5IXGA

Crystal structure of burkholderia cenocepacia bcnb
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
168
structure length
168
Chain Sequence
b'ATYQFDPSHTYPSFEADHFGGLSVWRGKFDKSSGTVTLDRAAKTGTVDVTTDIASIHTGSAKLDEHLQTAEFFDAAKFPQANYKGTIKFDGDKPVSVVGNLTLHGVTKPLTLKIDSFKCMPHPMLKREVCGVDAVGEFSRDDFGLDYGKQYGFKMKTKLLITAEAVKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YceI
publication title Antibiotic Capture by Bacterial Lipocalins Uncovers an Extracellular Mechanism of Intrinsic Antibiotic Resistance.
pubmed doi rcsb
source organism Burkholderia cenocepacia pc184
molecule tags Unknown function
total genus 43
structure length 168
sequence length 168
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04264 YceI YceI-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.110 Mainly Beta Beta Barrel Lipocalin Lipid/polyisoprenoid-binding, YceI-like 5ixgA00
2FGSA 3Q34A 1Y0GA 3HPEA 5IXGA 2X34A 2X32A 1WUBA
chains in the Genus database with same CATH superfamily
3PPTA 2AT6X 1RSTB 1FEMA 1LKEA 1SWAA 1NQNA 3D9WA 4I95A 4QGWA 2NNEA 4I60A 5HZ6A 4WHIA 4AYHA 2IFBA 3SOTA 3RDOA 1YWCA 2CAMA 1E06A 4QYPA 2X8SA 1X8NA 3ZW0B 1UYNX 1E2TA 1KT5A 1SA8A 2RTLA 2DJGA 1AVDA 1WUBA 1GT5A 2RD7C 3HWEA 1XCAA 2M4LA 4CPIA 1JMXA 1NBXA 1X89A 3Q6LA 4GK9A 5AQ6A 2OFMX 2WQ9A 3SLTA 3TGAA 4YGGA 3T1DA 2HKDA 2VFBA 4IABA 4QNIA 3ZW1A 3SLOA 3PQSA 1HXLA 3CMPA 4LKPA 1YWDA 4CDFA 5LJGA 1RSUB 3FEKA 3VG3A 4Z28A 1QG5A 4JO6A 4YDAA 2F73A 3DSZA 1CRBA 1EPBA 1GKAB 1TXLA 2KTDA 3FYFA 3LHNA 4QRLA 5DPQA 3STMX 1W6FA 3SZHA 5D8JA 2O62A 1Y0GA 2KW1A 1LIBA 1KL4A 3FDCA 5EEDA 1UREA 3ELZA 3GAQA 4XMGA 1VWCB 5K06A 2AT5X 1HQPA 3WJDA 1QQSA 4IMNA 4GGTA 5KICA 5BVTA 1LELA 3F8AA 2LFOA 1LUQA 3WZOA 1JJJA 4U8UO 4GUZA 4RUUA 2QO5A 4O3XB 3NBXX 5FQ7E 2OY1O 1JYDA 4DQ4A 1JJXA 1FENA 1LCWA 2POAA 1IJ8A 1VWAB 2IZHB 3APXA 3K3LA 2BS6A 1JQPA 3UEUA 4GGRA 2ZAIA 4ZHCA 3BDRA 3CBSA 1NP1A 1VWBB 2FRSA 1SY2A 5IRUA 4O4OA 4L3RA 3IFBA 4YGZA 1VWLB 5HCDC 4D6AA 4KH8A 4Y5DA 1SWLA 1NQMA 1IKJA 4OELA 4ORUA 1VWOB 3OJYC 3VE2A 2UZ2A 2LKKA 4COTA 2RTAA 3HOEA 1LIEA 2IZBA 1X8PA 3NR3A 5EEEA 4IAXA 2HZQA 3DTQA 4QYNA 4GD9A 1VPRA 4EFGA 2FHNX 3B2IA 3KZAA 3B2JA 2FHLA 1PTSA 4EDEA 5IRWA 1DZPA 2RTKA 2N93A 3VU1A 1VWPB 2Z4HA 4M6SA 3NP1A 1ZNEA 3VGWA 1GT1A 2K23A 1AVEA 4JGLA 1GKAA 1GX3A 1KQWA 1HMSA 1VWKB 1VYFA 2C1QA 4MVEA 2OF9A 5IRAA 3WJGA 3T6FA 4ORSA 1S2PA 1R0UA 1ML7A 1MVGA 5HAEA 4ZH9A 1CBQA 3WJBA 1D3SA 2RTHB 3PK2A 1Y55X 2A8GA 2I5ZO 1OSPO 3PH6A 1I78A 1GXAA 1SWQA 3D96A 4TLJA 3WZQA 4GNWA 1X8QA 1ERBA 3D97A 1I4UA 1MX8A 2ANSA 1SRFA 2W2FA 1QY0A 3P6HA 4NP1A 3APUA 3CWKA 3L4RA 4A1YA 2X56A 1P6PA 1I9HA 1KT6A 1K24A 2AT8X 3LTWA 3NQKA 2OFRX 1ZNGA 1HY2A 3FR5A 4LZVA 3FLLA 5B11O 2AH7X 4EKVA 2EU7X 4YBPA 2Y3FA 1W5RA 1U0XA 1GM6A 1YWAA 2RTFB 3GE2A 2IZGB 4ZCBA 2R74A 4WFUA 4Y0RA 3RZYA 1I04A 3CKFA 1EI5A 3EW2A 1VWIB 2ALLX 3HK1A 3KFHA 4DNEA 2OF8A 1OPBA 4O49A 3WZNA 3O2YA 1BBPA 1NC9A 4U8UM 3PH5A 2KT4B 2RTRB 2VFCA 3WVMA 3ZI8A 2DJFA 1SRHA 4RUNA 5LJHA 4A60A 2CM4A 2OFBA 3C78X 5B2AO 2VDFA 2G78A 1SY1A 3APVA 5HZQA 5HZ5A 3WYQA 3RE6A 2NNDA 4TKBA 3S5XA 1VWGB 3EYCA 3MBTA 4ODDA 2RTPB 3BU1A 3HOLA 4ON1A 3TZSA 1QABE 3CKGA 3MG5A 3QKGA 4NLJA 5HA1A 1G5WA 3NQ3A 1VWDB 1HXZA 1T8VA 3FR4A 3WZPA 2CZUA 2QOSC 3P6FA 5L8OA 1N7YA 2RN4A 3P02A 3ZWEA 1SLFB 4YVBA 4OMWA 3RKGA 1BLRA 3S5VA 2XKLA 3QQ2A 4CPEA 3FA9A 4YKOA 5AJBA 4BX5A 2QO4A 4YBUA 2Q4NA 5F1EA 3BS2A 2MO5A 5B5GA 5K67A 2P8GA 2A2UA 2NP1A 1VWQB 4GH7A 4OS8A 2X32A 4L1NA 2FT9A 2FKJA 4U9CA 5LJEA 2WEXA 3G7XA 5HCCC 1JJUA 4CV7A 2HMBA 2RTGB 3EMMA 3NQ9A 4YDBA 5IO5A 4TQ2A 3UEXA 4I9RA 5FFHA 2LA7A 4CDEA 1VWEB 3RDXA 1GT3A 5B5FA 2PY1A 3HWGA 1N4JA 3PDFA 5C0NA 4WBKA 3CQRA 2JMBA 3B2LA 4GETA 4K19A 3VG7A 1E00A 1MOYA 4TKJA 5CYBA 3KFGA 4OKAA 1G85A 2R73A 2OYBO 4C5PA 3T6LA 1SLGB 3MX7A 3P6CA 1B8EA 2IZKA 5CHKA 4CK4A 4UU3A 3JSQA 1DZMA 4GRJA 2F01A 1GX8A 5HBSA 3FEPA 1SREA 1N9YA 1LF7A 2ACOA 5BVSA 4CDCA 1O8VA 2BHVA 2L5PA 2W2BA 3P6DA 5HTEA 4PSQA 2AF5A 2GTLM 4FBRA 4ZHGA 1EW3A 3OBLA 1A2DA 1ADLA 2WPUA 4R0BA 1SWEA 1LCVA 1WBIA 3FA8A 4BX7B 1NP4A 2I5VO 4HWMA 1AQBA 3UEVA 1K3BA 4Z2OA 3OD9A 5EPQA 2XSTA 1HBPA 1IFBA 3CR6A 2Z4IA 4HPBA 4TNNA 1PBYA 1MUPA 3H3IA 3RDMA 1AVGI 1Y9LA 2FR2A 2GC9A 1X8UA 3BSZE 5FAZA 4EXZA 3SAOA 1RLBE 3NADA 5B27A 1VYGA 2OY5O 1LICA 2CM9A 3EC5A 4WFVA 4FBVA 1KZWA 4N7DA 2OVSA 4BGFA 1Z24A 3X00A 3EM0A 1IIUA 2A3FX 1VWHB 2RTMA 4GE1A 4O3YA 3VG5A 4BBOA 5HTDA 3VHIA 3U0DA 4QAEA 2OL7A 1LNMA 4IMOA 1SLDB 2A5BA 2JW1A 2RTBB 1LDQA 3I0AA 4NYRA 4ZHFA 3AKNA 5HWZA 4IB9A 3ZW0A 1YWBA 1EALA 5H9KA 2G7BA 5JD2A 4OEMA 3VG2A 4NLIA 4Z6JA 2Q2MA 4ZR2A 3FW5A 2X55A 2Q9SA 5H9NA 2A13A 3RSWA 1KL3A 2Y3EA 1T0VA 2MM3A 1FDQA 3BU9A 4GKCA 4ZGFA 1EIOA 2LBAA 1QWDA 1EQDA 2OFAA 4DQ3A 5L3YA 4NV7A 2G5LA 1SWRA 2HZRA 4I3DA 2G8CO 4O4UA 4M7MA 2AL0X 1EPAA 1HN2A 2FS6A 1S7DA 1GX9A 2BS5A 2RTJA 3LV4A 4IBAA 4ML7B 4ORYA 4TJZA 2MF6A 3FIQA 4ZFXA 5LKEA 1CJ5A 2CZTA 3SLJA 3ZW2A 1JZUA 5D47A 4IAWA 2YMSA 3MM0A 4MVLA 3RY1A 1SRGA 2C1SA 4NNTA 3VE1A 4AZPA 1YP7A 1X71A 1ZNKA 3VPJE 2QO6A 4U46A 4ZHHA 4ORXA 5D4AA 4IB6A 2IZDB 1ALBA 1YIVA 4N7CA 4YFRA 1HBQA 1PBOA 1SWOA 1SY3A 2RTIB 2ZAGA 5D48A 2K62A 2RTQB 3KVNA 5F7GA 4D6BA 4FBOA 1ICNA 4ES7A 2GTLO 4JHQA 4LKTA 1MDCA 1G7NA 1JYJA 2W2AA 3UAQA 3WJEA 4QGVA 1Y52X 3I17A 5AEOA 4CPHB 1EUOA 4GDZA 2AT3X 4JNJA 1IW2A 3APWA 1BSOA 1UYOX 4UU2A 2CBRA 1LIDA 3NX1A 4A1HA 1KT4A 1JIWI 1STSB 2WSJA 1QFTA 1VWMB 4QZTA 1N0SA 1ICMA 1SWFA 3FELA 3HWFA 1OEKA 3Q34A 3IA8A 1ZNDA 4IRWA 2QCBA 2AMMX 1SWDA 3ZQ3A 4GU8A 2MJIA 1SLEB 2FGSA 4XMHA 5F6BA 2IZAA 1KXOA 2BSZA 2JN3A 2L68A 2OL8O 2AKQA 2IZEB 4LQZA 4YH0A 5LJCA 1S44A 3JS1A 1X8OA 1FTPA 1HMRA 1ZRYA 2FTBA 2MHDA 4KC7A 3O22A 1BJ7A 1A57A 1OBQA 1SY0A 1SWHA 1AB0A 3P6GA 5H9AA 1DZJA 2OY8A 4GZVA 1SWUA 5LJDA 4MISA 4AZNA 1STPA 1MEPA 1T68X 2HLVA 3KFIA 3RE5A 4NW4A 3HPEA 3FR2A 3STKA 2QMIA 4HPDA 1IFCA 4GGZA 1Y9TA 3FMZA 2ACPX 2X46A 1W4TA 4BX6B 5L8NA 2A5CA 5LKFA 3C77X 4Y59A 3VHMA 5IO7A 2WEWA 4O4XA 5DG4A 3EBWA 4U8UN 5F58A 2IZLB 3BY0A 2Q39A 4NV8A 4Z2PA 3WXQA 4YCHA 1I05A 1ZNLA 4IB8A 1SWJA 4YFQA 4DCBA 5CSEA 4YCEA 1LIFA 1SWTA 2GH7A 2BLGA 3AEHA 3RDUA 3S60A 3WJFA 3PEDA 5EDBA 1DF3A 1I06A 2FLJA 1KOIA 2RQ0A 4CPHA 4I9SA 1OEEA 1SWGA 4XMDA 2BT9A 2OL6O 1BM5A 1TOWA 2KD2A 3S26A 1DF8A 4AZRA 2HYSA 1EIIA 1SRIA 2BC3A 1TW4A 1DFVA 3SZIA 2OZQA 1GT4A 1SWCA 4QGXA 4Z2VA 1BRQA 1QFVA 2Y32A 1ACDA 1OBPA 2RTDB 2JU3A 5F6ZA 1RBPA 3WYPA 2C4IA 3V8UA 2KTSA 4KC8A 4U3QA 4HPAA 5IXGA 4ALBA 5B29A 1L6MA 2LB6A 3RY2A 1FJ1E 3EW1A 1LPJA 1OPAA 2OVDA 3B2HA 4ZGUA 2A0AA 3AKMA 2FKGA 1KT7A 2AVIA 2JU7A 2IZFB 2IZCB 4MEEA 4MVKA 1CBIA 4I3BA 1CBRA 2PI3O 4MVIA 2UYWA 3FA7A 3T2XA 4I3CA 2YG2A 3BX8A 2OY7A 1KT3A 1VWNB 1XKIA 2MWHA 4GJSA 3BLGA 2Q2PA 4O4SA 1SXYA 1E02A 1PMPA 4QQ1A 1HQQA 1U18A 3EBKA 1MX7A 4IB7A 2ASNX 3RDSA 5HZ9A 2WWPA 5F2BA 4A8ZA 1NDJA 4BX6A 1N9MA 5L8IA 1KQXA 4AZOA 5IO6A 5H9LA 1RXHA 3FA6A 3ZUIA 3RDQA 1YUPA 4EQAC 2WUTA 1KGLA 3FW4A 1FELA 3KQ0A 5K68A 1G74A 4GDAA 1JBHA 1OBUA 4BQUA 1U17A 4ALOA 2DM5A 2GTLN 4GJVA 3C76X 5H8TA 5HCEC 4ZHDA 4Y0SA 4FQBB 1RXJA 2G79A 2QM9A 4OMXA 4XMEA 1VWFB 1YP6A 1BSQA 5FENA 3WBGA 1TOUA 3F6ZB 2GJ5A 2IZIA 4KIIA 2ZSCA 2F09A 4ORRA 4MIRA 1A3YA 4LZUA 3PQUA 1TVQA 1IKEA 1DV9A 3VG6A 4QZUA 3ZZVA 4Z27A 3D4RA 2RA6A 3P24A 3VHHA 5D45A 1VWJB 1D2UA 3FIDA 3T2WA 4YMYA 2QOMA 5BYPA 1B4MA 1MM9A 2OVEA 1SWSA 4FGIB 3JQOA 2A2GA 1CBSA 2CBSA 4BX7A 4O3WA 2L9CA 2FR3A 1O1VA 4OS3A 3N91A 1AELA 3RBYA 3BRNA 1GGLA 1MK5A 1QY2A 2AT0X 2RTCB 1DZKA 3FENA 5AJCA 4BOEA 3CBCA 2HNXA 1LFOA 1Y53X 1BRPA 1EXSA 1STRB 3ZUOA 5FQ8E 3OE3A 1SXXA 2RTNB 4EEJA 3MVFA 1BEBA 5B3MO 1JV4A 3TF6A 4ID2A 1LDOA 2WR6A 3NPOA 4O9SA 3P6EA 5LJKA 1ERXA 1OEJA 4BX5B 3ELXA 1RXKA 1PM1X 3E3CA 4B55A 1SWPA 1SWKA 2RCQA 1B56A 1VWRB 3BX7A 1ZNHA 2FWVA 4KCAA 3KFFA 4ORWA 3WJCA 1KL5A 1A18A 1HMTA 2X45A 3CQNA 5EZ2A 3U9PC 5KHPA 4HFOA 4YKMA 4ARHA 4ZJ0A 3TGCA 3O19A 4HPCA 3WOVA 1SWBA 1QY1A 4AZQA 4TKHA 4NNSA 2L67A 5B10O 4PJ2A 2R56A 2OVAA 2JGSA 5CE4A 4GNYA 4INNA 3VG4A 4YFPA 1FE3A 3NX2A 4AZMA 3AUMO 3SZJA 4O3ZA 3ZW1B 5KIDA 1DC9A 1RAVA 2RTEB 4NYQA 1BWYA 1SXWA 4BVMA 4OS0A 2E4JA 2JOZA 2JU8A 1NGLA 1O1UA 5BVQA 2X4MA 1PEEA 1KFFA 3U03A 3F9DA 3STNA 1SWNA 5HA0A 3TGBA 1E5PA 5EDCA 1JMZA 5LJBA 3PP6A 1SXUA 1BSYA 2IZJA 4CSBA 4XMCA 1SMPI 1UZ2X 2RCTA 1H91A 2GTFX 4CPFA 5JR8A 3B2KA 2FS7A 3HWDA 3D95A 3RWXA 5FQ6E 1VYOA 3HTYA 4Y0PA 1B0OA 2WQAE 3UEWA 1SRJA 4I6SA 4XMFA 4BJ8A 2X34A 4YGHA 3PECA 4ZH6A 4CDDA 1LCZA 5HZ8A 4Y0QA 2LBVA 2X8FA 2RTOB 2NNQA 4KT5A 2X8TA 4BCSA 1N43A 4AW8A 1KZXA
chains in the Genus database with same CATH topology
2FGSA 3Q34A 1Y0GA 3HPEA 5IXGA 2X34A 2X32A 1WUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FGS A;  3Q34 A;  1Y0G A;  3HPE A;  5IXG A;  2X34 A;  2X32 A;  1WUB A; 
#chains in the Genus database with same CATH topology
 3PPT A;  2AT6 X;  1RST B;  1FEM A;  1LKE A;  1SWA A;  1NQN A;  3D9W A;  4I95 A;  4QGW A;  2NNE A;  4I60 A;  5HZ6 A;  4WHI A;  4AYH A;  2IFB A;  3SOT A;  3RDO A;  1YWC A;  2CAM A;  1E06 A;  4QYP A;  2X8S A;  1X8N A;  3ZW0 B;  1UYN X;  1E2T A;  1KT5 A;  1SA8 A;  2RTL A;  2DJG A;  1AVD A;  1WUB A;  1GT5 A;  2RD7 C;  3HWE A;  1XCA A;  2M4L A;  4CPI A;  1JMX A;  1NBX A;  1X89 A;  3Q6L A;  4GK9 A;  5AQ6 A;  2OFM X;  2WQ9 A;  3SLT A;  3TGA A;  4YGG A;  3T1D A;  2HKD A;  2VFB A;  4IAB A;  4QNI A;  3ZW1 A;  3SLO A;  3PQS A;  1HXL A;  3CMP A;  4LKP A;  1YWD A;  4CDF A;  5LJG A;  1RSU B;  3FEK A;  3VG3 A;  4Z28 A;  1QG5 A;  4JO6 A;  4YDA A;  2F73 A;  3DSZ A;  1CRB A;  1EPB A;  1GKA B;  1TXL A;  2KTD A;  3FYF A;  3LHN A;  4QRL A;  5DPQ A;  3STM X;  1W6F A;  3SZH A;  5D8J A;  2O62 A;  1Y0G A;  2KW1 A;  1LIB A;  1KL4 A;  3FDC A;  5EED A;  1URE A;  3ELZ A;  3GAQ A;  4XMG A;  1VWC B;  5K06 A;  2AT5 X;  1HQP A;  3WJD A;  1QQS A;  4IMN A;  4GGT A;  5KIC A;  5BVT A;  1LEL A;  3F8A A;  2LFO A;  1LUQ A;  3WZO A;  1JJJ A;  4U8U O;  4GUZ A;  4RUU A;  2QO5 A;  4O3X B;  3NBX X;  5FQ7 E;  2OY1 O;  1JYD A;  4DQ4 A;  1JJX A;  1FEN A;  1LCW A;  2POA A;  1IJ8 A;  1VWA B;  2IZH B;  3APX A;  3K3L A;  2BS6 A;  1JQP A;  3UEU A;  4GGR A;  2ZAI A;  4ZHC A;  3BDR A;  3CBS A;  1NP1 A;  1VWB B;  2FRS A;  1SY2 A;  5IRU A;  4O4O A;  4L3R A;  3IFB A;  4YGZ A;  1VWL B;  5HCD C;  4D6A A;  4KH8 A;  4Y5D A;  1SWL A;  1NQM A;  1IKJ A;  4OEL A;  4ORU A;  1VWO B;  3OJY C;  3VE2 A;  2UZ2 A;  2LKK A;  4COT A;  2RTA A;  3HOE A;  1LIE A;  2IZB A;  1X8P A;  3NR3 A;  5EEE A;  4IAX A;  2HZQ A;  3DTQ A;  4QYN A;  4GD9 A;  1VPR A;  4EFG A;  2FHN X;  3B2I A;  3KZA A;  3B2J A;  2FHL A;  1PTS A;  4EDE A;  5IRW A;  1DZP A;  2RTK A;  2N93 A;  3VU1 A;  1VWP B;  2Z4H A;  4M6S A;  3NP1 A;  1ZNE A;  3VGW A;  1GT1 A;  2K23 A;  1AVE A;  4JGL A;  1GKA A;  1GX3 A;  1KQW A;  1HMS A;  1VWK B;  1VYF A;  2C1Q A;  4MVE A;  2OF9 A;  5IRA A;  3WJG A;  3T6F A;  4ORS A;  1S2P A;  1R0U A;  1ML7 A;  1MVG A;  5HAE A;  4ZH9 A;  1CBQ A;  3WJB A;  1D3S A;  2RTH B;  3PK2 A;  1Y55 X;  2A8G A;  2I5Z O;  1OSP O;  3PH6 A;  1I78 A;  1GXA A;  1SWQ A;  3D96 A;  4TLJ A;  3WZQ A;  4GNW A;  1X8Q A;  1ERB A;  3D97 A;  1I4U A;  1MX8 A;  2ANS A;  1SRF A;  2W2F A;  1QY0 A;  3P6H A;  4NP1 A;  3APU A;  3CWK A;  3L4R A;  4A1Y A;  2X56 A;  1P6P A;  1I9H A;  1KT6 A;  1K24 A;  2AT8 X;  3LTW A;  3NQK A;  2OFR X;  1ZNG A;  1HY2 A;  3FR5 A;  4LZV A;  3FLL A;  5B11 O;  2AH7 X;  4EKV A;  2EU7 X;  4YBP A;  2Y3F A;  1W5R A;  1U0X A;  1GM6 A;  1YWA A;  2RTF B;  3GE2 A;  2IZG B;  4ZCB A;  2R74 A;  4WFU A;  4Y0R A;  3RZY A;  1I04 A;  3CKF A;  1EI5 A;  3EW2 A;  1VWI B;  2ALL X;  3HK1 A;  3KFH A;  4DNE A;  2OF8 A;  1OPB A;  4O49 A;  3WZN A;  3O2Y A;  1BBP A;  1NC9 A;  4U8U M;  3PH5 A;  2KT4 B;  2RTR B;  2VFC A;  3WVM A;  3ZI8 A;  2DJF A;  1SRH A;  4RUN A;  5LJH A;  4A60 A;  2CM4 A;  2OFB A;  3C78 X;  5B2A O;  2VDF A;  2G78 A;  1SY1 A;  3APV A;  5HZQ A;  5HZ5 A;  3WYQ A;  3RE6 A;  2NND A;  4TKB A;  3S5X A;  1VWG B;  3EYC A;  3MBT A;  4ODD A;  2RTP B;  3BU1 A;  3HOL A;  4ON1 A;  3TZS A;  1QAB E;  3CKG A;  3MG5 A;  3QKG A;  4NLJ A;  5HA1 A;  1G5W A;  3NQ3 A;  1VWD B;  1HXZ A;  1T8V A;  3FR4 A;  3WZP A;  2CZU A;  2QOS C;  3P6F A;  5L8O A;  1N7Y A;  2RN4 A;  3P02 A;  3ZWE A;  1SLF B;  4YVB A;  4OMW A;  3RKG A;  1BLR A;  3S5V A;  2XKL A;  3QQ2 A;  4CPE A;  3FA9 A;  4YKO A;  5AJB A;  4BX5 A;  2QO4 A;  4YBU A;  2Q4N A;  5F1E A;  3BS2 A;  2MO5 A;  5B5G A;  5K67 A;  2P8G A;  2A2U A;  2NP1 A;  1VWQ B;  4GH7 A;  4OS8 A;  2X32 A;  4L1N A;  2FT9 A;  2FKJ A;  4U9C A;  5LJE A;  2WEX A;  3G7X A;  5HCC C;  1JJU A;  4CV7 A;  2HMB A;  2RTG B;  3EMM A;  3NQ9 A;  4YDB A;  5IO5 A;  4TQ2 A;  3UEX A;  4I9R A;  5FFH A;  2LA7 A;  4CDE A;  1VWE B;  3RDX A;  1GT3 A;  5B5F A;  2PY1 A;  3HWG A;  1N4J A;  3PDF A;  5C0N A;  4WBK A;  3CQR A;  2JMB A;  3B2L A;  4GET A;  4K19 A;  3VG7 A;  1E00 A;  1MOY A;  4TKJ A;  5CYB A;  3KFG A;  4OKA A;  1G85 A;  2R73 A;  2OYB O;  4C5P A;  3T6L A;  1SLG B;  3MX7 A;  3P6C A;  1B8E A;  2IZK A;  5CHK A;  4CK4 A;  4UU3 A;  3JSQ A;  1DZM A;  4GRJ A;  2F01 A;  1GX8 A;  5HBS A;  3FEP A;  1SRE A;  1N9Y A;  1LF7 A;  2ACO A;  5BVS A;  4CDC A;  1O8V A;  2BHV A;  2L5P A;  2W2B A;  3P6D A;  5HTE A;  4PSQ A;  2AF5 A;  2GTL M;  4FBR A;  4ZHG A;  1EW3 A;  3OBL A;  1A2D A;  1ADL A;  2WPU A;  4R0B A;  1SWE A;  1LCV A;  1WBI A;  3FA8 A;  4BX7 B;  1NP4 A;  2I5V O;  4HWM A;  1AQB A;  3UEV A;  1K3B A;  4Z2O A;  3OD9 A;  5EPQ A;  2XST A;  1HBP A;  1IFB A;  3CR6 A;  2Z4I A;  4HPB A;  4TNN A;  1PBY A;  1MUP A;  3H3I A;  3RDM A;  1AVG I;  1Y9L A;  2FR2 A;  2GC9 A;  1X8U A;  3BSZ E;  5FAZ A;  4EXZ A;  3SAO A;  1RLB E;  3NAD A;  5B27 A;  1VYG A;  2OY5 O;  1LIC A;  2CM9 A;  3EC5 A;  4WFV A;  4FBV A;  1KZW A;  4N7D A;  2OVS A;  4BGF A;  1Z24 A;  3X00 A;  3EM0 A;  1IIU A;  2A3F X;  1VWH B;  2RTM A;  4GE1 A;  4O3Y A;  3VG5 A;  4BBO A;  5HTD A;  3VHI A;  3U0D A;  4QAE A;  2OL7 A;  1LNM A;  4IMO A;  1SLD B;  2A5B A;  2JW1 A;  2RTB B;  1LDQ A;  3I0A A;  4NYR A;  4ZHF A;  3AKN A;  5HWZ A;  4IB9 A;  3ZW0 A;  1YWB A;  1EAL A;  5H9K A;  2G7B A;  5JD2 A;  4OEM A;  3VG2 A;  4NLI A;  4Z6J A;  2Q2M A;  4ZR2 A;  3FW5 A;  2X55 A;  2Q9S A;  5H9N A;  2A13 A;  3RSW A;  1KL3 A;  2Y3E A;  1T0V A;  2MM3 A;  1FDQ A;  3BU9 A;  4GKC A;  4ZGF A;  1EIO A;  2LBA A;  1QWD A;  1EQD A;  2OFA A;  4DQ3 A;  5L3Y A;  4NV7 A;  2G5L A;  1SWR A;  2HZR A;  4I3D A;  2G8C O;  4O4U A;  4M7M A;  2AL0 X;  1EPA A;  1HN2 A;  2FS6 A;  1S7D A;  1GX9 A;  2BS5 A;  2RTJ A;  3LV4 A;  4IBA A;  4ML7 B;  4ORY A;  4TJZ A;  2MF6 A;  3FIQ A;  4ZFX A;  5LKE A;  1CJ5 A;  2CZT A;  3SLJ A;  3ZW2 A;  1JZU A;  5D47 A;  4IAW A;  2YMS A;  3MM0 A;  4MVL A;  3RY1 A;  1SRG A;  2C1S A;  4NNT A;  3VE1 A;  4AZP A;  1YP7 A;  1X71 A;  1ZNK A;  3VPJ E;  2QO6 A;  4U46 A;  4ZHH A;  4ORX A;  5D4A A;  4IB6 A;  2IZD B;  1ALB A;  1YIV A;  4N7C A;  4YFR A;  1HBQ A;  1PBO A;  1SWO A;  1SY3 A;  2RTI B;  2ZAG A;  5D48 A;  2K62 A;  2RTQ B;  3KVN A;  5F7G A;  4D6B A;  4FBO A;  1ICN A;  4ES7 A;  2GTL O;  4JHQ A;  4LKT A;  1MDC A;  1G7N A;  1JYJ A;  2W2A A;  3UAQ A;  3WJE A;  4QGV A;  1Y52 X;  3I17 A;  5AEO A;  4CPH B;  1EUO A;  4GDZ A;  2AT3 X;  4JNJ A;  1IW2 A;  3APW A;  1BSO A;  1UYO X;  4UU2 A;  2CBR A;  1LID A;  3NX1 A;  4A1H A;  1KT4 A;  1JIW I;  1STS B;  2WSJ A;  1QFT A;  1VWM B;  4QZT A;  1N0S A;  1ICM A;  1SWF A;  3FEL A;  3HWF A;  1OEK A;  3Q34 A;  3IA8 A;  1ZND A;  4IRW A;  2QCB A;  2AMM X;  1SWD A;  3ZQ3 A;  4GU8 A;  2MJI A;  1SLE B;  2FGS A;  4XMH A;  5F6B A;  2IZA A;  1KXO A;  2BSZ A;  2JN3 A;  2L68 A;  2OL8 O;  2AKQ A;  2IZE B;  4LQZ A;  4YH0 A;  5LJC A;  1S44 A;  3JS1 A;  1X8O A;  1FTP A;  1HMR A;  1ZRY A;  2FTB A;  2MHD A;  4KC7 A;  3O22 A;  1BJ7 A;  1A57 A;  1OBQ A;  1SY0 A;  1SWH A;  1AB0 A;  3P6G A;  5H9A A;  1DZJ A;  2OY8 A;  4GZV A;  1SWU A;  5LJD A;  4MIS A;  4AZN A;  1STP A;  1MEP A;  1T68 X;  2HLV A;  3KFI A;  3RE5 A;  4NW4 A;  3HPE A;  3FR2 A;  3STK A;  2QMI A;  4HPD A;  1IFC A;  4GGZ A;  1Y9T A;  3FMZ A;  2ACP X;  2X46 A;  1W4T A;  4BX6 B;  5L8N A;  2A5C A;  5LKF A;  3C77 X;  4Y59 A;  3VHM A;  5IO7 A;  2WEW A;  4O4X A;  5DG4 A;  3EBW A;  4U8U N;  5F58 A;  2IZL B;  3BY0 A;  2Q39 A;  4NV8 A;  4Z2P A;  3WXQ A;  4YCH A;  1I05 A;  1ZNL A;  4IB8 A;  1SWJ A;  4YFQ A;  4DCB A;  5CSE A;  4YCE A;  1LIF A;  1SWT A;  2GH7 A;  2BLG A;  3AEH A;  3RDU A;  3S60 A;  3WJF A;  3PED A;  5EDB A;  1DF3 A;  1I06 A;  2FLJ A;  1KOI A;  2RQ0 A;  4CPH A;  4I9S A;  1OEE A;  1SWG A;  4XMD A;  2BT9 A;  2OL6 O;  1BM5 A;  1TOW A;  2KD2 A;  3S26 A;  1DF8 A;  4AZR A;  2HYS A;  1EII A;  1SRI A;  2BC3 A;  1TW4 A;  1DFV A;  3SZI A;  2OZQ A;  1GT4 A;  1SWC A;  4QGX A;  4Z2V A;  1BRQ A;  1QFV A;  2Y32 A;  1ACD A;  1OBP A;  2RTD B;  2JU3 A;  5F6Z A;  1RBP A;  3WYP A;  2C4I A;  3V8U A;  2KTS A;  4KC8 A;  4U3Q A;  4HPA A;  5IXG A;  4ALB A;  5B29 A;  1L6M A;  2LB6 A;  3RY2 A;  1FJ1 E;  3EW1 A;  1LPJ A;  1OPA A;  2OVD A;  3B2H A;  4ZGU A;  2A0A A;  3AKM A;  2FKG A;  1KT7 A;  2AVI A;  2JU7 A;  2IZF B;  2IZC B;  4MEE A;  4MVK A;  1CBI A;  4I3B A;  1CBR A;  2PI3 O;  4MVI A;  2UYW A;  3FA7 A;  3T2X A;  4I3C A;  2YG2 A;  3BX8 A;  2OY7 A;  1KT3 A;  1VWN B;  1XKI A;  2MWH A;  4GJS A;  3BLG A;  2Q2P A;  4O4S A;  1SXY A;  1E02 A;  1PMP A;  4QQ1 A;  1HQQ A;  1U18 A;  3EBK A;  1MX7 A;  4IB7 A;  2ASN X;  3RDS A;  5HZ9 A;  2WWP A;  5F2B A;  4A8Z A;  1NDJ A;  4BX6 A;  1N9M A;  5L8I A;  1KQX A;  4AZO A;  5IO6 A;  5H9L A;  1RXH A;  3FA6 A;  3ZUI A;  3RDQ A;  1YUP A;  4EQA C;  2WUT A;  1KGL A;  3FW4 A;  1FEL A;  3KQ0 A;  5K68 A;  1G74 A;  4GDA A;  1JBH A;  1OBU A;  4BQU A;  1U17 A;  4ALO A;  2DM5 A;  2GTL N;  4GJV A;  3C76 X;  5H8T A;  5HCE C;  4ZHD A;  4Y0S A;  4FQB B;  1RXJ A;  2G79 A;  2QM9 A;  4OMX A;  4XME A;  1VWF B;  1YP6 A;  1BSQ A;  5FEN A;  3WBG A;  1TOU A;  3F6Z B;  2GJ5 A;  2IZI A;  4KII A;  2ZSC A;  2F09 A;  4ORR A;  4MIR A;  1A3Y A;  4LZU A;  3PQU A;  1TVQ A;  1IKE A;  1DV9 A;  3VG6 A;  4QZU A;  3ZZV A;  4Z27 A;  3D4R A;  2RA6 A;  3P24 A;  3VHH A;  5D45 A;  1VWJ B;  1D2U A;  3FID A;  3T2W A;  4YMY A;  2QOM A;  5BYP A;  1B4M A;  1MM9 A;  2OVE A;  1SWS A;  4FGI B;  3JQO A;  2A2G A;  1CBS A;  2CBS A;  4BX7 A;  4O3W A;  2L9C A;  2FR3 A;  1O1V A;  4OS3 A;  3N91 A;  1AEL A;  3RBY A;  3BRN A;  1GGL A;  1MK5 A;  1QY2 A;  2AT0 X;  2RTC B;  1DZK A;  3FEN A;  5AJC A;  4BOE A;  3CBC A;  2HNX A;  1LFO A;  1Y53 X;  1BRP A;  1EXS A;  1STR B;  3ZUO A;  5FQ8 E;  3OE3 A;  1SXX A;  2RTN B;  4EEJ A;  3MVF A;  1BEB A;  5B3M O;  1JV4 A;  3TF6 A;  4ID2 A;  1LDO A;  2WR6 A;  3NPO A;  4O9S A;  3P6E A;  5LJK A;  1ERX A;  1OEJ A;  4BX5 B;  3ELX A;  1RXK A;  1PM1 X;  3E3C A;  4B55 A;  1SWP A;  1SWK A;  2RCQ A;  1B56 A;  1VWR B;  3BX7 A;  1ZNH A;  2FWV A;  4KCA A;  3KFF A;  4ORW A;  3WJC A;  1KL5 A;  1A18 A;  1HMT A;  2X45 A;  3CQN A;  5EZ2 A;  3U9P C;  5KHP A;  4HFO A;  4YKM A;  4ARH A;  4ZJ0 A;  3TGC A;  3O19 A;  4HPC A;  3WOV A;  1SWB A;  1QY1 A;  4AZQ A;  4TKH A;  4NNS A;  2L67 A;  5B10 O;  4PJ2 A;  2R56 A;  2OVA A;  2JGS A;  5CE4 A;  4GNY A;  4INN A;  3VG4 A;  4YFP A;  1FE3 A;  3NX2 A;  4AZM A;  3AUM O;  3SZJ A;  4O3Z A;  3ZW1 B;  5KID A;  1DC9 A;  1RAV A;  2RTE B;  4NYQ A;  1BWY A;  1SXW A;  4BVM A;  4OS0 A;  2E4J A;  2JOZ A;  2JU8 A;  1NGL A;  1O1U A;  5BVQ A;  2X4M A;  1PEE A;  1KFF A;  3U03 A;  3F9D A;  3STN A;  1SWN A;  5HA0 A;  3TGB A;  1E5P A;  5EDC A;  1JMZ A;  5LJB A;  3PP6 A;  1SXU A;  1BSY A;  2IZJ A;  4CSB A;  4XMC A;  1SMP I;  1UZ2 X;  2RCT A;  1H91 A;  2GTF X;  4CPF A;  5JR8 A;  3B2K A;  2FS7 A;  3HWD A;  3D95 A;  3RWX A;  5FQ6 E;  1VYO A;  3HTY A;  4Y0P A;  1B0O A;  2WQA E;  3UEW A;  1SRJ A;  4I6S A;  4XMF A;  4BJ8 A;  2X34 A;  4YGH A;  3PEC A;  4ZH6 A;  4CDD A;  1LCZ A;  5HZ8 A;  4Y0Q A;  2LBV A;  2X8F A;  2RTO B;  2NNQ A;  4KT5 A;  2X8T A;  4BCS A;  1N43 A;  4AW8 A;  1KZX A; 
#chains in the Genus database with same CATH homology
 2FGS A;  3Q34 A;  1Y0G A;  3HPE A;  5IXG A;  2X34 A;  2X32 A;  1WUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...