5IXGA

Crystal structure of burkholderia cenocepacia bcnb
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
168
structure length
168
Chain Sequence
ATYQFDPSHTYPSFEADHFGGLSVWRGKFDKSSGTVTLDRAAKTGTVDVTTDIASIHTGSAKLDEHLQTAEFFDAAKFPQANYKGTIKFDGDKPVSVVGNLTLHGVTKPLTLKIDSFKCMPHPMLKREVCGVDAVGEFSRDDFGLDYGKQYGFKMKTKLLITAEAVKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YceI
publication title Antibiotic Capture by Bacterial Lipocalins Uncovers an Extracellular Mechanism of Intrinsic Antibiotic Resistance.
pubmed doi rcsb
source organism Burkholderia cenocepacia pc184
molecule tags Unknown function
total genus 43
structure length 168
sequence length 168
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04264 YceI YceI-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.110 Mainly Beta Beta Barrel Lipocalin Lipid/polyisoprenoid-binding, YceI-like 5ixgA00
3HPEA 2X32A 1Y0GA 3Q34A 2FGSA 2X34A 1WUBA 5IXGA
chains in the Genus database with same CATH superfamily
2A3FX 2X55A 2W2BA 3FELA 4I3BA 3I0AA 4RUUA 5FQ6E 5H9AA 2ANSA 3ZW0B 2RTEB 1SRFA 2RTOB 4TLJA 1B8EA 5F7GA 3P6FA 3ZI8A 3MBTA 3BY0A 1STPA 2PY1A 3CBCA 1DV9A 2LB6A 1A57A 4ZHDA 4GNWA 4WHIA 5JR8A 4YH0A 2IZKA 1JYDA 1BWYA 1IW2A 3X00A 1SWNA 4U9CA 1D3SA 4IMNA 1SWAA 1Y9TA 4WFVA 4BJ8A 1LIBA 2X4MA 4BX7B 1S7DA 1A2DA 1LNMA 1I78A 4ARHA 1W5RA 4LQZA 3SAOA 3ZQ3A 4DNEA 1KT7A 2N93A 4FGIB 1D2UA 5LJKA 2OY5O 1LDOA 2L9CA 2FRSA 1GX3A 1YUPA 2NNDA 3HOEA 2KD2A 4I95A 2X45A 1SWOA 3AUMO 3PP6A 3Q6LA 4O4UA 1JZUA 4IAWA 4DQ3A 4KCAA 1I05A 1LCZA 1IFCA 1O8VA 1TOWA 4ON1A 5JD2A 2K23A 5LJHA 5L8NA 4HPAA 3ZW1B 5LJGA 4NNSA 4R0BA 1KL3A 3T2XA 5HZ6A 2OFAA 3RSWA 1VWHB 1DZKA 2HNXA 2R56A 3ZWEA 2L5PA 5EEEA 2JW1A 1X71A 2A2GA 3D4RA 3RE5A 4KC7A 4GJSA 3D95A 1UYNX 3VG6A 3PPTA 1B4MA 4OKAA 1HXLA 2QCBA 4XMGA 4I60A 4YBUA 1SXYA 4L3RA 4GK9A 3APVA 1MEPA 1PM1X 3T2WA 3HOLA 4AZPA 3D9WA 4Z28A 1N7YA 2BC3A 5HZ8A 2JU3A 3P02A 4GGZA 2RTRB 4LZUA 2IZBA 3C78X 1DZPA 4ID2A 3ZW0A 4ORSA 2C1QA 2AH7X 3CWKA 1HBPA 4I3CA 4M7MA 3CQNA 4PJ2A 1JMZA 4GUZA 4XMCA 4MVLA 4QGWA 2WWPA 3WZQA 3H3IA 5EPQA 5KIDA 3BX7A 1NC9A 2LKKA 2O62A 1E2TA 1MDCA 1T8VA 4Z27A 4AZNA 3KFHA 2FS7A 2HKDA 2UYWA 4EKVA 1HBQA 1SWBA 2RA6A 2FR2A 3VHHA 1CBIA 4YGHA 1SLDB 3SZJA 5B29A 1E00A 4JGLA 2WQ9A 4Y0RA 5FAZA 1I9HA 4ZHHA 1SXUA 2NP1A 2Q4NA 1KFFA 1NBXA 2K62A 3NX1A 3RKGA 3AKNA 1SREA 2DJFA 2FWVA 3L4RA 3PH6A 5IO7A 1H91A 4JO6A 2RTLA 2ACPX 1Y53X 3T6LA 3LTWA 1STRB 1NP4A 1GX8A 4O9SA 3O2YA 3WJBA 2OFMX 4OELA 4NW4A 1BLRA 2DJGA 2GTLN 3FR5A 4K19A 2MHDA 4IB7A 2OZQA 3VHMA 2A13A 3GAQA 4BGFA 2QO6A 2YG2A 5HZ5A 2HZQA 3CKFA 3RY2A 1ERBA 1ZNGA 4WFUA 5LJEA 4INNA 4COTA 1I4UA 1SWGA 1EW3A 1S2PA 5B5GA 4MEEA 1LIEA 1Y9LA 2Y3FA 1OPBA 1SY1A 3FA9A 4ZFXA 3VG4A 5LJDA 1ZNDA 1EI5A 2R74A 3K3LA 4ZGFA 3DTQA 3D97A 1LPJA 1RBPA 4U46A 1OBUA 4YMYA 4GGTA 4GRJA 1JBHA 2RTJA 1TVQA 4QNIA 1VWNB 3NP1A 5D47A 1LDQA 3RDQA 3O19A 3MM0A 1N43A 2IZHB 5DG4A 3FA6A 2OFBA 2BS5A 2QMIA 1EIIA 3KFGA 5BVSA 2OY7A 1GT1A 1SA8A 1Y0GA 2CM4A 3EW2A 3WBGA 4CK4A 2IZCB 4EXZA 2G5LA 5B5FA 3T6FA 1KZWA 3WZNA 2E4JA 4TKHA 3WJGA 1HMRA 1SLGB 2X8SA 1KT6A 2AT8X 3TZSA 3VG7A 1PMPA 4GETA 4YVBA 3FIQA 4IB9A 1VWCB 1BRPA 2IZDB 2W2FA 4KC8A 2JGSA 3VE1A 4BVMA 4FBRA 3VPJE 2C4IA 2F73A 2I5VO 1VWIB 1OPAA 1SXWA 2Q2PA 5HA1A 4KIIA 3TGAA 1A3YA 4YFPA 3WYQA 1RXHA 1QABE 2GTFX 4EDEA 3HWEA 2RQ0A 2G78A 2WSJA 2AT3X 2RTPB 5HBSA 1IKEA 1ALBA 1GKAB 2FTBA 1OBPA 2JU8A 1ADLA 4Y5DA 4D6BA 2MO5A 3LV4A 1TW4A 4A1YA 4CPEA 3U9PC 1E5PA 3HPEA 2GC9A 3BSZE 4LKPA 5AEOA 1U18A 3B2IA 2RTNB 1MX7A 1JJJA 4Z2VA 4DQ4A 4QZTA 5HZQA 1QY2A 1MUPA 2A2UA 5HAEA 4U3QA 3HWDA 4BOEA 3NQ3A 3HTYA 4NNTA 3F9DA 3APXA 2CBRA 1VYFA 3BLGA 4HPDA 1K3BA 1X8OA 1QQSA 3HWGA 1CBSA 4FQBB 2ACOA 3NR3A 5H9NA 4NV7A 5FENA 3UEVA 3UAQA 2POAA 1RSUB 4YGZA 2FGSA 3UEWA 4GE1A 1VWFB 1OBQA 2RCQA 3P6HA 4OS8A 3S5VA 4JHQA 2RTGB 4JNJA 5F58A 4AW8A 3EMMA 1JJXA 2IZGB 2MWHA 2G7BA 5AJCA 2HZRA 2Q9SA 2ALLX 3V8UA 1QY1A 4ZHFA 2AVIA 2P8GA 1O1VA 2QO5A 4A60A 1EIOA 4CDFA 2RTIB 1FELA 4L1NA 2OVSA 2CAMA 2X56A 3HK1A 4MVEA 3SLOA 5LJCA 1MK5A 1AVEA 1OSPO 2AL0X 5F6BA 5DPQA 3JQOA 3U03A 2MF6A 4IBAA 2JN3A 5HTDA 4EQAC 1LKEA 2ZAIA 2CZTA 1VYGA 4QGVA 2X8TA 4TNNA 1RAVA 3TF6A 1YWBA 2FHLA 1SY3A 2YMSA 3JS1A 3KFFA 2UZ2A 4ZHGA 4IB8A 3HWFA 4C5PA 2RTHB 2KT4B 1GX9A 1HQPA 4I6SA 1KT3A 1SWLA 3FA8A 3O22A 2OY8A 3CBSA 4O3YA 1SLEB 1LIDA 2CBSA 1GKAA 4IRWA 3WJDA 3VG2A 4A1HA 5BYPA 2F09A 4OS3A 3SLTA 5HA0A 3OD9A 3NX2A 3JSQA 1EXSA 1W4TA 3CKGA 2AF5A 1PBYA 4NYRA 1BSYA 5BVQA 4QRLA 2RTBB 3WVMA 2RCTA 1N4JA 4GU8A 4MIRA 1PTSA 4NV8A 4U8UO 4YFQA 5D8JA 3SZIA 1AB0A 2GH7A 2Q39A 5L8IA 5IXGA 2LFOA 4YDBA 4AYHA 1JV4A 2OY1O 3P6EA 1FTPA 3PDFA 5HCDC 5L3YA 3P6DA 1ZNEA 1TOUA 4GNYA 3WZPA 4XMHA 2EU7X 2Z4HA 3IFBA 1XCAA 3FW5A 4UU2A 5IRUA 5BVTA 1G74A 1FE3A 1JQPA 1SWQA 2HLVA 3B2JA 4FBOA 4QYNA 1SRGA 1ZNHA 4YKOA 5F6ZA 3SZHA 4GD9A 2Y32A 2C1SA 4GKCA 4TQ2A 5FQ8E 3WZOA 3ELZA 2Q2MA 3BU9A 1AQBA 1ICMA 4Y59A 4AZQA 2JOZA 4IABA 4YGGA 2RTDB 4YCHA 1AVGI 4I9SA 3KZAA 5CHKA 5D48A 4CSBA 4U8UM 2GTLO 4ZJ0A 1MOYA 1G85A 2DM5A 2WEXA 2OVEA 4Y0QA 3TGCA 3NQ9A 4ORYA 4CPIA 4N7CA 1SY0A 1HN2A 3BX8A 4CDDA 5LKEA 1AVDA 1CBQA 3APWA 4HFOA 4ODDA 4ORXA 3WJEA 3EBKA 1GM6A 5FFHA 1ERXA 1RXKA 3PEDA 2JU7A 5KHPA 3TGBA 1UYOX 1S44A 1P6PA 4O4OA 1KXOA 2QO4A 3BRNA 3F8AA 1LIFA 2PI3O 4IB6A 2IZIA 3FLLA 2GJ5A 2KW1A 4IMOA 1NQMA 4PSQA 5IRWA 2WUTA 3FENA 1FDQA 1SWJA 3FYFA 1IIUA 2Z4IA 4NYQA 1EPBA 2A5CA 2WQAE 3P6GA 2LBAA 3E3CA 2JMBA 2OVDA 4GZVA 3RDXA 1QY0A 1SWEA 3CR6A 1FJ1E 1GGLA 2AMMX 3OBLA 5D4AA 4GGRA 5EEDA 4YFRA 4ALBA 2OL6O 3AKMA 2KTDA 4BBOA 4MISA 4QQ1A 2BHVA 2GTLM 2RTKA 4NLJA 1BSQA 1SRIA 4GDAA 1EQDA 3RE6A 2BSZA 3PH5A 2VFCA 2RTAA 1VWBB 4RUNA 1UREA 3FR2A 1VPRA 1R0UA 1HY2A 5HCEC 3FEKA 1U0XA 4QYPA 1KZXA 2Y3EA 4ES7A 3PQSA 3KVNA 3OE3A 2F01A 2ZSCA 4NP1A 1BEBA 3WYPA 4XMEA 1PBOA 1DZJA 4EEJA 1A18A 1L6MA 1VWGB 5F1EA 1SMPI 4Z2OA 3MVFA 1VWEB 2XSTA 5H9KA 4ALOA 3QKGA 2VDFA 1KT4A 1X89A 5CE4A 1VWLB 3C77X 3NADA 5EDCA 3FR4A 4ZCBA 1SWKA 1E02A 3GE2A 1PEEA 2FT9A 2AKQA 4DCBA 4OS0A 5L8OA 1YWCA 3D96A 3P6CA 4XMFA 4YKMA 4D6AA 2MJIA 4ZHCA 4ZH6A 1LF7A 3STMX 3VG3A 3VU1A 2RTCB 3FIDA 4Y0PA 1VWPB 2LBVA 4HWMA 3FDCA 5B11O 3RZYA 1RXJA 3FA7A 3STNA 2X34A 1BM5A 1YP7A 4O4XA 1G7NA 2G8CO 2IFBA 2MM3A 3IA8A 1CJ5A 2X46A 4GJVA 1KL4A 3EM0A 1JMXA 2RD7C 2ZAGA 4UU3A 1BSOA 4YCEA 2QOSC 5AJBA 2BLGA 3MX7A 3DSZA 1X8QA 4ZH9A 1DZMA 4M6SA 4TKBA 4OMXA 5B27A 5C0NA 1ACDA 3EYCA 2M4LA 5IO5A 4MVIA 4O3ZA 1SWTA 5K06A 2WR6A 4LKTA 4WBKA 1VWJB 2WPUA 5FQ7E 2FR3A 1JYJA 2CM9A 1DC9A 1I06A 1DF8A 1HQQA 1MM9A 1OEKA 2A5BA 3BS2A 1VYOA 3KFIA 1B56A 4O3XB 1G5WA 3RY1A 1ZNKA 3STKA 2OFRX 1SWCA 4CPHB 5B10O 1UZ2X 1T0VA 4OEMA 4BCSA 3C76X 4QGXA 2I5ZO 3RDOA 4XMDA 1U17A 4IAXA 4LZVA 1T68X 4BX6B 3U0DA 3LHNA 3Q34A 1RLBE 1SWSA 1EPAA 4ML7B 4O4SA 1IFBA 5EDBA 4ZGUA 4Z2PA 2KTSA 1OEEA 3ZUIA 1YIVA 2IZAA 4Y0SA 1BJ7A 1KOIA 1W6FA 1ZRYA 3RDMA 3N91A 1LICA 3B2HA 1NGLA 2FS6A 5HTEA 4AZOA 3PECA 1K24A 4BX5B 1LCWA 1YWAA 3VE2A 1MX8A 1MVGA 1QFVA 4HPCA 1SY2A 1VWQB 1LUQA 4KT5A 3SOTA 1QWDA 3VHIA 1GT5A 1E06A 5B2AO 1LELA 1BBPA 1QG5A 3B2LA 5K68A 3S26A 3WJFA 1DF3A 5CYBA 3B2KA 2FKJA 1Y52X 3BDRA 2L67A 4TJZA 5K67A 5H8TA 1STSB 4OMWA 3S5XA 3SLJA 3ZUOA 3NBXX 5HWZA 3UEXA 1X8UA 4YDAA 2FLJA 2OVAA 2FKGA 3T1DA 1CRBA 4TKJA 1VWRB 2AT6X 2X8FA 4U8UN 1NP1A 3OJYC 1ML7A 4AZMA 1GT3A 3BU1A 1LFOA 2LA7A 3CQRA 4FBVA 4ORWA 2ASNX 4CV7A 1IKJA 1SWHA 4BX7A 5EZ2A 4GH7A 1SRHA 5KICA 3PQUA 1OEJA 3AEHA 3RDUA 2NNQA 2RTQB 2G79A 2NNEA 4ORRA 2OL8O 4Z6JA 3NPOA 1DFVA 1FEMA 1GXAA 1HMSA 1SLFB 2A0AA 3G7XA 4CDEA 3FW4A 1NQNA 1KT5A 2OL7A 4HPBA 2FHNX 2RTFB 4EFGA 4CPHA 3VGWA 4AZRA 5F2BA 3UEUA 3ZW1A 1X8NA 4BX6A 4MVKA 1I04A 1SWDA 1ZNLA 1N9MA 3F6ZB 4KH8A 2RTMA 2WEWA 3WJCA 2HYSA 1VWAB 1QFTA 2VFBA 5HZ9A 1TXLA 1B0OA 3MG5A 2OF8A 3EBWA 3EC5A 5AQ6A 4QZUA 2OF9A 5LKFA 1Y55X 3ZZVA 3VG5A 1SXXA 4N7DA 5H9LA 1O1UA 3RDSA 2IZFB 2IZLB 3EW1A 2IZEB 4NLIA 3WOVA 4BX5A 2HMBA 4O49A 1JJUA 3I17A 2AT0X 1N9YA 1SWFA 1VWOB 1HXZA 2CZUA 1VWMB 1VWDB 3FEPA 1CBRA 4GDZA 5CSEA 2OYBO 4B55A 4CDCA 5LJBA 1KGLA 2IZJA 3P24A 2W2AA 5B3MO 3FMZA 1SRJA 1GT4A 3KQ0A 3RBYA 1ICNA 3PK2A 1Z24A 1N0SA 1SWUA 2AT5X 2QM9A 4I3DA 3WXQA 4BQUA 1WUBA 2QOMA 2A8GA 3ZW2A 1SWPA 3RWXA 1EALA 1VWKB 4YBPA 1LCVA 1HMTA 1YP6A 1KL5A 4O3WA 3QQ2A 2R73A 4CPFA 1JIWI 3NQKA 5D45A 1X8PA 4ZR2A 1KQWA 3CMPA 3APUA 1FENA 4I9RA 4ORUA 1EUOA 2XKLA 1AELA 1BRQA 4QAEA 1YWDA 4A8ZA 2L68A 1XKIA 1KQXA 1RSTB 1SWRA 2RN4A 2X32A 3S60A 1IJ8A 2BS6A 1NDJA 2BT9A 3ELXA 1WBIA 5IRAA 5IO6A 5HCCC
chains in the Genus database with same CATH topology
3HPEA 2X32A 1Y0GA 3Q34A 2FGSA 2X34A 1WUBA 5IXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HPE A;  2X32 A;  1Y0G A;  3Q34 A;  2FGS A;  2X34 A;  1WUB A;  5IXG A; 
#chains in the Genus database with same CATH topology
 2A3F X;  2X55 A;  2W2B A;  3FEL A;  4I3B A;  3I0A A;  4RUU A;  5FQ6 E;  5H9A A;  2ANS A;  3ZW0 B;  2RTE B;  1SRF A;  2RTO B;  4TLJ A;  1B8E A;  5F7G A;  3P6F A;  3ZI8 A;  3MBT A;  3BY0 A;  1STP A;  2PY1 A;  3CBC A;  1DV9 A;  2LB6 A;  1A57 A;  4ZHD A;  4GNW A;  4WHI A;  5JR8 A;  4YH0 A;  2IZK A;  1JYD A;  1BWY A;  1IW2 A;  3X00 A;  1SWN A;  4U9C A;  1D3S A;  4IMN A;  1SWA A;  1Y9T A;  4WFV A;  4BJ8 A;  1LIB A;  2X4M A;  4BX7 B;  1S7D A;  1A2D A;  1LNM A;  1I78 A;  4ARH A;  1W5R A;  4LQZ A;  3SAO A;  3ZQ3 A;  4DNE A;  1KT7 A;  2N93 A;  4FGI B;  1D2U A;  5LJK A;  2OY5 O;  1LDO A;  2L9C A;  2FRS A;  1GX3 A;  1YUP A;  2NND A;  3HOE A;  2KD2 A;  4I95 A;  2X45 A;  1SWO A;  3AUM O;  3PP6 A;  3Q6L A;  4O4U A;  1JZU A;  4IAW A;  4DQ3 A;  4KCA A;  1I05 A;  1LCZ A;  1IFC A;  1O8V A;  1TOW A;  4ON1 A;  5JD2 A;  2K23 A;  5LJH A;  5L8N A;  4HPA A;  3ZW1 B;  5LJG A;  4NNS A;  4R0B A;  1KL3 A;  3T2X A;  5HZ6 A;  2OFA A;  3RSW A;  1VWH B;  1DZK A;  2HNX A;  2R56 A;  3ZWE A;  2L5P A;  5EEE A;  2JW1 A;  1X71 A;  2A2G A;  3D4R A;  3RE5 A;  4KC7 A;  4GJS A;  3D95 A;  1UYN X;  3VG6 A;  3PPT A;  1B4M A;  4OKA A;  1HXL A;  2QCB A;  4XMG A;  4I60 A;  4YBU A;  1SXY A;  4L3R A;  4GK9 A;  3APV A;  1MEP A;  1PM1 X;  3T2W A;  3HOL A;  4AZP A;  3D9W A;  4Z28 A;  1N7Y A;  2BC3 A;  5HZ8 A;  2JU3 A;  3P02 A;  4GGZ A;  2RTR B;  4LZU A;  2IZB A;  3C78 X;  1DZP A;  4ID2 A;  3ZW0 A;  4ORS A;  2C1Q A;  2AH7 X;  3CWK A;  1HBP A;  4I3C A;  4M7M A;  3CQN A;  4PJ2 A;  1JMZ A;  4GUZ A;  4XMC A;  4MVL A;  4QGW A;  2WWP A;  3WZQ A;  3H3I A;  5EPQ A;  5KID A;  3BX7 A;  1NC9 A;  2LKK A;  2O62 A;  1E2T A;  1MDC A;  1T8V A;  4Z27 A;  4AZN A;  3KFH A;  2FS7 A;  2HKD A;  2UYW A;  4EKV A;  1HBQ A;  1SWB A;  2RA6 A;  2FR2 A;  3VHH A;  1CBI A;  4YGH A;  1SLD B;  3SZJ A;  5B29 A;  1E00 A;  4JGL A;  2WQ9 A;  4Y0R A;  5FAZ A;  1I9H A;  4ZHH A;  1SXU A;  2NP1 A;  2Q4N A;  1KFF A;  1NBX A;  2K62 A;  3NX1 A;  3RKG A;  3AKN A;  1SRE A;  2DJF A;  2FWV A;  3L4R A;  3PH6 A;  5IO7 A;  1H91 A;  4JO6 A;  2RTL A;  2ACP X;  1Y53 X;  3T6L A;  3LTW A;  1STR B;  1NP4 A;  1GX8 A;  4O9S A;  3O2Y A;  3WJB A;  2OFM X;  4OEL A;  4NW4 A;  1BLR A;  2DJG A;  2GTL N;  3FR5 A;  4K19 A;  2MHD A;  4IB7 A;  2OZQ A;  3VHM A;  2A13 A;  3GAQ A;  4BGF A;  2QO6 A;  2YG2 A;  5HZ5 A;  2HZQ A;  3CKF A;  3RY2 A;  1ERB A;  1ZNG A;  4WFU A;  5LJE A;  4INN A;  4COT A;  1I4U A;  1SWG A;  1EW3 A;  1S2P A;  5B5G A;  4MEE A;  1LIE A;  1Y9L A;  2Y3F A;  1OPB A;  1SY1 A;  3FA9 A;  4ZFX A;  3VG4 A;  5LJD A;  1ZND A;  1EI5 A;  2R74 A;  3K3L A;  4ZGF A;  3DTQ A;  3D97 A;  1LPJ A;  1RBP A;  4U46 A;  1OBU A;  4YMY A;  4GGT A;  4GRJ A;  1JBH A;  2RTJ A;  1TVQ A;  4QNI A;  1VWN B;  3NP1 A;  5D47 A;  1LDQ A;  3RDQ A;  3O19 A;  3MM0 A;  1N43 A;  2IZH B;  5DG4 A;  3FA6 A;  2OFB A;  2BS5 A;  2QMI A;  1EII A;  3KFG A;  5BVS A;  2OY7 A;  1GT1 A;  1SA8 A;  1Y0G A;  2CM4 A;  3EW2 A;  3WBG A;  4CK4 A;  2IZC B;  4EXZ A;  2G5L A;  5B5F A;  3T6F A;  1KZW A;  3WZN A;  2E4J A;  4TKH A;  3WJG A;  1HMR A;  1SLG B;  2X8S A;  1KT6 A;  2AT8 X;  3TZS A;  3VG7 A;  1PMP A;  4GET A;  4YVB A;  3FIQ A;  4IB9 A;  1VWC B;  1BRP A;  2IZD B;  2W2F A;  4KC8 A;  2JGS A;  3VE1 A;  4BVM A;  4FBR A;  3VPJ E;  2C4I A;  2F73 A;  2I5V O;  1VWI B;  1OPA A;  1SXW A;  2Q2P A;  5HA1 A;  4KII A;  3TGA A;  1A3Y A;  4YFP A;  3WYQ A;  1RXH A;  1QAB E;  2GTF X;  4EDE A;  3HWE A;  2RQ0 A;  2G78 A;  2WSJ A;  2AT3 X;  2RTP B;  5HBS A;  1IKE A;  1ALB A;  1GKA B;  2FTB A;  1OBP A;  2JU8 A;  1ADL A;  4Y5D A;  4D6B A;  2MO5 A;  3LV4 A;  1TW4 A;  4A1Y A;  4CPE A;  3U9P C;  1E5P A;  3HPE A;  2GC9 A;  3BSZ E;  4LKP A;  5AEO A;  1U18 A;  3B2I A;  2RTN B;  1MX7 A;  1JJJ A;  4Z2V A;  4DQ4 A;  4QZT A;  5HZQ A;  1QY2 A;  1MUP A;  2A2U A;  5HAE A;  4U3Q A;  3HWD A;  4BOE A;  3NQ3 A;  3HTY A;  4NNT A;  3F9D A;  3APX A;  2CBR A;  1VYF A;  3BLG A;  4HPD A;  1K3B A;  1X8O A;  1QQS A;  3HWG A;  1CBS A;  4FQB B;  2ACO A;  3NR3 A;  5H9N A;  4NV7 A;  5FEN A;  3UEV A;  3UAQ A;  2POA A;  1RSU B;  4YGZ A;  2FGS A;  3UEW A;  4GE1 A;  1VWF B;  1OBQ A;  2RCQ A;  3P6H A;  4OS8 A;  3S5V A;  4JHQ A;  2RTG B;  4JNJ A;  5F58 A;  4AW8 A;  3EMM A;  1JJX A;  2IZG B;  2MWH A;  2G7B A;  5AJC A;  2HZR A;  2Q9S A;  2ALL X;  3V8U A;  1QY1 A;  4ZHF A;  2AVI A;  2P8G A;  1O1V A;  2QO5 A;  4A60 A;  1EIO A;  4CDF A;  2RTI B;  1FEL A;  4L1N A;  2OVS A;  2CAM A;  2X56 A;  3HK1 A;  4MVE A;  3SLO A;  5LJC A;  1MK5 A;  1AVE A;  1OSP O;  2AL0 X;  5F6B A;  5DPQ A;  3JQO A;  3U03 A;  2MF6 A;  4IBA A;  2JN3 A;  5HTD A;  4EQA C;  1LKE A;  2ZAI A;  2CZT A;  1VYG A;  4QGV A;  2X8T A;  4TNN A;  1RAV A;  3TF6 A;  1YWB A;  2FHL A;  1SY3 A;  2YMS A;  3JS1 A;  3KFF A;  2UZ2 A;  4ZHG A;  4IB8 A;  3HWF A;  4C5P A;  2RTH B;  2KT4 B;  1GX9 A;  1HQP A;  4I6S A;  1KT3 A;  1SWL A;  3FA8 A;  3O22 A;  2OY8 A;  3CBS A;  4O3Y A;  1SLE B;  1LID A;  2CBS A;  1GKA A;  4IRW A;  3WJD A;  3VG2 A;  4A1H A;  5BYP A;  2F09 A;  4OS3 A;  3SLT A;  5HA0 A;  3OD9 A;  3NX2 A;  3JSQ A;  1EXS A;  1W4T A;  3CKG A;  2AF5 A;  1PBY A;  4NYR A;  1BSY A;  5BVQ A;  4QRL A;  2RTB B;  3WVM A;  2RCT A;  1N4J A;  4GU8 A;  4MIR A;  1PTS A;  4NV8 A;  4U8U O;  4YFQ A;  5D8J A;  3SZI A;  1AB0 A;  2GH7 A;  2Q39 A;  5L8I A;  5IXG A;  2LFO A;  4YDB A;  4AYH A;  1JV4 A;  2OY1 O;  3P6E A;  1FTP A;  3PDF A;  5HCD C;  5L3Y A;  3P6D A;  1ZNE A;  1TOU A;  4GNY A;  3WZP A;  4XMH A;  2EU7 X;  2Z4H A;  3IFB A;  1XCA A;  3FW5 A;  4UU2 A;  5IRU A;  5BVT A;  1G74 A;  1FE3 A;  1JQP A;  1SWQ A;  2HLV A;  3B2J A;  4FBO A;  4QYN A;  1SRG A;  1ZNH A;  4YKO A;  5F6Z A;  3SZH A;  4GD9 A;  2Y32 A;  2C1S A;  4GKC A;  4TQ2 A;  5FQ8 E;  3WZO A;  3ELZ A;  2Q2M A;  3BU9 A;  1AQB A;  1ICM A;  4Y59 A;  4AZQ A;  2JOZ A;  4IAB A;  4YGG A;  2RTD B;  4YCH A;  1AVG I;  4I9S A;  3KZA A;  5CHK A;  5D48 A;  4CSB A;  4U8U M;  2GTL O;  4ZJ0 A;  1MOY A;  1G85 A;  2DM5 A;  2WEX A;  2OVE A;  4Y0Q A;  3TGC A;  3NQ9 A;  4ORY A;  4CPI A;  4N7C A;  1SY0 A;  1HN2 A;  3BX8 A;  4CDD A;  5LKE A;  1AVD A;  1CBQ A;  3APW A;  4HFO A;  4ODD A;  4ORX A;  3WJE A;  3EBK A;  1GM6 A;  5FFH A;  1ERX A;  1RXK A;  3PED A;  2JU7 A;  5KHP A;  3TGB A;  1UYO X;  1S44 A;  1P6P A;  4O4O A;  1KXO A;  2QO4 A;  3BRN A;  3F8A A;  1LIF A;  2PI3 O;  4IB6 A;  2IZI A;  3FLL A;  2GJ5 A;  2KW1 A;  4IMO A;  1NQM A;  4PSQ A;  5IRW A;  2WUT A;  3FEN A;  1FDQ A;  1SWJ A;  3FYF A;  1IIU A;  2Z4I A;  4NYQ A;  1EPB A;  2A5C A;  2WQA E;  3P6G A;  2LBA A;  3E3C A;  2JMB A;  2OVD A;  4GZV A;  3RDX A;  1QY0 A;  1SWE A;  3CR6 A;  1FJ1 E;  1GGL A;  2AMM X;  3OBL A;  5D4A A;  4GGR A;  5EED A;  4YFR A;  4ALB A;  2OL6 O;  3AKM A;  2KTD A;  4BBO A;  4MIS A;  4QQ1 A;  2BHV A;  2GTL M;  2RTK A;  4NLJ A;  1BSQ A;  1SRI A;  4GDA A;  1EQD A;  3RE6 A;  2BSZ A;  3PH5 A;  2VFC A;  2RTA A;  1VWB B;  4RUN A;  1URE A;  3FR2 A;  1VPR A;  1R0U A;  1HY2 A;  5HCE C;  3FEK A;  1U0X A;  4QYP A;  1KZX A;  2Y3E A;  4ES7 A;  3PQS A;  3KVN A;  3OE3 A;  2F01 A;  2ZSC A;  4NP1 A;  1BEB A;  3WYP A;  4XME A;  1PBO A;  1DZJ A;  4EEJ A;  1A18 A;  1L6M A;  1VWG B;  5F1E A;  1SMP I;  4Z2O A;  3MVF A;  1VWE B;  2XST A;  5H9K A;  4ALO A;  3QKG A;  2VDF A;  1KT4 A;  1X89 A;  5CE4 A;  1VWL B;  3C77 X;  3NAD A;  5EDC A;  3FR4 A;  4ZCB A;  1SWK A;  1E02 A;  3GE2 A;  1PEE A;  2FT9 A;  2AKQ A;  4DCB A;  4OS0 A;  5L8O A;  1YWC A;  3D96 A;  3P6C A;  4XMF A;  4YKM A;  4D6A A;  2MJI A;  4ZHC A;  4ZH6 A;  1LF7 A;  3STM X;  3VG3 A;  3VU1 A;  2RTC B;  3FID A;  4Y0P A;  1VWP B;  2LBV A;  4HWM A;  3FDC A;  5B11 O;  3RZY A;  1RXJ A;  3FA7 A;  3STN A;  2X34 A;  1BM5 A;  1YP7 A;  4O4X A;  1G7N A;  2G8C O;  2IFB A;  2MM3 A;  3IA8 A;  1CJ5 A;  2X46 A;  4GJV A;  1KL4 A;  3EM0 A;  1JMX A;  2RD7 C;  2ZAG A;  4UU3 A;  1BSO A;  4YCE A;  2QOS C;  5AJB A;  2BLG A;  3MX7 A;  3DSZ A;  1X8Q A;  4ZH9 A;  1DZM A;  4M6S A;  4TKB A;  4OMX A;  5B27 A;  5C0N A;  1ACD A;  3EYC A;  2M4L A;  5IO5 A;  4MVI A;  4O3Z A;  1SWT A;  5K06 A;  2WR6 A;  4LKT A;  4WBK A;  1VWJ B;  2WPU A;  5FQ7 E;  2FR3 A;  1JYJ A;  2CM9 A;  1DC9 A;  1I06 A;  1DF8 A;  1HQQ A;  1MM9 A;  1OEK A;  2A5B A;  3BS2 A;  1VYO A;  3KFI A;  1B56 A;  4O3X B;  1G5W A;  3RY1 A;  1ZNK A;  3STK A;  2OFR X;  1SWC A;  4CPH B;  5B10 O;  1UZ2 X;  1T0V A;  4OEM A;  4BCS A;  3C76 X;  4QGX A;  2I5Z O;  3RDO A;  4XMD A;  1U17 A;  4IAX A;  4LZV A;  1T68 X;  4BX6 B;  3U0D A;  3LHN A;  3Q34 A;  1RLB E;  1SWS A;  1EPA A;  4ML7 B;  4O4S A;  1IFB A;  5EDB A;  4ZGU A;  4Z2P A;  2KTS A;  1OEE A;  3ZUI A;  1YIV A;  2IZA A;  4Y0S A;  1BJ7 A;  1KOI A;  1W6F A;  1ZRY A;  3RDM A;  3N91 A;  1LIC A;  3B2H A;  1NGL A;  2FS6 A;  5HTE A;  4AZO A;  3PEC A;  1K24 A;  4BX5 B;  1LCW A;  1YWA A;  3VE2 A;  1MX8 A;  1MVG A;  1QFV A;  4HPC A;  1SY2 A;  1VWQ B;  1LUQ A;  4KT5 A;  3SOT A;  1QWD A;  3VHI A;  1GT5 A;  1E06 A;  5B2A O;  1LEL A;  1BBP A;  1QG5 A;  3B2L A;  5K68 A;  3S26 A;  3WJF A;  1DF3 A;  5CYB A;  3B2K A;  2FKJ A;  1Y52 X;  3BDR A;  2L67 A;  4TJZ A;  5K67 A;  5H8T A;  1STS B;  4OMW A;  3S5X A;  3SLJ A;  3ZUO A;  3NBX X;  5HWZ A;  3UEX A;  1X8U A;  4YDA A;  2FLJ A;  2OVA A;  2FKG A;  3T1D A;  1CRB A;  4TKJ A;  1VWR B;  2AT6 X;  2X8F A;  4U8U N;  1NP1 A;  3OJY C;  1ML7 A;  4AZM A;  1GT3 A;  3BU1 A;  1LFO A;  2LA7 A;  3CQR A;  4FBV A;  4ORW A;  2ASN X;  4CV7 A;  1IKJ A;  1SWH A;  4BX7 A;  5EZ2 A;  4GH7 A;  1SRH A;  5KIC A;  3PQU A;  1OEJ A;  3AEH A;  3RDU A;  2NNQ A;  2RTQ B;  2G79 A;  2NNE A;  4ORR A;  2OL8 O;  4Z6J A;  3NPO A;  1DFV A;  1FEM A;  1GXA A;  1HMS A;  1SLF B;  2A0A A;  3G7X A;  4CDE A;  3FW4 A;  1NQN A;  1KT5 A;  2OL7 A;  4HPB A;  2FHN X;  2RTF B;  4EFG A;  4CPH A;  3VGW A;  4AZR A;  5F2B A;  3UEU A;  3ZW1 A;  1X8N A;  4BX6 A;  4MVK A;  1I04 A;  1SWD A;  1ZNL A;  1N9M A;  3F6Z B;  4KH8 A;  2RTM A;  2WEW A;  3WJC A;  2HYS A;  1VWA B;  1QFT A;  2VFB A;  5HZ9 A;  1TXL A;  1B0O A;  3MG5 A;  2OF8 A;  3EBW A;  3EC5 A;  5AQ6 A;  4QZU A;  2OF9 A;  5LKF A;  1Y55 X;  3ZZV A;  3VG5 A;  1SXX A;  4N7D A;  5H9L A;  1O1U A;  3RDS A;  2IZF B;  2IZL B;  3EW1 A;  2IZE B;  4NLI A;  3WOV A;  4BX5 A;  2HMB A;  4O49 A;  1JJU A;  3I17 A;  2AT0 X;  1N9Y A;  1SWF A;  1VWO B;  1HXZ A;  2CZU A;  1VWM B;  1VWD B;  3FEP A;  1CBR A;  4GDZ A;  5CSE A;  2OYB O;  4B55 A;  4CDC A;  5LJB A;  1KGL A;  2IZJ A;  3P24 A;  2W2A A;  5B3M O;  3FMZ A;  1SRJ A;  1GT4 A;  3KQ0 A;  3RBY A;  1ICN A;  3PK2 A;  1Z24 A;  1N0S A;  1SWU A;  2AT5 X;  2QM9 A;  4I3D A;  3WXQ A;  4BQU A;  1WUB A;  2QOM A;  2A8G A;  3ZW2 A;  1SWP A;  3RWX A;  1EAL A;  1VWK B;  4YBP A;  1LCV A;  1HMT A;  1YP6 A;  1KL5 A;  4O3W A;  3QQ2 A;  2R73 A;  4CPF A;  1JIW I;  3NQK A;  5D45 A;  1X8P A;  4ZR2 A;  1KQW A;  3CMP A;  3APU A;  1FEN A;  4I9R A;  4ORU A;  1EUO A;  2XKL A;  1AEL A;  1BRQ A;  4QAE A;  1YWD A;  4A8Z A;  2L68 A;  1XKI A;  1KQX A;  1RST B;  1SWR A;  2RN4 A;  2X32 A;  3S60 A;  1IJ8 A;  2BS6 A;  1NDJ A;  2BT9 A;  3ELX A;  1WBI A;  5IRA A;  5IO6 A;  5HCC C; 
#chains in the Genus database with same CATH homology
 3HPE A;  2X32 A;  1Y0G A;  3Q34 A;  2FGS A;  2X34 A;  1WUB A;  5IXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...