5IY5E

Electron transfer complex of cytochrome c and cytochrome c oxidase at 2.0 angstrom resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Complex structure of cytochrome c-cytochrome c oxidase reveals a novel protein-protein interaction mode
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 40
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2016-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 5iy5E00
3X2QE 3ABME 3WG7E 2ZXWE 3AG4E 2DYSE 2OCCE 3ABLE 2EIME 2EILE 2EIKE 3ASOE 1OCCE 1OCZE 2Y69E 3ABKE 3ASNE 2EIJE 1V54E 5B1BE 1V55E 3AG3E 2EINE 5IY5E 5B1AE 1OCRE 1OCOE 3AG2E 3AG1E 2DYRE 5B3SE
chains in the Genus database with same CATH superfamily
2F8YA 3SHFA 2DWZA 3CVQA 2A5EA 1OCZE 4U96D 5BXUA 4J0UA 3IBEA 3TWWA 5A6CA 2WXMA 5D66A 2DVWA 5KBAA 2GRQB 4I1AA 4AXHA 1EDUA 4AJWA 2R59A 3S2AA 1E7VA 5G04J 5FQ4A 3B7TA 2OCCE 3ABLE 2KCKA 3PZ3A 4CDMA 3ZFWA 1EPUA 4XI0A 3FFLA 4GTTA 1SQMA 3DSWA 4EPZA 5IY5E 4E6HA 5B3SE 3HVEA 4X8QA 2ETAA 2IU1A 2AVPA 4FLBA 5JHAA 4N2SA 4AOFA 4JZYA 4Q94A 1OCOE 4OYSA 3T5VA 4GZDA 4BX9A 2WMNA 3D3MA 3ZGQA 2R03A 1RZ4A 3CKCA 3L6AA 1L5JA 2YHCA 3UM1A 4Z68A 3NOCD 4G8KA 4I2ZA 2EIJE 1U3CA 2BKGA 3SBSA 2A4ZA 3LY8A 3CVPA 4ILGA 1BLXB 3PE3A 3TJPA 4LEUA 1DCQA 5FQ7A 3RO3A 3MA5A 4JEHA 2KZTB 1MZCA 2J07A 4ACKA 2EIME 2XRYA 4BEPA 4F53A 1SVXA 3B7BA 3SZ7A 3V31A 2JEKA 4G8LA 4JVSA 4IYPA 3ZHEB 4J8SA 5FZSA 5FINA 1HS6A 2H6HA 5CECB 4GTRA 4PUCA 2GRNB 2HR2A 4H7YA 2QC9A 4W9RA 3RRUA 5E76A 3T5XA 3EHRA 4KXKB 3ZIMA 3FY4A 4BETA 1E8ZA 5DBKA 4J8FA 4YDEA 4B94A 4HNAD 4HS2A 2V5QC 4R7LA 4N5CA 3RU0A 3KD7A 3Q75A 2AJAA 4ABNA 3C98A 4G26A 4CEMA 4CGWA 3TXMA 1E8WA 2XS8A 4KVOA 5EN5D 1K1AA 1NP7A 5ENOD 4ZFHA 3I3NA 2J08A 5AN8A 1OCCE 2VGXB 4J8EA 2E0IA 4DLQA 4CZ2D 2PL2A 2WXQA 4A1GA 4BERA 3FUMA 3VTXA 1HZ4A 5CCMA 2X38A 3Q78A 3FUHA 5H7PA 4LSZE 5CEAA 3OXGA 3TGOA 4DX6D 3PEVB 1WDYA 1BI8B 3MKQB 4F1SA 2KXPC 3CHPA 3PEUB 5JMND 2J8SD 4K5CA 5ENNA 4F6RD 1V55E 3QWPA 4FHJA 2H6IA 5J08A 1NA3A 3OAWA 4C0MA 3APFA 2H6GA 4HI9A 4B8AA 3LS8A 2ETCA 2P9UG 4N39A 2A5UA 2WXRA 1KT0A 3C3OA 3LPZA 3QKYA 2P2CP 4A3TA 3G2VA 3ONKA 5FT9A 4GAAA 4HOTA 2VJ8A 2PQNA 2X6KA 4GZ3A 2PM7A 3SQVA 4G11A 3LVRE 4AY5A 1TNBA 4JPSA 2AW6A 3CR3A 3JXJA 4I6EA 4EZJA 1HXIA 4UQXA 3OXLA 3ZUVB 1W3BA 1LD8A 3QB2A 4CYMD 2KC7A 2ILRA 3ZVVA 5AJLA 4AVXA 2B0OE 1JUQA 1LF8A 1OWMA 2Y1LE 2BKKB 3IXEA 4BSZB 3UPVA 3B13A 3IHVA 4CCAA 4UWHA 1N4QA 2GROB 1KT1A 2VSOE 3D9LA 4RG9A 4U8YD 2NXPA 3KSQA 1U2VG 3B95A 4JA9A 4ANXA 3I4GA 3ZN3A 1X5BA 1AWCB 3VLEA 2R2LA 3JCKC 1WM5A 4HI8A 2P9SG 3G2SA 3TG4A 2LUHA 4XKBA 4KBQA 5M72A 4RQIA 3CHOA 2R17C 2V4HC 4HQDA 3JUIA 1S63A 4HB5A 1FPPA 1FT2A 5KCMA 5AJDA 2XEEA 3J5QB 1BU9A 1NFIE 4J7WA 4HORA 2WM9A 3DSSA 1UOHA 1QBQA 2PZIA 2IO2C 3JUEA 3FTUA 3JYSA 2IEJA 3UTMA 3W9FA 2H6FA 2CG2A 2F0YA 4A55A 2V4LA 2MYOA 3FUEA 4U63A 2KZTA 4Y6CA 4UWGA 4I6GA 5ENPD 1Z3XA 3U9WA 4L7TA 4EZLA 5FQ6A 2UY1A 3P1UA 2XGOA 2XS1A 3DXKG 3PZ2A 3ZHEA 3UT4A 4U04A 3PNLB 4GA2A 1FCHA 3WG7E 2ZXWE 2J09A 4FC8A 5LCWC 3KSLA 3APDA 3RAUA 3V2OA 1TR4A 2GW1A 4O60A 3E33A 1SW6A 4AV7A 3LXUX 3FULA 4ILHB 3ONLA 4CDNA 5BNWA 1EF1C 2WXNA 3Q5MA 3TL5A 2MOWA 3HXFA 4F7AA 4PH4B 2RG8A 3T8MA 5FJYA 3CQCB 1QZ2A 4IN3B 3L22A 3ASGA 2L9BA 4UQYA 3UINC 4I43A 1MX4A 1IXVA 4GTPA 4NURA 2XPZA 4HVBA 2I6HA 3E32A 3G2UA 1HE8A 2LSVA 4B89A 5LP0A 3QK0A 3PS6A 3CHQA 3T9KA 2XGSA 3RRNB 3FH7A 3R7RA 3RJVA 1MHQA 4G2VA 3PUJA 5ITZF 4CDRA 3DEPA 5ENQD 4WUYA 4UWFA 3MKQA 4C48B 2RFMA 3PREA 2KCLA 3R7QA 1FVHA 2GRMA 4DX2A 4G25A 3GZ1A 1QNFA 2R5SA 4WWNA 1O1RA 3B7RL 3CHSA 4N5QA 3ESLA 3FUIA 2IY0C 3SD5A 3EU5A 5LCWJ 3GYZA 5KNGA 2P9KG 2X6JA 3HIZA 1UW4B 4U07A 4A3VA 5HQ8A 5D0QD 2J4DA 4XEIG 1IQUA 4B0ZA 3CVVA 3DBSA 4GPMA 2QY7A 3PZDA 3DSUA 4WWPA 1YMPA 2CHXA 3TWQA 3L54A 3FWVA 3SNXA 3OTNA 3Q4AB 3S7FA 4H7XA 3MJWA 4GZ5A 3RK6A 1ELRA 4EECA 3CHRA 4HFGA 4J8DA 2DYRE 5CRVA 4YDYA 2QYJA 2WPVA 3RKVA 2ZISA 2VTBB 5HS0A 2J49A 3HXBA 5AQBA 2VQ2A 1Q2ZA 1WY6A 4JHJA 2XHEA 1ELWA 4LCTA 2KM4A 3MV3B 3L08A 3X2QE 3BEEA 2AXUA 2WQ6A 2IO3C 4HOSA 4BTAA 3ZEFA 3UKUG 2YQ8A 3CVNA 4WNFA 5ARFA 5ANLA 5EX3A 3E4BA 3TWTA 4BSXA 4GMRA 3UM2A 1H6KA 3ZU7B 5JA4D 4ANVA 3LEWA 3CSTA 3D9IA 4LNUD 3CK7A 3UIPC 4EQFA 3NZSA 3ZRHA 2VSXE 1BPOA 3O48A 4HOQA 3SFZA 4JEUA 4EBAG 4BFRA 2PM6A 1E96B 2LXMA 4BESA 2YNQA 3QC1A 3Q9UC 3FU6A 5BV1A 4KMOA 2BUGA 3K9IA 4FLHA 3NBNB 3SBTB 4DJAA 4GB9A 4B8CB 4YVQC 2XENA 4RVBA 2GRLA 2IF4A 4EHMA 4O1PA 5FWQA 4U7EB 3FUNA 3DRAA 2CHWA 1N11A 4N2QA 5AARA 2WXGA 4DX1A 4APFA 3LY7A 3LYAA 4U0UA 3UX4A 4TXQA 2E2EA 1JWFA 2HYZA 5AYWD 1Y8MA 4B93B 4M3OA 4GTOA 4AP2A 3ZXSA 2ZGDA 1RW2A 3FU5A 5AQAA 5ANRA 2XQ0A 3ASFA 3PUKA 4GPKA 3UUXA 5KWDA 1LD7A 1IHGA 2OOEA 4EZKA 3AU4A 3MX3A 4CT4A 2EILE 2EIKE 2OVFA 2P9PG 2LSUA 4I1OB 2OEVA 2Y0BG 3DWLG 2UWJG 3LJNA 2IOSA 5CBNA 1OWOA 1Z3YA 2GRPB 1H6OA 2QFCA 2HE0A 2MHKA 2R02A 4ATZD 3CVUA 2J9QA 4F3VA 3ZYQA 1BI7B 3JXIA 3HXEA 4ILIA 3KAEA 2CFZA 4V3IA 3UKRG 3EHNA 5JHBA 1BD8A 3FTZA 3V79K 3ASOE 2X6HA 4CT0A 3OXFA 1ZB1A 4HRNA 3U66A 3ZYKA 3E30A 5HRYA 3FDHA 4RG6A 5BV0A 4KYOB 1UG3A 4GYWA 3UXGA 3HG0D 3EUVA 3G2WA 4ME2A 3Q7FA 2XEHA 2XZTG 5A7DB 2FEZA 4FU3A 4MKTA 1JCRA 1TEZA 4UI9C 3LKUA 5EYPF 3LJ3A 3CKBA 5D0OD 2IONA 4ANWA 4UI9K 3VLDA 1NA0A 2V0PA 4FJZA 3MKRA 5CCLA 5ENRD 5FZRA 1VDYA 4DK5A 1A5EA 3DSTA 4LUNU 2DIWA 3FEXA 3KEAA 1UN8A 3ULEG 3CK9A 3KS2A 3QAQA 4A1SA 5E75A 3T8KA 2CFUA 4GYOA 4AY6A 2FO7A 2HO1A 3AG1E 3CEQA 1TN8A 4GMLA 2KATA 1LTXA 2WXKA 5KJLA 4MLPA 5LFAA 3CQGB 2AXVA 4D10C 4FA6A 4K5AB 1H6PA 3MCXA 3E34A 4U8HA 3UT8A 1KPSB 4XZ4A 4BY6A 3HVEB 3DSXA 2XZDG 3SGHA 1FVFA 5HKPA 3NF1A 2FI7A 2NYJA 1JCSA 3AG3E 1YA0A 4I17A 3UMVA 3MV2B 2KCVA 3N71A 2KBXA 4UUCA 3L16A 1S70B 1AP7A 4FADA 4TV3A 2IJGX 3TWVA 4ACLA 1DNPA 4L1BA 1TN7A 4GYYA 1HG5A 5BPPA 1E90A 4N3CA 3DEOA 2BF0X 5CMYA 5JJ6A 3TXNA 2VSYA 3DXMG 1QYMA 2VYIA 3ABKE 2WVIA 4DPRA 3D9JA 2BTDA 4JA7A 1OWNA 3AS5A 3SFXA 2LNIA 1N54A 3ASDA 1N0QA 5CEDB 3IV0A 2LXLA 4DI3A 4OAVB 1TJCA 2I2OA 4NRHB 3HXDA 3CK8A 1EYHA 3ZNGA 3CVWA 3TWXA 2EQXA 2OEWA 4OVUA 4O1OA 2OV8A 2WXOA 4C0EA 3QJZA 2C2LA 2YINA 1KLXA 2FBNA 1TNOA 4RLYA 1WG0A 4WAFA 2NC9A 4G23A 3Q49B 4LNGA 4U8VD 5T8IA 2WXIA 5EX0A 3HXCA 5FIOA 4JHRA 3FUFA 4HRLA 3RIBA 1Z6TA 1E8YA 5BUZA 1K8KG 4E85A 3PZ4A 1OT8A 3NQPA 1O1TA 4JB8P 2AXZA 4XKCA 4U0ZA 5G05C 3NZUA 4KVMA 4GU5A 3C3RA 4L2LA 2VGXA 1OWPA 3CGHA 4G1TA 5ENTD 2ZU6B 4DRXE 3FEYA 4Y6WA 4J8YA 4Q96A 2M63A 4FULA 1B89A 3ZXPA 1HX8A 3FHEA 3SY2A 2IFUA 3SO8A 3I5PA 1HU3A 5CERB 3TWRA 5C2YA 2B6CA 3I4RB 5AQ9A 3ML8A 3FP3A 2WQ7A 2WQHA 2Y3AA 3D9OA 2WXFA 4UWKA 4AIFA 3R9MA 4L23A 3L13A 4IULA 3QWVA 2P58C 3SI5A 3FU3A 3HDXA 4HXIA 3QARA 3GZ2A 1OY3D 3FU0A 2RFAA 2P9NG 3AU5A 3AG2E 5ENSD 4JHKA 3CV0A 3ABME 4K0RA 5LOZA 5KJKA 3EHQA 4DX5D 2I9CA 4CRWA 3QWWA 3J5PA 2IOLA 3ML9A 3C72A 1SA5A 4JW1A 4APOA 1A17A 4TUMA 4BTBA 1HF8A 5T4YA 3LCAA 1DC2A 3C3QA 5G05J 1H2TC 2Y69E 5CBOA 4K03A 3CVLA 5KJNA 5CRUA 1OUVA 4WNGA 5T3RA 4OVVA 4C9BB 1TYQG 3PE4A 3TG5A 2Q7FA 3ULYA 3WXXA 1FT1A 3EJNA 3QOUA 4HLLA 3UM3A 5G2NA 3ZYLA 3GZSA 5ARGA 1ELKA 1S0PA 1N95A 4YVOA 4HLEA 1IHBA 2XGMA 1IKND 3EHMA 2GRRB 4I9EA 5KNHD 2I1KA 4XX5A 1OWLA 1D8DA 3RO2A 5G55A 3MEKA 3L17A 3UT7A 4JC8A 2DBAA 2LAHA 4PS3A 4L9PA 1QQEA 3FH5A 1INZA 4RSYA 4CGVA 2WMOA 2GGFA 1K1BA 3S7JA 3CVYA 3DPYA 5J90A 5EKQD 3ZYMA 3FTWA 4U0SA 5B1AE 2F37A 1HG2A 3BG0B 3JQ0A 1KZOA 4AEZC 1TJFA 1JPLA 4GZ6A 4BX8A 5JJ7A 1UJJA 1DVPA 2IQCA 1U3DA 2UY1B 2DZOA 4GMJA 4XE0A 1XNFA 3MYVA 2EINE 2P9IG 3S7DA 1DCEA 4LG6A 4PS7A 2LAIA 4O6FA 4ZHBA 5CMWA 2J4BA 2WXHA 2CHZA 3ASHA 3Q47B 4HRMB 3PH0C 5A23A 3D9MA 3FTXA 1JCQA 4ATGA 3S7BA 1H0AA 1N0RA 4YDWA 1O5MA 1IYGA 4PS8A 4GZCA 2L0TB 1H2VC 3EIJA 3R9AB 4BT9A 3HRAA 1HH8A 3HHMA 4XI9A 5BW8C 2BEDA 2FULA 2V8SE 2RD0A 4GA1A 5BT1A 2ZIRA 3AJIA 3TWSA 4MRUA 3O4ZA 4GCOA 2Y4TA 3NAWA 1PY1A 1KZPA 5JJTA 2XPIA 4MS6A 2I1JA 5EILA 2YHEA 2AWIA 1MX2A 1O1SA 3TWUA 1IQRA 3L82A 3URZA 5BXOA 3CSFA 3QNKA 3EIQC 3SF4A 1TNZA 1X81A 3APCA 4M7CA 1TNUA 4JXTA 2C0LA 4GA0A 1MQSA 4DX7D 2F8XK 3FUKA 4UWLA 3ZKJA 3CLJA 4LRZA 4I6JA 3PDNA 3BG1B 3MGBA 3FH8A 3ISMC 4HBDA 4K5BA 4IRUA 3W9GA 3C5RA 3PNTB 2FO1E 2Y4UA 4LERA 4UQZA 1HFAA 2HM8A 3RSEG 3ZW3A 1NI1A 5AIJA 3U3WA 4URKA 4WNEA 2X6IA 4DLOA 4J6IA 3NB2A 2VSNA 2WXJA 3QDNA 3SFYA 3PVLA 3AAAC 4Q69A 1D8EA 2WXLA 4HOUA 3UQ3A 1G3NB 4TRQA 4A63B 3Q79A 5EIDA 1SZAA 4GCNA 2ONDA 5FTPA 3AS4A 3BU8A 3BUAA 2JLBA 4OAUC 3KEZA 4GTSA 2MRIA 1JWGA 4NQ0A 4BWRA 4XIFA 4KT6B 2VTBA 1NL4A 1UN9A 2QZAA 2WXPA 4NIKA 3FUDA 4DUIA 3Q73A 3LY9A 1SA4A 1MJ0A 2DCPA 1ZBPA 5DIZA 3Q9NC 4ANUA 3ENEA 5D2MC 3IKOB 4JL0A 1NZNA 3GW4A 4WWOA 3IHYA 5LX8A 3D9HA 4EBAA 1N4SA 4GTVA 4NACA 4WNDA 2ETBA 4I1MA 3ASNE 3RRMB 5CHEE 2L6JA 4TXRA 2L6BA 2NSZA 2PNNA 2DZNA 3AG4E 3U4TA 4TXPA 3ESKA 3L9TA 3Q15A 3ZPJA 1SZ9A 4N3AA 4UI9J 1MX6A 3V30A 1Y6IA 4FHKA 3FTYA 4P29A 2P9LG 2XRZA 5C1DA 3D9NA 4GTMA 2RKKA 3LVQE 4AM9A 3CIAA 2PQRA 4U95D 1N94A 3PRZA 1Z5SC 3CHMA 3HYMB 1E8XA 3JQ1A 4I2WA 3UI2A 4QQIA 3U64A 1TN6A 2LO6A 3VTYA 3FTSA 5HI7A 1V54E 3VLFA 1WAO1 3CVXA 2WB2A 1HO8A 2XPYA 3PZ1A 3TAXA 2V5FA 3FUJA 3MZLB 1PC2A 2X3MA 4QFVA 2OVBA 4N3BA 5B1BE 4F1PA 4JD2G 3EU9A 1K3ZD 2JABA 2DYSE 3G2TA 4YDOA 4FP7A 4PDXA 5EDSA 4TUUA 3E37A 3Q7AA 1N9AA 1H2UA 3DSVA 1OCRE 2QYUA 4KZ0A 4LNBA 4YNDA 3FTVA 3EDTB 3DPDA 1H19A 5G04C 5FQ8A 3UM0A 1TNYA 4G24A 1UJKA 3P2BA 2XCCA 1GW6A 1YCSB 5KJMA 3NOGD 1YYHA 3B7UX 2L0IA 4GTQA 4BT8A 3UIOC 2FF4A 3BQOA 4DI4A 5AQ7A 2VGEA 3ULQA 1OXJA 5FZQA 1N4PA 2ZGGA 4FJYA 2X6FA 2XEVA 3D9KA 1MYOA 1PAQA 3B7SA 1E7UA 3V2XA 1ZU2A 3AS8A 2R05A 1N52A 3IEGA 5AENA 5EYLA 4KZCA 4L2YA 4MBGA 4I9CA 3D9PA 5EIBE 1S64A 2CG3A 3LDZA 3F6QA 2C0MA 1XGWA 5AAOA 1N4RA 2XCBA 1D9SA 1P5QA 2VGYA
chains in the Genus database with same CATH topology
3X2QE 3ABME 3WG7E 2ZXWE 3AG4E 2DYSE 2OCCE 3ABLE 2EIME 2EILE 2EIKE 3ASOE 1OCCE 1OCZE 2Y69E 3ABKE 3ASNE 2EIJE 1V54E 5B1BE 1V55E 3AG3E 2EINE 5IY5E 5B1AE 1OCRE 1OCOE 3AG2E 3AG1E 2DYRE 5B3SE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X2Q E;  3ABM E;  3WG7 E;  2ZXW E;  3AG4 E;  2DYS E;  2OCC E;  3ABL E;  2EIM E;  2EIL E;  2EIK E;  3ASO E;  1OCC E;  1OCZ E;  2Y69 E;  3ABK E;  3ASN E;  2EIJ E;  1V54 E;  5B1B E;  1V55 E;  3AG3 E;  2EIN E;  5IY5 E;  5B1A E;  1OCR E;  1OCO E;  3AG2 E;  3AG1 E;  2DYR E;  5B3S E; 
#chains in the Genus database with same CATH topology
 2F8Y A;  3SHF A;  2DWZ A;  3CVQ A;  2A5E A;  1OCZ E;  4U96 D;  5BXU A;  4J0U A;  3IBE A;  3TWW A;  5A6C A;  2WXM A;  5D66 A;  2DVW A;  5KBA A;  2GRQ B;  4I1A A;  4AXH A;  1EDU A;  4AJW A;  2R59 A;  3S2A A;  1E7V A;  5G04 J;  5FQ4 A;  3B7T A;  2OCC E;  3ABL E;  2KCK A;  3PZ3 A;  4CDM A;  3ZFW A;  1EPU A;  4XI0 A;  3FFL A;  4GTT A;  1SQM A;  3DSW A;  4EPZ A;  5IY5 E;  4E6H A;  5B3S E;  3HVE A;  4X8Q A;  2ETA A;  2IU1 A;  2AVP A;  4FLB A;  5JHA A;  4N2S A;  4AOF A;  4JZY A;  4Q94 A;  1OCO E;  4OYS A;  3T5V A;  4GZD A;  4BX9 A;  2WMN A;  3D3M A;  3ZGQ A;  2R03 A;  1RZ4 A;  3CKC A;  3L6A A;  1L5J A;  2YHC A;  3UM1 A;  4Z68 A;  3NOC D;  4G8K A;  4I2Z A;  2EIJ E;  1U3C A;  2BKG A;  3SBS A;  2A4Z A;  3LY8 A;  3CVP A;  4ILG A;  1BLX B;  3PE3 A;  3TJP A;  4LEU A;  1DCQ A;  5FQ7 A;  3RO3 A;  3MA5 A;  4JEH A;  2KZT B;  1MZC A;  2J07 A;  4ACK A;  2EIM E;  2XRY A;  4BEP A;  4F53 A;  1SVX A;  3B7B A;  3SZ7 A;  3V31 A;  2JEK A;  4G8L A;  4JVS A;  4IYP A;  3ZHE B;  4J8S A;  5FZS A;  5FIN A;  1HS6 A;  2H6H A;  5CEC B;  4GTR A;  4PUC A;  2GRN B;  2HR2 A;  4H7Y A;  2QC9 A;  4W9R A;  3RRU A;  5E76 A;  3T5X A;  3EHR A;  4KXK B;  3ZIM A;  3FY4 A;  4BET A;  1E8Z A;  5DBK A;  4J8F A;  4YDE A;  4B94 A;  4HNA D;  4HS2 A;  2V5Q C;  4R7L A;  4N5C A;  3RU0 A;  3KD7 A;  3Q75 A;  2AJA A;  4ABN A;  3C98 A;  4G26 A;  4CEM A;  4CGW A;  3TXM A;  1E8W A;  2XS8 A;  4KVO A;  5EN5 D;  1K1A A;  1NP7 A;  5ENO D;  4ZFH A;  3I3N A;  2J08 A;  5AN8 A;  1OCC E;  2VGX B;  4J8E A;  2E0I A;  4DLQ A;  4CZ2 D;  2PL2 A;  2WXQ A;  4A1G A;  4BER A;  3FUM A;  3VTX A;  1HZ4 A;  5CCM A;  2X38 A;  3Q78 A;  3FUH A;  5H7P A;  4LSZ E;  5CEA A;  3OXG A;  3TGO A;  4DX6 D;  3PEV B;  1WDY A;  1BI8 B;  3MKQ B;  4F1S A;  2KXP C;  3CHP A;  3PEU B;  5JMN D;  2J8S D;  4K5C A;  5ENN A;  4F6R D;  1V55 E;  3QWP A;  4FHJ A;  2H6I A;  5J08 A;  1NA3 A;  3OAW A;  4C0M A;  3APF A;  2H6G A;  4HI9 A;  4B8A A;  3LS8 A;  2ETC A;  2P9U G;  4N39 A;  2A5U A;  2WXR A;  1KT0 A;  3C3O A;  3LPZ A;  3QKY A;  2P2C P;  4A3T A;  3G2V A;  3ONK A;  5FT9 A;  4GAA A;  4HOT A;  2VJ8 A;  2PQN A;  2X6K A;  4GZ3 A;  2PM7 A;  3SQV A;  4G11 A;  3LVR E;  4AY5 A;  1TNB A;  4JPS A;  2AW6 A;  3CR3 A;  3JXJ A;  4I6E A;  4EZJ A;  1HXI A;  4UQX A;  3OXL A;  3ZUV B;  1W3B A;  1LD8 A;  3QB2 A;  4CYM D;  2KC7 A;  2ILR A;  3ZVV A;  5AJL A;  4AVX A;  2B0O E;  1JUQ A;  1LF8 A;  1OWM A;  2Y1L E;  2BKK B;  3IXE A;  4BSZ B;  3UPV A;  3B13 A;  3IHV A;  4CCA A;  4UWH A;  1N4Q A;  2GRO B;  1KT1 A;  2VSO E;  3D9L A;  4RG9 A;  4U8Y D;  2NXP A;  3KSQ A;  1U2V G;  3B95 A;  4JA9 A;  4ANX A;  3I4G A;  3ZN3 A;  1X5B A;  1AWC B;  3VLE A;  2R2L A;  3JCK C;  1WM5 A;  4HI8 A;  2P9S G;  3G2S A;  3TG4 A;  2LUH A;  4XKB A;  4KBQ A;  5M72 A;  4RQI A;  3CHO A;  2R17 C;  2V4H C;  4HQD A;  3JUI A;  1S63 A;  4HB5 A;  1FPP A;  1FT2 A;  5KCM A;  5AJD A;  2XEE A;  3J5Q B;  1BU9 A;  1NFI E;  4J7W A;  4HOR A;  2WM9 A;  3DSS A;  1UOH A;  1QBQ A;  2PZI A;  2IO2 C;  3JUE A;  3FTU A;  3JYS A;  2IEJ A;  3UTM A;  3W9F A;  2H6F A;  2CG2 A;  2F0Y A;  4A55 A;  2V4L A;  2MYO A;  3FUE A;  4U63 A;  2KZT A;  4Y6C A;  4UWG A;  4I6G A;  5ENP D;  1Z3X A;  3U9W A;  4L7T A;  4EZL A;  5FQ6 A;  2UY1 A;  3P1U A;  2XGO A;  2XS1 A;  3DXK G;  3PZ2 A;  3ZHE A;  3UT4 A;  4U04 A;  3PNL B;  4GA2 A;  1FCH A;  3WG7 E;  2ZXW E;  2J09 A;  4FC8 A;  5LCW C;  3KSL A;  3APD A;  3RAU A;  3V2O A;  1TR4 A;  2GW1 A;  4O60 A;  3E33 A;  1SW6 A;  4AV7 A;  3LXU X;  3FUL A;  4ILH B;  3ONL A;  4CDN A;  5BNW A;  1EF1 C;  2WXN A;  3Q5M A;  3TL5 A;  2MOW A;  3HXF A;  4F7A A;  4PH4 B;  2RG8 A;  3T8M A;  5FJY A;  3CQC B;  1QZ2 A;  4IN3 B;  3L22 A;  3ASG A;  2L9B A;  4UQY A;  3UIN C;  4I43 A;  1MX4 A;  1IXV A;  4GTP A;  4NUR A;  2XPZ A;  4HVB A;  2I6H A;  3E32 A;  3G2U A;  1HE8 A;  2LSV A;  4B89 A;  5LP0 A;  3QK0 A;  3PS6 A;  3CHQ A;  3T9K A;  2XGS A;  3RRN B;  3FH7 A;  3R7R A;  3RJV A;  1MHQ A;  4G2V A;  3PUJ A;  5ITZ F;  4CDR A;  3DEP A;  5ENQ D;  4WUY A;  4UWF A;  3MKQ A;  4C48 B;  2RFM A;  3PRE A;  2KCL A;  3R7Q A;  1FVH A;  2GRM A;  4DX2 A;  4G25 A;  3GZ1 A;  1QNF A;  2R5S A;  4WWN A;  1O1R A;  3B7R L;  3CHS A;  4N5Q A;  3ESL A;  3FUI A;  2IY0 C;  3SD5 A;  3EU5 A;  5LCW J;  3GYZ A;  5KNG A;  2P9K G;  2X6J A;  3HIZ A;  1UW4 B;  4U07 A;  4A3V A;  5HQ8 A;  5D0Q D;  2J4D A;  4XEI G;  1IQU A;  4B0Z A;  3CVV A;  3DBS A;  4GPM A;  2QY7 A;  3PZD A;  3DSU A;  4WWP A;  1YMP A;  2CHX A;  3TWQ A;  3L54 A;  3FWV A;  3SNX A;  3OTN A;  3Q4A B;  3S7F A;  4H7X A;  3MJW A;  4GZ5 A;  3RK6 A;  1ELR A;  4EEC A;  3CHR A;  4HFG A;  4J8D A;  2DYR E;  5CRV A;  4YDY A;  2QYJ A;  2WPV A;  3RKV A;  2ZIS A;  2VTB B;  5HS0 A;  2J49 A;  3HXB A;  5AQB A;  2VQ2 A;  1Q2Z A;  1WY6 A;  4JHJ A;  2XHE A;  1ELW A;  4LCT A;  2KM4 A;  3MV3 B;  3L08 A;  3X2Q E;  3BEE A;  2AXU A;  2WQ6 A;  2IO3 C;  4HOS A;  4BTA A;  3ZEF A;  3UKU G;  2YQ8 A;  3CVN A;  4WNF A;  5ARF A;  5ANL A;  5EX3 A;  3E4B A;  3TWT A;  4BSX A;  4GMR A;  3UM2 A;  1H6K A;  3ZU7 B;  5JA4 D;  4ANV A;  3LEW A;  3CST A;  3D9I A;  4LNU D;  3CK7 A;  3UIP C;  4EQF A;  3NZS A;  3ZRH A;  2VSX E;  1BPO A;  3O48 A;  4HOQ A;  3SFZ A;  4JEU A;  4EBA G;  4BFR A;  2PM6 A;  1E96 B;  2LXM A;  4BES A;  2YNQ A;  3QC1 A;  3Q9U C;  3FU6 A;  5BV1 A;  4KMO A;  2BUG A;  3K9I A;  4FLH A;  3NBN B;  3SBT B;  4DJA A;  4GB9 A;  4B8C B;  4YVQ C;  2XEN A;  4RVB A;  2GRL A;  2IF4 A;  4EHM A;  4O1P A;  5FWQ A;  4U7E B;  3FUN A;  3DRA A;  2CHW A;  1N11 A;  4N2Q A;  5AAR A;  2WXG A;  4DX1 A;  4APF A;  3LY7 A;  3LYA A;  4U0U A;  3UX4 A;  4TXQ A;  2E2E A;  1JWF A;  2HYZ A;  5AYW D;  1Y8M A;  4B93 B;  4M3O A;  4GTO A;  4AP2 A;  3ZXS A;  2ZGD A;  1RW2 A;  3FU5 A;  5AQA A;  5ANR A;  2XQ0 A;  3ASF A;  3PUK A;  4GPK A;  3UUX A;  5KWD A;  1LD7 A;  1IHG A;  2OOE A;  4EZK A;  3AU4 A;  3MX3 A;  4CT4 A;  2EIL E;  2EIK E;  2OVF A;  2P9P G;  2LSU A;  4I1O B;  2OEV A;  2Y0B G;  3DWL G;  2UWJ G;  3LJN A;  2IOS A;  5CBN A;  1OWO A;  1Z3Y A;  2GRP B;  1H6O A;  2QFC A;  2HE0 A;  2MHK A;  2R02 A;  4ATZ D;  3CVU A;  2J9Q A;  4F3V A;  3ZYQ A;  1BI7 B;  3JXI A;  3HXE A;  4ILI A;  3KAE A;  2CFZ A;  4V3I A;  3UKR G;  3EHN A;  5JHB A;  1BD8 A;  3FTZ A;  3V79 K;  3ASO E;  2X6H A;  4CT0 A;  3OXF A;  1ZB1 A;  4HRN A;  3U66 A;  3ZYK A;  3E30 A;  5HRY A;  3FDH A;  4RG6 A;  5BV0 A;  4KYO B;  1UG3 A;  4GYW A;  3UXG A;  3HG0 D;  3EUV A;  3G2W A;  4ME2 A;  3Q7F A;  2XEH A;  2XZT G;  5A7D B;  2FEZ A;  4FU3 A;  4MKT A;  1JCR A;  1TEZ A;  4UI9 C;  3LKU A;  5EYP F;  3LJ3 A;  3CKB A;  5D0O D;  2ION A;  4ANW A;  4UI9 K;  3VLD A;  1NA0 A;  2V0P A;  4FJZ A;  3MKR A;  5CCL A;  5ENR D;  5FZR A;  1VDY A;  4DK5 A;  1A5E A;  3DST A;  4LUN U;  2DIW A;  3FEX A;  3KEA A;  1UN8 A;  3ULE G;  3CK9 A;  3KS2 A;  3QAQ A;  4A1S A;  5E75 A;  3T8K A;  2CFU A;  4GYO A;  4AY6 A;  2FO7 A;  2HO1 A;  3AG1 E;  3CEQ A;  1TN8 A;  4GML A;  2KAT A;  1LTX A;  2WXK A;  5KJL A;  4MLP A;  5LFA A;  3CQG B;  2AXV A;  4D10 C;  4FA6 A;  4K5A B;  1H6P A;  3MCX A;  3E34 A;  4U8H A;  3UT8 A;  1KPS B;  4XZ4 A;  4BY6 A;  3HVE B;  3DSX A;  2XZD G;  3SGH A;  1FVF A;  5HKP A;  3NF1 A;  2FI7 A;  2NYJ A;  1JCS A;  3AG3 E;  1YA0 A;  4I17 A;  3UMV A;  3MV2 B;  2KCV A;  3N71 A;  2KBX A;  4UUC A;  3L16 A;  1S70 B;  1AP7 A;  4FAD A;  4TV3 A;  2IJG X;  3TWV A;  4ACL A;  1DNP A;  4L1B A;  1TN7 A;  4GYY A;  1HG5 A;  5BPP A;  1E90 A;  4N3C A;  3DEO A;  2BF0 X;  5CMY A;  5JJ6 A;  3TXN A;  2VSY A;  3DXM G;  1QYM A;  2VYI A;  3ABK E;  2WVI A;  4DPR A;  3D9J A;  2BTD A;  4JA7 A;  1OWN A;  3AS5 A;  3SFX A;  2LNI A;  1N54 A;  3ASD A;  1N0Q A;  5CED B;  3IV0 A;  2LXL A;  4DI3 A;  4OAV B;  1TJC A;  2I2O A;  4NRH B;  3HXD A;  3CK8 A;  1EYH A;  3ZNG A;  3CVW A;  3TWX A;  2EQX A;  2OEW A;  4OVU A;  4O1O A;  2OV8 A;  2WXO A;  4C0E A;  3QJZ A;  2C2L A;  2YIN A;  1KLX A;  2FBN A;  1TNO A;  4RLY A;  1WG0 A;  4WAF A;  2NC9 A;  4G23 A;  3Q49 B;  4LNG A;  4U8V D;  5T8I A;  2WXI A;  5EX0 A;  3HXC A;  5FIO A;  4JHR A;  3FUF A;  4HRL A;  3RIB A;  1Z6T A;  1E8Y A;  5BUZ A;  1K8K G;  4E85 A;  3PZ4 A;  1OT8 A;  3NQP A;  1O1T A;  4JB8 P;  2AXZ A;  4XKC A;  4U0Z A;  5G05 C;  3NZU A;  4KVM A;  4GU5 A;  3C3R A;  4L2L A;  2VGX A;  1OWP A;  3CGH A;  4G1T A;  5ENT D;  2ZU6 B;  4DRX E;  3FEY A;  4Y6W A;  4J8Y A;  4Q96 A;  2M63 A;  4FUL A;  1B89 A;  3ZXP A;  1HX8 A;  3FHE A;  3SY2 A;  2IFU A;  3SO8 A;  3I5P A;  1HU3 A;  5CER B;  3TWR A;  5C2Y A;  2B6C A;  3I4R B;  5AQ9 A;  3ML8 A;  3FP3 A;  2WQ7 A;  2WQH A;  2Y3A A;  3D9O A;  2WXF A;  4UWK A;  4AIF A;  3R9M A;  4L23 A;  3L13 A;  4IUL A;  3QWV A;  2P58 C;  3SI5 A;  3FU3 A;  3HDX A;  4HXI A;  3QAR A;  3GZ2 A;  1OY3 D;  3FU0 A;  2RFA A;  2P9N G;  3AU5 A;  3AG2 E;  5ENS D;  4JHK A;  3CV0 A;  3ABM E;  4K0R A;  5LOZ A;  5KJK A;  3EHQ A;  4DX5 D;  2I9C A;  4CRW A;  3QWW A;  3J5P A;  2IOL A;  3ML9 A;  3C72 A;  1SA5 A;  4JW1 A;  4APO A;  1A17 A;  4TUM A;  4BTB A;  1HF8 A;  5T4Y A;  3LCA A;  1DC2 A;  3C3Q A;  5G05 J;  1H2T C;  2Y69 E;  5CBO A;  4K03 A;  3CVL A;  5KJN A;  5CRU A;  1OUV A;  4WNG A;  5T3R A;  4OVV A;  4C9B B;  1TYQ G;  3PE4 A;  3TG5 A;  2Q7F A;  3ULY A;  3WXX A;  1FT1 A;  3EJN A;  3QOU A;  4HLL A;  3UM3 A;  5G2N A;  3ZYL A;  3GZS A;  5ARG A;  1ELK A;  1S0P A;  1N95 A;  4YVO A;  4HLE A;  1IHB A;  2XGM A;  1IKN D;  3EHM A;  2GRR B;  4I9E A;  5KNH D;  2I1K A;  4XX5 A;  1OWL A;  1D8D A;  3RO2 A;  5G55 A;  3MEK A;  3L17 A;  3UT7 A;  4JC8 A;  2DBA A;  2LAH A;  4PS3 A;  4L9P A;  1QQE A;  3FH5 A;  1INZ A;  4RSY A;  4CGV A;  2WMO A;  2GGF A;  1K1B A;  3S7J A;  3CVY A;  3DPY A;  5J90 A;  5EKQ D;  3ZYM A;  3FTW A;  4U0S A;  5B1A E;  2F37 A;  1HG2 A;  3BG0 B;  3JQ0 A;  1KZO A;  4AEZ C;  1TJF A;  1JPL A;  4GZ6 A;  4BX8 A;  5JJ7 A;  1UJJ A;  1DVP A;  2IQC A;  1U3D A;  2UY1 B;  2DZO A;  4GMJ A;  4XE0 A;  1XNF A;  3MYV A;  2EIN E;  2P9I G;  3S7D A;  1DCE A;  4LG6 A;  4PS7 A;  2LAI A;  4O6F A;  4ZHB A;  5CMW A;  2J4B A;  2WXH A;  2CHZ A;  3ASH A;  3Q47 B;  4HRM B;  3PH0 C;  5A23 A;  3D9M A;  3FTX A;  1JCQ A;  4ATG A;  3S7B A;  1H0A A;  1N0R A;  4YDW A;  1O5M A;  1IYG A;  4PS8 A;  4GZC A;  2L0T B;  1H2V C;  3EIJ A;  3R9A B;  4BT9 A;  3HRA A;  1HH8 A;  3HHM A;  4XI9 A;  5BW8 C;  2BED A;  2FUL A;  2V8S E;  2RD0 A;  4GA1 A;  5BT1 A;  2ZIR A;  3AJI A;  3TWS A;  4MRU A;  3O4Z A;  4GCO A;  2Y4T A;  3NAW A;  1PY1 A;  1KZP A;  5JJT A;  2XPI A;  4MS6 A;  2I1J A;  5EIL A;  2YHE A;  2AWI A;  1MX2 A;  1O1S A;  3TWU A;  1IQR A;  3L82 A;  3URZ A;  5BXO A;  3CSF A;  3QNK A;  3EIQ C;  3SF4 A;  1TNZ A;  1X81 A;  3APC A;  4M7C A;  1TNU A;  4JXT A;  2C0L A;  4GA0 A;  1MQS A;  4DX7 D;  2F8X K;  3FUK A;  4UWL A;  3ZKJ A;  3CLJ A;  4LRZ A;  4I6J A;  3PDN A;  3BG1 B;  3MGB A;  3FH8 A;  3ISM C;  4HBD A;  4K5B A;  4IRU A;  3W9G A;  3C5R A;  3PNT B;  2FO1 E;  2Y4U A;  4LER A;  4UQZ A;  1HFA A;  2HM8 A;  3RSE G;  3ZW3 A;  1NI1 A;  5AIJ A;  3U3W A;  4URK A;  4WNE A;  2X6I A;  4DLO A;  4J6I A;  3NB2 A;  2VSN A;  2WXJ A;  3QDN A;  3SFY A;  3PVL A;  3AAA C;  4Q69 A;  1D8E A;  2WXL A;  4HOU A;  3UQ3 A;  1G3N B;  4TRQ A;  4A63 B;  3Q79 A;  5EID A;  1SZA A;  4GCN A;  2OND A;  5FTP A;  3AS4 A;  3BU8 A;  3BUA A;  2JLB A;  4OAU C;  3KEZ A;  4GTS A;  2MRI A;  1JWG A;  4NQ0 A;  4BWR A;  4XIF A;  4KT6 B;  2VTB A;  1NL4 A;  1UN9 A;  2QZA A;  2WXP A;  4NIK A;  3FUD A;  4DUI A;  3Q73 A;  3LY9 A;  1SA4 A;  1MJ0 A;  2DCP A;  1ZBP A;  5DIZ A;  3Q9N C;  4ANU A;  3ENE A;  5D2M C;  3IKO B;  4JL0 A;  1NZN A;  3GW4 A;  4WWO A;  3IHY A;  5LX8 A;  3D9H A;  4EBA A;  1N4S A;  4GTV A;  4NAC A;  4WND A;  2ETB A;  4I1M A;  3ASN E;  3RRM B;  5CHE E;  2L6J A;  4TXR A;  2L6B A;  2NSZ A;  2PNN A;  2DZN A;  3AG4 E;  3U4T A;  4TXP A;  3ESK A;  3L9T A;  3Q15 A;  3ZPJ A;  1SZ9 A;  4N3A A;  4UI9 J;  1MX6 A;  3V30 A;  1Y6I A;  4FHK A;  3FTY A;  4P29 A;  2P9L G;  2XRZ A;  5C1D A;  3D9N A;  4GTM A;  2RKK A;  3LVQ E;  4AM9 A;  3CIA A;  2PQR A;  4U95 D;  1N94 A;  3PRZ A;  1Z5S C;  3CHM A;  3HYM B;  1E8X A;  3JQ1 A;  4I2W A;  3UI2 A;  4QQI A;  3U64 A;  1TN6 A;  2LO6 A;  3VTY A;  3FTS A;  5HI7 A;  1V54 E;  3VLF A;  1WAO 1;  3CVX A;  2WB2 A;  1HO8 A;  2XPY A;  3PZ1 A;  3TAX A;  2V5F A;  3FUJ A;  3MZL B;  1PC2 A;  2X3M A;  4QFV A;  2OVB A;  4N3B A;  5B1B E;  4F1P A;  4JD2 G;  3EU9 A;  1K3Z D;  2JAB A;  2DYS E;  3G2T A;  4YDO A;  4FP7 A;  4PDX A;  5EDS A;  4TUU A;  3E37 A;  3Q7A A;  1N9A A;  1H2U A;  3DSV A;  1OCR E;  2QYU A;  4KZ0 A;  4LNB A;  4YND A;  3FTV A;  3EDT B;  3DPD A;  1H19 A;  5G04 C;  5FQ8 A;  3UM0 A;  1TNY A;  4G24 A;  1UJK A;  3P2B A;  2XCC A;  1GW6 A;  1YCS B;  5KJM A;  3NOG D;  1YYH A;  3B7U X;  2L0I A;  4GTQ A;  4BT8 A;  3UIO C;  2FF4 A;  3BQO A;  4DI4 A;  5AQ7 A;  2VGE A;  3ULQ A;  1OXJ A;  5FZQ A;  1N4P A;  2ZGG A;  4FJY A;  2X6F A;  2XEV A;  3D9K A;  1MYO A;  1PAQ A;  3B7S A;  1E7U A;  3V2X A;  1ZU2 A;  3AS8 A;  2R05 A;  1N52 A;  3IEG A;  5AEN A;  5EYL A;  4KZC A;  4L2Y A;  4MBG A;  4I9C A;  3D9P A;  5EIB E;  1S64 A;  2CG3 A;  3LDZ A;  3F6Q A;  2C0M A;  1XGW A;  5AAO A;  1N4R A;  2XCB A;  1D9S A;  1P5Q A;  2VGY A; 
#chains in the Genus database with same CATH homology
 3X2Q E;  3ABM E;  3WG7 E;  2ZXW E;  3AG4 E;  2DYS E;  2OCC E;  3ABL E;  2EIM E;  2EIL E;  2EIK E;  3ASO E;  1OCC E;  1OCZ E;  2Y69 E;  3ABK E;  3ASN E;  2EIJ E;  1V54 E;  5B1B E;  1V55 E;  3AG3 E;  2EIN E;  5IY5 E;  5B1A E;  1OCR E;  1OCO E;  3AG2 E;  3AG1 E;  2DYR E;  5B3S E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...