5IY5E

Electron transfer complex of cytochrome c and cytochrome c oxidase at 2.0 angstrom resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
105
structure length
105
Chain Sequence
b'HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Complex structure of cytochrome c-cytochrome c oxidase reveals a novel protein-protein interaction mode
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 40
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2016-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 5iy5E00
1V55E 2Y69E 3AG4E 2EIME 2ZXWE 2EIJE 2EINE 3X2QE 2EILE 5B1BE 1V54E 3ASNE 5IY5E 2OCCE 1OCRE 3WG7E 3AG2E 3ABLE 1OCCE 3ABME 3ASOE 3AG1E 1OCZE 5B1AE 2EIKE 3ABKE 5B3SE 1OCOE 2DYRE 3AG3E 2DYSE
chains in the Genus database with same CATH superfamily
4TXRA 3DWLG 2GW1A 3B95A 2HE0A 3OXGA 3LS8A 5A7DB 3JXJA 4FADA 1S64A 1TNUA 4F6RD 3GZ2A 4GTOA 2DYSE 3QARA 3HXBA 5AN8A 2WB2A 2AJAA 1D9SA 1NI1A 2RKKA 3SI5A 3DSUA 3FUJA 3JCKC 4LNGA 2RD0A 3ABME 3ULQA 1DCEA 3MEKA 3TWSA 4URKA 5B3SE 1HH8A 1UJKA 4BSXA 3L13A 3CSTA 4GA1A 1SZAA 5BXOA 3Q7AA 2H6IA 4GYYA 5EDSA 2XZTG 3D3MA 3CEQA 5JHAA 4Q94A 5T8IA 1PY1A 3L16A 1NFIE 3ZKJA 4FJZA 4OYSA 3FH5A 4APFA 4WWNA 2OEVA 3C3QA 2VTBB 2I9CA 3PZ1A 2MOWA 2LSUA 1NL4A 5FTPA 2OEWA 2WXJA 2IO3C 3UT8A 5AJDA 1MX6A 5CRVA 3APCA 1HS6A 2L0IA 3G2SA 3SO8A 5KCMA 4G24A 4JHKA 5D0QD 4CYMD 4UWKA 4Y6CA 4CEMA 2CG2A 1OWNA 4U04A 3IEGA 4GCNA 2Y69E 4Z68A 1FVFA 2BKKB 3ZUVB 1AWCB 3TXNA 4AIFA 4I1MA 3NBNB 4WWPA 2IQCA 2X38A 4WNGA 5ARGA 4AOFA 2WMNA 4KYOB 4XZ4A 2NC9A 3DSTA 3D9NA 5FQ8A 1E8YA 4PS7A 5ENSD 2C2LA 1BD8A 2WXMA 5KBAA 1OCCE 4EHMA 3Q49B 2FBNA 3LY9A 2IO2C 4GTTA 2XCCA 4J6IA 3Q9UC 2B6CA 3ZYQA 3EHNA 4UWHA 5AAOA 3HRAA 4L9PA 4DI4A 2GRMA 3CR3A 2V5QC 2ZGDA 3C72A 4I6JA 2J9QA 2IONA 3AU5A 2CFZA 1MQSA 3CVPA 4C9BB 1EDUA 3V30A 5CEAA 1IKND 1E8ZA 4U07A 4RVBA 5AJLA 2WQHA 3FUKA 3S2AA 5FZRA 5B1AE 2QYUA 3MV2B 2P9UG 1TJCA 3UT7A 2QYJA 2HO1A 1OY3D 4K5BA 4NACA 2I1JA 5FIOA 3T8MA 3CHQA 3UM2A 2UWJG 5CMYA 1O1SA 5DIZA 4A3VA 4KT6B 3CKBA 3BG1B 2XHEA 4IRUA 4D10C 3TJPA 2GRRB 4DX7D 4ATZD 1N95A 3PZ2A 3SFYA 5KNGA 4AY6A 1Z3YA 2UY1A 4JHRA 2ETAA 4G11A 4XI9A 2FULA 3TGOA 4I43A 3FFLA 1HF8A 2XPZA 3R9MA 5G05C 1G3NB 4WWOA 1MJ0A 3IXEA 5LCWC 2DYRE 2J49A 1H6KA 3QNKA 4G2VA 3RK6A 3IHYA 4L7TA 2XQ0A 1JPLA 5HQ8A 4U0UA 4BTAA 4ANXA 3FU6A 3ZYLA 4UQZA 2R02A 4TUMA 1K1AA 2WXOA 3AG3E 2KCKA 4EPZA 2XEHA 5G04C 3G2TA 1KLXA 2PNNA 4IULA 1FCHA 4RLYA 2YHCA 4KZCA 1TR4A 2V4LA 4OVVA 4DX5D 4WNEA 1UW4B 2F0YA 4FU3A 3R7RA 1Q2ZA 1E8WA 4KZ0A 5EKQD 3ENEA 4XX5A 2J08A 5ENTD 1N0RA 3CK8A 3FH8A 4GYWA 2E2EA 4B94A 3SY2A 1ELWA 1WM5A 1WAO1 3E37A 3ZFWA 3SBTB 4GU5A 3NOGD 3QDNA 4N39A 3JXIA 1RW2A 3ULYA 3FTYA 3AS5A 1OCRE 4HFGA 5C2YA 4GZ3A 2P9PG 4CDRA 4FULA 4BESA 3MKQA 1OCZE 1UOHA 1PAQA 5LFAA 3AJIA 3I4GA 3KSLA 4G23A 3C3OA 4P29A 2E0IA 5AQ7A 3ML9A 4CDNA 4DK5A 4HORA 2A4ZA 2KCLA 1S63A 4JPSA 3PUJA 4B8CB 3FUHA 2X6JA 2XPIA 3E34A 1OCOE 2FEZA 1N4QA 3EU9A 1D8EA 3D9LA 3S7JA 2AWIA 3QKYA 3U3WA 2ZGGA 2WXQA 4HRMB 3BUAA 3UTMA 2WXIA 3RO2A 3CVQA 4DUIA 1QQEA 4GZDA 3GZ1A 5AQBA 3UMVA 1IYGA 1QNFA 2C0MA 4YVQC 1N9AA 4V3IA 2L9BA 3TWXA 4CT4A 4DI3A 3PRZA 4JA7A 1TNOA 3LDZA 1AP7A 1Y6IA 4N3AA 1BI8B 3PZ4A 4KXKB 4HOTA 4DPRA 5HI7A 2NXPA 3OXLA 3RJVA 4J8EA 1O1TA 5EIDA 5CECB 2R17C 3B13A 1E8XA 4YVOA 5C1DA 3FHEA 5G05J 1HXIA 2Y3AA 3E32A 3TWVA 4KVOA 3RRUA 1MX4A 4EBAG 2VGYA 3SD5A 1Y8MA 4LERA 1Z5SC 2ONDA 4L1BA 2BUGA 4GA2A 3RRNB 1N94A 2X6FA 4M7CA 4AY5A 5G04J 2CHWA 2VGXA 2J07A 3IKOB 2F8XK 4IN3B 3FH7A 3MV3B 2PQNA 4B93B 3ZU7B 3HIZA 2I1KA 4AEZC 4TUUA 2VYIA 3FTUA 3PZ3A 4ILGA 4J8YA 2FO1E 3WXXA 1V54E 4ZFHA 2V4HC 2NYJA 4QFVA 3DEPA 1JUQA 1INZA 4KBQA 3FTXA 5A6CA 4I9EA 5KNHD 4TRQA 3CV0A 3PDNA 4AJWA 3PH0C 3ML8A 4DLOA 3KS2A 3B7UX 4F3VA 4OVUA 4GTMA 3ZVVA 3TWQA 3N71A 4XIFA 3J5PA 4HOQA 2I2OA 5AARA 3V31A 1SW6A 4PS3A 4CDMA 4HLEA 3U4TA 3ZPJA 4JD2G 2JEKA 3U64A 2VSOE 3D9KA 1FT2A 4JEHA 3DXMG 4HRLA 1DCQA 4AVXA 1TEZA 3EJNA 4ANUA 4N2SA 2EIME 2IF4A 5ARFA 5JA4D 3MKRA 1OWOA 3FTWA 4L2LA 5A23A 1IQRA 3ZHEA 4HI9A 2WQ6A 2BEDA 3GW4A 5T3RA 3L6AA 4N3CA 4APOA 4BX8A 5G2NA 2XEVA 1ZB1A 3Q5MA 4FHKA 3I5PA 2KCVA 1NZNA 3NF1A 2KC7A 1IXVA 3DSSA 4LNUD 1H6OA 2WXFA 1JCQA 3CHRA 3CLJA 4XI0A 1Z6TA 3PNLB 4CCAA 3KAEA 3APDA 3WG7E 2PZIA 4PDXA 4B0ZA 4EZKA 5LOZA 4U7EB 3JQ0A 3ZGQA 5CCLA 1V55E 2ETCA 2FF4A 4XKBA 2WMOA 3CK7A 2KXPC 2V5FA 3O4ZA 1EF1C 3Q47B 2XZDG 2XGMA 4U8YD 4HQDA 4FHJA 3TWUA 2XCBA 2AVPA 4ANVA 3DSWA 3R9AB 3NOCD 3SNXA 3QWPA 2VGEA 4HS2A 4L2YA 4PH4B 3D9IA 3SHFA 3CHMA 3U66A 1LD8A 2J8SD 3PVLA 2BTDA 3ZEFA 3T5VA 2CFUA 4NURA 2H6HA 3FTZA 4BSZB 3LKUA 2H6FA 1EYHA 2L0TB 1KZOA 1TN6A 1A5EA 3ASNE 3OAWA 4FLBA 1D8DA 2P9KG 2WXKA 2X6IA 3FP3A 5DBKA 4JB8P 5FT9A 3FUFA 1SVXA 1RZ4A 1WDYA 3QOUA 3EU5A 3UXGA 3VLEA 5ENRD 5D2MC 3UINC 2P9LG 2MRIA 4J7WA 4HBDA 1QBQA 3GZSA 3VLDA 3QB2A 4GZCA 2DWZA 2R59A 3J5QB 5CERB 4XKCA 3CVUA 4JL0A 4EECA 3D9JA 1N4PA 2KM4A 3SGHA 3ONKA 1KZPA 5FZSA 5IY5E 2GRQB 2X6HA 2CG3A 1X81A 2ILRA 3HVEB 3BQOA 2Q7FA 3CHSA 3EIJA 3CVNA 4JA9A 4OAUC 2KZTA 3G2VA 4G1TA 3AS8A 1GW6A 4RG9A 1QYMA 4GTVA 2CHXA 2BKGA 2VSNA 5ITZF 4N2QA 1E90A 5FQ4A 3SQVA 1OWMA 5KJKA 4ME2A 3AG4E 2LUHA 1S0PA 3QAQA 3DSVA 2IOSA 2I6HA 2XGOA 2VTBA 4N5CA 3UPVA 3SFZA 3LEWA 4EQFA 1N52A 1OWLA 4CGWA 4GTSA 4AV7A 3W9FA 4GYOA 5EYPF 3FY4A 2R05A 2F8YA 3O48A 3P1UA 4C48B 1HE8A 4DX6D 1H6PA 3HYMB 2IU1A 4WUYA 2ZU6B 4EBAA 4QQIA 3HDXA 4NQ0A 3X2QE 5FZQA 1PC2A 3TWRA 5BW8C 4CT0A 3L22A 3T5XA 4BETA 4BEPA 4HOSA 4HXIA 2EINE 4FLHA 2OV8A 4HOUA 4E85A 4BWRA 1K3ZD 3EIQC 3DSXA 3CIAA 4K5CA 3R7QA 2GRNB 3D9PA 2XGSA 2F37A 2FI7A 1OUVA 4U96D 3ISMC 4I6EA 3Q73A 1NA0A 5JJ6A 3ABKE 2H6GA 1E7VA 5AENA 4F7AA 4GMJA 1N4RA 1EPUA 4MBGA 2HR2A 3KD7A 3L9TA 4LUNU 2LAHA 3Q9NC 5ENPD 3UIPC 4H7XA 1TJFA 4GAAA 3B7RL 3CGHA 1TNBA 2QC9A 3FUMA 3LJNA 2EIJE 2EILE 4JC8A 4GB9A 3VLFA 3AU4A 3LPZA 1BPOA 4O1PA 3ASHA 3HXCA 3EUVA 1DC2A 3TG5A 2JABA 1WG0A 4H7YA 1H2UA 5BXUA 4B8AA 3DBSA 5BV1A 2DBAA 4HRNA 1S70B 3Q79A 4FA6A 5FQ7A 4ACLA 3FU3A 1O1RA 4UI9K 5T4YA 1LD7A 1ZU2A 3ZNGA 5G55A 4O1OA 3KEZA 4RSYA 4L23A 4AP2A 4O6FA 1H2TC 3UM0A 3UKUG 1FT1A 3MCXA 2IFUA 3DEOA 1KPSB 4YDOA 3CVXA 3LY7A 4Q69A 5CRUA 5AYWD 3GYZA 4A63B 2XPYA 4NRHB 3ZRHA 2ZISA 1OT8A 5CBNA 3UIOC 4B89A 4GCOA 2AXUA 2WXPA 1SA5A 4A1GA 3DPDA 1HG2A 1P5QA 3SBSA 4KMOA 3AG1E 3HXFA 4GMRA 5CBOA 4TXQA 2IJGX 4GA0A 4K5AB 1MYOA 3FULA 2DCPA 3TWTA 5JJ7A 5FQ6A 2Y1LE 3DRAA 3EHRA 1Z3XA 2LSVA 1U2VG 3HHMA 5JHBA 4UWGA 4OAVB 2WPVA 3CKCA 2FO7A 2J4BA 5HRYA 3V2XA 3NQPA 4LNBA 5BUZA 2Y4UA 1YA0A 2LXLA 3IHVA 3ONLA 5J90A 3URZA 3CHPA 4UWLA 3D9HA 3FEXA 3PE3A 2YQ8A 3LY8A 5EX3A 1NA3A 5AQAA 2XRYA 2DVWA 2XRZA 3FUDA 3E30A 5M72A 1LF8A 3Q78A 4DLQA 1HZ4A 1E7UA 4E6HA 3QK0A 2QY7A 1BLXB 1MX2A 5FWQA 4HVBA 4A1SA 1IQUA 4TXPA 1ELRA 2KZTB 4G25A 2WVIA 3LYAA 3TG4A 3ZXPA 4KVMA 3CQCB 3CVWA 1UG3A 3FWVA 5JMND 1FVHA 4I1AA 4G26A 3S7BA 2P2CP 2VQ2A 3MYVA 4K03A 4MRUA 1WY6A 1BU9A 4X8QA 4N5QA 2RFAA 3Q7FA 2WXNA 2UY1B 3PEUB 1L5JA 3ESKA 2A5EA 4N3BA 1JWFA 3HXEA 3NZUA 3LXUX 4BX9A 1N54A 2P58C 4U63A 3PZDA 4JW1A 4ACKA 4G8KA 2GROB 4YNDA 2JLBA 4UI9C 1HG5A 2J4DA 5LP0A 4ILIA 3ULEG 3JYSA 5BV0A 4A55A 3ZYMA 4J0UA 2LXMA 3BU8A 2ZXWE 5LX8A 4Q96A 4C0MA 4M3OA 2LNIA 3L82A 4DRXE 1TNZA 3ASFA 2AW6A 2P9SG 5FJYA 3QC1A 5KJLA 2EIKE 3I4RB 3B7TA 3ZYKA 4GZ5A 3JQ1A 4HI8A 1DNPA 1K1BA 3L08A 3AG2E 3CHOA 3PE4A 3DPYA 3FUEA 4LRZA 4CRWA 1TN7A 1LTXA 4GPKA 3K9IA 4U8HA 3T8KA 3PS6A 3D9OA 3Q15A 4XEIG 4YDEA 5BT1A 3FUNA 2KBXA 3SF4A 2YNQA 2ZIRA 4HLLA 4JZYA 3LVRE 2PQRA 1MZCA 4ILHB 2MHKA 1H19A 3PEVB 3ASGA 5ANRA 2Y4TA 4YDYA 3QWWA 4PUCA 3FEYA 2PL2A 2VJ8A 3OXFA 1XGWA 4UWFA 5HS0A 2LO6A 3MKQB 3VTXA 1W3BA 4BT8A 2C0LA 4JEUA 3W9GA 3CVYA 4F1SA 3AAAC 4UUCA 1MHQA 4BFRA 2PM7A 3FU5A 3UM1A 4JXTA 3UI2A 4I1OB 1JWGA 2HM8A 1TYQG 3UKRG 3G2UA 3PNTB 4BT9A 2X6KA 2OCCE 3ZIMA 5D0OD 2WXRA 4GTPA 4R7LA 3EHQA 2L6JA 4UQXA 5EIBE 1SZ9A 3PUKA 3ASDA 3UX4A 3B7BA 3TWWA 4BY6A 3F6QA 3U9WA 4A3TA 3CQGB 1HFAA 2J09A 5AQ9A 5KJNA 4LCTA 4AM9A 1IHGA 4J8FA 2R03A 4AXHA 4BERA 4IYPA 1YMPA 4G8LA 4YDWA 2LAIA 3SZ7A 1H2VC 3C5RA 3FTSA 5CEDB 3FTVA 4FJYA 4NIKA 5AIJA 1TNYA 3KSQA 4MLPA 1OXJA 2IEJA 2CHZA 3NZSA 3IV0A 4LEUA 3C98A 1H0AA 3UM3A 4RQIA 5CHEE 2OVBA 2OVFA 2R5SA 3LJ3A 3I3NA 1UN9A 2P9NG 2XENA 4U0ZA 3UT4A 4UI9J 4U95D 3LVQE 5EYLA 3OTNA 1YYHA 3CVVA 2L6BA 2M63A 4U0SA 3MA5A 3ABLE 1IHBA 1ELKA 2MYOA 3RRMB 3MJWA 2XS1A 1DVPA 3SFXA 5EILA 4GTQA 4GTRA 2QZAA 2VGXB 3S7DA 4I17A 3HG0D 4EZJA 5E75A 4TV3A 5ENQD 2X3MA 4JVSA 1ZBPA 3IBEA 1JCRA 4BTBA 4F53A 4FP7A 1BI7B 3B7SA 1SA4A 2OOEA 3RSEG 1HO8A 5KWDA 4FC8A 1A17A 3EHMA 1UJJA 1QZ2A 4PS8A 2RFMA 4I6GA 2Y0BG 4J8DA 1SQMA 1N11A 4GMLA 2NSZA 2RG8A 3ASOE 2WM9A 3BG0B 3Q4AB 2EQXA 3ZN3A 4ZHBA 4CGVA 4GPMA 3UUXA 4XE0A 2XEEA 3ZW3A 5KJMA 4I2ZA 4HB5A 3CSFA 1HX8A 2PM6A 3CK9A 3JUIA 3KEAA 3HXDA 3C3RA 1U3DA 3EDTB 3PREA 3HVEA 5ENOD 3E4BA 3RO3A 2DZNA 2YINA 4F1PA 5E76A 2VSYA 3FU0A 5D66A 3TAXA 4HNAD 3NB2A 1KT0A 4O60A 3ZHEB 3JUEA 3T9KA 4Y6WA 4DJAA 3TXMA 3FUIA 5J08A 4MS6A 2YHEA 3NAWA 2R2LA 3D9MA 5BPPA 2XS8A 2WQ7A 3S7FA 4W9RA 3RIBA 3APFA 1E96B 5CCMA 3RU0A 1U3CA 4WNFA 1KT1A 4GZ6A 2V0PA 3L17A 1XNFA 5ENNA 3MX3A 4LSZE 3VTYA 5H7PA 3L54A 2AXZA 4I9CA 4DX1A 5JJTA 2B0OE 4DX2A 3QWVA 5EX0A 2ETBA 1TN8A 2GGFA 1N0QA 2GRPB 1X5BA 2WXLA 3G2WA 2A5UA 2IY0C 4J8SA 2VSXE 2AXVA 3DXKG 3AS4A 2V8SE 3RAUA 2QFCA 5B1BE 2IOLA 5LCWJ 5CMWA 4K0RA 1N4SA 4ANWA 5FINA 4ABNA 2KATA 3CVLA 1JCSA 4EZLA 4WAFA 1B89A 3MZLB 3ZXSA 3RKVA 3Q75A 4JHJA 1HU3A 3V2OA 2WXGA 4MKTA 4U8VD 5HKPA 2WXHA 3P2BA 4WNDA 4C0EA 4I2WA 3BEEA 3QJZA 2BF0X 3UQ3A 3TL5A 4CZ2D 3E33A 3FDHA 1FPPA 2DZOA 2DIWA 4ATGA 1VDYA 5EN5D 1UN8A 4RG6A 4LG6A 3MGBA 1K8KG 1NP7A 3LCAA 1O5MA 1YCSB 3V79K 5BNWA 5ANLA 3ESLA 2GRLA 4UQYA 1OWPA 2HYZA 2P9IG
chains in the Genus database with same CATH topology
1V55E 2Y69E 3AG4E 2EIME 2ZXWE 2EIJE 2EINE 3X2QE 2EILE 5B1BE 1V54E 3ASNE 5IY5E 2OCCE 1OCRE 3WG7E 3AG2E 3ABLE 1OCCE 3ABME 3ASOE 3AG1E 1OCZE 5B1AE 2EIKE 3ABKE 5B3SE 1OCOE 2DYRE 3AG3E 2DYSE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V55 E;  2Y69 E;  3AG4 E;  2EIM E;  2ZXW E;  2EIJ E;  2EIN E;  3X2Q E;  2EIL E;  5B1B E;  1V54 E;  3ASN E;  5IY5 E;  2OCC E;  1OCR E;  3WG7 E;  3AG2 E;  3ABL E;  1OCC E;  3ABM E;  3ASO E;  3AG1 E;  1OCZ E;  5B1A E;  2EIK E;  3ABK E;  5B3S E;  1OCO E;  2DYR E;  3AG3 E;  2DYS E; 
#chains in the Genus database with same CATH topology
 4TXR A;  3DWL G;  2GW1 A;  3B95 A;  2HE0 A;  3OXG A;  3LS8 A;  5A7D B;  3JXJ A;  4FAD A;  1S64 A;  1TNU A;  4F6R D;  3GZ2 A;  4GTO A;  2DYS E;  3QAR A;  3HXB A;  5AN8 A;  2WB2 A;  2AJA A;  1D9S A;  1NI1 A;  2RKK A;  3SI5 A;  3DSU A;  3FUJ A;  3JCK C;  4LNG A;  2RD0 A;  3ABM E;  3ULQ A;  1DCE A;  3MEK A;  3TWS A;  4URK A;  5B3S E;  1HH8 A;  1UJK A;  4BSX A;  3L13 A;  3CST A;  4GA1 A;  1SZA A;  5BXO A;  3Q7A A;  2H6I A;  4GYY A;  5EDS A;  2XZT G;  3D3M A;  3CEQ A;  5JHA A;  4Q94 A;  5T8I A;  1PY1 A;  3L16 A;  1NFI E;  3ZKJ A;  4FJZ A;  4OYS A;  3FH5 A;  4APF A;  4WWN A;  2OEV A;  3C3Q A;  2VTB B;  2I9C A;  3PZ1 A;  2MOW A;  2LSU A;  1NL4 A;  5FTP A;  2OEW A;  2WXJ A;  2IO3 C;  3UT8 A;  5AJD A;  1MX6 A;  5CRV A;  3APC A;  1HS6 A;  2L0I A;  3G2S A;  3SO8 A;  5KCM A;  4G24 A;  4JHK A;  5D0Q D;  4CYM D;  4UWK A;  4Y6C A;  4CEM A;  2CG2 A;  1OWN A;  4U04 A;  3IEG A;  4GCN A;  2Y69 E;  4Z68 A;  1FVF A;  2BKK B;  3ZUV B;  1AWC B;  3TXN A;  4AIF A;  4I1M A;  3NBN B;  4WWP A;  2IQC A;  2X38 A;  4WNG A;  5ARG A;  4AOF A;  2WMN A;  4KYO B;  4XZ4 A;  2NC9 A;  3DST A;  3D9N A;  5FQ8 A;  1E8Y A;  4PS7 A;  5ENS D;  2C2L A;  1BD8 A;  2WXM A;  5KBA A;  1OCC E;  4EHM A;  3Q49 B;  2FBN A;  3LY9 A;  2IO2 C;  4GTT A;  2XCC A;  4J6I A;  3Q9U C;  2B6C A;  3ZYQ A;  3EHN A;  4UWH A;  5AAO A;  3HRA A;  4L9P A;  4DI4 A;  2GRM A;  3CR3 A;  2V5Q C;  2ZGD A;  3C72 A;  4I6J A;  2J9Q A;  2ION A;  3AU5 A;  2CFZ A;  1MQS A;  3CVP A;  4C9B B;  1EDU A;  3V30 A;  5CEA A;  1IKN D;  1E8Z A;  4U07 A;  4RVB A;  5AJL A;  2WQH A;  3FUK A;  3S2A A;  5FZR A;  5B1A E;  2QYU A;  3MV2 B;  2P9U G;  1TJC A;  3UT7 A;  2QYJ A;  2HO1 A;  1OY3 D;  4K5B A;  4NAC A;  2I1J A;  5FIO A;  3T8M A;  3CHQ A;  3UM2 A;  2UWJ G;  5CMY A;  1O1S A;  5DIZ A;  4A3V A;  4KT6 B;  3CKB A;  3BG1 B;  2XHE A;  4IRU A;  4D10 C;  3TJP A;  2GRR B;  4DX7 D;  4ATZ D;  1N95 A;  3PZ2 A;  3SFY A;  5KNG A;  4AY6 A;  1Z3Y A;  2UY1 A;  4JHR A;  2ETA A;  4G11 A;  4XI9 A;  2FUL A;  3TGO A;  4I43 A;  3FFL A;  1HF8 A;  2XPZ A;  3R9M A;  5G05 C;  1G3N B;  4WWO A;  1MJ0 A;  3IXE A;  5LCW C;  2DYR E;  2J49 A;  1H6K A;  3QNK A;  4G2V A;  3RK6 A;  3IHY A;  4L7T A;  2XQ0 A;  1JPL A;  5HQ8 A;  4U0U A;  4BTA A;  4ANX A;  3FU6 A;  3ZYL A;  4UQZ A;  2R02 A;  4TUM A;  1K1A A;  2WXO A;  3AG3 E;  2KCK A;  4EPZ A;  2XEH A;  5G04 C;  3G2T A;  1KLX A;  2PNN A;  4IUL A;  1FCH A;  4RLY A;  2YHC A;  4KZC A;  1TR4 A;  2V4L A;  4OVV A;  4DX5 D;  4WNE A;  1UW4 B;  2F0Y A;  4FU3 A;  3R7R A;  1Q2Z A;  1E8W A;  4KZ0 A;  5EKQ D;  3ENE A;  4XX5 A;  2J08 A;  5ENT D;  1N0R A;  3CK8 A;  3FH8 A;  4GYW A;  2E2E A;  4B94 A;  3SY2 A;  1ELW A;  1WM5 A;  1WAO 1;  3E37 A;  3ZFW A;  3SBT B;  4GU5 A;  3NOG D;  3QDN A;  4N39 A;  3JXI A;  1RW2 A;  3ULY A;  3FTY A;  3AS5 A;  1OCR E;  4HFG A;  5C2Y A;  4GZ3 A;  2P9P G;  4CDR A;  4FUL A;  4BES A;  3MKQ A;  1OCZ E;  1UOH A;  1PAQ A;  5LFA A;  3AJI A;  3I4G A;  3KSL A;  4G23 A;  3C3O A;  4P29 A;  2E0I A;  5AQ7 A;  3ML9 A;  4CDN A;  4DK5 A;  4HOR A;  2A4Z A;  2KCL A;  1S63 A;  4JPS A;  3PUJ A;  4B8C B;  3FUH A;  2X6J A;  2XPI A;  3E34 A;  1OCO E;  2FEZ A;  1N4Q A;  3EU9 A;  1D8E A;  3D9L A;  3S7J A;  2AWI A;  3QKY A;  3U3W A;  2ZGG A;  2WXQ A;  4HRM B;  3BUA A;  3UTM A;  2WXI A;  3RO2 A;  3CVQ A;  4DUI A;  1QQE A;  4GZD A;  3GZ1 A;  5AQB A;  3UMV A;  1IYG A;  1QNF A;  2C0M A;  4YVQ C;  1N9A A;  4V3I A;  2L9B A;  3TWX A;  4CT4 A;  4DI3 A;  3PRZ A;  4JA7 A;  1TNO A;  3LDZ A;  1AP7 A;  1Y6I A;  4N3A A;  1BI8 B;  3PZ4 A;  4KXK B;  4HOT A;  4DPR A;  5HI7 A;  2NXP A;  3OXL A;  3RJV A;  4J8E A;  1O1T A;  5EID A;  5CEC B;  2R17 C;  3B13 A;  1E8X A;  4YVO A;  5C1D A;  3FHE A;  5G05 J;  1HXI A;  2Y3A A;  3E32 A;  3TWV A;  4KVO A;  3RRU A;  1MX4 A;  4EBA G;  2VGY A;  3SD5 A;  1Y8M A;  4LER A;  1Z5S C;  2OND A;  4L1B A;  2BUG A;  4GA2 A;  3RRN B;  1N94 A;  2X6F A;  4M7C A;  4AY5 A;  5G04 J;  2CHW A;  2VGX A;  2J07 A;  3IKO B;  2F8X K;  4IN3 B;  3FH7 A;  3MV3 B;  2PQN A;  4B93 B;  3ZU7 B;  3HIZ A;  2I1K A;  4AEZ C;  4TUU A;  2VYI A;  3FTU A;  3PZ3 A;  4ILG A;  4J8Y A;  2FO1 E;  3WXX A;  1V54 E;  4ZFH A;  2V4H C;  2NYJ A;  4QFV A;  3DEP A;  1JUQ A;  1INZ A;  4KBQ A;  3FTX A;  5A6C A;  4I9E A;  5KNH D;  4TRQ A;  3CV0 A;  3PDN A;  4AJW A;  3PH0 C;  3ML8 A;  4DLO A;  3KS2 A;  3B7U X;  4F3V A;  4OVU A;  4GTM A;  3ZVV A;  3TWQ A;  3N71 A;  4XIF A;  3J5P A;  4HOQ A;  2I2O A;  5AAR A;  3V31 A;  1SW6 A;  4PS3 A;  4CDM A;  4HLE A;  3U4T A;  3ZPJ A;  4JD2 G;  2JEK A;  3U64 A;  2VSO E;  3D9K A;  1FT2 A;  4JEH A;  3DXM G;  4HRL A;  1DCQ A;  4AVX A;  1TEZ A;  3EJN A;  4ANU A;  4N2S A;  2EIM E;  2IF4 A;  5ARF A;  5JA4 D;  3MKR A;  1OWO A;  3FTW A;  4L2L A;  5A23 A;  1IQR A;  3ZHE A;  4HI9 A;  2WQ6 A;  2BED A;  3GW4 A;  5T3R A;  3L6A A;  4N3C A;  4APO A;  4BX8 A;  5G2N A;  2XEV A;  1ZB1 A;  3Q5M A;  4FHK A;  3I5P A;  2KCV A;  1NZN A;  3NF1 A;  2KC7 A;  1IXV A;  3DSS A;  4LNU D;  1H6O A;  2WXF A;  1JCQ A;  3CHR A;  3CLJ A;  4XI0 A;  1Z6T A;  3PNL B;  4CCA A;  3KAE A;  3APD A;  3WG7 E;  2PZI A;  4PDX A;  4B0Z A;  4EZK A;  5LOZ A;  4U7E B;  3JQ0 A;  3ZGQ A;  5CCL A;  1V55 E;  2ETC A;  2FF4 A;  4XKB A;  2WMO A;  3CK7 A;  2KXP C;  2V5F A;  3O4Z A;  1EF1 C;  3Q47 B;  2XZD G;  2XGM A;  4U8Y D;  4HQD A;  4FHJ A;  3TWU A;  2XCB A;  2AVP A;  4ANV A;  3DSW A;  3R9A B;  3NOC D;  3SNX A;  3QWP A;  2VGE A;  4HS2 A;  4L2Y A;  4PH4 B;  3D9I A;  3SHF A;  3CHM A;  3U66 A;  1LD8 A;  2J8S D;  3PVL A;  2BTD A;  3ZEF A;  3T5V A;  2CFU A;  4NUR A;  2H6H A;  3FTZ A;  4BSZ B;  3LKU A;  2H6F A;  1EYH A;  2L0T B;  1KZO A;  1TN6 A;  1A5E A;  3ASN E;  3OAW A;  4FLB A;  1D8D A;  2P9K G;  2WXK A;  2X6I A;  3FP3 A;  5DBK A;  4JB8 P;  5FT9 A;  3FUF A;  1SVX A;  1RZ4 A;  1WDY A;  3QOU A;  3EU5 A;  3UXG A;  3VLE A;  5ENR D;  5D2M C;  3UIN C;  2P9L G;  2MRI A;  4J7W A;  4HBD A;  1QBQ A;  3GZS A;  3VLD A;  3QB2 A;  4GZC A;  2DWZ A;  2R59 A;  3J5Q B;  5CER B;  4XKC A;  3CVU A;  4JL0 A;  4EEC A;  3D9J A;  1N4P A;  2KM4 A;  3SGH A;  3ONK A;  1KZP A;  5FZS A;  5IY5 E;  2GRQ B;  2X6H A;  2CG3 A;  1X81 A;  2ILR A;  3HVE B;  3BQO A;  2Q7F A;  3CHS A;  3EIJ A;  3CVN A;  4JA9 A;  4OAU C;  2KZT A;  3G2V A;  4G1T A;  3AS8 A;  1GW6 A;  4RG9 A;  1QYM A;  4GTV A;  2CHX A;  2BKG A;  2VSN A;  5ITZ F;  4N2Q A;  1E90 A;  5FQ4 A;  3SQV A;  1OWM A;  5KJK A;  4ME2 A;  3AG4 E;  2LUH A;  1S0P A;  3QAQ A;  3DSV A;  2IOS A;  2I6H A;  2XGO A;  2VTB A;  4N5C A;  3UPV A;  3SFZ A;  3LEW A;  4EQF A;  1N52 A;  1OWL A;  4CGW A;  4GTS A;  4AV7 A;  3W9F A;  4GYO A;  5EYP F;  3FY4 A;  2R05 A;  2F8Y A;  3O48 A;  3P1U A;  4C48 B;  1HE8 A;  4DX6 D;  1H6P A;  3HYM B;  2IU1 A;  4WUY A;  2ZU6 B;  4EBA A;  4QQI A;  3HDX A;  4NQ0 A;  3X2Q E;  5FZQ A;  1PC2 A;  3TWR A;  5BW8 C;  4CT0 A;  3L22 A;  3T5X A;  4BET A;  4BEP A;  4HOS A;  4HXI A;  2EIN E;  4FLH A;  2OV8 A;  4HOU A;  4E85 A;  4BWR A;  1K3Z D;  3EIQ C;  3DSX A;  3CIA A;  4K5C A;  3R7Q A;  2GRN B;  3D9P A;  2XGS A;  2F37 A;  2FI7 A;  1OUV A;  4U96 D;  3ISM C;  4I6E A;  3Q73 A;  1NA0 A;  5JJ6 A;  3ABK E;  2H6G A;  1E7V A;  5AEN A;  4F7A A;  4GMJ A;  1N4R A;  1EPU A;  4MBG A;  2HR2 A;  3KD7 A;  3L9T A;  4LUN U;  2LAH A;  3Q9N C;  5ENP D;  3UIP C;  4H7X A;  1TJF A;  4GAA A;  3B7R L;  3CGH A;  1TNB A;  2QC9 A;  3FUM A;  3LJN A;  2EIJ E;  2EIL E;  4JC8 A;  4GB9 A;  3VLF A;  3AU4 A;  3LPZ A;  1BPO A;  4O1P A;  3ASH A;  3HXC A;  3EUV A;  1DC2 A;  3TG5 A;  2JAB A;  1WG0 A;  4H7Y A;  1H2U A;  5BXU A;  4B8A A;  3DBS A;  5BV1 A;  2DBA A;  4HRN A;  1S70 B;  3Q79 A;  4FA6 A;  5FQ7 A;  4ACL A;  3FU3 A;  1O1R A;  4UI9 K;  5T4Y A;  1LD7 A;  1ZU2 A;  3ZNG A;  5G55 A;  4O1O A;  3KEZ A;  4RSY A;  4L23 A;  4AP2 A;  4O6F A;  1H2T C;  3UM0 A;  3UKU G;  1FT1 A;  3MCX A;  2IFU A;  3DEO A;  1KPS B;  4YDO A;  3CVX A;  3LY7 A;  4Q69 A;  5CRU A;  5AYW D;  3GYZ A;  4A63 B;  2XPY A;  4NRH B;  3ZRH A;  2ZIS A;  1OT8 A;  5CBN A;  3UIO C;  4B89 A;  4GCO A;  2AXU A;  2WXP A;  1SA5 A;  4A1G A;  3DPD A;  1HG2 A;  1P5Q A;  3SBS A;  4KMO A;  3AG1 E;  3HXF A;  4GMR A;  5CBO A;  4TXQ A;  2IJG X;  4GA0 A;  4K5A B;  1MYO A;  3FUL A;  2DCP A;  3TWT A;  5JJ7 A;  5FQ6 A;  2Y1L E;  3DRA A;  3EHR A;  1Z3X A;  2LSV A;  1U2V G;  3HHM A;  5JHB A;  4UWG A;  4OAV B;  2WPV A;  3CKC A;  2FO7 A;  2J4B A;  5HRY A;  3V2X A;  3NQP A;  4LNB A;  5BUZ A;  2Y4U A;  1YA0 A;  2LXL A;  3IHV A;  3ONL A;  5J90 A;  3URZ A;  3CHP A;  4UWL A;  3D9H A;  3FEX A;  3PE3 A;  2YQ8 A;  3LY8 A;  5EX3 A;  1NA3 A;  5AQA A;  2XRY A;  2DVW A;  2XRZ A;  3FUD A;  3E30 A;  5M72 A;  1LF8 A;  3Q78 A;  4DLQ A;  1HZ4 A;  1E7U A;  4E6H A;  3QK0 A;  2QY7 A;  1BLX B;  1MX2 A;  5FWQ A;  4HVB A;  4A1S A;  1IQU A;  4TXP A;  1ELR A;  2KZT B;  4G25 A;  2WVI A;  3LYA A;  3TG4 A;  3ZXP A;  4KVM A;  3CQC B;  3CVW A;  1UG3 A;  3FWV A;  5JMN D;  1FVH A;  4I1A A;  4G26 A;  3S7B A;  2P2C P;  2VQ2 A;  3MYV A;  4K03 A;  4MRU A;  1WY6 A;  1BU9 A;  4X8Q A;  4N5Q A;  2RFA A;  3Q7F A;  2WXN A;  2UY1 B;  3PEU B;  1L5J A;  3ESK A;  2A5E A;  4N3B A;  1JWF A;  3HXE A;  3NZU A;  3LXU X;  4BX9 A;  1N54 A;  2P58 C;  4U63 A;  3PZD A;  4JW1 A;  4ACK A;  4G8K A;  2GRO B;  4YND A;  2JLB A;  4UI9 C;  1HG5 A;  2J4D A;  5LP0 A;  4ILI A;  3ULE G;  3JYS A;  5BV0 A;  4A55 A;  3ZYM A;  4J0U A;  2LXM A;  3BU8 A;  2ZXW E;  5LX8 A;  4Q96 A;  4C0M A;  4M3O A;  2LNI A;  3L82 A;  4DRX E;  1TNZ A;  3ASF A;  2AW6 A;  2P9S G;  5FJY A;  3QC1 A;  5KJL A;  2EIK E;  3I4R B;  3B7T A;  3ZYK A;  4GZ5 A;  3JQ1 A;  4HI8 A;  1DNP A;  1K1B A;  3L08 A;  3AG2 E;  3CHO A;  3PE4 A;  3DPY A;  3FUE A;  4LRZ A;  4CRW A;  1TN7 A;  1LTX A;  4GPK A;  3K9I A;  4U8H A;  3T8K A;  3PS6 A;  3D9O A;  3Q15 A;  4XEI G;  4YDE A;  5BT1 A;  3FUN A;  2KBX A;  3SF4 A;  2YNQ A;  2ZIR A;  4HLL A;  4JZY A;  3LVR E;  2PQR A;  1MZC A;  4ILH B;  2MHK A;  1H19 A;  3PEV B;  3ASG A;  5ANR A;  2Y4T A;  4YDY A;  3QWW A;  4PUC A;  3FEY A;  2PL2 A;  2VJ8 A;  3OXF A;  1XGW A;  4UWF A;  5HS0 A;  2LO6 A;  3MKQ B;  3VTX A;  1W3B A;  4BT8 A;  2C0L A;  4JEU A;  3W9G A;  3CVY A;  4F1S A;  3AAA C;  4UUC A;  1MHQ A;  4BFR A;  2PM7 A;  3FU5 A;  3UM1 A;  4JXT A;  3UI2 A;  4I1O B;  1JWG A;  2HM8 A;  1TYQ G;  3UKR G;  3G2U A;  3PNT B;  4BT9 A;  2X6K A;  2OCC E;  3ZIM A;  5D0O D;  2WXR A;  4GTP A;  4R7L A;  3EHQ A;  2L6J A;  4UQX A;  5EIB E;  1SZ9 A;  3PUK A;  3ASD A;  3UX4 A;  3B7B A;  3TWW A;  4BY6 A;  3F6Q A;  3U9W A;  4A3T A;  3CQG B;  1HFA A;  2J09 A;  5AQ9 A;  5KJN A;  4LCT A;  4AM9 A;  1IHG A;  4J8F A;  2R03 A;  4AXH A;  4BER A;  4IYP A;  1YMP A;  4G8L A;  4YDW A;  2LAI A;  3SZ7 A;  1H2V C;  3C5R A;  3FTS A;  5CED B;  3FTV A;  4FJY A;  4NIK A;  5AIJ A;  1TNY A;  3KSQ A;  4MLP A;  1OXJ A;  2IEJ A;  2CHZ A;  3NZS A;  3IV0 A;  4LEU A;  3C98 A;  1H0A A;  3UM3 A;  4RQI A;  5CHE E;  2OVB A;  2OVF A;  2R5S A;  3LJ3 A;  3I3N A;  1UN9 A;  2P9N G;  2XEN A;  4U0Z A;  3UT4 A;  4UI9 J;  4U95 D;  3LVQ E;  5EYL A;  3OTN A;  1YYH A;  3CVV A;  2L6B A;  2M63 A;  4U0S A;  3MA5 A;  3ABL E;  1IHB A;  1ELK A;  2MYO A;  3RRM B;  3MJW A;  2XS1 A;  1DVP A;  3SFX A;  5EIL A;  4GTQ A;  4GTR A;  2QZA A;  2VGX B;  3S7D A;  4I17 A;  3HG0 D;  4EZJ A;  5E75 A;  4TV3 A;  5ENQ D;  2X3M A;  4JVS A;  1ZBP A;  3IBE A;  1JCR A;  4BTB A;  4F53 A;  4FP7 A;  1BI7 B;  3B7S A;  1SA4 A;  2OOE A;  3RSE G;  1HO8 A;  5KWD A;  4FC8 A;  1A17 A;  3EHM A;  1UJJ A;  1QZ2 A;  4PS8 A;  2RFM A;  4I6G A;  2Y0B G;  4J8D A;  1SQM A;  1N11 A;  4GML A;  2NSZ A;  2RG8 A;  3ASO E;  2WM9 A;  3BG0 B;  3Q4A B;  2EQX A;  3ZN3 A;  4ZHB A;  4CGV A;  4GPM A;  3UUX A;  4XE0 A;  2XEE A;  3ZW3 A;  5KJM A;  4I2Z A;  4HB5 A;  3CSF A;  1HX8 A;  2PM6 A;  3CK9 A;  3JUI A;  3KEA A;  3HXD A;  3C3R A;  1U3D A;  3EDT B;  3PRE A;  3HVE A;  5ENO D;  3E4B A;  3RO3 A;  2DZN A;  2YIN A;  4F1P A;  5E76 A;  2VSY A;  3FU0 A;  5D66 A;  3TAX A;  4HNA D;  3NB2 A;  1KT0 A;  4O60 A;  3ZHE B;  3JUE A;  3T9K A;  4Y6W A;  4DJA A;  3TXM A;  3FUI A;  5J08 A;  4MS6 A;  2YHE A;  3NAW A;  2R2L A;  3D9M A;  5BPP A;  2XS8 A;  2WQ7 A;  3S7F A;  4W9R A;  3RIB A;  3APF A;  1E96 B;  5CCM A;  3RU0 A;  1U3C A;  4WNF A;  1KT1 A;  4GZ6 A;  2V0P A;  3L17 A;  1XNF A;  5ENN A;  3MX3 A;  4LSZ E;  3VTY A;  5H7P A;  3L54 A;  2AXZ A;  4I9C A;  4DX1 A;  5JJT A;  2B0O E;  4DX2 A;  3QWV A;  5EX0 A;  2ETB A;  1TN8 A;  2GGF A;  1N0Q A;  2GRP B;  1X5B A;  2WXL A;  3G2W A;  2A5U A;  2IY0 C;  4J8S A;  2VSX E;  2AXV A;  3DXK G;  3AS4 A;  2V8S E;  3RAU A;  2QFC A;  5B1B E;  2IOL A;  5LCW J;  5CMW A;  4K0R A;  1N4S A;  4ANW A;  5FIN A;  4ABN A;  2KAT A;  3CVL A;  1JCS A;  4EZL A;  4WAF A;  1B89 A;  3MZL B;  3ZXS A;  3RKV A;  3Q75 A;  4JHJ A;  1HU3 A;  3V2O A;  2WXG A;  4MKT A;  4U8V D;  5HKP A;  2WXH A;  3P2B A;  4WND A;  4C0E A;  4I2W A;  3BEE A;  3QJZ A;  2BF0 X;  3UQ3 A;  3TL5 A;  4CZ2 D;  3E33 A;  3FDH A;  1FPP A;  2DZO A;  2DIW A;  4ATG A;  1VDY A;  5EN5 D;  1UN8 A;  4RG6 A;  4LG6 A;  3MGB A;  1K8K G;  1NP7 A;  3LCA A;  1O5M A;  1YCS B;  3V79 K;  5BNW A;  5ANL A;  3ESL A;  2GRL A;  4UQY A;  1OWP A;  2HYZ A;  2P9I G; 
#chains in the Genus database with same CATH homology
 1V55 E;  2Y69 E;  3AG4 E;  2EIM E;  2ZXW E;  2EIJ E;  2EIN E;  3X2Q E;  2EIL E;  5B1B E;  1V54 E;  3ASN E;  5IY5 E;  2OCC E;  1OCR E;  3WG7 E;  3AG2 E;  3ABL E;  1OCC E;  3ABM E;  3ASO E;  3AG1 E;  1OCZ E;  5B1A E;  2EIK E;  3ABK E;  5B3S E;  1OCO E;  2DYR E;  3AG3 E;  2DYS E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...