5IXUA

Crystal structure of an uncharacterized nipsnap domain protein from burkholderia xenovorans
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
102
structure length
102
Chain Sequence
MLVEMRTYRITAGKVPEFLKIYQDEGLGIITQYARLRGCWTQDSGTLNSVVFWWAYDDYSHRAAQRERLAADPQWQAFTPRIVPYLEHQESVFLVPAAFCPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an uncharacterized protein from Burkholderia xenovorans
rcsb
source organism Burkholderia xenovorans (strain lb400)
molecule tags Structural genomics/unknown function
molecule keywords Uncharacterized protein
total genus 29
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07978 NIPSNAP NIPSNAP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5ixuA00
1OQ6A 2QLXA 3HX9A 1YJRA 1QUPA 4Y2IA 2ZDPA 1TR0A 1Y0HA 4A47A 3E8OA 2QIFA 2CRLA 2HFOA 1Q8LA 2QYCA 2HFNA 4YEAA 1MWZA 1TZ0A 2LXFA 2PGCA 2RILA 3UDCA 1Y9OA 2GA7A 2RSQA 3IWXA 2XMJA 2XMTA 2K7KA 1SQEA 5B0DA 1YJVA 2BJEA 2K2PA 3TOQA 2RU9A 2L3MA 3BB5A 4DL0C 2HIQA 2KT2A 3BM7A 2VV5A 4Q2LA 1S6OA 5B0FA 1SB6A 1FVQA 5B08A 2GV1A 3F44A 2ACYA 2AJ0A 2KKHA 1LQ9A 1RJJA 4NPOA 4QOTA 1GXTA 2BBEA 2IFXA 2OD4A 2XMWA 3HHLC 3MCSA 5B0GA 1OPZA 5A6WA 1Q4RA 3HHLD 1AFJA 5B09A 1VQSA 4OJ1A 2OP5A 3FGVA 5F0UA 3HFKA 2LQBA 1W2IA 5KAKA 1TUVA 1TL4A 2EW9A 1X8DA 1MWYA 1Y3KA 1N5TA 2GFFA 3HF5A 1Q53A 1FD8A 1P8GA 3DXSX 2BYCA 4Y2MA 3TRGA 2HQIA 1YJTA 1OSDA 3WDOA 2W4DA 2XMVA 2PD1A 2IYIA 1V3ZA 4HL9A 3BGUA 1FESA 2OKQA 2OAUA 2VH7A 3VTIA 2KYZA 3FMBA 1U7LA 5IXUA 2AP6A 2XMKA 3BN7A 2Q3PA 1XBWA 2FIUA 2OFGX 3LO3A 2AW0A 2N4DA 4A48A 1AW0A 1K0VA 1KQKA 1JK9B 3QGPA 4ZA1A 1Y3JA 5T7LA 1X0PA 1YJUA 1WD6A 1N5VA 2KT3A 4A46A 1CPZA 2BJDA 3K7RA 2JDJA 1N5SA 1YRXA 5T7LB 5B0AA 1JWWA 2GGPA 4U9RA 1VQYA 2FHMA 2G9OA 3T9NA 1OQ3A 4HH1A 4A4JA 3HDSA 2GCFA 1P6TA 3LGMA 3CJKB 1SI9A 2GGPB 3I9ZA 3LGNA 2AJ1A 2ASYA 2IYGA 5B0EA 2N4CA 2ROPA 1TL5A 2ROGA 1GXUA 1N5QA 2W4CA 4Y2KA 2FTRA 3HHLB 5K9FA 4F67A 3CJKA 5B0BA 4DN9A 5A6PA 2ZDOA 1CC7A 5B0CA 2HLTA 3HHLA 2K7JA 1ULRA 2BUNA 1FE0A 1FVSA 1Q8BA 3QMQA 4DPOA 1AFIA 4HI1A 4OJHA 4NL5A 2QLWA 3KG0A 1KVJA 3KG1A 1FEEA 3DCAA 2OFHX 2LDIA 3FRYA 4OIXA 3GZ7A 4Q2MA 2N7YA 4HH0A 3IWLA 4YDXA 2XMUA 2K1RB 3BDEA 4OJGA 1X7VA 2RMLA 4OJ3A 2ROEA 3BF4A 2HLUA 4ZOSA 2K1RA 2OD6A 2LQ9A 5F0WA 4HI2A 4EFAC 2GO8A 1KVIA 4FNIA 2W4PA 1FE4A 1S6UA 1CC8A 1IUJA 2OMOA 3KNGA 4FNHA 3KKFA 1URRA 3TNVA 1APSA 2XMMA 3MZIA 1R6YA 3BR8A 1YG0A 2FB0A
chains in the Genus database with same CATH superfamily
2GJFA 5DQIA 2V4JB 3MTJA 3ZZUA 5KFWA 3J81Y 3EPGA 5ETPA 2GJ2A 3G8SA 3OR1A 2LVWA 1D3WA 4PYAA 4W90B 4G1QB 4MIAA 2LXFA 4KC5A 2RILA 2AYMA 3IS9A 4OHXA 2MJNA 2Y9HA 3TQEA 1QTMA 2EK6A 1K44A 3MCMA 1FNOA 4ED3A 8ATCB 2HK3A 5LJ5Y 3VAKA 3D1OA 4DQRA 3B54A 4EGLA 3OD2A 1YJVA 2QV6A 3L7OA 2AMCB 3N6NA 1RT3A 4PAAA 1Q8KA 3W5XA 3DRSB 4DSJA 1HBUB 3C66A 4IRKA 4KB7A 2DNGA 4FDFA 2VICA 1PSDA 1VFJA 2D41A 2R2SA 4TN2A 4Y00A 2ZHAA 3T5KA 1BUXA 2GVDB 1B7FA 4NPOA 4QOTA 2JLEA 4AD6A 2VPYB 2CWKA 2GHVC 4RW9B 2IBKA 1HBOA 2VQFF 1GMVA 4BLGA 1UW9A 2XTJP 5D8HB 4E8UA 2KDOA 1N54B 2QJ3A 3LP2A 3HFKA 1HBOB 2KRRA 4RBVA 1WJ9A 1YJ9S 1X60A 5G4DA 4LF7J 2DT9A 2KU7A 1PJ5A 4WU3A 3BJYA 1LV5A 1TFYA 4ECWA 4ILRA 3ZZRA 2CJBA 1N32F 3WC0A 4F3OA 1FFWB 1NNDA 3QLHA 5J2PB 2PD1A 1M5HA 3OTBA 4HTJA 3G6VA 2YKOA 2OKQA 5KFMA 5DLFA 1P9QC 1CG2A 3NNAA 5I3PA 3Q24A 3MEGA 3CJSA 1X5SA 3M2RB 5HANA 3RB0A 4RU2A 2QTWA 4DSIA 2G13A 4F26A 4NLUA 3OW2R 3N5FA 3JSMA 1YJUA 1ZS6A 4P6QA 2NZCA 3TEHB 4AQYJ 3KUGA 2ZH5A 4LFCJ 3TWZA 2RU3A 2GAGC 3LA0A 4OYIA 4FKXA 1TFWA 2Q66A 1IKWA 4GMKA 4DFMA 3DOKB 5H9EJ 4LF5F 5B0AA 2ZZMA 2XGPA 1VYAA 2G9OA 3RB4A 1NSPA 2JEIA 4B9NA 3B82A 3HDSA 4I4BA 1LEOA 4ZP6A 4RUAA 3J81j 4PXCA 2W4CA 4ECSA 3AJ2A 3FEYB 3TJ8A 1T9UA 3GB0A 1TKTB 1JNZB 4C11A 2AIRB 4WYWA 2ZM6F 4FXVA 5IM0B 4PQUB 2YWWA 3ZXWA 4USWA 3QWUA 2Z4PA 1UJ5A 4YB5A 4FYXB 3CJTA 4IOCQ 1FRKA 2VQEJ 3KNAA 1NPRA 2HBRB 4FPRA 4OZ2A 2OELA 2Z56B 4GO5X 1SC6A 2B5JA 2EC2A 4NL5A 4Z7YA 5LJ3Y 1RYSA 2VOOA 3CMES 4B3OB 4I64A 4ZVOB 4WFNQ 4LVNP 4KR0B 4CO5A 3VZIA 4HH0A 2CQIA 2F8HA 2WONA 4YDXA 3CMQA 1GAOA 4ID5B 3UD5A 2B4VA 4DR6F 3AHPA 2M2BA 2QLJB 2PA8D 4XO0A 4I2QB 1HKAA 1M1GA 3D67A 4K4WA 3SV4A 2ASJA 4KGMA 2OD6A 4L74A 1GX5A 4IFYB 5KFXA 2HGMA 5DDQC 5KFAA 4NRUA 4A8OA 4IR9A 4NLSA 1KNZA 1KVIA 2EEYA 2OPRB 3U1NA 1FKPB 1T9TA 3H98A 4WP9A 4GKKF 1FRJA 4CO3A 3K5LA 2MZTA 4DCPB 2V4RA 2NXNA 3ZZPA 1RWKB 3BQ2A 1M5OC 1MN7A 2CYYA 4ZCLA 3ZZTA 3ET6A 3PDNA 3QIPA 2HHHJ 4B3MF 1TAUA 5D4PA 2FYXA 2DRBA 3C16B 3ISNC 3R7BB 4R5PA 1TR0A 2LMIA 2PEBA 1TTHB 1PJ6A 3W2WA 2Z2YB 1VQ7S 4HR2A 4WWSA 1CSJA 2ZZNA 2QIFA 3N79A 5A8WB 3O6QA 3D1QA 4ZS6A 2BQRA 2CQ3A 1DBDA 1NPKA 1WSVA 4DV5J 4A8WA 2W7PA 4EYHB 1WOPA 1FXDA 1URNA 1C1CB 2A2CA 4NLTA 1EX8A 4EI2A 4M5DA 5CAAA 2R8KA 2BANB 1D9AA 2C2KB 3CJQA 4QWEA 4V1Ak 5ETSA 4EWTA 3MUVP 1WF0A 1H38A 2L3MA 3F56A 4ZVEA 2UVUA 2FJBB 4KV8B 3MD3A 1QUVA 3D4JA 2M88A 2B3TB 3GSIA 4Q2LA 2UVWA 1TK0A 3NMAA 3MPVA 2OHDA 5A8KA 1UA1A 2ACYA 4JB8B 3BH6B 1LQ9A 1DURA 4I7FB 4MMOA 2DGWA 1G3OA 3GE9A 3KHHA 2DHGA 2NSCA 1FK9A 3MHYA 3C15B 4M5LA 3CIMA 5A8RB 1RE1B 4KY3A 2E7XA 2I0XA 4WP8A 2RF2B 1FK9B 1L3SA 1AB8A 4RW9A 3QT7A 4WFYA 4I2PB 4DDFA 1HNXJ 4RWWA 4YS2A 2QSWA 3OXGA 5GMDA 2V2KA 3RUBL 1N36J 2Y3YA 1MWYA 1HLWA 2VOPA 1RU1A 3DFEA 3M8RA 2BYCA 1MLAA 1KHVA 2W01A 3CCWA 3WDOA 1WKJA 2FQQB 4XPCA 2XMVA 3KLFA 4Q7AA 1B64A 3DRRB 2J7KA 5BJRA 3AXMA 4DL3A 4DR7J 4X2BA 3TA0A 4ZLJA 1XBWA 3LO3A 3RRKA 2AW0A 3VQTA 4DL6A 1NSQA 3M9OB 1QSYA 1S1TB 1DAXA 1VBZA 4ZVQB 2P6SA 1XJWB 1VQLS 3G6ES 2GQ2A 3K7RA 3DI6A 2LDYA 2OPSA 3E3XA 4FP9A 3W3SA 2VHGA 2MEWA 5I42B 3MR3A 1VQYA 3QIDA 3QT6A 4PUOA 1RSCA 4Y65A 4A4JA 4ECVA 5HBMB 3D5MA 3LALA 3FJ2A 1BQNB 3LGMA 4C8MA 3DHXA 5IM0A 4C8OA 4PUOB 2HVIA 2N4CA 3DHWC 1YWXA 2DTJA 2MQOA 3BDPA 1S7IA 2PMWA 3MGJA 3H40A 4FF4A 2Y0BB 3T1YF 3QJPA 2M3DA 1VJQA 4ZVUB 1SIWB 2ZDOA 3FEXB 4QQBA 1HR0J 5B0CA 4JI1J 1LXNA 1RA6A 2XYHB 3MEEA 3R7SB 5KG4A 3HLUA 2L41A 2E9RX 2M4MA 3HSGA 2DY9A 4I1TA 4WE1B 5GAHU 4F50A 2BW2A 2RHSB 3E01B 2J76E 4AXJA 4DPWA 1UVLA 4ATNA 5J2QA 1KVJA 2BV3A 3GCXP 3VGVA 5CH7B 1ZTWA 4X65J 3IWLA 4B3OA 2CPDA 3BZQA 3FCHA 2UXDJ 2RMLA 3DOMA 1EETA 3K89A 2MJUA 4CO2A 4NLWA 4EMDA 5DM6Q 2PDAA 3N6MA 5C24A 4CM2A 2DNZA 3W8PA 4OMFG 4YR3A 2V8PA 3FQLA 1RQ0A 3QQCD 1CC8A 2OI2A 2OMOA 2ZBRA 3AJDA 3E51A 3FBFA 3EZOA 4NLDA 1WEYA 2YY3A 3A4TA 4P74A 1KVKA 1RT7A 3QT8A 2FVPA 3SIPB 1APSA 4DV2F 4NXNF 2XMMA 1CJUB 1Z4UA 3T1YJ 1ZH5A 2CPJA 2Z2ZA 1WG5A 2WSFC 1N32J 3UR3C 4K4XA 5HP1A 3SV3A 3NS5A 2A2DA 5J1EB 1FRIA 3MMAB 2NCKL 2ZWOA 3G6YA 5HROA 3K58A 3F41A 4LR9A 4QU7A 2QMWA 1RI7A 3AFGA 1VBXA 3EVWA 4ED6A 1M90T 2CRLA 3EICA 1NSAA 4WYLA 4X4PA 1C1CA 1VQ4S 2ZC3A 4KBIA 1RHMB 4YY3F 4R0JA 5KFKA 1JLQA 5GAEU 3NGRA 5A8WA 1U1QA 2VZ9A 1HYSA 3HI9A 3S8SA 5HL7Q 2VASA 2LQ5A 2IHR1 3GWCA 5IQQA 4BC9A 1HWLA 2CJQA 3ZZZA 1KBRA 3OHBA 2E1CA 4KT0C 4JI2F 2XCAA 3NKYA 5HMWA 5I4MA 2I6WA 2ADCA 4EZ6A 3HHEA 4P2FA 3J7AN 3R5DA 3T41A 3GPAA 1C0UB 4A8FA 4JOUA 3I5BA 1R8BA 2B56A 1LW0A 1S1XA 3V4MA 1WSRA 5IWAF 4QIWD 2M8DB 1RADB 1FDAA 2ZBIA 2ZM6J 1ZTTA 4KHRA 3BS9A 2C42A 2RF2A 3NWRA 1DLOA 1T94A 3LP2B 4NLVA 1Q4RA 1WF2A 4QZVB 5D0EA 3JXOA 3IN5A 1QDUB 1AFJA 3KG4A 3LGHA 2G0JA 1YIJS 4EBEA 4K59A 1RLCL 5KFPA 4AQYF 2KL8A 4RBTA 4KPYA 4EUVA 2IRYA 1RTIB 5LMUF 3D54A 2GQCA 2EW9A 1X8DA 3Q8UA 5G0RA 2IVFB 1WF1A 5F9NA 5KFYA 5HSPA 2H54B 2HHPA 2ALYB 3HVTB 4O4GA 4P2XA 4URSA 2AF6A 4U6PA 1LWXA 4U7UD 3TZYA 3HVAA 1L3VA 1S79A 1KLMA 4Q8EA 4KHPJ 3PHEA 3J81U 1K1QA 2HAIA 2PMHA 4CDIA 1T3NA 3SCIE 4K2JA 1X4AA 1IKYB 3MD1A 2XMAA 4M94A 2CPIA 5AT1B 2A1BA 5KFFA 4U95A 5DRKA 3NL0A 3UDLA 1J5EJ 3P8BB 1PIEA 1D0EA 1P27B 2E1RA 3S1TA 2JDJA 3GV7B 4DV7F 3KXDA 2OLWA 4X4VA 1FF2A 2CAJA 1RABB 2LXIA 2B0GA 1W26A 2FHMA 4TLQA 5FJ4A 3F0NA 3R6LB 3TW0A 3TEGA 3G82A 4URQU 5IV4A 5LXYA 2B6AB 4OYBA 1P6TA 2RDJA 4DLGA 1VC5A 4B3SF 4J9LA 4B3SJ 4ERDA 4ZCKA 4LF6F 1FT8A 2FPHX 1JLFA 4K4YA 1RAOA 3FSXA 5B0BA 3BGFA 1U8WA 1WHXA 1C4AA 1VCTA 2ZOMA 2KHDA 3TUJC 2CJKA 2YWHA 4LF9J 4QCLA 2DR7A 3CCTA 1A0OB 1Y5LB 2HLTA 4PXDA 2ATLA 3LP1A 1FJCA 1S7HA 2F7VA 2FJDB 1CJVB 1YBAA 1L3UA 4PQAA 4HI1A 1YRUA 3BQ1A 3I0SB 3RR8A 4ZJQA 3EGWB 4HHUA 5KG0A 4RLEA 5HO4A 2YKMB 1FWPA 1SUQA 5E3AA 2IJNA 5EWGA 4NLYA 2WOMB 4B08A 2NXJA 1SKSA 4FYDA 1ZAVA 3FZBA 4KAIA 5I3UA 2MKJA 2UZAA 3L9ZA 3TI0A 5AJ3J 4WU2A 3LPEA 1OSCA 3CVKA 3BGOP 3BF4A 2CJAA 1FKPA 2HS4A 4DR1F 1S0MA 1OS5A 2Y0SD 3QWPA 2M0GB 1EETB 2L9DA 4ES2A 3HT0A 3T9ZA 3QGIA 3BBCA 2IJFA 3WX4A 4ZPWR 4ED4A 1G7CB 2VPZB 2V67A 4CWBA 2UU9J 3CC2S 1Q16B 4DR3J 4CLFA 1I1GA 2KG1A 3V6KA 3ONQA 1AZSB 2QYGA 3CJRA 3DYAA 1RAJA 1DY3A 5EHHA 2FB0A 3AJ1A 3NAIA 5E2QA 1HNVA 1N34J 2A6MA 2QT7A 3LANA 1IN0A 2VJUA 2XZWA 1S1UA 1N52B 2M5YA 3M8PA 3RJMB 1WOSA 1IKXA 4UOCA 4RKUC 3NAHA 4AL6A 2WB4A 4OZ5A 2BJ7A 1U09A 3AD9C 1RAIB 1WOOA 1H72C 2WW8A 2RRNA 4MK7A 4WFBQ 3OTOF 4IH7A 4EK2A 1S72S 3JAMU 3M6XA 3K59A 1NXIA 1S5ZA 2ZD1B 3P4UB 4G1QA 2QN6B 3L09A 3JAMY 3MUMP 2NSBA 2LFVA 1TL3B 3CCUS 2NR0A 3A12A 3GYXB 4JI5F 2NYIA 4LF1A 4C48A 1JLQB 2NREA 4CLZA 9RUBA 3C3LA 4F7VA 4IRDA 1UJ6A 2R7OA 1RWMB 3ZZ0A 2MHNA 5LT5A 2WAQD 5EWFA 2V6AA 4CTAA 2HEKA 3CULA 2AJ0A 2K06A 1PC4A 1TKXB 2OPQA 4PPDA 4KGKA 5CZVA 4AT1B 1WG1A 1OJ4A 2HKEA 2XMWA 4TQRA 3MCSA 2BOPA 1F3FA 3G2XA 4WFXA 2R7VA 1N33F 1VI7A 3GTYX 3NXZA 4FZVA 4RUHA 4O3RA 5B09A 2HSEB 4HEA9 5F8NA 3VF0B 4DUZF 2H4WB 3CTRA 1EHWA 2G1HA 3MM9A 4ZP9A 3PV8A 2AJQA 3C6UA 3H0PA 1NJIT 2C2OB 4O4GB 4RWXA 3DNCA 4WXWA 3HF5A 1FCAA 2E9TA 2MHEA 2C2ZB 4C8NA 2HHSA 2HNDA 2XHCA 3PJ9A 3VVUA 4FYVB 4RNNA 2F4VJ 1NRKA 4OZNA 4ZK7M 5HJYA 3ILLA 3O3LA 5HQ8A 2XY7A 4A48A 5CXTA 1M1HA 1AW0A 3PX4A 1BC6A 1E6YB 1SJQA 5AXMA 1PG5B 2D9OA 2CVIA 5HAOA 4IQXA 3K5OA 2YKAA 5F3TA 5HN0A 1NSKL 5GAHI 4DV1F 1KP6A 5DS7A 5T7LA 5L9NA 2XY6A 1QD1A 2KB2A 2J8SA 5K20B 4ZPAA 1X5PA 2KVQE 4DXLA 4YR2A 4PWDA 2OTJS 1MG7A 4ZPTR 1RTDB 3KUHA 1KD1T 1X0FA 1S0NA 1NJWA 1BQNA 3QT5A 4RZRA 3MTKA 4U9RA 1RT1A 4J9SA 2XS2A 2EPIA 2KVIA 1OQ3A 2B51A 3QNWB 4N7TA 2AX0A 3DI6B 1RUSA 3M05A 4WTYA 4YY3J 3U1MA 1IVZA 3WZ0A 1NBEB 3JTOA 1JXEA 5KFBA 1NH8A 2GMJA 2ZKUA 1FRLA 4F67A 2FJVA 3G82B 5HBMA 3LP1B 4OX8A 2F63A 2MKSA 2NQPA 3HT3A 2HRTA 5L9XA 2RS2A 2ZUGA 1BE4A 4IOBA 3TVYA 1XC9A 4BDPA 3H5XA 1D8ZA 2VG6B 4DPYA 5KFEA 5BR8J 4EO8A 2VA3A 2YKNB 1Y11A 3VAMA 2R2TA 1S9EA 4ANDA 2FVRA 2YNGA 5CCMA 1JLGB 1U02A 1WORA 5IWAJ 2DHXA 2DYAA 4DV2J 2ZE2B 1X4DA 1GT8A 2VFVA 2H5IB 2F3JA 3NEKA 4M5MA 4NRTA 5DDPC 2DR8A 3HHNB 3CCMS 1N6QB 4Q2MA 4ZHRA 2HYIB 4LJMA 4ZJOA 2R8GA 1F3VA 5H1SV 2W9AA 4L72B 1JLAA 2FVCA 1X7VA 2DXDA 1B70B 4G6VB 3K5PA 2M8HA 2XI3A 3H2VE 3JQMA 4LBPA 3U27A 3CCLS 3AB2B 2V8VA 4W4MA 4B3TJ 3EX7B 5DJBA 2MQNA 2ZHOA 1RGVA 4QBUA 1R89A 2HFSA 3H4BA 4KHMA 2PEHA 5KT4A 2DNRA 2R2UA 3GYNA 3H90A 2LECA 4LFBF 4X4QA 3HSJA 3NWGA 2WB1D 3UCGA 1RT4A 5D0RA 3BO4A 2AYBA 1MN9A 2QO3A 1U4BA 3RU0A 3NMRA 1Y7PA 1KC8T 2KZMA 2W9BB 4TYBA 4M5IA 2DHAA 5BYQA 3ZTPA 3GG1A 4O4RA 2BXJA 5E33A 1ZYQA 2VFTA 1Q81T 2EFVA 3RTVA 1T9VA 1LK5A 3EDRB 3JTNA 2H51B 4X4TA 2XSFA 4DHVA 4DV4F 1K9MT 1KR4A 1X4BA 4A8YA 4L75A 2RSQA 3GFXA 2AJ4A 3OL7A 1N88A 1PKUA 2XMTA 4LF2A 4XAKA 1ZPVA 4ZVPB 5DGBA 3BQ0A 3AD7C 3IS9B 4L3NA 2HW3A 5D6GA 2LQ8A 1S0VA 4RBUA 3NBPB 1SL2A 2BANA 4OYOA 3TO8A 1RWPB 4UQTA 2C2NA 4E98A 5DG7A 4QR0A 2BEFA 3NCPA 2C3OA 1XMOF 1XMOJ 1NHKL 2GV1A 2XM3A 3W61A 3KTQA 2MZQA 4MYUA 4NA1A 4KTQA 2OPPA 2HS0A 3NGKA 3TAQA 1J27A 4X4UA 3OUYB 1RTIA 4WPAA 1IM6A 4NLXA 3M30A 2QSFA 3UO0A 4IH6A 5CD4H 3D2WA 1N56A 4ELTA 2OP5A 4QR1A 1PO6A 3BBFA 3OSPA 1KWMA 3SSSA 1SC3B 3GFHA 3HVTA 3W7BA 4MT1A 1TKDA 2LXUA 1S77D 1PBAA 2MQ8A 3NOCA 5D0GA 5DLGA 2H5JB 1VHIA 3HULA 3KJNB 2JLFA 4C3MA 2AT1B 3NNCA 5IC4B 5JJBA 2W4DA 1ZZNA 1YLXA 4C8KA 4NLGA 2IYIA 3EWGA 4HL9A 1R0CB 5FDLA 4DF4A 4OYPA 3TP2A 2AP6A 4RW6A 1S12A 3CJ8A 4BCAA 2R4FA 3I6PA 2N4DA 4NI2A 1B3TA 5FDLB 4ED5A 2VDIA 5HMZA 3MR2A 2MQQA 1RT2A 2EWHA 1BHNA 1UWBB 2HNZB 3MI7X 4TYAA 4USJC 3WQPA 4YR0A 1TV6B 2B7CB 3FBBA 1N5VA 2VKRA 2JC0A 4KGVB 1UP1A 3MMCB 3NLCA 4NLRA 2IIHA 3QGHA 3MAQA 1R0BG 3V81B 1N5SA 1UA0A 4J9VA 3K5NA 2DR6A 1PBUA 2PN6A 3PW4A 5KFSA 3AXKA 1DTQA 1AUSL 2GGPA 2GHWA 3AA8A 2A18A 1AYEA 1YSJA 3BH7B 3T9NA 1JLFB 4DPXA 4N56A 2XO6A 4K4TA 1WDDA 4ED7A 2C22A 1IBMJ 1RHUB 5L8RC 2PSZA 5J1NA 2X7IA 3IR6B 2RIJA 1RCXB 1N5QA 1MMDA 1UCNA 2ROGA 2FTRA 1U2CA 3MEEB 3NRBA 4ECTA 1ZETA 4Y3CA 1S0OA 1D9FA 1HFEL 1U45A 1JLBA 3TJAA 3BBBA 3KDOA 4NE9C 3L95X 2RJZA 1HR0F 2FJEB 1ULRA 3A8IA 2UUBF 4F36A 2E29A 1FWKA 1HBMB 8AT1B 3M8YA 4CT8A 3LAKA 4OJHA 1HNXF 3BSNA 2R7WA 2WBRA 1WC5A 2CQHA 5KFJA 2XC9A 1R6VA 2OFHX 4CO0A 1KRPA 1CQNA 1EAYC 2YH1A 3DOMB 4J7CA 2HMIA 1SJ4P 2DGUA 2RVJA 1YHQS 4ILMA 5DGAA 1QY7A 2WCXA 2KG0A 3LQVA 2B7BB 4K4UA 4EZ9A 2V0NA 4OI4A 5IT0A 4N5SA 4QWCA 2DNYA 3V6HA 3THVA 2XO7A 3CO0P 2W4PA 2LEPA 4PG8A 3GILA 1EKRA 5EX3A 5ETTA 4H4OB 4M5KA 4X4SA 5SUHA 1VQ5S 3DYAB 3TAPA 5F8HA 4NXNJ 2E7VA 2CPYA 3TNVA 1QLNA 2F4VF 1WC1A 3AY0A 2FY8A 4TQSA 4LF7F 2E5GA 4PKDB 1YK9A 4DJBA 4E0DA 4UY85 1RISA 4K4VA 1H2VZ 3MECB 4UZBA 2DPIA 1LW2B 4ZVHA 1NMEB 1UFWA 4RL1A 4AUKA 1VQKS 1G4CA 1SJ1A 2N3OA 3WIVA 2CADA 2J7WA 2ZWPA 3D1HA 5SZTA 4BWMA 3QZ7A 1SKWA 5M2RA 4ALZA 3GFYA 2CDRB 3PEHA 3RZAA 3BSOA 1KS2A 3T5LA 3OR1B 2E5LF 4ICLA 4Q5VA 4LFAJ 1T0TV 3HO1A 5KFUA 4Q0BA 3JQKA 2J0SD 1NB2A 3N9UC 1SQEA 3TVZA 3IGVA 4LF5J 4CLUA 1H98A 3B8HA 3CIZA 5AXNA 2WTFA 4M5DB 3OL8A 5F8IA 2H1YA 2WK4A 1SQGA 3CCVS 1RT6B 5HVGA 2Y1RI 4NZ0A 2YX7A 4MIWA 2XLIA 1WC4A 2DXFA 1UKUA 4YHHJ 1FVQA 1V6HA 1I94F 4IO1A 4X4RA 2DY1A 3IBWA 2KKHA 1RT6A 1RJJA 3L4BC 2RH3A 4C0OC 5LMNJ 4DS5A 2H9ZA 2BRKA 3FFIA 3IXQA 5B0GA 4DL4A 3M4XA 1OPZA 2VG7A 2LEBA 1F9HA 4KKOA 4O44A 3HHLD 4I2PA 2VQFJ 2ASLA 4LF8F 1RWOB 3RG6A 5L1LA 1YI2S 1G6BA 1R8PA 2DRAA 3VALA 1GTHA 4YB1P 2IY5B 5LL6d 4OYMA 3V6DB 2HNDB 3FDSA 4RUCA 1B7YB 1J2VA 2F9DA 3SFUA 5C7PA 4PG6A 4HVZA 4D3HA 3TRGA 4XIUA 3QSYB 1U0SA 3OFEA 3S6EA 5G0RB 1TMJA 2MZJA 3KMSA 1KOHA 3CUNA 5L1JA 2ZOGA 1E6YA 1L3KA 1RT2B 3GJQB 2I5JB 2Q3PA 1UVJA 3DRRA 3AAWB 4MFBA 3LAMA 1X4FA 4X4NA 3KHRA 3MFIA 1VIXA 7FD1A 2NS1B 1IJFB 4A46A 4KQZA 1LWEB 4DR6J 1R0AB 4DQQA 2GZOA 2W8LA 3VAIA 4DV3J 1VQ9S 4HACB 4ID8A 4PXBA 5KFTA 5KT6A 3MOZA 2I1RA 3K0JA 4PCQA 2VBXA 1TVRA 2Q43A 2RQMA 2YWFA 1IXKA 1PILA 3P5TL 5KT2A 3DOLA 4Q45A 4I56A 3D6MB 5FIIA 4H4KC 1F5CA 3OHAA 3DLHA 2GNKA 1GX6A 1G2EA 3LW5C 3TARA 1LFWA 1H0HB 1TKTA 4DUYF 4ZIWA 1YTYA 1IBKJ 4MKBA 4CH0S 1Q8BA 4I6WA 2YPZA 3A1YG 3D9BA 4I69A 3R9LA 2R8IA 4HDHA 1T9WA 2ZH2A 1GMWA 4P7TA 2QL7B 1RKIA 4RR5A 4F4YA 1NJXA 2HRUA 4FF1A 1U6FA 2LDIA 4OIXA 3K8WA 5F41A 2YNFA 2HZVA 3CCES 2UUTA 2EG2A 3WIUA 3CCZA 2KFNA 1U6BA 2C2RA 2K1RB 2HHVA 3PYGA 4G1IA 1K8AT 4OL8A 1M5KC 3DRPA 3ZZYA 4RW7A 1OPIA 4WIQA 1H7WA 5C25A 2QE5A 2P6TA 4USIA 4ID5A 5F0WA 4ECYA 2GO8A 1KQGB 3R5CA 8RUCA 4I2QA 3A3PB 1VBKA 2EKNA 3M8SA 2J6SA 2VJVA 3KNGA 3N4WA 2GVZA 1LXJA 4B02A 4OI0A 1UVNA 3B4DA 3IWNC 1RT4B 1CQMA 3UVJA 3EE3A 4IDKB 1L3TA 1WI6A 1WACA 1SPBP 4F3QA 4JI8F 4JV1A 3MR5A 1T05A 3BSAA 3PVXA 3RB3A 5T14A 5F9LA 3O8WA 3KLIA 3BKUA 2G2OA 1H6KX 2I8EA 4NEYA 1GQEA 5CHCB 3T5JA 1OY6A 4ZIVA 3DDKA 2BX6A 3BREA 1X4GA 3U7JA 4F04B 1TL3A 1S4EA 3KOAA 1IQTA 1PAEX 1FDBA 1HQUA 4OI6A 3EVMA 2XLKA 3HP6A 4KIAA 2AZ3A 1D09B 1SXLA 3IR5B 2ZEJA 4LRBA 4ECZA 1XEZA 3GP9A 1JJCB 1SH2A 4KV8A 1ZM9A 2D3UA 1YJ7A 3H2LA 2GIRA 4DX7A 3PZPA 5HK4A 2UUCJ 4ZP7A 3Q89A 5C24B 5KFCA 2UUCF 2QZ8A 4P73A 3U02A 2KT2A 4ANCA 3IM8A 2IM3A 3OJSA 4OYAA 1P1LA 4DV0J 4CLWA 1RHKB 5B08A 1T7PA 1HNWJ 1I6JA 5M2UA 1GXTA 3LP0B 4A8SA 1VQPS 1RWNB 4EU0A 2AV5A 1VQMS 3M1VB 4I6AA 2CZ9A 4BBYA 4F02A 1N34F 1K1SA 2JRSA 3AOCA 1WKLA 1XK8A 3B78A 3R97A 1T95A 3MM6A 5J2NB 3W9JA 4NCGB 5GADI 2AGPA 1NK9A 2U2FA 1KHWA 2XEXA 4LRFA 5HMYA 2BKOA 1TUVA 4JV0A 2GMHA 1TUWA 1FD8A 3VR1A 2HS3A 4CLSA 4KE5A 4OYXA 3T1HF 1MROB 3D6TB 1CS4A 1V3ZA 1IKYA 3BGUA 5LMNF 3UD3P 4K4SA 5IXUA 1VRQC 2YWKA 2YQ3A 2FGOA 4F3MA 3SYZA 2HWTA 4JI4F 3J7A1 1EIYB 2ACMA 1CS4B 1SH3A 4KH1B 1I5OB 4NLQA 3RGIA 3SZ2A 1LWEA 1LWCB 3BYRA 3V81A 2ZNYA 4ZA1A 3CC7S 4FBTA 1EKSA 4RW6B 4PR6A 2VBYA 4MK9A 5IQ6A 3ISZA 1ICEB 1CPZA 3M8ZA 1RTJA 3DU5A 4MFBB 1NCLA 2HNZA 4O3NA 4DG1B 4EO6A 3KLEB 1RKJA 1SC1B 2HK2A 2QMXA 2EBEA 5KT5A 3SQOP 3GJSB 4NEZA 2UUBJ 2DITA 2EC0A 2YTCA 2VC1A 1Y10A 2IAJB 1SI9A 2NXEA 2VF3A 2VPXB 3AT1B 3DLEB 4J9UE 3ZNUA 5F8LA 3IC1A 4HLBA 5I3QA 5LSRA 2B43A 3CJKA 2DH7A 1FXLA 1S97A 2DEIA 1CJVA 3GFZA 3B4MA 3CCRS 2IA6A 1KOOA 1OYEA 4H54A 4ETZA 2OUGA 3N6LA 4FVMA 4DPOA 1LWFA 1NHVA 4F2SA 1AFIA 2JEGA 4ZN1A 1RXOB 3O5TB 4C4WA 5JUMA 1F2GA 3FUYA 3RW7A 4QWDA 2E44A 3WHIA 2NPFA 3GG0A 3M2UB 2B8PA 2RDIA 3C6TA 1KFSA 4KH0B 1RHQB 1T9XA 4IFYA 2E66A 3B6BA 3TX8A 3KJQB 4HTIA 3UN3A 1TK8A 4QU6A 1HBNB 2JJ4D 5IT4A 1LKZA 2F5GA 3I96A 4WZMA 1UAWA 5CYMB 1S1WA 4MJKA 4CP5A 2MZ1A 2VFSA 3DGPB 1R31A 4OHVA 2MKIA 3MAHA 2R7UA 4TNOA 3QLHB 3LUYA 4A8MP 3W9HA 3I82A 1FX2A 3NCRA 1R6YA 2GJIA 3KYLA 4KJIA 2GVZB 4GVBA 2ZJQQ 2PT0A 3T5HA 4A8QA 3Q8PB 3BO2A 1Z2ZA 1AZSA 1QAYA 2YKQA 2A0FB 4USUA 3HHKA 4Y2CA 4GVBB 7AT1B 4LQ3A 4C98A 1PAUB 1TUGB 2BE7D 2GS8A 4UT4A 4Q44A 4PRFA 2RKIA 1V5VA 4JP8A 1CEZA 2ZH8A 3P3DA 2HIYA 1HHSA 2DD8S 2DNHA 2HHHF 2O67A 1DTTA 4OYWA 1KTQA 4K4ZA 4ED0A 1J5EF 2AJ2A 1MMNA 3D0IE 3P49B 1I3OB 3EMTA 4NLOA 1RTZA 4QYRA 4D3GA 4CLTA 4B3RJ 1Q7YT 3DN9A 1F5AA 3P45B 1REVB 2HQ3A 3VWSA 5DDRC 4DV7J 4ECRA 2MQLA 4LSLB 2HZAA 1MNEA 1TELA 5E3QA 5J1PA 3ICLA 2C2DA 3CJ0A 2CNKB 2LU2A 2HHQA 4WIIA 4MAKA 2VFRA 2IPOB 2OPQB 1EJ7L 2CJYB 1S9GA 3GYGA 5DM7Q 1S6OA 1SCJB 1RT3B 2V34A 4TKTA 1PYOB 5U47A 1NK0A 1YKWA 4FXWA 3R5JB 4PXEA 2X3GA 2ZHBA 1KSPA 4UUWA 2NXUA 3MEDB 3MM6B 3MM5A 3ULHA 4J9MA 3UD4P 5KFQA 1IBCB 2HBZB 2V8HA 3SQGA 4DV5F 1VHFA 1K73T 5K8NA 1NKBA 3MEDA 4OJ1A 2CQCA 1X9SA 4WK3A 5CA5A 3JYTA 1N0VC 3W9IA 1FRXA 2XYGB 1R8CA 2GIQA 1B4SA 3MM8A 5ETLA 2O1PA 3CEDA 1IBLJ 1QAJA 1NHUA 2B9EA 2KXFA 3BGLA 3DXSX 1SV5A 4NYPA 4B3MJ 1X5TA 3IGNA 4B17A 1OSDA 3OFHA 3M32A 2W2QP 3P5BP 1SJFA 4E2FB 4NZ7A 2BA9A 1FESA 2VH7A 4DSLA 1WDTA 3A3OB 1UWBA 3MF5A 1QE1A 4KFBB 1EQ0A 3ITHB 2G2YA 3DDIA 1K0VA 1HD0A 4LSZB 2YKPA 4USHA 2Z58B 3MCOA 5C42B 2J6TA 3AQPA 2OTLS 5L46A 4C8ZA 3TA2A 3RBXA 4FBUA 1K47A 3H42A 3ITHA 5CABA 1HHQA 4WP3A 2C1EB 2EVZA 4IG0B 3VQSA 4WCEQ 3C46A 2JEJA 4MK8A 4CLYA 1T8EA 3MMCA 2N3LA 4B9LA 2F8MA 2J9DA 4DF8A 2MZSA 2CQ0A 1T3OA 4LF4J 3I0RB 4YN3B 5ITHA 2DO0A 2YXLA 2XSJA 1FFGB 1GXUA 4Y2KA 4DSFA 4L73A 4LBIA 5DETA 2VG6A 3NY0A 3SDEB 1HWUA 3DGVA 4OHWA 5HQMA 1LWFB 1LOUA 2C3YA 1H2TZ 1U1KA 1UVIA 3G8TA 1VQ6S 2OH2A 4ENOA 4MKYA 1JLBB 3UQSA 4ZLNA 4Y6IA 3CO9A 4QIVA 5BXIA 1FJGJ 1HQ2A 3M2UA 2QG9B 2V50A 1M0SA 4NX9A 1FO1A 2YNGB 4LREA 4EYIB 1RYRA 3FRYA 3GZ7A 3N01A 2N7YA 1E6VA 5DZ6A 2WVCA 2AX1A 2ZZTA 3PRDA 5KFZA 2HG4A 3KDNA 3BDEA 2N7CA 4OI2A 4BHQA 4OJ3A 2LA4A 3IMQJ 2IDLA 2OPRA 3HSDA 1NUEA 1SQFA 3GJTB 1XNQJ 1S6PA 2ZNZA 2QFJA 3C8YA 3DMJB 1F0XA 4LF6J 3UI3A 2KI2A 3R6GB 2PA3A 3A3NB 4X65F 4RNFA 1NK6A 4OX9F 2OIHA 4PPZA 1P1TA 1RWWB 4QIEA 3UWTA 3PR5B 4B9TA 3LTOA 5ETVA 2QA4G 3O44A 3BR8A 3PYFA 1UZHA 2JSXA 1DARA 3AQOA 2PFFB 1ACMB 3C19A 1HMVB 1RAHB 2M52A 2Q79A 4ZPBA 3RAXA 4HT5A 1BY9A 1YJRA 4ZVGA 1RB0A 2Z8QA 4H4MA 3ILOA 1NDPA 3W1YC 3DC2A 5H9EK 1PC5A 1MU2B 5IS2A 2FHKA 4ZP8A 1T11A 2CQ4A 2K3IA 2VU5A 3CT9A 1CJTB 4DV1J 2PO4A 1U1MA 1S99A 4U8VA 2X1AA 3RAQA 3ZO7A 5B0DA 5EX0A 2P9CA 4U8YA 4WKYA 2X1BA 1RBAA 3KLVA 1QSLA 3I87A 4C2MA 2UXBF 3BM7A 1NDLA 4I7FA 1DJ0A 3NCQA 2BACA 3TYTA 2CQ1A 6AT1B 1DHMA 2W24A 4DQSA 3JSRA 3OTEA 2F1FA 1S9GB 3VAHA 2CNOB 3CB4A 1FTCA 5C2CA 4TU7A 4F25A 2G0IA 4PZVA 1S10A 5D3GA 2CPFA 4ZITA 3US5A 4JV5F 1RP5A 2H48B 1QVGR 4LSNB 2ZKTA 4RU9A 3M9MB 2KXHA 1JLEA 1VR6A 2YNIA 1NO8A 4OZ0A 2KFYA 3EZ5A 2YH0A 2QRRA 3DLKB 4MTPA 1B0PA 1N5TA 1ZA1B 3THTA 3KK3A 2FLLA 2CPXA 2D69A 1V3RA 3FK4A 1VRTB 2BDPA 4URGA 2MTLA 4NI2B 4USKA 5IV3A 1U47A 4IH5A 3R7NB 3VTIA 3E2EA 1Q7LB 3KLFB 2XZDB 5GMEA 5J2PA 2AGOA 2BKNA 2C28A 2BMBA 1NDKA 2XULA 2I5JA 1QE1B 4KFBA 4PG7A 2HHTA 1TL7A 2CVEA 1HYSB 3IFEA 4NWBA 5ETQA 1RTHB 2BOAA 1S57A 3QPIA 3MMBA 3A8KA 1HI1A 4FF2A 2D3ZA 1H2UX 3N5BA 4M5JA 3I56S 2FJWA 1O51A 3OVBA 1ZOTA 2WRMA 4AL7A 3LGNA 2ASYA 2RT3A 1HWIA 2YNHA 2UXDF 3Q86A 2HQGA 3DRYA 5HVFA 4X66J 3BYPA 2OEMA 4JI2J 3SCLE 2YKNA 3NOGA 4DN9A 3FSIA 1NAQA 2ZJRQ 4C11B 1FA0A 2HFZA 2JLGA 4ELUA 2CPHA 2MLXA 4ECUA 1N6QA 2DGOA 2YNFB 3Q23A 5H9FK 2KJVA 1HBMA 1TMMA 3KG0A 1S9EB 1CBKA 3KG1A 5EWEA 1D8YA 2YX4A 1U25A 4USTA 1JLGA 4LVOP 4JI6F 5F8MA 2IMWP 1RWXB 2WVBA 2M70A 2KO1A 1WKKA 4RW8A 3GIJA 4IRCA 4ZKAA 3MFHA 1DQ9A 2AYEA 3PKMA 3OXFA 1YITS 3VAGA 2P9GA 2ADBA 4LFBJ 3U1LA 1Q5VA 3PFOA 1MW7A 2YQ1A 4CQ1A 2ZITA 3M2VB 1IUJA 4ED8A 4QWBA 2JFKA 3ENQA 4USVA 1URRA 4JUZA 4FS1A 5E3CA 3K57A 2KTQA 1HNVB 4X66F 3Q22A 3MMAA 3D7SB 3MZIA 3C16A 2HURA 3N28A 5K14B 3H20A 4LUBA 2F9JA 4W98A 1IKXB 2CXEA 2DNMA 2L08A 2RUSA 3HHDA 3LOUA 4OI3A 4RNHA 3UVJB 2XLJA 2BW7A 5T41A 3MECA 3EZUA 3W66A 1DTTB 3OXLA 1JIHA 4F4KA 1A9NB 1GNKA 2LKZA 4RJVA 4TXSA 4X62F 4LT6A 4CO1A 3V6JA 2Q6BA 4M63A 1TZ0A 4H4MB 2SXLA 1XTZA 2APOA 3CXCR 4DU7A 3OL9A 2V2ZA 4TY8B 2BQUA 2DGTA 3EXYA 3H4DA 3TOQA 2RU9A 4TU9A 1VQNS 3MXHP 2VD3A 1PCAA 5CYJA 1LW0B 1BD6A 3LWLA 1RDRA 1Q1KA 2WVFA 2VV5A 3FFIB 3OFGA 3R8YA 2OPPB 5CYQA 5D77A 5B0FA 4RX6A 4DS4A 3TJ9A 1S9FA 1U1RA 4B9VA 1UFKA 1XWLA 2C3UA 2JH3A 1RAAB 2BE2B 5D4OA 1IM4A 2H65B 4DCOB 4DUTA 4DX5A 4ZCMA 2VUGA 5HVHA 3TZWA 3V6DA 1IKVB 4K5SA 2MB0B 2WSEC 2GC8A 3BPDA 4O3SA 4MYTA 4DCJB 3J80Y 2BE2A 2CA9A 3RW6A 5D78A 2ZBQA 3H7HB 1HNWF 1WWHA 4UUXA 1SL1A 2GFFA 4JBCA 2Q6CA 1Q53A 1XNQF 1NM2A 4A8XA 2GX8A 4MKVA 2ZH9A 2HQIA 4RW4A 2AU0A 4CLPA 2DHSA 5D4NA 2HVEA 2MGZB 2FVQA 4DR3F 3TUPA 3ISND 3KJVA 3BKFA 3FMBA 1JX4A 1JB0C 1QAIA 1UEUA 1EARA 3JSMB 1YQHA 4ETXA 1VLOA 4PWDB 2FUG9 3KMQA 4Y28C 5D15A 2VODA 4HACA 3MEGB 4LRCA 1FXRA 4CYUA 4NA3A 5KT3A 2J0WA 3HCXA 2UUAJ 1S1TA 3K8VA 3PG9A 1WEXA 4X84A 1GMWD 1VDHA 1VISA 2JL9A 4O3QA 4CYUB 2B4PA 4HH1A 1HWJA 2XSJB 4P72A 4AXIA 3EPIA 1U2RA 2BQ3A 3GR0A 2Z30B 3MPWA 2AQ4A 2HBYB 2UXCJ 2RQCA 2IYGA 5AXLA 1FJEB 2DVIA 1FHTA 1VC0A 5AJ3F 2DISA 2B9WA 5KFHA 2DIVA 4V19J 1X5OA 1QSSA 4N41A 4YB6A 3I32A 4R8UA 1L5UA 4HHHA 3UE2A 3BO3A 3BN4A 3M8WA 4IFVA 3PACA 1UVMA 2EBGA 2HWHA 2V8GA 1UEVA 2HGLA 3TZZA 2QMUB 2WOMA 4Q43A 2AYGA 3TAMB 1NDCA 1RK8A 1Y5NB 3DLJA 4OLOA 1U2FA 1JLAB 4OFZA 4UOFA 2GQQA 2OJ3A 2R8HA 3WC2A 4NXMF 2D1CA 4LR7A 1WG4A 4J90A 5THWA 3HVRA 3KUEA 4R0EA 1AA1B 1WTFA 3T3FA 1Q82T 1F9EB 2HLUA 3PIOQ 1F1BB 4FN5A 3KK2A 2V9KA 4DR2F 5L39A 3OVAA 5BR8F 2BE9B 5JXSA 4LRDA 2DKOB 1TKZB 3PJWA 5KOXA 5ETNA 4N8NA 4FPIA 2E1MC 4NMLA 4N47A 3MR7A 1A7GE 3AODA 3UNYA 4RO0A 2CPEA 2BR0A 1VQ8S 1C1BA 2KFZA 4NYOA 2YWEA 1NK5A 2G0CA 1W25A 4IDKA 2MLYA 3TX0A 6FDRA 3Q8VA 1UETA 3TQ1A 3JSYA 3HD1A 5ETMA 2I38A 5ETRA 1HMVA 2W2MP 3CE8A 2UV8G 4A47A 3QO9B 1B0VA 5HP1B 2J6UA 3UFCX 3NS6A 5L1IA 3PNIA 1S1UB 3I55S 1RT5B 5EUHA 5A0YA 1JNRB 5ETOA 2QC3A 4OHZA 3QFHA 2RKIB 2UVRA 3PX6A 1S4FA 3UDCA 2VBWA 3BGRA 1CULA 2RRBA 2DRDA 1RT5A 5A0YB 3J7YI 1FJ7A 2EG1A 3V4IA 4LR8A 2DEJA 2ZOFA 3BGRB 5GAEI 3PO4A 3BB5A 3Q2TC 1NK7A 4S0MA 4IYQA 5KFLA 3Q8RB 4N77A 2Y1IA 2IDEA 4QYZJ 2IA0A 3NBPA 5D4LA 3SFGA 1T02A 2I9SA 3UR0A 3MM7B 4ZPVR 2CQBA 5KG6A 4MH8A 2V2QA 1S1XB 2CQDA 1JJHA 4DUYJ 2MDAA 3QRRA 2FC9A 1S49A 4JI3J 3D6HB 3SQGB 1Q0NA 2J9CA 2GHPA 2FC8A 5KAKA 2DR9A 3Q2SC 1RZMA 3OR2B 2X51A 3DM2A 4N76A 4LSNA 1OY9A 4WFZA 4AE5A 1YBUA 4OYZA 3UW1A 3GIKA 2FHJD 4GKKJ 1SIZA 4R25A 3MOJB 2W2NP 1WTBA 1UMJA 3FKBA 3R27A 3CGIA 4WZQA 3JSBA 4DV3F 3DDNA 5HI7A 3PW7A 1HD1A 2YPYA 5F8GA 5KG2A 3IAS9 1KLMB 4ZPDA 1YJNS 2V63A 3D6FB 4UF4A 4DG1A 3KLEA 1DQ8A 5A2QY 1M5PC 4WFAQ 1TK5A 1QVFR 2R7SA 3MMBB 5C42A 4P2SA 4OZ1A 3ETMA 2BVZA 3GCWP 4M5GA 4ECQA 3CW2C 1UW4A 2WHOA 3DOLB 1NB7A 2I2YA 2XS5A 1GH8A 1TL7B 2WVDA 3NGDA 3CCSS 3K2YA 1RTJB 4LF9F 1R0AA 2HQCA 3FNNA 1NLKL 2GCFA 4P75A 1LFPA 3DKDA 1HNIA 2DBBA 3SDEA 1KN6A 3LPYA 3R3TA 1TL5A 5ETKA 2RAQA 2CKWA 3CJ4A 4X62J 1XMQF 5KFNA 1FFSB 1RAEB 2P5VA 3PCOB 3OTDA 3SSRA 2DGQA 2VG5A 1HPZA 4QPXA 2BM1A 2VC0A 4AFFA 1CLFA 4F4AA 5KTQA 3PKYA 2J8AA 4AYBD 1SUQB 1GXLA 2M9KA 5J2QB 1Y4ZB 3D3CJ 2O66A 3OLAA 4UOGA 3PY8A 2Y8YA 2X3DA 1VC6A 3AD8C 1UVKA 2EFGA 3G9CA 1M5VC 3DRPB 4IR1A 3VZHA 4AL5A 2CQ2A 2QA1A 4GVLA 1FD2A 4L3KA 2HMIB 1ZA2B 4DEZA 4KO0B 5DZ7A 5GAGU 2HRYA 2UV8A 3NGUA 1J5OB 3CC4S 2NLWA 1RT7B 4DSEA 4BS2A 2JWNA 1WEZA 1XQIA 4U7UK 2Z0GA 1PYTA 2DGVA 3CD7A 3J7YU 1CJKA 3KLGA 1S6QB 1WUUA 4ZPCA 2AWZA 3GLJA 3LWMA 4DL5A 4G3IA 5AXKA 4G65A 4RNOA 1XMQJ 3VAJA 3EGZA 2ZFHA 1C0TA 4FYWB 2QLFB 3W2WB 2CZ4A 2DCLA 3IRWP 3T6JA 3W8GA 1QUPA 2XI2A 5E7OB 3FCWA 3GIMA 1IBMF 4LQ9A 4OX9J 4EBCA 4DR7F 3PM9A 1Q79A 1T05B 1ZZFA 3E8OA 1HQUB 3T1AA 4XK8C 2BM0A 2HFUA 5JMNA 3O2IA 1CULB 1DZ5A 2HFOA 5A2QU 1R27B 3OJUA 1MWZA 2RUGA 2XBPA 2UP1A 2AZ1A 3QO9A 1FERA 2PGCA 4ED2A 3KJVB 1HNZF 2MMYA 3MR6A 2GA7A 1VRUB 1MU2A 4LSLA 3OPKA 3CD6S 1KDNA 2ZVSA 2HHUA 4M95A 2JHEA 3A8JA 2DIUA 1Z2LA 3EDQB 4P7VA 2B9XA 3PIPQ 4DR1J 5A8KB 3G4SS 4IUFA 2UXCF 4N8OA 3MAAB 1SB6A 2HQFA 3A8EA 5M2PA 3M1VA 4M5NA 5E41A 4KKOB 1HBUA 4B9MA 4Y0FA 3R1LA 5IT9U 2IM1A 2BBEA 2OD4A 1C0UA 1XN9A 3HHLC 1UJ4A 3L3CA 1VLYA 5IC6B 1FKAF 2HPUA 4ZDNA 4B9SA 2DK2A 2FJAB 5BYRA 1BQMB 1S59A 3CWJA 3K17A 5F0UA 5KFDA 2FVSA 4O44B 3ZTSA 3DLLQ 3HVWA 3MPUB 1IKVA 4FS2A 1ZPWX 5EDWA 2JOQA 2IC3B 2HHWA 1PGZA 4FXDA 4M5HA 3IBFB 3SBMA 3GU0A 2EXUA 2MKYA 5L38A 4FF3A 1RWUA 2MKKA 4DR5F 2JZ5A 2KYZA 4RW4B 1T03B 1SC4B 2CG4A 4O3PA 5CD4A 1TV6A 5HLFA 4TU8A 3M7VA 1NKEA 3QZ8A 2FJXA 2W2OP 2FZGB 4QPTA 2DO4A 4XDDA 4YFUA 4DR4F 3EM1A 1LWCA 1M1KT 1RLDA 5CCLA 5T7LB 3M6VA 4F0MA 4DZDA 3BKTA 4IQMA 4I68A 2L9NA 3HK2A 1U6ZA 3VGTA 2PE8A 3R1HA 5AE2A 2CNLB 4ES1A 2ZH7A 1BQXA 3KLHA 2DNPA 1HPZB 1TVRB 1IJEB 1IR1A 4OX6A 2K8GA 3R2CJ 1R3NA 4HT7A 3I0RA 4K0KF 2WBMA 4RPFA 5A6PA 1LK7A 1SL0A 4JI0J 1N8RT 4I0WA 2FLOA 2LQJA 2K7JA 4K2XA 4DR2J 1FE0A 3S01A 4GC6A 2YKMA 1FVSA 3QMQA 5HMXA 4B3RF 4PQUA 1SH0A 1Z1ZA 5DDOC 1V9OA 3UPFA 4ZHRB 2DNQA 3EUNA 3ETOA 4QW9A 3J80U 3L7UA 3PRVA 2V2VA 4O0IA 3C6TB 3Q0AA 1DQAA 4DFPA 2UVVA 2W1BA 2MSSA 2F8EX 4ZVFA 4HHJA 3ELHA 2ZE2A 4USMA 4J9KA 2MYFA 2G2ZA 2QA4S 2MPUA 1J5OA 2J5AA 1WELA 2OEJA 3CNQP 5KOWA 3I9V9 2CQGA 1TAQA 2ZBCA 2X1GA 3ZTRA 2PI5A 3H2UB 2MQPA 2MKCA 1S1VB 3HJVA 1JKHA 4QJVA 4FNHA 4DX6A 4QIFA 4G1PA 4ANEA 2MY8A 5K8PA 1C0TB 4IOAQ 3TUZC 1RHRB 3A13A 1AT1B 2U1AA 2IM2A 3O1LA 4LFCF 2D9PA 2YWGA 2ZUAA 3C14B 3OLBA 2JC1A 3D66A 3M8PB 2DCUB 4C6AA 5RUBA 4DPTA 1OQ6A 2MZRA 3C2PA 4OHYA 3HX9A 4LMZA 1CJUA 3PYDA 1NKCA 4KHPF 2ZDPA 2ZH1A 3ADAC 1Y0HA 1H3DA 2QL9B 1Q95G 3EXCX 4OZ3A 3SSQA 3Q8QB 1SKUB 3NNHA 4WTOB 5HROB 1WC0A 4R5PB 2IRXA 1Q8LA 1ELOA 4O23A 2PMZD 1UWAA 3CF5Q 3UCUP 1UPPA 2V68A 1T9YA 2PFDA 2JNJA 3G87A 4MIBA 5JVGQ 3IWXA 3UDEA 3ZZOA 3FBCA 1C2PA 2KRBA 3MUTP 1U48A 4ELVA 4RUBA 4XPEA 1IR0A 2POKA 1BWEA 3TANA 4ECXA 2O01C 3V4IB 3OBIA 2GAHC 1FKOB 3SEOA 4U67Q 2Z2MA 3G8QA 5J2MA 2EK1A 2LP4A 1YJWS 2AEMA 4C3LA 5H9FJ 2VG7B 3DRSA 3OL6A 3OUYA 2XNQA 3CDEA 3IA0A 3GV5B 3HM9A 3M30B 1IBLF 6FD1A 2W2PP 1VJWA 5E0OA 1FX4A 3CSKA 2NXCA 2ZVIA 3PHTA 2ATCB 4NCGA 2GVDA 3C6UB 3PJXA 2YNIB 4UY8T 1AROP 3LP0A 3MM8B 3MM5B 3QSIA 2IC3A 4CH7A 1WHWA 3DM2B 3QBCA 2OMLA 4CZCA 4DL2A 2FLPA 4CCHA 3ZC4A 2CJXB 3RBDA 3FEZA 1VRTA 3H5SA 2IMOA 1QAXA 4PWUA 1NJYA 1BQMA 3PTWA 4J9OA 4NCBA 1UPMB 2ILYA 4FVCA 5JVHQ 3BPSP 4Y2MA 3UDVA 3VVTA 3AOAA 1OYDA 2QX0A 3FC9A 2M7SA 2RNEA 3WX8A 1HI0P 1MWQA 2BKPA 2JFDA 4ILLA 2J0QD 3GJRB 2FDNA 5LM7E 3KK1A 2BJ8A 2DGSA 2EFPA 3TA1A 5L1KA 3AH6A 3SI8A 3X1LB 1V3SA 4OQJA 4L6V3 1KQKA 4DMZA 1U0HA 3MWBA 3QGPA 1KQFB 4CRJA 1SJ3P 2G4BA 1DFDA 4V19X 2VB6A 2KT3A 2BZ2A 2E7WA 3CDUA 3M8QB 4LIRA 2R2RA 2BJDA 3MCNA 5CQGA 2YX1A 4WXOA 9ATCB 1A6LA 2NPIA 1JWWA 3VGUA 3PRBA 2F65A 3EJMA 1QJHA 1RAFB 3FZ2A 1RTHA 5FLXU 1GEHA 1UEKA 1YZ7A 2V4QA 1DRZA 2XB2D 1G1XA 2R7TA 4DV0F 4NLPA 5E5NA 2FZCB 3HHLB 5K9FA 4DV6J 4C9DA 4DV6F 1NU4A 2IAJA 4HKQA 2BJ1A 3QAEA 3KLHB 1N5YB 1CC7A 1H73A 4PABA 4ZVRB 2CQPA 4J9PA 1FRMA 2BUNA 2J7UA 2MLZA 3E01A 3W64A 2AJFE 3VGSA 2H3EB 2XQCA 1Q5YA 3CCQS 4C8YA 5KT7A 3PXGa 1U1LA 3DLBA 2G1DA 2YBVA 4DI6A 2B5JB 1UFLA 2KZZA 2D74B 3DXBA 3H5YA 3CJ3A 3T1HJ 4W92B 3SXLA 5C25B 2UUWA 2FGCA 2HVZA 3VCDA 3T6BA 2ROEA 4X64F 2ILZA 2K1RA 4J37A 5IZHA 1W7WA 2EKYA 2LCWA 3R5AA 4HI2A 1TKZA 3T19A 3KLGB 1U1OA 3J7Z5 4RNMA 4JV5J 2XG8A 3PX0A 5KFVA 4JYAF 1GK8A 1LNQA 1Q8IA 1U24A 2W9CB 1TL1A 3UCZP 3AA9A 2UUAF 2HWIA 1IWAA 3IG1B 5J1EA 2CDQA 3QJLA 2IJRA 1YG0A 2GMLA 4DZ6A 2CJ9A 4J9RA 4UW2A 2R8JA 2VQEF 2NUUG 2B8QA 3HD2A 5MAOA 2DJWA 3ET6B 3JS9A 3QIPB 4WK1A 5KG7A 4DR5J 1X9MA 2E9ZA 1YRTA 5DG8A 2V8DA 3WBZA 4JV2A 3L7PA 2DNLA 2QYCA 4DSKA 1O0PA 1NZ8A 2Z2LA 3ENAA 4UOHA 3H5UA 3OFFA 4F0HA 5BYSA 2DH8A 4PWWA 3HKZD 3V2UC 4ZCIA 4B9UA 2UXBJ 3CCJS 1MSWD 4WKRA 4CT9A 5LOQA 1RBLA 2K7KA 1CJTA 4X64J 1KONA 5J2MB 1KQSR 4K0KJ 3GQCA 3CPWR 1YDLA 1VRUA 2HAFA 2K2PA 4JI0F 3MAAA 2FY1A 2J9EA 1X31C 4CIOA 4HDGA 2HIQA 1TKXA 2H5EA 2KN4A 4CI0B 1JXLA 2RD5C 4YHHF 2L48A 4J9QA 4CH1A 4PEOA 5LSOA 4DL7A 1HA1A 4JI4J 1VMBA 2W7OA 4U7CA 2QLBB 5J2NA 2R7XA 1AUDA 3PW0A 2OSQA 4LBHA 1OO0B 4X4OA 2Y1JA 4ITSA 1PJ7A 3FBEA 1VQSA 2NYHA 4UZCA 3VV2B 1IQZA 1XNRF 5LSLA 4JI3F 2LQBA 5D3GB 3SCJE 3M32B 1MROA 1O8BA 2FHOB 2XWYA 4ES3A 5DQGA 1YJTA 1R43A 2V5HG 2O3DA 4F4ZA 2HGNA 4FKYA 1EQMA 1KTVA 1JXVA 4WBFA 4M1KA 3VHQA 3QJJA 4KGXB 3RBEA 3QRPA 1U1NA 2FIUA 2KJWA 2F4FA 3PFEA 3POTB 1F60B 4IG3B 2ABYA 3W62A 2P9EA 3IM9A 2E5JA 2V69A 4QWAA 2E5IA 1VK3A 2ZH4A 3P96A 2RRAA 3FSYA 5AE3A 4Y2AA 1Q78A 5GVQA 3ILIA 2VIHA 2B6AA 2XCPA 2QL5B 4QIGA 4OLPA 2OSRA 3JTPA 2VKZG 3EGNA 4IG0A 1RTDA 2IM0A 4KRWA 2DNKA 1H7XA 3CJKB 4LF8J 2MY7A 3W65A 2AJ1A 5LXRA 2ROPA 1RACB 4BWJA 2AGQA 1OY8A 3KJFB 2CZVC 4L76A 5IOLA 3KHGA 4J9NA 4JI7J 2MQMA 2PIIA 1S48A 2V94A 4JI7F 3G6XA 4UQGA 1TU0B 1HW8A 1WHYA 5IT9Y 3DLGB 2EFNA 1F2HA 2HVDA 3HHLA 4CNYA 4YMEA 4Q8FA 1XNRJ 1ZM3A 4Z7CA 2ZC4A 2VG5B 1XERA 3ILJA 3FQKA 4R8UB 1JLCB 4DU8A 3TUIC 5HATA 5D0HA 1KEKA 3F73A 2R9LA 2KH9A 1JLCA 5KG5A 3IO1A 2C2EA 3I0SA 3OQ2A 4DBQA 2WW4A 4KPCA 4WE1A 1BXNA 1N4LA 2P2CB 1HBNA 4C7QA 5KFOA 1U1PA 3GMGA 3KK2B 1JMTA 3CDAA 2XGQA 3DMJA 2VONA 4I67A 5CYMA 1VBYA 1FJGF 4GKJF 3MEKA 3DGPA 3HZEA 3IBCB 4F4WA 5F8JA 4F4XA 2DGXA 1CJKB 3EVOA 2FD2A 4RW8B 4EFAC 1M5SA 4FNIA 4LIWA 2CUYA 4YUDA 5EGYA 4KO0A 3NG8A 3QRQA 4ZMMA 3UNGC 7FDRA 1RCOB 1X4EA 2P8IA 4NMXA 1N0UA 1N36F 2IVMA 3M6UA 3JB9k 2XHWA 2AD9A 2V4JA 3UN5A 1X4CA 1Y00A 2HVHA 1EP4A 2BJ9A 1QM9A 4I6YA 1S6QA 1REGX 3R5GA 2W9CA 3RBZA 4DV4J 3RRGA 2QLXA 4LF4F 3QATA 1IBKF 3C14A 3IR7B 1WC6A 4Y2IA 2H4YB 1X4HA 1YX2A 2HQDA 1LW2A 2LEAA 2WVEA 3HFZB 3I31A 3W2VA 3LH2S 4ZVSB 3NP5A 3HKWA 2DB1A 2IRUA 4K8RA 2DPJA 3KLIB 1FNXH 3OTCA 1P9YA 3BV8A 2HFNA 3MPYA 3W2VB 2W9BA 3HXMA 1VQOS 4DQPA 4TY8A 1Q86T 4DOZA 3D68A 2ASDA 1HWKA 1REVA 3DRXA 3KWMA 3SMZA 3TVKA 1Y9OA 2C3MA 4EBDA 1NH7A 5IFMA 5KFGA 2KM8C 3I4PA 5FD1A 2HHXA 4GRSA 1FKOA 1HW9A 3NS7B 3Q83A 4ZJLA 3THPA 2BJEA 4CO4A 3M9NB 2ERRA 2X1FA 1ZBTA 3CD0A 3CMAS 1CVJA 4CLKA 1HNZJ 2KYXA 1R8AA 2DNNA 4GKJJ 2O5DA 3QFWA 2HNYA 2CWXA 2VDHA 3F44A 3IRXB 2WSCC 3Q8YA 4UTGA 2EFOA 3H8YA 3RYLA 3SCKE 5MLCV 2HZCA 2A3JA 1B0TA 5A6WA 2ZH3A 4NCAA 4IO9Q 4CTAB 5E3RA 5KFIA 3I5CA 1XIQA 1K0TA 3HSZA 3EGVA 2C3PA 2WZ1A 3RB6A 2A6OA 3CJ2A 4JI8J 5A8RA 3G96A 1IR2A 4YB7A 2MXYA 2AEJA 3JQJA 1Y3KA 2E5HA 4A8KA 2D3OR 2VA2A 1N33J 4JI1F 2BRLA 1JLEB 3QAUA 5K8MA 1B99A 4PG5A 3OR2A 4FYYB 3GV8B 3FRZA 1HL6A 2E1PA 2OAUA 5C5JA 1O5JA 1SV5B 1YBTA 2LLZA 1U7LA 2Q1LA 2RQ4A 4C3KA 3BN7A 4ZLPA 3OT9A 4ER8A 1D1UA 1KLNA 1D9DA 4CM0A 1MMLA 3W5ZA 3PW5A 1V5IB 2YVSA 2A10A 4QW8A 4J91A 4C97A 3DOKA 5HLFB 1X0PA 3MDFA 3M2RA 1RT1B 4DX8H 1X9WA 1SJRA 1FDNA 4IG3A 4O0NA 2VL1A 4YDDB 2VFUA 3UN2A 1YRXA 2CG8A 4GO7X 2PI4A 4JI5J 1SKRA 2PC6A 3DLEA 2CPZA 4OV1A 2FZKB 3Q8SB 2YNHB 4NA2A 4LFAF 2RE1A 5DQHA 2E5LJ 4YQWA 4EEYA 4OV6A 2CFXA 2KT5A 2AHOB 5B0EA 4CNZA 5I42A 3OVSA 1WC3A 1YZ6A 2DNOA 4WJBA 1BLUA 2RB7A 3MMJA 4F2RA 1H74A 4KSEB 1F5BA 2IVYA 4LRAA 1HIYA 3S7RA 3OV7A 2ZBPA 1QTNB 5K5MA 3PW2A 3G86A 5F3ZA 1TP7A 2W8KA 3VAFA 5GMKa 1ZM2A 3DLGA 1FNMA 1U26A 2B4OA 2XYPB 5A76A 4NZ6A 2DH9A 1RWVB 4IFVB 1WHVA 4TLRA 3TR5A 4GC7A 1FEEA 2QGFB 4NASA 1HI8A 4DFJA 3FMWA 3D0GE 1EZZB 3CJ5A 2W25A 2B4UA 2XMUA 1EB0A 3D0HE 1I94J 1S76D 1KFDA 1ZAXA 3MPDA 4OJGA 1HARA 4CLLA 1UTAA 1E6VB 2JVOA 3HZGA 5HJXA 1ROFA 3ENVA 2DR5A 4ZOSA 3PO5A 1FEHA 1RU2A 1WI8A 2JVRA 2LQ9A 3R2DJ 4QYZK 1BMQB 4RW7B 3GIRA 1RAGB 1TL1B 1FE4A 1TQLA 1VK8A 4OI1A 4DPUA 5C2GA 2XY5A 1NK4A 2Y8WA 3KKFA 4U96A 1OIAA 2LYVA 3KHLA 1C1BB 1ZAWA 3FVYA 1S1WB 4C8LA 4DR4J 4ZN3A 1JKHB 3H59A 3AOBA 3RRHA 1JJ4A 3IP0A 4P71A 4Y34A 1XR5A 3I5AA 4M8LA 2E1AA 3IG1A 4C0BA 3X3UA 3AB4B 4IKAA 4DN0A 2R7RA 3HJFA 2W7AA 2LA6A 5FLXY 1JJ2R 4WF9Q 1BWVA 4ZVTB 2BABA 2ZD1A 4ICLB 4P9SA 1UZDA 5GAGI 2RHQB 4YEAA 1NEEA 1XR7A 5B7WA 3RR7A 4Q0BB 4YOEA 1ITPA 3MURP 2COLA 2ALZA 3DU6A 2RS8A 2XWXA 2XMJA 3NGSA 2IBOA 2RDDA 3CDBA 4BC7A 3BEGB 1FDDA 2J0XA 1KKHA 5CYQB 2HNYB 4DL0C 5AE1A 2GO9A 3QGGA 3MM7A 3PYEA 1NK8A 1U8SA 1HQEB 4DLEA 1YVFA 2XNRA 3P6YC 1YGYA 2AEFA 1DLOB 2QA2A 3C15A 3TZXA 4KYZA 3ZTQA 5LMUJ 1ZM4A 1NZAA 2Y1LB 2KM8B 5DO2A 1HQEA 2IFXA 3GSDA 2ZJPQ 3HMJG 1FI4A 1NPPA 2Z57B 3IRXA 3M6WA 5KG1A 3K5MA 3PEJA 5KG3A 5HQLA 3NGTA 1RHJB 1O6XA 2CIMA 2HFVA 5E3PA 3ZTOA 2N82B 3FCVA 4B3TF 3ENWA 3FGVA 2L9WA 1GMUA 2RQKA 1C4CA 1W2IA 3R5BA 2V9WA 1TL4A 5DG9A 2FHJA 4K50A 4XDCA 3J7ZT 2MGZA 1R8HA 1P8GA 3MM9B 3I4HX 3JYTB 2DXEA 2NUHA 1JQGA 3KFWX 3IAM9 1T03A 4DFKA 5KFRA 3DLKA 2D3O1 1HHTP 1VIOA 4PYDA 3KK3B 2XS7A 4OX7A 4F0KA 2JX2A 2R3VA 3W60A 3ZNJ1 1IWGA 2XMKA 2MKHA 4OZJA 1GFWB 2OFGX 4TVAB 4XTTA 2OEKA 1JK9B 1I51B 3KK1B 3GONA 1IKWB 5EN1A 1AXQA 1Y3JA 4PG4A 1WD6A 3HFVA 2B9YA 3D28A 3POTA 1U0HB 2EFQA 2FLNA 2GIFA 3RAMA 3QYYA 1R7IA 2OGUA 3M8QA 2J9DE 2ZH6A 4JI6J 3ZFVA 2OPSB 2CNNB 4ZLLA 2BJ3A 2HBQB 3BSCA 4ED1A 3I9ZA 1DTQB 2GGPB 4OZLA 3H25A 3CD5A 1SBRA 3N0VA 3W5YA 4J5OA 1HNIB 2KXNB 1WNEA 2K3KA 5K8OA 3V5RA 2MSTA 1Y5IB 4QR2A 1N48A 4H4KA 4O3OA 1F9FA 4YP3A 3TAMA 2C2MB 1U49A 4DWIA 1N5YA 1NJZA 4P2MA 2AKWB 1VGYA 2QLWA 4P10A 2WONB 4TY9A 4P52A 2QEXS 2JEFA 1OWXA 3DCAA 3OTOJ 4NYZA 1OMSA 1F6TA 2NZ4A 2GW8A 2VPWB 2XZTB 5CZXA 4C0HA 2YQ0A 4KGZB 3GIIA 1W2BR 4HYKA 1S6PB 1SVDA 2R42A 2OO4A 2EI5A 1FRHA 2VBZA 1XR6A 3CDWA 4NOHA 1UL3A 4F8RA 4K7QA 1FTRA 2DHHA 3M2VA 4H4OA 4K5RA 3W63A 4Z2XA 5ADZA 5I3UB 1XMBA 2KHCA 1RBOB 2D7SA 1RA7A 3EYZA 4DUZJ 4NXMJ 1S6UA 2QFIA 4DQIA 5K14A 2UU9F 1EP4B 3PR4A 2R7QA 4JYAJ 2F40A 1GTEA 1VS3A 3LF0A 1S1VA 3G71S 5GADU 1VOMA 3BR9A 3GR1A 1BGXT 2LU1A 3D3BJ 4MKAA 1FWLA 4Z37A 3OSNA 1PYSB 3HPOA
chains in the Genus database with same CATH topology
5DQIA 2V4JB 3MTJA 3ZZUA 3J81Y 3EPGA 2GJ2A 3G8SA 3OR1A 2LVWA 1D3WA 4W90B 4G1QB 4MIAA 2LXFA 4KC5A 2RILA 2AYMA 3IS9A 4OHXA 2MJNA 1QTMA 2EK6A 1FNOA 4ED3A 5LJ5Y 3VAKA 3D1OA 4DQRA 4EGLA 1YJVA 2QV6A 3L7OA 3N6NA 1RT3A 4DSJA 3DRSB 1HBUB 3C66A 4IRKA 4KB7A 2DNGA 1PSDA 1VFJA 2D41A 2R2SA 4TN2A 4Y00A 2ZHAA 3T5KA 1B7FA 4NPOA 4QOTA 2JLEA 2VPYB 2GHVC 4RW9B 2IBKA 1HBOA 2VQFF 5D8HB 4E8UA 2KDOA 1N54B 3LP2A 3HFKA 1HBOB 2KRRA 4RBVA 1YJ9S 5G4DA 2DT9A 2KU7A 4WU3A 3BJYA 1LV5A 1TFYA 4ECWA 4ILRA 3ZZRA 2CJBA 1N32F 3WC0A 4F3OA 1NNDA 3QLHA 5J2PB 2PD1A 1M5HA 3OTBA 4HTJA 3G6VA 2YKOA 2OKQA 5KFMA 5DLFA 1P9QC 1CG2A 3NNAA 5I3PA 3Q24A 3MEGA 1X5SA 3M2RB 3RB0A 4RU2A 4DSIA 2G13A 4F26A 4NLUA 3OW2R 3N5FA 3JSMA 1YJUA 4P6QA 2ZH5A 2RU3A 1TFWA 2Q66A 1IKWA 4GMKA 4DFMA 3DOKB 5H9EJ 4LF5F 5B0AA 2ZZMA 2XGPA 3RB4A 2G9OA 2JEIA 4B9NA 3B82A 3HDSA 4I4BA 4ZP6A 4RUAA 4PXCA 2W4CA 4ECSA 3AJ2A 3FEYB 3GB0A 1TKTB 1JNZB 4C11A 2ZM6F 4FXVA 5IM0B 4PQUB 3QWUA 2Z4PA 1UJ5A 4YB5A 4IOCQ 3KNAA 1FRKA 4FPRA 4GO5X 1SC6A 2B5JA 4NL5A 1RYSA 5LJ3Y 2VOOA 3CMES 4B3OB 4I64A 4WFNQ 4LVNP 4KR0B 4CO5A 3VZIA 4HH0A 2CQIA 2F8HA 2WONA 4YDXA 1GAOA 4ID5B 2B4VA 4DR6F 3AHPA 2M2BA 4XO0A 2PA8D 4I2QB 4K4WA 3SV4A 2ASJA 4KGMA 2OD6A 1GX5A 4IFYB 5KFXA 2HGMA 5DDQC 5KFAA 4NRUA 4A8OA 4IR9A 4NLSA 1KNZA 1KVIA 2OPRB 3U1NA 1FKPB 3H98A 4GKKF 1FRJA 4CO3A 3K5LA 2MZTA 2V4RA 3ZZPA 3BQ2A 2CYYA 4ZCLA 3ZZTA 3PDNA 3QIPA 4B3MF 1TAUA 5D4PA 2DRBA 3ISNC 4R5PA 1TR0A 2LMIA 3W2WA 1VQ7S 1CSJA 2ZZNA 2QIFA 3N79A 5A8WB 3O6QA 3D1QA 4ZS6A 2BQRA 2CQ3A 1DBDA 4A8WA 2W7PA 4EYHB 1URNA 1FXDA 1C1CB 2A2CA 4NLTA 2R8KA 4M5DA 2BANB 1D9AA 4QWEA 4EWTA 3MUVP 1WF0A 1H38A 2L3MA 3F56A 4ZVEA 2UVUA 2FJBB 4KV8B 3MD3A 1QUVA 2M88A 2B3TB 4Q2LA 2UVWA 1TK0A 3NMAA 3MPVA 5A8KA 1UA1A 2ACYA 4MMOA 1LQ9A 1DURA 4I7FB 3KHHA 2DGWA 1G3OA 3GE9A 2DHGA 2NSCA 1FK9A 3MHYA 3CIMA 5A8RB 2E7XA 2I0XA 2RF2B 1FK9B 1L3SA 4RW9A 4DDFA 4WFYA 4I2PB 4RWWA 4I67A 2QSWA 3OXGA 2V2KA 1MWYA 2VOPA 3DFEA 3M8RA 2BYCA 1KHVA 3CCWA 3WDOA 4XPCA 3KLFA 2XMVA 1B64A 4Q7AA 3DRRB 2J7KA 5BJRA 4DL3A 4X2BA 3TA0A 1XBWA 3LO3A 3RRKA 2AW0A 3VQTA 4DL6A 3M9OB 1QSYA 1S1TB 1DAXA 1VBZA 2P6SA 1VQLS 3G6ES 2GQ2A 3K7RA 3DI6A 2LDYA 2OPSA 3E3XA 4FP9A 3W3SA 3MR3A 1VQYA 3QIDA 4PUOA 4Y65A 4A4JA 4ECVA 5HBMB 3D5MA 3LALA 3FJ2A 1BQNB 3LGMA 4C8MA 3DHXA 5IM0A 4C8OA 4PUOB 2HVIA 2N4CA 3DHWC 1YWXA 2DTJA 2MQOA 3BDPA 3MGJA 3H40A 4FF4A 3T1YF 3QJPA 2M3DA 1SIWB 2ZDOA 3FEXB 4QQBA 5B0CA 1RA6A 1LXNA 5KG4A 3MEEA 2L41A 3HLUA 2E9RX 2M4MA 4I1TA 4WE1B 5GAHU 4F50A 2BW2A 3E01B 4AXJA 2J76E 1UVLA 1KVJA 4ATNA 5J2QA 2BV3A 5CH7B 1ZTWA 3IWLA 4B3OA 2CPDA 3BZQA 3FCHA 2RMLA 3DOMA 1EETA 4CO2A 2MJUA 4NLWA 5DM6Q 2PDAA 3N6MA 5C24A 4YR3A 2DNZA 4OMFG 3FQLA 1RQ0A 1CC8A 2OMOA 4WYWA 5E3QA 3E51A 4NLDA 5C24B 2FVPA 1WEYA 2YY3A 1RT7A 1APSA 4DV2F 4NXNF 2XMMA 1Z4UA 1ZH5A 2CPJA 1WG5A 2WSFC 3UR3C 4K4XA 5HP1A 3SV3A 3NS5A 2A2DA 5J1EB 1FRIA 3MMAB 3G6YA 5HROA 3K58A 3F41A 4QU7A 2QMWA 1RI7A 1VBXA 4ED6A 1M90T 2CRLA 4WYLA 4X4PA 1C1CA 1VQ4S 2ZC3A 4KBIA 4YY3F 5GAEU 4R0JA 5KFKA 1JLQA 1U1QA 5A8WA 2VZ9A 3HI9A 3S8SA 5HL7Q 2VASA 2LQ5A 2IHR1 3GWCA 5IQQA 4BC9A 1HWLA 2CJQA 3ZZZA 3OHBA 4KT0C 4JI2F 2XCAA 3NKYA 5HMWA 5I4MA 2ADCA 4EZ6A 3HHEA 3R5DA 1C0UB 4A8FA 4JOUA 3I5BA 1R8BA 2B56A 1LW0A 1S1XA 3V4MA 5IWAF 4QIWD 2M8DB 1ZTTA 1FDAA 2ZBIA 3QJLA 4KHRA 3BS9A 2C42A 2RF2A 4QZVB 1DLOA 1T94A 3LP2B 4NLVA 1Q4RA 1WF2A 5KFWA 3IN5A 1AFJA 3KG4A 1YIJS 4EBEA 4K59A 5KFPA 4AQYF 4KPYA 4RBTA 4EUVA 2IRYA 1RTIB 5LMUF 3D54A 2GQCA 2EW9A 1X8DA 5G0RA 2IVFB 1WF1A 5F9NA 5KFYA 3KJVB 2HHPA 3HVTB 4WKRA 4O4GA 4URSA 2AF6A 1L3VA 3HVAA 1S79A 1KLMA 4Q8EA 3PHEA 1K1QA 2HAIA 2PMHA 1T3NA 3SCIE 1X4AA 1IKYB 3MD1A 4M94A 2CPIA 2A1BA 5KFFA 5DRKA 3NL0A 3UDLA 1D0EA 1P27B 2E1RA 3S1TA 2JDJA 3GV7B 4DV7F 2OLWA 4X4VA 1FF2A 4TLQA 2LXIA 5FJ4A 2B0GA 2FHMA 3TW0A 4URQU 4DLGA 5LXYA 2B6AB 2RDJA 1P6TA 1VC5A 4B3SF 4ERDA 4J9LA 4ZCKA 4LF6F 1FT8A 2FPHX 1JLFA 4K4YA 3FSXA 5B0BA 3BGFA 2CJKA 1WHXA 1C4AA 2ZOMA 3TUJC 2KHDA 2YWHA 4QCLA 2DR7A 3CCTA 4PXDA 1Y5LB 2HLTA 2ATLA 1FJCA 3LP1A 1S7HA 2F7VA 2FJDB 1YBAA 1L3UA 4PQAA 4HI1A 1YRUA 3BQ1A 3I0SB 3RR8A 3EGWB 5KG0A 4RLEA 5HO4A 2YKMB 5EWGA 1SUQA 5E3AA 2IJNA 4NLYA 2WOMB 4B08A 1SKSA 4FYDA 1ZAVA 3FZBA 4KAIA 5I3UA 2MKJA 2UZAA 3TI0A 4WU2A 1OSCA 3CVKA 3BF4A 2CJAA 1FKPA 2HS4A 4DR1F 1S0MA 1OS5A 2Y0SD 3QWPA 2M0GB 1EETB 2L9DA 4ES2A 3T9ZA 3QGIA 3WX4A 2IJFA 4ZPWR 1G7CB 2VPZB 3CC2S 1Q16B 2KG1A 1I1GA 3ONQA 3DYAA 1RAJA 5EHHA 2FB0A 3AJ1A 3NAIA 5E2QA 1HNVA 2QT7A 3LANA 1IN0A 2XZWA 1S1UA 1N52B 2M5YA 3M8PA 1IKXA 4UOCA 4RKUC 3NAHA 4AL6A 2WB4A 4OZ5A 1U09A 4WFBQ 2WW8A 2RRNA 4MK7A 3OTOF 1S72S 4IH7A 3M6XA 3K59A 2ZD1B 4G1QA 3L09A 3JAMY 3MUMP 2NSBA 1TL3B 3CCUS 2NR0A 3GYXB 4JI5F 2NYIA 1JLQB 2NREA 3C3LA 4IRDA 1UJ6A 2R7OA 3ZZ0A 2MHNA 5LT5A 2WAQD 5EWFA 4CTAA 3CULA 2AJ0A 2OPQA 1PC4A 1TKXB 4U6PA 4PPDA 4KGKA 5CZVA 4TQRA 1WG1A 2XMWA 3MCSA 2BOPA 4WFXA 1N33F 1VI7A 4FZVA 4RUHA 5B09A 4HEA9 5F8NA 3VF0B 4DUZF 3CTRA 3PV8A 3MM9A 4ZP9A 2AJQA 3C6UA 1NJIT 4O4GB 4RWXA 3DNCA 4WXWA 3HF5A 1FCAA 2E9TA 2MHEA 4C8NA 2HHSA 2HNDA 4RNNA 1NRKA 4OZNA 4ZK7M 3O3LA 5HQ8A 2XY7A 4A48A 5CXTA 1AW0A 3PX4A 1BC6A 1E6YB 1SJQA 5AXMA 4IQXA 2D9OA 2CVIA 1G1XA 1HYSA 3K5OA 2YKAA 5F3TA 5HN0A 5GAHI 4DV1F 5T7LA 5DS7A 5L9NA 2XY6A 2KB2A 2OTJS 4ZPAA 1X5PA 4YR2A 4PWDA 4ZPTR 1RTDB 1KD1T 1X0FA 1S0NA 1NJWA 1BQNA 4RZRA 4J9SA 3MTKA 4U9RA 1RT1A 2XS2A 4C8ZA 2EPIA 2KVIA 1OQ3A 2B51A 4CO1A 5I42B 2AX0A 3DI6B 4WTYA 3M05A 3U1MA 3WZ0A 3JTOA 5KFBA 1JXEA 2ZKUA 1NH8A 2GMJA 1FRLA 4F67A 2FJVA 5HBMA 3LP1B 4OX8A 2MKSA 2NQPA 3HT3A 5L9XA 2RS2A 2ZUGA 1XC9A 4IOBA 3TVYA 4BDPA 3H5XA 1D8ZA 2VG6B 5KFEA 4EO8A 2VA3A 2YKNB 3VAMA 2R2TA 1S9EA 2FVRA 2YNGA 5CCMA 1JLGB 2DHXA 3V6KA 2ZE2B 1X4DA 1GT8A 2VFVA 4NRTA 2F3JA 2DR8A 5DDPC 3HHNB 3CCMS 1N6QB 4Q2MA 4ZHRA 2HYIB 4LJMA 2R8GA 5H1SV 2W9AA 4L72B 1JLAA 2FVCA 1X7VA 4G6VB 3K5PA 2M8HA 2XI3A 3H2VE 3U27A 3CCLS 3AB2B 2V8VA 3EX7B 5DJBA 2MQNA 2ZHOA 1RGVA 4QBUA 1R89A 3H4BA 4KHMA 2PEHA 5KT4A 2DNRA 2R2UA 3GYNA 2LECA 4LFBF 4X4QA 3NWGA 3UCGA 2WB1D 3BO4A 1RT4A 2AYBA 2QO3A 1U4BA 3RU0A 3NMRA 1Y7PA 1KC8T 2KZMA 2W9BB 4TYBA 5BYQA 2DHAA 3GG1A 4O4RA 2BXJA 5E33A 1ZYQA 2VFTA 1Q81T 2EFVA 3RTVA 1LK5A 3JTNA 4X4TA 2XSFA 4DHVA 4DV4F 1K9MT 1KR4A 1X4BA 4A8YA 2RSQA 3GFXA 2AJ4A 3OL7A 1N88A 2XMTA 4XAKA 1ZPVA 5DGBA 3BQ0A 3IS9B 2HW3A 4L3NA 5D6GA 1S0VA 4RBUA 3NBPB 1SL2A 2BANA 3TO8A 4UQTA 4E98A 5DG7A 4QR0A 3NCPA 2C3OA 1XMOF 2GV1A 3KTQA 2MZQA 4MYUA 4NA1A 4KTQA 2OPPA 2HS0A 3NGKA 3TAQA 4X4UA 3OUYB 1RTIA 4NLXA 3M30A 2QSFA 5CD4H 4IH6A 3D2WA 4ELTA 2OP5A 4QR1A 1PO6A 3OSPA 3SSSA 3GFHA 3HVTA 3W7BA 1TKDA 2LXUA 1S77D 5DLGA 4C3MA 2JLFA 3NNCA 5JJBA 1ZZNA 2W4DA 4C8KA 4NLGA 2IYIA 4HL9A 4DF4A 5FDLA 3TP2A 2AP6A 4RW6A 4BCAA 2R4FA 2N4DA 5FDLB 4ED5A 5HMZA 3MR2A 2MQQA 1RT2A 2EWHA 2HNZB 1UWBB 3MI7X 4TYAA 4USJC 4YR0A 1TV6B 2B7CB 1N5VA 2VKRA 2JC0A 3MAQA 1UP1A 3MMCB 3NLCA 4NLRA 3QGHA 1UA0A 1TK8A 3V81B 1N5SA 3K5NA 2PN6A 3PW4A 5KFSA 1DTQA 2GGPA 2GHWA 3T9NA 3AA8A 2A18A 1YSJA 4N56A 3BSOA 2C22A 1JLFB 4ED7A 4K4TA 5L8RC 2PSZA 5J1NA 3IR6B 4GKJF 2RIJA 2ROGA 1N5QA 1MMDA 2OIHA 2FTRA 3NRBA 3MEEB 4ECTA 1ZETA 4Y3CA 1S0OA 1D9FA 1HFEL 1U45A