;  4JJC A;  2YUQ A;  2KGT A;  2J6F A;  2ED0 A;  3VRY A;  1AZG B;  2BZY A;  2H8H A;  1KJW A;  3VS3 A;  1AZE A;  2KT1 A;  1K0S A;  1SRM A;  1YCS B;  3PE0 A;  2X3W D;  2K9G A;  1OPL A;  2C0T A;  4J9H A;  2J05 A;  2L0A A;  2LQN A;  1JXM A;  1PKS A;  2DMO A;  2DL8 A;  2DE0 X;  3NGP A;  2NWM A;  5EC7 A;  3I35 A;  1X27 A;  2C0O A;  4CC2 A;  2DJQ A;  1WYX A;  3EG2 A;  5IXB A;  3UA7 A;  3VS7 A;  2BZX A;  2EGA A;  1M27 C;  1UEC A;  1AWW A;  1WXU A;  1NEB A;  4JJB A;  2LCS A;  2KYB A;  2EYX A;  4GBQ A;  3RNJ A;  3M0S A;  1UFF A;  1U3O A;  2KR3 A;  3NPF A;  3VS0 A;  1ZUY A;  1W1F A;  2K6D A;  1X2K A;  1JQQ A;  1KIK A;  4OMN A;  3H0I A;  4DEY A;  1MUZ A;  1UHC A;  5IHN A;  1GL5 A;  1W6X A;  4CC4 B;  2FPE A;  1NM7 A;  4WCI A;  2M51 A;  1UUE A;  1H8K A;  2LJ3 A;  2L2P A;  2EQI A;  4J9I A;  2J6O A;  2FPD A;  1JU5 C;  3I5S A;  2X3X D;  2SEM A;  2A37 A;  1OEB A;  2KE9 A;  2RPN A;  1FYN A;  2DL3 A;  1JXO A;  2EBP A;  2DNU A;  1BK2 A;  5IHI A;  2DBK A;  5IH2 A;  1VYV A;  4IIO A;  2D8J A;  2P4R A;  2K3B A;  1QKW A;  2AKL A;  2D0N A;  1AD5 A;  3EGU A;  1M3B A;  2GTO A;  1RLQ C;  1J3T A;  2QDL A;  3M0T A;  1GBQ A;  1U06 A;  1H3H A;  4RTT A;  4D8K A;  4RTY A;  4CC3 A;  2A08 A;  1ZX6 A;  4J9E A;  1Y0M A;  1KFZ A;  1NYG A;  5HCK A;  2KRM A;  3EHR A;  2OAW A;  1H92 A;  4JZ3 A;  1YWP A;  1E6H A;  4CC7 A;  2CDT A;  5I11 A;  2CRE A;  2LZ6 B;  1T3S A;  2IIM A;  2F2X A;  4DEX A;  2CT3 A;  3JV3 A;  4J9C A;  2JM8 A;  3VS4 A;  1B07 A;  1ZUU A;  4Y92 A;  5GJV B;  2ENM A;  3C0C A;  2LJ1 A;  4OMO A;  2MIO A;  1AEY A;  2VVK A;  1K4U S;  4F16 A;  2KXC A;  1I1J A;  1RLP C;  4Z89 A;  1UDL A;  2OJ2 A;  1BBZ A;  2E5K A;  2D8H A;  2YUP A;  1OOT A;  2DL4 A;  1IO6 A;  4AFS C;  1PWT A;  4J9D A;  4F14 A;  1E7O A;  2OI3 A;  1UE9 A;  1WXB A;  1I0C A;  1OV3 A;  1TUD A;  2CH4 A;  2F2V A;  1HJD A;  4A63 B;  1QCF A;  4HVV A;  2FRW A;  2RMO A;  3VRZ A;  2J6K A;  5IHK A;  1OPK A;  2DVJ A;  2A36 A;  2PNI A;  4JPB W;  3VS1 A;  4D8D A;  4KRT A;  2AK5 A;  1GFC A;  1GBR A;  1T0H A;  2VWF A;  4OMP A;  3LH5 A;  1ZBJ A;  1AVZ C;  2PTK A;  2RQU A;  1WDX A;  1ZLM A;  2M0Y A;  1MV3 A;  1E6G A;  2CUB A;  2L3S A;  1B3Q A;  1K9A A;  2PZ1 A;  2ECZ A;  4X1V A;  4ESR A;  2G6F X;  1WFW A;  3H0H A;  3I9Q A;  4Z8A A;  2DRM A;  1K76 A;  4AFQ C;  2EW3 A;  2J06 A;  2JTE A;  2HEQ A;  2YSQ A;  2BZ8 A;  2O31 A;  4M4Z A;  4J9G A;  2AZV A;  2DL5 A;  1QWE A;  2KNB B;  4LUD A;  3EG0 A;  4OMM A;  5ECA A;  2KBT A;  1YWO A;  2D1X A;  1CKA A;  4HXJ A;  2V1Q A;  3R6N A;  4ZNX A;  1A0N B;  1K1Z A;  1AWX A;  3PVQ A;  1JEG A;  1PHT A;  3M0R A;  1CKB A;  4RTU A;  3H41 A;  3UF4 A;  4HVU A;  4HVW A;  2L3P A;  1SHG A;  1ZSG A;  1AWJ A;  2RQV A;  3H0F A;  2V1R A;  3NMZ C;  2KT8 A;  1PRM C;  1GCQ C;  2RQT A;  2HDA A;  1Z9Z A;  1GCQ A;  4FSS A;  2RN8 A;  3IQL A;  2HSP A;  2ED1 A;  2FO0 A;  1UGV A;  2YT6 A;  1SRL A;  1QKX A;  1VYT A;  1QWF A;  4GLM A;  4JJD A;  3GBQ A;  2J7I A;  1CSK A;  1M3A A;  2LP5 A;  2O9S A;  4E6R A;  1GFD A;  2A28 A;  1HSQ A;  2O88 A;  3ULR B;  1GRI A;  4K11 A;  2CSQ A;  2SRC A;  2DX1 A;  1SEM A;  1RUW A;  1G2B A;  2KYM A;  4LNP A;  3A98 A;  2GNC A;  2CUD A;  2LNH B;  2FPF A;  4RTV A;  2JS0 A;  1TUC A;  1T3L A;  4JZ4 A;  2CH4 W;  2JMA A;  2KEA A;  1WXT A;  1NEG A;  1PRL C;  2KRO A;  3M0P A;  3TSZ A;  2MOX A;  4AFZ C;  5FWB A;  1M3C A;  3EG3 A;  2DYB A;  3VS2 A;  4AFU C;  4RUG A;  3SEM A;  1LCK A;  2ROT A;  1GCP A;  4RTW A;  1W70 A;  2EYZ A;  2DM1 A;  3U23 A;  1M8M A;  2EKH A;  4J9F A;  2FEI A;  3EHQ A;  1ZUK A;  3VS5 A;  2DA9 A;  1AWO A;  1X69 A;  2K79 A;  2EVR A;  3M0Q A;  2DBM A;  1ARK A;  1SHF A;  2K7A A;  2JS2 A;  2JMC A;  1WA7 A;  1BU1 A;  2NUZ A;  5L23 A;  2LJ0 A;  1YP5 A;  2RQR A;  1NYF A;  2K2M A;  2FG0 A;  1N5Z A;  1WIE A;  1AOJ A;  1NG2 A;  5FWC A;  3RBB B;  1PKT A;  1FMK A;  2O9V A;  2EYW A;  1UTI A;  1X6B A;  1VA7 A;  2DRK A;  3O5Z A;  3M0U A;  4IIM A;  1T0J A;  3THK A;  1ABO A;  2GQI A;  1Z9Q A;  2DF6 A;  2HBW A;  1BB9 A;  1WLP B;  1K0X A;  1X6G A;  2EPD A;  2GTJ A;  3SHW A;  3TVT A;  4LUE A;  2XMF A;  2YDL A;  4RTX A;  1S1N A;  5IXF A;  2O2O A;  1X2Q A;  2BTT A;  4OMQ A;  4F17 A;  3ZL7 C;  1RI9 A;  2AZS A;  2LX7 A;  4R0K A;  4Z88 A;  2RF0 A;  1Y57 A;  2AKK A;  2YUN A;  1YNZ A;  1MV0 B;  2EGE A;  2CT4 A;  2FRY A;  3QWY A;  1M30 A;  1TG0 A;  1SSH A;  3QWX X;  4AG1 C;  1UG1 A;  3NHN A;  2JW4 A;  3I5R A;  2LMJ A;  4LN2 A;  1V1C A;  2JM9 A;  2L3Q A;  2KRN A;  4QT7 A;  1UJY A;  2RNA A;  2GBQ A;  1WI7 A;  1ABQ A;  1HD3 A;  1JO8 A;  4AG2 C;  3UA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...