5IY5H

Electron transfer complex of cytochrome c and cytochrome c oxidase at 2.0 angstrom resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Complex structure of cytochrome c-cytochrome c oxidase reveals a novel protein-protein interaction mode
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 26
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 5iy5H00
2EILH 3ABLH 1OCCH 2EIJH 3ABKH 3ABMH 2DYSH 3AG2H 3AG4H 5B1AH 2EIKH 1V54H 1OCOH 1OCZH 2EIMH 3WG7H 5B3SH 5B1BH 3AG3H 3ASNH 2DYRH 2ZXWH 1V55H 2EINH 2Y69H 3X2QH 2OCCH 3ASOH 1OCRH 5IY5H 3AG1H
chains in the Genus database with same CATH superfamily
5DD4A 3R6SA 2VT2A 2CQQA 1WQ2A 2XAQA 3CCEI 1V3FA 2EBIA 5KNLA 1KGSA 1OYIA 2QEXI 3CP8A 2F5CA 5IOYA 3RKXA 4A3KJ 1MNMC 2DLLA 1X3WB 3TO9A 4MNUA 2PMZA 2AQFA 2VB6A 4G94A 5GTHC 4GFBA 2FMLA 4XRFA 4BE2A 1K4TA 4A93J 3E97A 2MLKA 2HDCA 2ACJA 4RGXA 4E6KG 2HOTA 3EUAA 3CDIA 5B1BH 4PJJA 1ZRCA 2IGMA 1VQMI 3MZ8A 3G6EI 5F64A 1FZPB 3CC4I 5H2FC 3LSHA 3GW2A 3LAPA 3BG6A 4R79A 3S3OA 3PO2J 2CQNA 1RI7A 3ABLH 1WFXA 2HDDA 4LD5A 1DQUA 2RQQA 4AWXB 4WCGA 1ZK8A 2MLGA 4WXDA 3OYLA 5FRMA 3I4NJ 3E6BA 2H27A 2NOGA 1L3LA 2MG4A 1RETA 1WPKA 2W85A 4PJLA 2VJ5A 4O5VA 2HZTA 4PFPA 3GUDA 5LEJA 3K4JA 1JUPA 2RREA 4LLGF 2TDXA 1KQ8A 1IF1A 5DUKA 2ZSIB 2FNAA 3WTVC 5F1JA 2JVHA 4M71A 2X85A 1G2HA 2YU9J 5M3MJ 1IRFA 1ZGJA 2EILH 5CLSA 3T8RA 3K70C 5HODA 1EH7A 4C2TA 1J0RA 1P7IA 3KPHA 5TGTA 4L0ZB 2KRCA 2JVGA 1ETKA 1N75A 5CQEA 3WGIA 4HNUA 2EB7A 4Q5SF 1GLNA 2XROA 3DKWA 1VQ7I 4GGGA 4PSWA 3ASNH 1R4MB 5AIQA 1P4WA 3PM1A 1JHFA 1HKSA 4UUVA 5D5WB 3WTYC 4XSZF 1N78A 2HPMA 2WY7Q 2ELKA 2VN2A 2K5CA 2FA5A 1KZHA 3FIWA 2V1XA 1FYKA 4P5OA 2HI3A 1FBUA 2XSDC 2DMQA 4X6AJ 2G7HA 2BXYA 2YU3A 4HF1A 3M9AA 1ETXA 2ESNA 3VYRB 2EIKH 1BOBA 2W1OA 1JKQC 1WRJA 2KIFA 2KLOA 5KVRA 2ECCA 1YITI 3QPLA 1RR7A 4N9HA 4PGGA 5EZGA 5KCMA 1H9TA 1WVRA 3GTJJ 1W7PB 2B0LA 1APLC 5CJ9A 5DCMB 3KIOA 2EFQA 5CQGA 1QPMA 2A6HF 3HXLA 2P7CB 1SFXA 3TQNA 3DFGA 3GFJA 4IQJA 3VYUB 2KISA 2CO5A 2F4OB 3HEFA 3KP4A 3LFUA 2DFFA 2ZMEB 4HNVA 1TP4A 2R5YA 1SMTA 1IN7A 2RDPA 5GTIC 1AKHA 2DA4A 5ICEA 3M07A 3REOA 3FXOA 1KU3A 4YIRX 3M7GA 5K5RA 4LG3A 3DTEA 2XRLA 3NEUA 3CD6I 3FBNB 3WTSC 1YW8A 4RB2C 3S14J 1ZAOA 3K0LA 4HYEA 1U78A 2VQGA 3GFIA 1NH3A 2P8TA 1EA3A 2GA2A 1R49A 3BPXA 2EV5A 4UUTA 1S29A 4RB1A 4KICA 1Y0NA 1WJBA 3PNVA 2E1MC 4RLQA 2BE5F 1VQKI 3I59A 5FKLA 2EINH 4U0VA 1G59A 4BY7J 1X58A 4M3EA 4NC8A 4HDUA 5HS7A 1U3EM 1R1UA 3E6CC 1ZLJA 2HNHA 2CUZA 3S1QJ 2BGCA 2VASA 2COMA 3HHHA 3CUQC 3M8FA 4V19K 3RIRA 3KZIC 3IH3A 3S15J 3TP0A 3ELKA 1BM9A 3KCCA 3HG9A 2H94A 3QPSA 1K78B 1I27A 1IC8A 1RPWA 2DA2A 3LQQA 4PDKA 3PSIA 1GT0C 3K1PA 1ZN2A 3OIQA 2OTLI 4AIJA 2GM4A 5FLXZ 2R7WA 1XPXA 3K4CA 1IZ1A 4KIGA 4IHTA 1ULYA 2XB5A 5FJ8J 2QKMB 3K1MA 1O3QA 3BTLA 2A07F 1TWHJ 5CVUA 2R5ZB 3TMOA 2HTSA 3LOCA 4ESFA 3W6VA 3A0BC 4MQ9F 5JHUA 2A5WA 3JAMK 3F3XA 5EG0B 1EKEA 2DDAA 4NQWA 2I8DA 3FM3A 3HOZJ 4BJTA 2HFHA 2K7LA 4UXNA 5IP6A 1FMWA 2VKHA 3HB9A 5L3DA 4NC6A 4Q47A 1LDDA 2YX7A 3NAUA 4V2GA 2LC2A 1X19A 1VQOI 1V55H 2R7ZJ 3M3YJ 2QZ8A 1TQIA 5E1ZB 2HQ5A 1D3YA 2Q0OA 4EMSA 3CCQI 1MZBA 3EETA 3BZ6A 1YX3A 5FD5A 3LSKA 2DOFA 4HDVA 2K9MA 3GZ6A 1VQLI 2KMUA 2MC3A 2IA2A 3OR1C 2LVSA 4K2EA 2DTRA 3WTWC 3HUGA 3DV8A 1A5JA 3BWGA 1FYMA 5F08A 1X3ZB 5CVIA 2M9HA 2NVQJ 1ZELA 5D6FA 2EA4A 1M1EB 4QLCU 3ECHA 5D4SA 3ZQCA 4M3BA 1QQIA 1XCBA 4AIKA 1HDPA 1OPCA 4E7HA 4RGRA 2DU9A 3HJEA 1MBGA 3VODA 1JKPC 1VQ6I 4PJNA 3OYDA 2FRHA 1J2XA 5GAGJ 1RIOH 2FXAA 4UY8I 1J59A 4F3QA 3KYLA 5E3NA 4CZZA 2KIMA 2KL4A 2GBYA 1X1AA 4LG0A 2F5VA 1FTZA 2WB1A 4QIWN 5KAIC 4N0BA 1LE8B 2RNGA 5TJJA 2K40A 2V1NA 4G6QA 5K5QA 2EZHA 1U6GA 2OD5A 1ENHA 2CJJA 2L9RA 2JRMA 1QBJA 1HW5A 5CVJA 3TDZC 3K4NA 3LA2A 5K1YA 1VQ4I 3F9KA 1HW1A 1TQMA 3HSEA 1A6IA 1X3UA 4XONA 3ZXSA 3CF5F 4CGZA 2PJRB 1LFBA 3Q0VA 2R7TA 4E7LA 1F1ZA 2Z1DA 4P96A 1PUEE 2DFHA 2VODA 2W84A 2XASA 5CVRA 3KP3A 1PJRA 2DO7A 4FX4A 1T33A 4O6JA 1SD7A 2HS5A 4BL0B 1U9NA 1ON1A 3MKLA 1X1DA 4XLAA 3S2WA 3RYRA 4L9JA 1J75A 1PUFA 2OBPA 2HYGD 5J1UA 4RGSA 1YIOA 2JMWA 4IEJA 2IP2A 3ZQ7A 2MBFA 3H9GA 2IRFG 3I4PA 4ZTFA 2LKPA 4UB8C 4TV7A 3S3NA 2CV0A 1UJ8A 3ZMSA 3FXMA 3DPTA 4OIQF 2KZVA 5GAHJ 3AL0C 1P7JA 2ECBA 1OCPA 1A04A 1RZ4A 3TL4X 1FOYA 4OINF 2JK3A 5LGNA 2FNPA 4A3IJ 2LY2A 1GDTA 1UZCA 3D5SC 3ML6A 2K4JA 1JUSA 2EZKA 2DMNA 2I10A 1BOAA 3GXOA 3ZMDA 4L9VA 4I09A 2JA7J 3GTPJ 1JE8A 3CLQA 3UR3C 3HKZA 1TW3A 1DPUA 4IHWA 3I58A 2M87A 2FUG2 4BYYA 3BCBA 4XIDA 2Y69H 2ESHA 3ASOH 1I39A 1WJFA 3OS0A 1ZG3A 3V7CA 4B43A 2MC4A 5BQTA 3GLLA 2JUCA 1MSFC 2R93J 4EVIA 5FKOA 4HBLA 1OJLA 1FMVA 3T8TA 1WJ5A 2X1CA 3L2UA 4KISA 2KFDA 2M2EA 3E5QA 5J1YA 2Q8KA 4XBFA 3U21A 1PVEA 2JUGA 3KE2A 2GIZA 2IGOA 3CCSI 3SDBA 2ETHA 2PEXA 3G1MA 4IX7A 1A6QA 1MNEA 1BI3A 2DA3A 2OC6A 5F27A 2JRTA 3ZMVA 5DCFA 1K7AA 4HSTA 2WC2A 3EPZA 1Z9CA 3CQZJ 1IDYA 1G3SA 5DM6F 1G3YA 5E1WA 1MMAA 4P9UA 2QBYA 3ZMZA 2DQLA 5JHFA 2CH0A 2M0MA 4XORA 4XM3A 4II3A 4I98B 2F4IA 1P6RA 4CUGA 3NWSA 4R8HA 4ZYHA 1B8IA 1R5GA 2RKHA 1W5SA 4IHVA 2BY0A 1FIAA 3E1SA 2A6EF 1P9QC 2O7OA 2L02A 3VYSB 5C4JJ 2ZJQF 1TQPA 4ZDLA 1UCRA 2DW4A 2HOAA 2B7EA 2MA3A 3ONQA 2RNJA 1DP7P 1K6OA 4M6YA 5LFAA 2L4MA 3DXJF 1IAWA 2DI3A 1VQ9I 4XLFA 5B1AH 2JA2A 1P4AA 2F5FA 2XAFA 3F8MA 2Z99A 3DU6A 4A6EA 4A5NA 2PBIA 1G3WA 5IYCJ 2R7VA 3QU6A 1RC9A 2IEKA 4BBRJ 3KP6A 3QRFF 1MNDA 2CQ7A 1XGMA 2LMDA 3NQOA 3ZP5A 5LD2C 1DUXC 3I4MJ 2HYJA 2RC4A 2UXXA 3GFMA 4CYCB 1T38A 2ZXIA 2Y0SN 3BJOA 4E7ZA 3H9JA 1OCZH 3CC2I 2FMYA 1LVAA 3KZZA 4KIFA 4HG2A 1REPC 4I02A 1XGSA 3QOPA 3OWTA 3WG7H 1B4AA 3C1DA 2DYRH 5FO5A 2E1OA 2VC0A 1MJBA 2JTVA 3JTGA 4XLNF 1USSA 2KDOA 2VBXA 2CYYA 4M6VA 2BHYA 1G4DA 2DT6A 1ZQ3P 4G6TB 3JSOA 5LBQA 2NOJB 4P1WA 4BDYA 1LFUP 4KNYA 4L9TA 4FQGA 2P0WA 3CCYA 2DFEA 2V6CA 3OMYA 2XUBA 3GWZA 4FE7A 4M9ZA 5ERIA 2E1NA 1JGGA 1USTA 1BN5A 1FY7A 5HLGA 4BDZA 4HW0A 2M34A 4BKXA 4A69C 4PUSA 1IN6A 2QQBA 4Q4ZF 1YS7A 2ID3A 4KT6A 5ILUA 3M1CA 1LUJB 3O6BB 1BIAA 5DV5A 4WX9A 3AKZA 3PUBA 4EM0B 2ZNZA 3KLNA 1XSXA 2ZFWA 5DS9A 1FC3A 4HX7A 2E34A 2ZC2A 3OS1A 3ABMH 1Y6IA 1OQYA 2DODA 1RESA 4KIBA 2WB1N 4BUPA 4YFNF 4CXFA 3K4LA 4M3DA 3Q0WA 2KRHA 3S2HJ 2GXGA 2E1MB 3QP5A 1T8IA 2WY8Q 3A02A 2L7MP 5ED4A 4RAZA 1X4PA 1FWZA 2R7UA 3K4KA 3CUQB 2E1CA 3J7AY 2CUJA 5C4XJ 3V8LA 2M45A 5J4YA 3Q5FA 1WZ2A 1DU0A 2X1DA 4A5MA 4ENKA 1D5VA 5BOXA 3HIFA 4A3EJ 3SEZA 5HNHA 4LIUA 2BBYA 2VT3A 4J00A 2K9SA 2V9VA 2PJPA 3IAM2 4IVNA 4NUBA 2A3SA 4CICA 2HOSA 3E6MA 2OZUA 2V26A 1GXPA 4XMYA 4HOBA 1W4MA 2VKEA 2XV4S 1UHSA 4OIPF 2L9NA 3AFHA 4HQMA 3E5UA 4MLOA 4D5CA 2XB0X 4HV5A 2LOOA 1UHWA 9ANTA 4BGDA 5LRRA 3G1OA 4A3BJ 3WE3A 1QHHD 3HOWJ 3HOSA 1NG7A 2KIQA 3CMAI 1U8BA 2TRTA 5M5XJ 5ILVA 1MDMA 3CMYA 5GPCA 2UUZA 1P2FA 3P9KA 5EEGA 3IL2A 2HWVA 3T1BA 3U1KA 4S0HB 4DYCA 1FP1D 4U87A 5K7ZA 3FHNA 1YJWI 1U0JA 2XGCA 1TWGJ 2MYSA 2QSFX 4EJVA 4ZYDA 4BH9A 1R5ID 3PFIA 3JSPA 3V4GA 3DTIA 4EJTA 5EEAA 3OYGA 1XSVA 2QM3A 4UHTA 4GO1A 3CCJI 5LHHA 4LLLA 3HKZN 2XGDA 1YHQI 5K7FA 3CUOA 2DDBA 1H89C 4BE0A 4UVBA 3SZGA 2HXOA 3HBLA 1D1AA 1BC7C 1O4XA 1QZEA 5FGMA 4E7JA 2DK8A 4Y4RA 1FNNA 3IUOA 5C3EJ 3IAS2 5B3SH 2F48A 4MFDA 5AONA 2R92J 2HVQA 3K4BA 5D8KB 3E5XA 3G71I 3QP6A 2OZ6A 4Y15A 3I71A 2X48A 5B66C 2EFWA 1Y56A 1H0MA 4A2UA 3S1MJ 1ITYA 1A36A 4F7ZA 4ZYEA 3GBGA 5HDGA 3GTLJ 1H88C 1JXSA 1MGTA 2BXZA 5JLWA 3AG4H 3RPUD 2EPFA 3LL7A 2O03A 3D1NI 4OIRF 3KP2A 2L7KA 3ZQIA 1XX5A 3DEWA 2A69F 3K2AA 3A01A 3KLOA 4XKVA 3W6KB 1P92A 2X4HA 5E8GA 3SZTA 3FXKA 1FJLA 3U9GA 3ERMA 2DTZA 1UAAA 1S7EA 4R1HA 3CO6C 1WJEA 3R0AA 3J81Z 3G3ZA 4B09A 1ONVA 4EM1A 3GO5A 3QAHA 1BJZA 4MQVA 3GTKJ 2O0YA 3OSFA 1SFKA 4OOIA 1YLFA 3PIPF 4E7SA 4IOCF 3WU0A 1TL8A 2R5YB 4UVAA 2AS5F 3MAJA 4XOTA 3EUKL 2AXLA 5IT3A 1W36C 4ABZA 1AKHB 4I0BA 3F23A 1GUUA 1IUFA 2E35A 3LSJA 1JJ8C 2E60A 2XRNA 2EFOA 1FLIA 1BR1A 1QHGA 5FKKA 4X0GA 2DYSH 3A0HC 3ZMUA 2FX0A 4V2FA 2OQRA 3K1NA 4BE1A 3S3MA 1G8XA 3J80Z 1XS9A 4RDUA 3JR9A 3AL0B 1POGA 5L3EA 2LD5A 1VF9A 3CCMI 1FEXA 2G9WA 3MVPA 3BG7A 1IN4A 1F4KA 2GXBA 1A35A 1Y8RB 4MTEA 4ANJA 4XLHA 3V42A 6PAXA 3A2KA 1WHUA 4WF2A 4D7MA 1BI0A 4UUSA 1Z6TA 2E36A 4KN4X 3I59B 1R00A 2XF7A 2NNYA 4GYIA 2Z3YA 4IZZA 3C7JA 4ASNA 3BC8A 3PQJA 1JT0A 2E19A 4RAFA 4I76A 4HA8A 5DEQA 2W7NA 2EK5A 3L00A 2LY1A 3CTAA 4DGWB 3S17J 2PFBA 3K69A 3ZQQA 3W2VA 1IDZA 3VSLA 2H8RA 1MBEA 4BEHA 3W6JB 4LGWA 3ZR8X 4RAGA 3CZ6A 2LK2A 1V5EA 1WGXA 4PJMA 4RM3A 4MIMA 4N4OB 4EJOA 1X1PA 1JGSA 1Z21A 3FKIJ 1XGOA 2K9LA 4DYRA 3N4MA 4BU2A 5EDNA 1I6XA 3S8PA 3PSFA 1ZREA 4NQWB 2EZIA 3FZVA 5FKNA 4W97A 2Z9OA 1SANA 5A2QK 2X0LA 2QGUA 1YOVB 1HBXG 2DCEA 3LSPA 3ABUA 1MH3A 2QENA 2YX4A 1XDUA 1ZG5A 5DYMA 5IY5H 3AG1H 3FXQA 2RAEA 4S04A 1ZARA 1CF7A 2FOWA 2JN6A 2I5UA 3ZGKA 4AVPA 3IHUA 5LLQA 4FCYA 1SD4A 3VYTB 5H6RA 1YO5C 1KU9A 2Y31A 3D0SA 2QKLB 1S8NA 1MIJA 3J7YJ 2VUMJ 2HTJA 4X1EA 1FP2A 3VSKA 3BR1A 5HDKA 1QRYA 2XPVA 2FQ3A 1HSTA 2NS8A 2ZFUA 4PSXA 1YJ9I 2E2HJ 2VKVA 1IXCA 4ESBA 3FXLA 1YQAA 3HUGB 3RKQA 2FD5A 4HX4A 4D5FA 2D1VA 2O5RA 4KFCA 2R7QA 2QSHX 3J7AO 1TTYA 3T5XA 4D1QA 4BACA 2KHMA 1TWFJ 2VJIA 3W3CA 5J8FA 3IV5A 2DMTA 2L54A 3GVAA 2K02A 1UG2A 1XMXA 1OCOH 2BEOA 4OU0A 2KQRA 3FXJA 1R4NB 1X1BA 4B44A 4OAYA 4ENJA 1KA8A 3AG3H 1DGRM 1Z77A 2F6CA 3CCUI 3HRUA 1YRNA 3HSRA 4P55A 1EJ9A 2EQRA 3HPHA 3SJMA 2XAUA 2Y0SA 3IWZA 4LG0B 2K9NA 4IRHA 1ON2A 3QPHA 5GPAA 4EJUA 5L3FA 1LEAA 3S1NJ 3HGGA 1TWAJ 4AC0A 4KN7X 4A3FJ 3LSRA 2X6YA 3HC7A 3KP5A 3M8JA 3DBLB 4FHTA 1X2NA 1E3PA 1MH4A 4DJAA 2JPBA 3O2PE 3HTUA 3WHCA 1O57A 3WE2A 1EH6A 1W7PD 2LREA 4HV6A 5L3BA 4MO7A 4IXAA 3LAJA 3JRCA 3GTGJ 1VQ8I 2HR3A 1U8RA 3MZYA 3ZCOA 5IYDJ 3OYKA 2H6BA 4CYDA 3MN2A 3S1RJ 2CS3A 3S32A 1MKMA 3LA3A 4U0WA 3DEEA 1ORKA 4XR6A 5B5EC 2W24A 3WTXC 3FHZA 4KJZA 1PUFB 2A05A 1JT6A 4YFXF 1ERDA 3LFKA 2W57A 1KQ0A 1QU3A 1V5FA 2CW7A 3OYBA 4A12A 2UV1A 1IN8A 2P5VA 1DU6A 1BL0A 2L7ZA 2AO9A 3R0JA 4IRIA 4HZFA 5IOZA 1BW5A 4XKBA 1VQ5I 1D1CA 5CKTA 3BQYA 4B8XA 3HM5A 1V5GA 2P6SA 4YEJA 4HNTA 1TNTA 3F22A 3OIPA 4HX8A 5E79C 2LY9A 3ABKH 4A6DA 2NAZA 2O6GE 4L5IA 4MHGA 3JREA 2DPUA 3DLLF 1DGWY 1E2XA 2XPWA 2DOEA 4QPQA 1ZKGA 4M6XA 4KMFA 1EV7A 1BR4A 3TW7A 4EJWA 4NNJA 5DDGA 2BV6A 1U9OA 4KITB 1YX5A 4IHYA 4LMYA 2ZXJA 2AQEA 2FBIA 5ICGA 2X51A 5EYRA 2KPMA 4CCJA 1XN7A 1ZHFA 3W2AA 4NDLA 4F92B 3MKWB 4XRSA 2IGKA 3JTHA 4MEXF 1ETOA 1Z91A 2CW0F 5E3LA 1IUYA 1STZA 1XDSA 1IRXA 2LP0A 2W82A 1MMSA 2X6WA 2BYVE 3ZN1A 5K7HA 2NRAC 1SEUA 1OCTC 4UNOA 3H3ZA 2OJED 2Z5UA 3PIOF 4QTRA 1E3OC 1QZZA 4B1RA 4KA4A 5EZHA 3H5AA 1Z6RA 2Y75A 4ZYAA 2E7XA 3H3UA 2VLAA 1NG6A 2V6EA 5EGOB 4HQEA 2QBYB 5H6QA 5BS6A 4I99C 1AU7A 1IO2A 2NYXA 3QYEA 2W25A 2P5KA 1Q1HA 2R7FA 5J3LA 2CV1A 1XSDA 2JJ7A 4Y13A 2CU7A 2J5OA 2MH2A 1IRZA 5IT9K 2HXIA 1FOXA 4WXHA 1S9HA 2OQGA 4N4NB 2D45A 3RKYA 2L3DA 3G2BA 3FMQA 4A3JJ 2JA5J 4RGUA 1F36A 5FKMA 3AAFA 1RR8C 2OU2A 1F5TA 2L9VA 2VC1A 2VOPA 1HKQA 4AM3A 1R36A 2LRDA 1S5LC 4FISA 1J09A 2ZXWH 1WI3A 4D9JA 4IHXA 4A3DJ 3GCMA 2DJNA 1NK3P 1IXRC 2H09A 1Z3YA 4U0YA 3HOUJ 3EYYA 1J9IA 1YS6A 2G0EA 2XAHA 3DBHB 4LB5A 3BR3A 2ZBKA 2DA6A 4IPAA 3BR0A 3RJPA 3CJRB 3O3KA 2Y0MA 3W2WA 1VI0A 3FMSA 3OYNA 2ADUA 2VXDA 3JAMZ 2P7VB 1QPIA 2CV2A 5FRNA 2QUFA 3HOYJ 1W1WE 3JRHA 3WGHA 3DKXA 3H0GJ 3SXYA 3BTJA 3I9V2 1TBXA 5DUIA 2CFOA 1T08B 3TBIA 4BQNA 2L5QA 3FM5A 3GTOJ 2IAIA 2GA1A 3C2GA 1C0WA 1HCRA 2VONA 3HL2A 2ZO4A 5HLIA 3TW6A 5D5VB 3H92A 2HYFA 3NARA 3K7AJ 1OLTA 4CCKA 3JRAA 2P81A 2ZXHA 2VE9A 3MD2A 4ZTJA 1OISA 2FSWA 3JRFA 2CGPA 2WAQA 4A0XA 3ZN0A 1K4SA 1T95A 2AHQA 3LSGA 5JI6A 3F6OA 4DBRA 1HF0A 1LEBA 2MGQA 3CJNA 2O8KA 4CHUA 5HOOA 4GYGA 3H5NA 4BHBA 4DNCA 1Y0UA 2RV8A 1WJAA 3PUFA 4IOAF 3H0DA 2CMPA 2DK5A 3A4CA 2LG4A 2AXTC 2O8XA 4RS8A 1R71A 4BXXJ 2Z2SB 1LB2A 1YFHA 3LSIA 2JA6J 1D0YA 1FBQA 2DOAA 1SFUA 4XLPF 5D6EA 3TGNA 4OAZA 3F8BA 3ISPA 1E0EA 2WV0A 5KHDA 4Y17A 1SAXA 5GP9A 4UV8A 1BC8C 3IKTA 3CCRI 4M72A 2TCTA 1IXSB 4G7HF 1Z7LA 1VZ0A 1XTAA 3DEUA 4PGHA 3U1DA 4XLCA 2EV6A 3GYHX 4HF0A 3TO6A 5FFXA 2KRFA 4M3FA 3NRVA 5EJCA 2DN0A 2IW5A 4ENMA 2X9DA 3I3LA 1HA8A 2BW3A 2FEZA 3OYIA 1XC5A 2ID6A 3PL8A 2QA4I 3H5RA 1U2WA 2WV1A 4LK1F 2Q2EA 5TRDA 3T0YA 2N8GA 2VPRA 2W00A 4XKWA 1LPQA 1XCVA 4NB5A 1S7AA 2YSRA 3IH4A 2IA1A 2O3FA 1ZGWA 3L9FA 1FPQA 3BLYA 3TP3A 1NHAA 4XRSG 1Z05A 2LBFA 2E71A 1HKTA 4Z2YA 4BXFA 3WTZA 2PLYA 3DPUA 1K79A 1V54H 5CPRB 5GADJ 2ISYA 5F0FA 1MDMB 1SVMA 3M4OJ 1E17A 2ZJRF 4UV9A 2KKOA 1XMKA 5FROA 3CO7C 3RI4A 3QQAA 3ZPLA 3SQNA 2ZKZA 2V1DA 5BMZA 2GOXB 2EWNA 3KEOA 2VBWA 3SZPA 2A61A 2VJ4A 4JX5A 3G73A 3F0CA 1NK2P 1Z7UA 1ZR2A 4FASD 4DBQA 4MEYF 1O7LA 1OMIA 4JQFA 2OTJI 3OYFA 3FKJA 1B1BA 1ODDA 2IBDA 2OCEA 4YFKF 2WWYA 2E2IJ 1N25A 4UVCA 5EF6A 3K70D 1I1GA 2F5EA 4F91B 4E70A 1LQ1A 4E4HA 2HVSA 4BQAA 4ZH4F 3HOVJ 3EUHA 3VFZA 1W5TA 2WTEA 5IP7J 1ZLKA 2LTPA 2EIJH 2V79A 2STTA 2ZJ2A 3GTQJ 2A6TA 2K4BA 3DTKA 2PMHA 3FBIB 3HRMA 3RPUA 4CCOA 4RB0A 3IH2A 4PJ0C 1FSEA 3H9QA 2IGNA 2F4MB 4OWRB 1B72A 1IV8A 2K3FA 2BZTA 5GAEJ 3DF8A 1GVDA 5CVVA 3OL3A 4Z6YA 2BVMA 5CYVA 2KT0A 2JWTA 3CMMA 2CG4A 2L4AA 4IQ4A 4P9FA 2P4WA 2CSOA 1ZR4A 1I3AA 1YIJI 3A01B 2VBZA 3F8CA 2CRGA 4BS9A 1IG7A 1B6AA 5EEHA 1T2KA 3P9CA 1JI8A 1IW7F 3SDGA 3TOBA 2LLKA 1RNLA 2DXIA 5J4VA 3E6DA 3K9TA 2VQLA 1YW7A 4IO9F 3FISA 4N9IA 1RUNA 1XMAA 2RQPA 4C2MJ 5FLXK 1O7FA 3QU3A 5IP9J 2J5PA 1VNDA 3BCAA 3ABTA 3PO3J 2C6YA 3WU2C 4ZZDA 5IPAA 1R1TA 2QLZA 3QYBA 1X1CA 2LR8A 4HLXA 1JHHA 1ETQA 4G7OF 3PJRA 3ECOA 2ZSHB 3HPGA 3ULQB 1IN5A 3MZHA 3P7NA 3QODA 3WGGA 3CLOA 3RTRA 5D5XB 5JLXA 5E3OA 1Y1VJ 4BBSJ 3R4KA 4EQQA 1OFCX 2EFNA 3A1YA 2YUSA 2BVLA 2HDWA 2RN7A 3GZNB 4U7BA 5J1RA 1PP7U 2MABA 3K2ZA 1IJWC 5HLHA 2E5ZA 3QPTA 1ETWA 1TNSA 2GIVA 3Q3SA 1VQNI 2LH9A 2EA2A 3HOTA 3TOAA 4LK0F 1D8JA 3SYTA 2UWMA 3LWFA 3OS2A 2CQKA 2QCOA 1W0UA 2GLOA 2GXAA 3GTMJ 1RRJA 3S2DJ 2VQCA 1G3TA 4UUSB 4ENNA 2GQQA 1U5TA 3KX2A 2NNNA 1YJNI 4C3HJ 2CFXA 3D5RC 3BR5A 2IJLA 4IJAA 2JT1A 2MH9A 3MWMA 1MBJA 4I0AA 3KFWX 5BPIA 1GVJA 3L2CA 1FIPA 1GXQA 2QYOA 4XRMA 2HEOA 2KP6A 4H0EA 3RKWA 3SFIA 1ZG1A 3FDYA 1Q1VA 3S16J 3BP8A 4RBOA 2QF7A 4C9YA 4BEHB 3CESA 1KONA 2NS0A 3U2RA 4FE4A 3VB2A 5L3GA 5BNGA 2PMUA 2F2EA 4JBAA 1UMQA 4MFEA 2WAQN 5F0CA 1JKOC 1FTTA 1X4OA 1RKWA 1F9NA 2HQRA 3FMRA 1WH5A 2EJRA 2FU4A 2EV0A 2V9KA 3OIOA 2IS1A 3OYHA 3JRBA 3ZQHA 4YELA 3LMMA 2NVTJ 3CJQB 2CUEA 4DZPA 2VL8A 1D0XA 1IGNA 2BOLA 1UFMA 3OOUA 4LLNA 4AVZA 3VEPA 2EZLA 2XIGA 1CF7B 4J01A 1MJAA 1ACIA 2HKOA 5JR3A 3C2HA 1O3SA 1HXDA 3F72A 3I53A 1I1SA 2G7UA 2Z33A 1BR2A 1UG0A 3QWLA 4M9SA 4GXOA 4ZDPA 2HU9A 1UELB 1SFEA 4HF2A 4KT5C 1LFPA 2DQRA 1SC7A 3L7WA 1BIBA 1NTCA 2IS6A 2M4GA 3BPVA 3MCZA 5J47A 1WKMA 2BHZA 3J7ZI 4U88A 2CWEA 4XNFA 4BHCA 4CDGA 4YG2F 4BY1J 1I5ZA 5J8CA 1JTXA 2HZDA 3C18A 3V8JA 3HRSA 2HGCA 4IL6C 3EDPA 2XGEA 3EUHC 2VOOA 4JK1X 4BQOA 2V4JC 4GCVA 5JVTA 1HW2A 4XL9A 2JPCA 3F6VA 3DLAA 2JSCA 2R7DA 2K3PA 5JFRA 1OR7A 1S3JA 4ZYGA 4CSWA 1RUOA 4BHPA 4CO8A 1JKRC 5JVGF 3PQKA 5C44J 1S6LA 4F52A 1LDKB 2XF5A 4CCNA 4CZCA 4Y52J 2RVCA 1D8KA 1YRNB 1MW7A 5ICFA 3R61A 4L18B 2JZYA 2EFPA 1R23A 4RB3C 4A0ZA 3E0JB 3ERED 2PN6A 3DQVC 2X6OA 3M1EA 4XKCA 4L5EA 4J19A 2LKXA 1D0ZA 2E7WA 1BI1A 1XD7A 2R7SA 3DP7A 2A5YB 4A3MJ 2X6XA 1W7PA 2IXSA 1H9GA 2ZB9A 4G9YA 4HEA2 3CCVI 3IRQA 4HSRA 1TT5B 3LA7A 5L3CA 2NVUB 5DCMA 4PFOA 2BY2A 4C3JJ 2HPIA 3E3VA 3RQIA 1D1BA 3OYJA 4L0YB 3NWTA 5F0HA 2H6CA 2Q1ZB 3K10A 3MKZA 4QPOA 3OYCA 4A3CJ 4E7KA 2YR2A 2ZMEA 3BY6A 5F1RA 4B3AA 2XSJC 3BR2A 1OKRA 1BW6A 2WAEA 1TW2A 1LVKA 3D5LA 5DD8A 3HHGA 3TKYA 3E7LA 3GMEA 3MMYB 3O8HA 3KYDB 3BROA 4GDFA 2CQXA 5IYBJ 4ETSA 4QSHA 2GWRA 1LJ9A 2H1KA 2QQAA 2V9PA 2JA8J 1UHMA 5D5UB 2M0CA 1MD0A 4PCQA 3N97A 1SMYF 4IF4A 3Q9SA 3RZDJ 3H1CA 4A0YA 4HAMA 3SFZA 4AU7A 3I55I 3RPQA 4F55A 2DA7A 2VI6A 2OF7A 2R4GA 4BXUA 2QSGX 2R7RA 2DMUA 4I01A 1VQPI 1LKXA 2FBHA 4RA2A 2O61A 2W4SA 1PYVA 3TEDA 1N77A 1U5TC 2WADA 2L01A 1MMDA 1Z3XA 1ETYA 2DT7B 1OYWA 3BTCA 4I7HA 2DMPA 1SFOJ 3ZQGA 1WH7A 4C3IJ 4PZJA 2R0QC 2PG4A 3CF2A 1R22A 4AIHA 1H8AC 1L0OC 1QVUA 2DBBA 3I64A 3H35A 3HYIA 3HOXJ 4Q48A 1I6HJ 2M7AA 3V7SA 2P6TA 3RYPA 4G7ZF 2ME6A 1K78A 3HSFA 1EH8A 1Z1DA 4DW6A 3KP7A 4LB6B 5HS9A 4EGZA 1FT9A 3COAC 1SD5A 4ZJZA 3BG9A 4JX4A 2VJJA 1KYWA 2PMZN 3F8FA 1D5YA 5K5OA 2R5ZA 2HKXA 1MJ9A 3R60A 3CJTB 1MBFA 1WJDA 4H4KC 2IS2A 1WJCA 5EG0A 4AIDA 2E5NA 3I56I 2YPRA 1TWCJ 2KIUA 3IWFA 4RAYA 4B4CA 5M5WJ 4L5JA 2MD5A 2XDVA 4LITA 2M4KA 2QVOA 3DKYA 2ZCWA 1IRGA 3H36A 2WA0A 3TDUC 4RMNA 4D7NA 3WG9A 2IT0A 1XB4A 3N05A 1T0FA 3P9IA 2LSOA 3VWBA 2Z16A 4CH7A 3IRRA 1TC3C 5LEKA 4E7IA 1MMGA 3MQ0A 3GEZA 1OCRH 2XKPA 1DP3A 3G1LA 3EQLF 3GFLA 5HLTA 2LKSA 2HVRA 3L2QA 2Y2ZA 3L2VA 2K9QA 2XPUA 2DFIA 2KZGA 3B73A 3LQRA 3PFYA 3VOEA 4FTHA 5KK1A 3B02A 1K61A 4NHJA 3FK6A 3PNYA 3FWEA 1T6SA 5F04A 1K83J 3FK7A 2M8EA 5J6XA 4I2OA 2K27A 1B9MA 3OR2C 4I6ZA 4JYKA 1R6RA 1B9NA 2VXZA 3RCOA 3JCUC 5FLMJ 3X2QH 2OCCH 3CDHA 5LGUA 3HTSB 3L09A 4LIVA 2XC7A 4AUXA 1OR7C 1TT0A 2K85A 2MSYA 4Y3OA 1XG1A 3OY9A 1O3TA 2DAOA 2OV7A 5D8LB 3RDIA 3BJ6A 2D2WA 1FYLA 1X2MA 4EEFG 3OYAA 3HZJA 3HRTA 5LHIA 2LFBA 3DPLC 2VPLA 3RZOJ 1LE8A 4DZJA 2PQ8A 3BQZA 5E17F 1T39A 4Y7NJ 1TLHB 4S05A 2IA0A 1OYYA 3DU5A 1S7OA 1AHDP 4XN0A 1BBYA 1VTNC 2L0KA 1B8IB 2UXNA 2ZNYA 2M3AA 1FBSA 2GAUA 1PDNC 2ME0A 2VIXA 4G8XA 3CCLI 1YTYA 2VBYA 5A2QZ 2FE3A 4AYBA 2M7BA 5KAFC 2PJRA 4JOMA 1YYVA 1SAUA 4WXCA 2NVXJ 3JW4A 3QYFA 2QQ8A 2MW8A 3OOPA 2DA1A 4C30A 4XOPA 4DOZA 3KZYA 2BY3A 2EIMH 1QGPA 2NS7A 1P4XA 1ZGAA 5E8IA 4FX0A 2ZMEC 4XICA 1HSJA 3ZQFA 3DCFA 1RKTA 2YS9A 2M8GX 5LHGA 2IVMA 4HLYA 4II2A 5FLVA 1FSHA 2B9SA 4KMUX 4F93B 4BJ5C 1IV6A 1ZH5A 2OUMA 2Y30A 2XAJA 2R7OA 3K6GA 4O3MA 4A3LJ 3B6AA 3Q9VA 1AWCA 4QWQA 2KJCA 2M1BA 1V4RA 4YRVA 2XKOA 4LOCA 5J40A 1KYZA 3CC7I 3I54A 4FETA 4ZDOA 3VDXA 3V7RA 5H20A 3BTIA 2XVCA 2QQ9A 2CUFA 3C3WA 2Y9ZA 1MMNA 5HS8A 2O9LA 1HLVA 2BY1A 1Z0XA 2L2OA 2OAZA 3LNQA 4DYQA 2WAFA 4CA0A 1Z67A 4RLFA 4BAYA 3WU1B 3ROUA 1HOMA 3FXRA 3MEXA 1J7KA 1BJAA 3BDDA 4PK4A 5EGOA 1O3RA 3RQ4A 3L1PA 3B6CA 1JTYA 1I3QJ 3BT9A 4MTDA 2LF8A 2VQHA 4DIQA 3H3VK 5E20A 2V1UA 3ZQLA 1KQ9A 1EF4A 2NVYJ 3L2WA 1TZLA 1JJ6C 1FX7A 3MKYB 2H8WA 1PP8F 3UNGC 4YIFA 3FF5A 2QWWA 2BW3B 2LYCA 3OYMA 1KU7A 1T56A 3P5JA 2ISZA 1SVLA 3BR6A 1YW9A 2XAGA 3LSMA 4G12A 1QA6A 3A03A 2PX9A 3O8GA 2PI0A 2Q2EB 2FJ1A 1GHCA 1QNTA 1ZYRF 3WTTC 2GZWA 2W48A 3CP2A 2JSPA 2Y48A 5E3MA 3G4SI 4XQFA 4HPQA 4ESJA 4C2UA 3AG2H 1GV5A 1LDJA 4JX6A 3FXUA 1FOWA 2LBFB 1MBKA 4G6DA 3L2RA 3JRDA 5FFZA 2OPTA 4IRGA 3J81K 2MFZA 1A31A 4A3GJ 2XGXA 3RSNA 2M30A 1YG2A 3M8EA 2K86A 3KEYA 1ZRFA 2V7FA 4ZC3A 3TO7A 1GV2A 1T0FC 1AOYA 2FOKA 1FOKA 1LNWA 1VFCA 2D5VA 1HC8A 1YI2I 1ETVA 1YE9A 4LJZF 3C2BA 1HQCA 4LFUA 1DDNA 3ZMTA 4M74A 4XN3A 2WBMA 1AA7A 3F21A 5F6FA 2UZKA 1BA5A 3GF2A 1XGNA 4M73A 1QVTA 3I5UA 1KU2A 3ESWB 5FD6A 1WCMJ 4KDPA 3DWLE 2IPQX 4NC7A 5AIPA 3WTUC 4W1UA 3WHBA 1W5CC 3J80K 3SHFA 4M3GA 2HOEA 5LGTA 3HDDA 1R7JA 2OA4A 3BZCA 4MGRA 3CMEI 2A68F 2HQNA 1B59A 4WK8F 1R58A 2DPDA 4D0PA 2R3SA 4KYWA 4OMYA 4L9NA 4YIIA 2GOMA 1Y39A 3PNTA 2RGVA 2E2JJ 2L7FP 2JQ7A 1SD6A 4U7DA 2IS4A 1DPRA 1T98A 2NXNB 2FQ4A 2EH3A 4XLEA 1B72B 2KDZA 5HNFA 3F8NA 2Y9YA 4NBQA 4ON0A 4XSXF 4KUMA 2D1HA 3OV8A 1MSEC 3CDLA 1ZTRA 1OCCH 3OYEA 3ZRGA 2DJIA 1ZRDA 4CYCA 2DA5A 4ZZLA 5TISC 4RM2A 2LNBA 1WWXA 1WSUA 1F43A 4IHSA 3Q0UA 2KJBA 2MD0A 1CQTA 4OIOF 2P5LC 4FT8A 3GX4X 1QZYA 3GLXA 2F5DA 4ITVA 4B3XA 4EV0A 3BOQA 3GZ5A 1K6YA 2LF7A 3OL4A 2M5WA 5DTDA 3V8KA 4OMZA 1MBHA 1R1VA 4BQQA 1BI2A 4EATA 3BG3A 1Y1WJ 2X1EA 2VKDA 1UB9A 2VE8A 2CW8A 5BPDA 2FF4A 5M5YJ 3S93A 1JUMA 4WWCA 3K4MA 4B48A 3IKVA 5E1XA 1R9TJ 4HRIA 5M3FJ 5IT9Z 2COBA 5FB2A 4EM2A 1W36D 1G6NA 3DBRB 5HDNA 2XF6A 1QO0D 1R5HA 2HQAA 3OSGA 3UKGA 2L9SA 3JRIA 3KEQA 4UB6C 5D4RA 1J5YA 3HGYA 2ELHA 4IKFA 3ZOBA 2STWA 4XK4A 3BG5A 1E3HA 2ICWG 3KYCB 3FX3A 4GRIA 2FBKA 4CCLA 5ICCA 3IP4B 5DM7F 2LDUA 3SEQA 3WODF 1WI9A 1SVOA 2ELJA 2ZJPF 4EGYA 4DQ2A 1W0TA 1U5TB 5ILSA 2B63J 1HDDC 2H1LA 2R7XA 3QOEA 4JP0A 4CCMA 5LRSA 3KETA 3LSTA 3IC7A 4BJ6C 1CGPA 1I50J 2XHKA 4BNCA 1S72I 4M9XA 3EYIA 5E18F 3MFKA 2DT5A 3CUQA 3VPRA 4AYBN 3BJAA 3BZKA 1Y8QB 4AD9A 3I0TA 5HVQC 4B47A 4Y33A 3JRGA
chains in the Genus database with same CATH topology
2EILH 3ABLH 1OCCH 2EIJH 3ABKH 3ABMH 2DYSH 3AG2H 3AG4H 5B1AH 2EIKH 1V54H 1OCOH 1OCZH 2EIMH 3WG7H 5B3SH 5B1BH 3AG3H 3ASNH 2DYRH 2ZXWH 1V55H 2EINH 2Y69H 3X2QH 2OCCH 3ASOH 1OCRH 5IY5H 3AG1H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIL H;  3ABL H;  1OCC H;  2EIJ H;  3ABK H;  3ABM H;  2DYS H;  3AG2 H;  3AG4 H;  5B1A H;  2EIK H;  1V54 H;  1OCO H;  1OCZ H;  2EIM H;  3WG7 H;  5B3S H;  5B1B H;  3AG3 H;  3ASN H;  2DYR H;  2ZXW H;  1V55 H;  2EIN H;  2Y69 H;  3X2Q H;  2OCC H;  3ASO H;  1OCR H;  5IY5 H;  3AG1 H; 
#chains in the Genus database with same CATH topology
 5DD4 A;  3R6S A;  2VT2 A;  2CQQ A;  1WQ2 A;  2XAQ A;  3CCE I;  1V3F A;  2EBI A;  5KNL A;  1KGS A;  1OYI A;  2QEX I;  3CP8 A;  2F5C A;  5IOY A;  3RKX A;  4A3K J;  1MNM C;  2DLL A;  1X3W B;  3TO9 A;  4MNU A;  2PMZ A;  2AQF A;  2VB6 A;  4G94 A;  5GTH C;  4GFB A;  2FML A;  4XRF A;  4BE2 A;  1K4T A;  4A93 J;  3E97 A;  2MLK A;  2HDC A;  2ACJ A;  4RGX A;  4E6K G;  2HOT A;  3EUA A;  3CDI A;  5B1B H;  4PJJ A;  1ZRC A;  2IGM A;  1VQM I;  3MZ8 A;  3G6E I;  5F64 A;  1FZP B;  3CC4 I;  5H2F C;  3LSH A;  3GW2 A;  3LAP A;  3BG6 A;  4R79 A;  3S3O A;  3PO2 J;  2CQN A;  1RI7 A;  3ABL H;  1WFX A;  2HDD A;  4LD5 A;  1DQU A;  2RQQ A;  4AWX B;  4WCG A;  1ZK8 A;  2MLG A;  4WXD A;  3OYL A;  5FRM A;  3I4N J;  3E6B A;  2H27 A;  2NOG A;  1L3L A;  2MG4 A;  1RET A;  1WPK A;  2W85 A;  4PJL A;  2VJ5 A;  4O5V A;  2HZT A;  4PFP A;  3GUD A;  5LEJ A;  3K4J A;  1JUP A;  2RRE A;  4LLG F;  2TDX A;  1KQ8 A;  1IF1 A;  5DUK A;  2ZSI B;  2FNA A;  3WTV C;  5F1J A;  2JVH A;  4M71 A;  2X85 A;  1G2H A;  2YU9 J;  5M3M J;  1IRF A;  1ZGJ A;  2EIL H;  5CLS A;  3T8R A;  3K70 C;  5HOD A;  1EH7 A;  4C2T A;  1J0R A;  1P7I A;  3KPH A;  5TGT A;  4L0Z B;  2KRC A;  2JVG A;  1ETK A;  1N75 A;  5CQE A;  3WGI A;  4HNU A;  2EB7 A;  4Q5S F;  1GLN A;  2XRO A;  3DKW A;  1VQ7 I;  4GGG A;  4PSW A;  3ASN H;  1R4M B;  5AIQ A;  1P4W A;  3PM1 A;  1JHF A;  1HKS A;  4UUV A;  5D5W B;  3WTY C;  4XSZ F;  1N78 A;  2HPM A;  2WY7 Q;  2ELK A;  2VN2 A;  2K5C A;  2FA5 A;  1KZH A;  3FIW A;  2V1X A;  1FYK A;  4P5O A;  2HI3 A;  1FBU A;  2XSD C;  2DMQ A;  4X6A J;  2G7H A;  2BXY A;  2YU3 A;  4HF1 A;  3M9A A;  1ETX A;  2ESN A;  3VYR B;  2EIK H;  1BOB A;  2W1O A;  1JKQ C;  1WRJ A;  2KIF A;  2KLO A;  5KVR A;  2ECC A;  1YIT I;  3QPL A;  1RR7 A;  4N9H A;  4PGG A;  5EZG A;  5KCM A;  1H9T A;  1WVR A;  3GTJ J;  1W7P B;  2B0L A;  1APL C;  5CJ9 A;  5DCM B;  3KIO A;  2EFQ A;  5CQG A;  1QPM A;  2A6H F;  3HXL A;  2P7C B;  1SFX A;  3TQN A;  3DFG A;  3GFJ A;  4IQJ A;  3VYU B;  2KIS A;  2CO5 A;  2F4O B;  3HEF A;  3KP4 A;  3LFU A;  2DFF A;  2ZME B;  4HNV A;  1TP4 A;  2R5Y A;  1SMT A;  1IN7 A;  2RDP A;  5GTI C;  1AKH A;  2DA4 A;  5ICE A;  3M07 A;  3REO A;  3FXO A;  1KU3 A;  4YIR X;  3M7G A;  5K5R A;  4LG3 A;  3DTE A;  2XRL A;  3NEU A;  3CD6 I;  3FBN B;  3WTS C;  1YW8 A;  4RB2 C;  3S14 J;  1ZAO A;  3K0L A;  4HYE A;  1U78 A;  2VQG A;  3GFI A;  1NH3 A;  2P8T A;  1EA3 A;  2GA2 A;  1R49 A;  3BPX A;  2EV5 A;  4UUT A;  1S29 A;  4RB1 A;  4KIC A;  1Y0N A;  1WJB A;  3PNV A;  2E1M C;  4RLQ A;  2BE5 F;  1VQK I;  3I59 A;  5FKL A;  2EIN H;  4U0V A;  1G59 A;  4BY7 J;  1X58 A;  4M3E A;  4NC8 A;  4HDU A;  5HS7 A;  1U3E M;  1R1U A;  3E6C C;  1ZLJ A;  2HNH A;  2CUZ A;  3S1Q J;  2BGC A;  2VAS A;  2COM A;  3HHH A;  3CUQ C;  3M8F A;  4V19 K;  3RIR A;  3KZI C;  3IH3 A;  3S15 J;  3TP0 A;  3ELK A;  1BM9 A;  3KCC A;  3HG9 A;  2H94 A;  3QPS A;  1K78 B;  1I27 A;  1IC8 A;  1RPW A;  2DA2 A;  3LQQ A;  4PDK A;  3PSI A;  1GT0 C;  3K1P A;  1ZN2 A;  3OIQ A;  2OTL I;  4AIJ A;  2GM4 A;  5FLX Z;  2R7W A;  1XPX A;  3K4C A;  1IZ1 A;  4KIG A;  4IHT A;  1ULY A;  2XB5 A;  5FJ8 J;  2QKM B;  3K1M A;  1O3Q A;  3BTL A;  2A07 F;  1TWH J;  5CVU A;  2R5Z B;  3TMO A;  2HTS A;  3LOC A;  4ESF A;  3W6V A;  3A0B C;  4MQ9 F;  5JHU A;  2A5W A;  3JAM K;  3F3X A;  5EG0 B;  1EKE A;  2DDA A;  4NQW A;  2I8D A;  3FM3 A;  3HOZ J;  4BJT A;  2HFH A;  2K7L A;  4UXN A;  5IP6 A;  1FMW A;  2VKH A;  3HB9 A;  5L3D A;  4NC6 A;  4Q47 A;  1LDD A;  2YX7 A;  3NAU A;  4V2G A;  2LC2 A;  1X19 A;  1VQO I;  1V55 H;  2R7Z J;  3M3Y J;  2QZ8 A;  1TQI A;  5E1Z B;  2HQ5 A;  1D3Y A;  2Q0O A;  4EMS A;  3CCQ I;  1MZB A;  3EET A;  3BZ6 A;  1YX3 A;  5FD5 A;  3LSK A;  2DOF A;  4HDV A;  2K9M A;  3GZ6 A;  1VQL I;  2KMU A;  2MC3 A;  2IA2 A;  3OR1 C;  2LVS A;  4K2E A;  2DTR A;  3WTW C;  3HUG A;  3DV8 A;  1A5J A;  3BWG A;  1FYM A;  5F08 A;  1X3Z B;  5CVI A;  2M9H A;  2NVQ J;  1ZEL A;  5D6F A;  2EA4 A;  1M1E B;  4QLC U;  3ECH A;  5D4S A;  3ZQC A;  4M3B A;  1QQI A;  1XCB A;  4AIK A;  1HDP A;  1OPC A;  4E7H A;  4RGR A;  2DU9 A;  3HJE A;  1MBG A;  3VOD A;  1JKP C;  1VQ6 I;  4PJN A;  3OYD A;  2FRH A;  1J2X A;  5GAG J;  1RIO H;  2FXA A;  4UY8 I;  1J59 A;  4F3Q A;  3KYL A;  5E3N A;  4CZZ A;  2KIM A;  2KL4 A;  2GBY A;  1X1A A;  4LG0 A;  2F5V A;  1FTZ A;  2WB1 A;  4QIW N;  5KAI C;  4N0B A;  1LE8 B;  2RNG A;  5TJJ A;  2K40 A;  2V1N A;  4G6Q A;  5K5Q A;  2EZH A;  1U6G A;  2OD5 A;  1ENH A;  2CJJ A;  2L9R A;  2JRM A;  1QBJ A;  1HW5 A;  5CVJ A;  3TDZ C;  3K4N A;  3LA2 A;  5K1Y A;  1VQ4 I;  3F9K A;  1HW1 A;  1TQM A;  3HSE A;  1A6I A;  1X3U A;  4XON A;  3ZXS A;  3CF5 F;  4CGZ A;  2PJR B;  1LFB A;  3Q0V A;  2R7T A;  4E7L A;  1F1Z A;  2Z1D A;  4P96 A;  1PUE E;  2DFH A;  2VOD A;  2W84 A;  2XAS A;  5CVR A;  3KP3 A;  1PJR A;  2DO7 A;  4FX4 A;  1T33 A;  4O6J A;  1SD7 A;  2HS5 A;  4BL0 B;  1U9N A;  1ON1 A;  3MKL A;  1X1D A;  4XLA A;  3S2W A;  3RYR A;  4L9J A;  1J75 A;  1PUF A;  2OBP A;  2HYG D;  5J1U A;  4RGS A;  1YIO A;  2JMW A;  4IEJ A;  2IP2 A;  3ZQ7 A;  2MBF A;  3H9G A;  2IRF G;  3I4P A;  4ZTF A;  2LKP A;  4UB8 C;  4TV7 A;  3S3N A;  2CV0 A;  1UJ8 A;  3ZMS A;  3FXM A;  3DPT A;  4OIQ F;  2KZV A;  5GAH J;  3AL0 C;  1P7J A;  2ECB A;  1OCP A;  1A04 A;  1RZ4 A;  3TL4 X;  1FOY A;  4OIN F;  2JK3 A;  5LGN A;  2FNP A;  4A3I J;  2LY2 A;  1GDT A;  1UZC A;  3D5S C;  3ML6 A;  2K4J A;  1JUS A;  2EZK A;  2DMN A;  2I10 A;  1BOA A;  3GXO A;  3ZMD A;  4L9V A;  4I09 A;  2JA7 J;  3GTP J;  1JE8 A;  3CLQ A;  3UR3 C;  3HKZ A;  1TW3 A;  1DPU A;  4IHW A;  3I58 A;  2M87 A;  2FUG 2;  4BYY A;  3BCB A;  4XID A;  2Y69 H;  2ESH A;  3ASO H;  1I39 A;  1WJF A;  3OS0 A;  1ZG3 A;  3V7C A;  4B43 A;  2MC4 A;  5BQT A;  3GLL A;  2JUC A;  1MSF C;  2R93 J;  4EVI A;  5FKO A;  4HBL A;  1OJL A;  1FMV A;  3T8T A;  1WJ5 A;  2X1C A;  3L2U A;  4KIS A;  2KFD A;  2M2E A;  3E5Q A;  5J1Y A;  2Q8K A;  4XBF A;  3U21 A;  1PVE A;  2JUG A;  3KE2 A;  2GIZ A;  2IGO A;  3CCS I;  3SDB A;  2ETH A;  2PEX A;  3G1M A;  4IX7 A;  1A6Q A;  1MNE A;  1BI3 A;  2DA3 A;  2OC6 A;  5F27 A;  2JRT A;  3ZMV A;  5DCF A;  1K7A A;  4HST A;  2WC2 A;  3EPZ A;  1Z9C A;  3CQZ J;  1IDY A;  1G3S A;  5DM6 F;  1G3Y A;  5E1W A;  1MMA A;  4P9U A;  2QBY A;  3ZMZ A;  2DQL A;  5JHF A;  2CH0 A;  2M0M A;  4XOR A;  4XM3 A;  4II3 A;  4I98 B;  2F4I A;  1P6R A;  4CUG A;  3NWS A;  4R8H A;  4ZYH A;  1B8I A;  1R5G A;  2RKH A;  1W5S A;  4IHV A;  2BY0 A;  1FIA A;  3E1S A;  2A6E F;  1P9Q C;  2O7O A;  2L02 A;  3VYS B;  5C4J J;  2ZJQ F;  1TQP A;  4ZDL A;  1UCR A;  2DW4 A;  2HOA A;  2B7E A;  2MA3 A;  3ONQ A;  2RNJ A;  1DP7 P;  1K6O A;  4M6Y A;  5LFA A;  2L4M A;  3DXJ F;  1IAW A;  2DI3 A;  1VQ9 I;  4XLF A;  5B1A H;  2JA2 A;  1P4A A;  2F5F A;  2XAF A;  3F8M A;  2Z99 A;  3DU6 A;  4A6E A;  4A5N A;  2PBI A;  1G3W A;  5IYC J;  2R7V A;  3QU6 A;  1RC9 A;  2IEK A;  4BBR J;  3KP6 A;  3QRF F;  1MND A;  2CQ7 A;  1XGM A;  2LMD A;  3NQO A;  3ZP5 A;  5LD2 C;  1DUX C;  3I4M J;  2HYJ A;  2RC4 A;  2UXX A;  3GFM A;  4CYC B;  1T38 A;  2ZXI A;  2Y0S N;  3BJO A;  4E7Z A;  3H9J A;  1OCZ H;  3CC2 I;  2FMY A;  1LVA A;  3KZZ A;  4KIF A;  4HG2 A;  1REP C;  4I02 A;  1XGS A;  3QOP A;  3OWT A;  3WG7 H;  1B4A A;  3C1D A;  2DYR H;  5FO5 A;  2E1O A;  2VC0 A;  1MJB A;  2JTV A;  3JTG A;  4XLN F;  1USS A;  2KDO A;  2VBX A;  2CYY A;  4M6V A;  2BHY A;  1G4D A;  2DT6 A;  1ZQ3 P;  4G6T B;  3JSO A;  5LBQ A;  2NOJ B;  4P1W A;  4BDY A;  1LFU P;  4KNY A;  4L9T A;  4FQG A;  2P0W A;  3CCY A;  2DFE A;  2V6C A;  3OMY A;  2XUB A;  3GWZ A;  4FE7 A;  4M9Z A;  5ERI A;  2E1N A;  1JGG A;  1UST A;  1BN5 A;  1FY7 A;  5HLG A;  4BDZ A;  4HW0 A;  2M34 A;  4BKX A;  4A69 C;  4PUS A;  1IN6 A;  2QQB A;  4Q4Z F;  1YS7 A;  2ID3 A;  4KT6 A;  5ILU A;  3M1C A;  1LUJ B;  3O6B B;  1BIA A;  5DV5 A;  4WX9 A;  3AKZ A;  3PUB A;  4EM0 B;  2ZNZ A;  3KLN A;  1XSX A;  2ZFW A;  5DS9 A;  1FC3 A;  4HX7 A;  2E34 A;  2ZC2 A;  3OS1 A;  3ABM H;  1Y6I A;  1OQY A;  2DOD A;  1RES A;  4KIB A;  2WB1 N;  4BUP A;  4YFN F;  4CXF A;  3K4L A;  4M3D A;  3Q0W A;  2KRH A;  3S2H J;  2GXG A;  2E1M B;  3QP5 A;  1T8I A;  2WY8 Q;  3A02 A;  2L7M P;  5ED4 A;  4RAZ A;  1X4P A;  1FWZ A;  2R7U A;  3K4K A;  3CUQ B;  2E1C A;  3J7A Y;  2CUJ A;  5C4X J;  3V8L A;  2M45 A;  5J4Y A;  3Q5F A;  1WZ2 A;  1DU0 A;  2X1D A;  4A5M A;  4ENK A;  1D5V A;  5BOX A;  3HIF A;  4A3E J;  3SEZ A;  5HNH A;  4LIU A;  2BBY A;  2VT3 A;  4J00 A;  2K9S A;  2V9V A;  2PJP A;  3IAM 2;  4IVN A;  4NUB A;  2A3S A;  4CIC A;  2HOS A;  3E6M A;  2OZU A;  2V26 A;  1GXP A;  4XMY A;  4HOB A;  1W4M A;  2VKE A;  2XV4 S;  1UHS A;  4OIP F;  2L9N A;  3AFH A;  4HQM A;  3E5U A;  4MLO A;  4D5C A;  2XB0 X;  4HV5 A;  2LOO A;  1UHW A;  9ANT A;  4BGD A;  5LRR A;  3G1O A;  4A3B J;  3WE3 A;  1QHH D;  3HOW J;  3HOS A;  1NG7 A;  2KIQ A;  3CMA I;  1U8B A;  2TRT A;  5M5X J;  5ILV A;  1MDM A;  3CMY A;  5GPC A;  2UUZ A;  1P2F A;  3P9K A;  5EEG A;  3IL2 A;  2HWV A;  3T1B A;  3U1K A;  4S0H B;  4DYC A;  1FP1 D;  4U87 A;  5K7Z A;  3FHN A;  1YJW I;  1U0J A;  2XGC A;  1TWG J;  2MYS A;  2QSF X;  4EJV A;  4ZYD A;  4BH9 A;  1R5I D;  3PFI A;  3JSP A;  3V4G A;  3DTI A;  4EJT A;  5EEA A;  3OYG A;  1XSV A;  2QM3 A;  4UHT A;  4GO1 A;  3CCJ I;  5LHH A;  4LLL A;  3HKZ N;  2XGD A;  1YHQ I;  5K7F A;  3CUO A;  2DDB A;  1H89 C;  4BE0 A;  4UVB A;  3SZG A;  2HXO A;  3HBL A;  1D1A A;  1BC7 C;  1O4X A;  1QZE A;  5FGM A;  4E7J A;  2DK8 A;  4Y4R A;  1FNN A;  3IUO A;  5C3E J;  3IAS 2;  5B3S H;  2F48 A;  4MFD A;  5AON A;  2R92 J;  2HVQ A;  3K4B A;  5D8K B;  3E5X A;  3G71 I;  3QP6 A;  2OZ6 A;  4Y15 A;  3I71 A;  2X48 A;  5B66 C;  2EFW A;  1Y56 A;  1H0M A;  4A2U A;  3S1M J;  1ITY A;  1A36 A;  4F7Z A;  4ZYE A;  3GBG A;  5HDG A;  3GTL J;  1H88 C;  1JXS A;  1MGT A;  2BXZ A;  5JLW A;  3AG4 H;  3RPU D;  2EPF A;  3LL7 A;  2O03 A;  3D1N I;  4OIR F;  3KP2 A;  2L7K A;  3ZQI A;  1XX5 A;  3DEW A;  2A69 F;  3K2A A;  3A01 A;  3KLO A;  4XKV A;  3W6K B;  1P92 A;  2X4H A;  5E8G A;  3SZT A;  3FXK A;  1FJL A;  3U9G A;  3ERM A;  2DTZ A;  1UAA A;  1S7E A;  4R1H A;  3CO6 C;  1WJE A;  3R0A A;  3J81 Z;  3G3Z A;  4B09 A;  1ONV A;  4EM1 A;  3GO5 A;  3QAH A;  1BJZ A;  4MQV A;  3GTK J;  2O0Y A;  3OSF A;  1SFK A;  4OOI A;  1YLF A;  3PIP F;  4E7S A;  4IOC F;  3WU0 A;  1TL8 A;  2R5Y B;  4UVA A;  2AS5 F;  3MAJ A;  4XOT A;  3EUK L;  2AXL A;  5IT3 A;  1W36 C;  4ABZ A;  1AKH B;  4I0B A;  3F23 A;  1GUU A;  1IUF A;  2E35 A;  3LSJ A;  1JJ8 C;  2E60 A;  2XRN A;  2EFO A;  1FLI A;  1BR1 A;  1QHG A;  5FKK A;  4X0G A;  2DYS H;  3A0H C;  3ZMU A;  2FX0 A;  4V2F A;  2OQR A;  3K1N A;  4BE1 A;  3S3M A;  1G8X A;  3J80 Z;  1XS9 A;  4RDU A;  3JR9 A;  3AL0 B;  1POG A;  5L3E A;  2LD5 A;  1VF9 A;  3CCM I;  1FEX A;  2G9W A;  3MVP A;  3BG7 A;  1IN4 A;  1F4K A;  2GXB A;  1A35 A;  1Y8R B;  4MTE A;  4ANJ A;  4XLH A;  3V42 A;  6PAX A;  3A2K A;  1WHU A;  4WF2 A;  4D7M A;  1BI0 A;  4UUS A;  1Z6T A;  2E36 A;  4KN4 X;  3I59 B;  1R00 A;  2XF7 A;  2NNY A;  4GYI A;  2Z3Y A;  4IZZ A;  3C7J A;  4ASN A;  3BC8 A;  3PQJ A;  1JT0 A;  2E19 A;  4RAF A;  4I76 A;  4HA8 A;  5DEQ A;  2W7N A;  2EK5 A;  3L00 A;  2LY1 A;  3CTA A;  4DGW B;  3S17 J;  2PFB A;  3K69 A;  3ZQQ A;  3W2V A;  1IDZ A;  3VSL A;  2H8R A;  1MBE A;  4BEH A;  3W6J B;  4LGW A;  3ZR8 X;  4RAG A;  3CZ6 A;  2LK2 A;  1V5E A;  1WGX A;  4PJM A;  4RM3 A;  4MIM A;  4N4O B;  4EJO A;  1X1P A;  1JGS A;  1Z21 A;  3FKI J;  1XGO A;  2K9L A;  4DYR A;  3N4M A;  4BU2 A;  5EDN A;  1I6X A;  3S8P A;  3PSF A;  1ZRE A;  4NQW B;  2EZI A;  3FZV A;  5FKN A;  4W97 A;  2Z9O A;  1SAN A;  5A2Q K;  2X0L A;  2QGU A;  1YOV B;  1HBX G;  2DCE A;  3LSP A;  3ABU A;  1MH3 A;  2QEN A;  2YX4 A;  1XDU A;  1ZG5 A;  5DYM A;  5IY5 H;  3AG1 H;  3FXQ A;  2RAE A;  4S04 A;  1ZAR A;  1CF7 A;  2FOW A;  2JN6 A;  2I5U A;  3ZGK A;  4AVP A;  3IHU A;  5LLQ A;  4FCY A;  1SD4 A;  3VYT B;  5H6R A;  1YO5 C;  1KU9 A;  2Y31 A;  3D0S A;  2QKL B;  1S8N A;  1MIJ A;  3J7Y J;  2VUM J;  2HTJ A;  4X1E A;  1FP2 A;  3VSK A;  3BR1 A;  5HDK A;  1QRY A;  2XPV A;  2FQ3 A;  1HST A;  2NS8 A;  2ZFU A;  4PSX A;  1YJ9 I;  2E2H J;  2VKV A;  1IXC A;  4ESB A;  3FXL A;  1YQA A;  3HUG B;  3RKQ A;  2FD5 A;  4HX4 A;  4D5F A;  2D1V A;  2O5R A;  4KFC A;  2R7Q A;  2QSH X;  3J7A O;  1TTY A;  3T5X A;  4D1Q A;  4BAC A;  2KHM A;  1TWF J;  2VJI A;  3W3C A;  5J8F A;  3IV5 A;  2DMT A;  2L54 A;  3GVA A;  2K02 A;  1UG2 A;  1XMX A;  1OCO H;  2BEO A;  4OU0 A;  2KQR A;  3FXJ A;  1R4N B;  1X1B A;  4B44 A;  4OAY A;  4ENJ A;  1KA8 A;  3AG3 H;  1DGR M;  1Z77 A;  2F6C A;  3CCU I;  3HRU A;  1YRN A;  3HSR A;  4P55 A;  1EJ9 A;  2EQR A;  3HPH A;  3SJM A;  2XAU A;  2Y0S A;  3IWZ A;  4LG0 B;  2K9N A;  4IRH A;  1ON2 A;  3QPH A;  5GPA A;  4EJU A;  5L3F A;  1LEA A;  3S1N J;  3HGG A;  1TWA J;  4AC0 A;  4KN7 X;  4A3F J;  3LSR A;  2X6Y A;  3HC7 A;  3KP5 A;  3M8J A;  3DBL B;  4FHT A;  1X2N A;  1E3P A;  1MH4 A;  4DJA A;  2JPB A;  3O2P E;  3HTU A;  3WHC A;  1O57 A;  3WE2 A;  1EH6 A;  1W7P D;  2LRE A;  4HV6 A;  5L3B A;  4MO7 A;  4IXA A;  3LAJ A;  3JRC A;  3GTG J;  1VQ8 I;  2HR3 A;  1U8R A;  3MZY A;  3ZCO A;  5IYD J;  3OYK A;  2H6B A;  4CYD A;  3MN2 A;  3S1R J;  2CS3 A;  3S32 A;  1MKM A;  3LA3 A;  4U0W A;  3DEE A;  1ORK A;  4XR6 A;  5B5E C;  2W24 A;  3WTX C;  3FHZ A;  4KJZ A;  1PUF B;  2A05 A;  1JT6 A;  4YFX F;  1ERD A;  3LFK A;  2W57 A;  1KQ0 A;  1QU3 A;  1V5F A;  2CW7 A;  3OYB A;  4A12 A;  2UV1 A;  1IN8 A;  2P5V A;  1DU6 A;  1BL0 A;  2L7Z A;  2AO9 A;  3R0J A;  4IRI A;  4HZF A;  5IOZ A;  1BW5 A;  4XKB A;  1VQ5 I;  1D1C A;  5CKT A;  3BQY A;  4B8X A;  3HM5 A;  1V5G A;  2P6S A;  4YEJ A;  4HNT A;  1TNT A;  3F22 A;  3OIP A;  4HX8 A;  5E79 C;  2LY9 A;  3ABK H;  4A6D A;  2NAZ A;  2O6G E;  4L5I A;  4MHG A;  3JRE A;  2DPU A;  3DLL F;  1DGW Y;  1E2X A;  2XPW A;  2DOE A;  4QPQ A;  1ZKG A;  4M6X A;  4KMF A;  1EV7 A;  1BR4 A;  3TW7 A;  4EJW A;  4NNJ A;  5DDG A;  2BV6 A;  1U9O A;  4KIT B;  1YX5 A;  4IHY A;  4LMY A;  2ZXJ A;  2AQE A;  2FBI A;  5ICG A;  2X51 A;  5EYR A;  2KPM A;  4CCJ A;  1XN7 A;  1ZHF A;  3W2A A;  4NDL A;  4F92 B;  3MKW B;  4XRS A;  2IGK A;  3JTH A;  4MEX F;  1ETO A;  1Z91 A;  2CW0 F;  5E3L A;  1IUY A;  1STZ A;  1XDS A;  1IRX A;  2LP0 A;  2W82 A;  1MMS A;  2X6W A;  2BYV E;  3ZN1 A;  5K7H A;  2NRA C;  1SEU A;  1OCT C;  4UNO A;  3H3Z A;  2OJE D;  2Z5U A;  3PIO F;  4QTR A;  1E3O C;  1QZZ A;  4B1R A;  4KA4 A;  5EZH A;  3H5A A;  1Z6R A;  2Y75 A;  4ZYA A;  2E7X A;  3H3U A;  2VLA A;  1NG6 A;  2V6E A;  5EGO B;  4HQE A;  2QBY B;  5H6Q A;  5BS6 A;  4I99 C;  1AU7 A;  1IO2 A;  2NYX A;  3QYE A;  2W25 A;  2P5K A;  1Q1H A;  2R7F A;  5J3L A;  2CV1 A;  1XSD A;  2JJ7 A;  4Y13 A;  2CU7 A;  2J5O A;  2MH2 A;  1IRZ A;  5IT9 K;  2HXI A;  1FOX A;  4WXH A;  1S9H A;  2OQG A;  4N4N B;  2D45 A;  3RKY A;  2L3D A;  3G2B A;  3FMQ A;  4A3J J;  2JA5 J;  4RGU A;  1F36 A;  5FKM A;  3AAF A;  1RR8 C;  2OU2 A;  1F5T A;  2L9V A;  2VC1 A;  2VOP A;  1HKQ A;  4AM3 A;  1R36 A;  2LRD A;  1S5L C;  4FIS A;  1J09 A;  2ZXW H;  1WI3 A;  4D9J A;  4IHX A;  4A3D J;  3GCM A;  2DJN A;  1NK3 P;  1IXR C;  2H09 A;  1Z3Y A;  4U0Y A;  3HOU J;  3EYY A;  1J9I A;  1YS6 A;  2G0E A;  2XAH A;  3DBH B;  4LB5 A;  3BR3 A;  2ZBK A;  2DA6 A;  4IPA A;  3BR0 A;  3RJP A;  3CJR B;  3O3K A;  2Y0M A;  3W2W A;  1VI0 A;  3FMS A;  3OYN A;  2ADU A;  2VXD A;  3JAM Z;  2P7V B;  1QPI A;  2CV2 A;  5FRN A;  2QUF A;  3HOY J;  1W1W E;  3JRH A;  3WGH A;  3DKX A;  3H0G J;  3SXY A;  3BTJ A;  3I9V 2;  1TBX A;  5DUI A;  2CFO A;  1T08 B;  3TBI A;  4BQN A;  2L5Q A;  3FM5 A;  3GTO J;  2IAI A;  2GA1 A;  3C2G A;  1C0W A;  1HCR A;  2VON A;  3HL2 A;  2ZO4 A;  5HLI A;  3TW6 A;  5D5V B;  3H92 A;  2HYF A;  3NAR A;  3K7A J;  1OLT A;  4CCK A;  3JRA A;  2P81 A;  2ZXH A;  2VE9 A;  3MD2 A;  4ZTJ A;  1OIS A;  2FSW A;  3JRF A;  2CGP A;  2WAQ A;  4A0X A;  3ZN0 A;  1K4S A;  1T95 A;  2AHQ A;  3LSG A;  5JI6 A;  3F6O A;  4DBR A;  1HF0 A;  1LEB A;  2MGQ A;  3CJN A;  2O8K A;  4CHU A;  5HOO A;  4GYG A;  3H5N A;  4BHB A;  4DNC A;  1Y0U A;  2RV8 A;  1WJA A;  3PUF A;  4IOA F;  3H0D A;  2CMP A;  2DK5 A;  3A4C A;  2LG4 A;  2AXT C;  2O8X A;  4RS8 A;  1R71 A;  4BXX J;  2Z2S B;  1LB2 A;  1YFH A;  3LSI A;  2JA6 J;  1D0Y A;  1FBQ A;  2DOA A;  1SFU A;  4XLP F;  5D6E A;  3TGN A;  4OAZ A;  3F8B A;  3ISP A;  1E0E A;  2WV0 A;  5KHD A;  4Y17 A;  1SAX A;  5GP9 A;  4UV8 A;  1BC8 C;  3IKT A;  3CCR I;  4M72 A;  2TCT A;  1IXS B;  4G7H F;  1Z7L A;  1VZ0 A;  1XTA A;  3DEU A;  4PGH A;  3U1D A;  4XLC A;  2EV6 A;  3GYH X;  4HF0 A;  3TO6 A;  5FFX A;  2KRF A;  4M3F A;  3NRV A;  5EJC A;  2DN0 A;  2IW5 A;  4ENM A;  2X9D A;  3I3L A;  1HA8 A;  2BW3 A;  2FEZ A;  3OYI A;  1XC5 A;  2ID6 A;  3PL8 A;  2QA4 I;  3H5R A;  1U2W A;  2WV1 A;  4LK1 F;  2Q2E A;  5TRD A;  3T0Y A;  2N8G A;  2VPR A;  2W00 A;  4XKW A;  1LPQ A;  1XCV A;  4NB5 A;  1S7A A;  2YSR A;  3IH4 A;  2IA1 A;  2O3F A;  1ZGW A;  3L9F A;  1FPQ A;  3BLY A;  3TP3 A;  1NHA A;  4XRS G;  1Z05 A;  2LBF A;  2E71 A;  1HKT A;  4Z2Y A;  4BXF A;  3WTZ A;  2PLY A;  3DPU A;  1K79 A;  1V54 H;  5CPR B;  5GAD J;  2ISY A;  5F0F A;  1MDM B;  1SVM A;  3M4O J;  1E17 A;  2ZJR F;  4UV9 A;  2KKO A;  1XMK A;  5FRO A;  3CO7 C;  3RI4 A;  3QQA A;  3ZPL A;  3SQN A;  2ZKZ A;  2V1D A;  5BMZ A;  2GOX B;  2EWN A;  3KEO A;  2VBW A;  3SZP A;  2A61 A;  2VJ4 A;  4JX5 A;  3G73 A;  3F0C A;  1NK2 P;  1Z7U A;  1ZR2 A;  4FAS D;  4DBQ A;  4MEY F;  1O7L A;  1OMI A;  4JQF A;  2OTJ I;  3OYF A;  3FKJ A;  1B1B A;  1ODD A;  2IBD A;  2OCE A;  4YFK F;  2WWY A;  2E2I J;  1N25 A;  4UVC A;  5EF6 A;  3K70 D;  1I1G A;  2F5E A;  4F91 B;  4E70 A;  1LQ1 A;  4E4H A;  2HVS A;  4BQA A;  4ZH4 F;  3HOV J;  3EUH A;  3VFZ A;  1W5T A;  2WTE A;  5IP7 J;  1ZLK A;  2LTP A;  2EIJ H;  2V79 A;  2STT A;  2ZJ2 A;  3GTQ J;  2A6T A;  2K4B A;  3DTK A;  2PMH A;  3FBI B;  3HRM A;  3RPU A;  4CCO A;  4RB0 A;  3IH2 A;  4PJ0 C;  1FSE A;  3H9Q A;  2IGN A;  2F4M B;  4OWR B;  1B72 A;  1IV8 A;  2K3F A;  2BZT A;  5GAE J;  3DF8 A;  1GVD A;  5CVV A;  3OL3 A;  4Z6Y A;  2BVM A;  5CYV A;  2KT0 A;  2JWT A;  3CMM A;  2CG4 A;  2L4A A;  4IQ4 A;  4P9F A;  2P4W A;  2CSO A;  1ZR4 A;  1I3A A;  1YIJ I;  3A01 B;  2VBZ A;  3F8C A;  2CRG A;  4BS9 A;  1IG7 A;  1B6A A;  5EEH A;  1T2K A;  3P9C A;  1JI8 A;  1IW7 F;  3SDG A;  3TOB A;  2LLK A;  1RNL A;  2DXI A;  5J4V A;  3E6D A;  3K9T A;  2VQL A;  1YW7 A;  4IO9 F;  3FIS A;  4N9I A;  1RUN A;  1XMA A;  2RQP A;  4C2M J;  5FLX K;  1O7F A;  3QU3 A;  5IP9 J;  2J5P A;  1VND A;  3BCA A;  3ABT A;  3PO3 J;  2C6Y A;  3WU2 C;  4ZZD A;  5IPA A;  1R1T A;  2QLZ A;  3QYB A;  1X1C A;  2LR8 A;  4HLX A;  1JHH A;  1ETQ A;  4G7O F;  3PJR A;  3ECO A;  2ZSH B;  3HPG A;  3ULQ B;  1IN5 A;  3MZH A;  3P7N A;  3QOD A;  3WGG A;  3CLO A;  3RTR A;  5D5X B;  5JLX A;  5E3O A;  1Y1V J;  4BBS J;  3R4K A;  4EQQ A;  1OFC X;  2EFN A;  3A1Y A;  2YUS A;  2BVL A;  2HDW A;  2RN7 A;  3GZN B;  4U7B A;  5J1R A;  1PP7 U;  2MAB A;  3K2Z A;  1IJW C;  5HLH A;  2E5Z A;  3QPT A;  1ETW A;  1TNS A;  2GIV A;  3Q3S A;  1VQN I;  2LH9 A;  2EA2 A;  3HOT A;  3TOA A;  4LK0 F;  1D8J A;  3SYT A;  2UWM A;  3LWF A;  3OS2 A;  2CQK A;  2QCO A;  1W0U A;  2GLO A;  2GXA A;  3GTM J;  1RRJ A;  3S2D J;  2VQC A;  1G3T A;  4UUS B;  4ENN A;  2GQQ A;  1U5T A;  3KX2 A;  2NNN A;  1YJN I;  4C3H J;  2CFX A;  3D5R C;  3BR5 A;  2IJL A;  4IJA A;  2JT1 A;  2MH9 A;  3MWM A;  1MBJ A;  4I0A A;  3KFW X;  5BPI A;  1GVJ A;  3L2C A;  1FIP A;  1GXQ A;  2QYO A;  4XRM A;  2HEO A;  2KP6 A;  4H0E A;  3RKW A;  3SFI A;  1ZG1 A;  3FDY A;  1Q1V A;  3S16 J;  3BP8 A;  4RBO A;  2QF7 A;  4C9Y A;  4BEH B;  3CES A;  1KON A;  2NS0 A;  3U2R A;  4FE4 A;  3VB2 A;  5L3G A;  5BNG A;  2PMU A;  2F2E A;  4JBA A;  1UMQ A;  4MFE A;  2WAQ N;  5F0C A;  1JKO C;  1FTT A;  1X4O A;  1RKW A;  1F9N A;  2HQR A;  3FMR A;  1WH5 A;  2EJR A;  2FU4 A;  2EV0 A;  2V9K A;  3OIO A;  2IS1 A;  3OYH A;  3JRB A;  3ZQH A;  4YEL A;  3LMM A;  2NVT J;  3CJQ B;  2CUE A;  4DZP A;  2VL8 A;  1D0X A;  1IGN A;  2BOL A;  1UFM A;  3OOU A;  4LLN A;  4AVZ A;  3VEP A;  2EZL A;  2XIG A;  1CF7 B;  4J01 A;  1MJA A;  1ACI A;  2HKO A;  5JR3 A;  3C2H A;  1O3S A;  1HXD A;  3F72 A;  3I53 A;  1I1S A;  2G7U A;  2Z33 A;  1BR2 A;  1UG0 A;  3QWL A;  4M9S A;  4GXO A;  4ZDP A;  2HU9 A;  1UEL B;  1SFE A;  4HF2 A;  4KT5 C;  1LFP A;  2DQR A;  1SC7 A;  3L7W A;  1BIB A;  1NTC A;  2IS6 A;  2M4G A;  3BPV A;  3MCZ A;  5J47 A;  1WKM A;  2BHZ A;  3J7Z I;  4U88 A;  2CWE A;  4XNF A;  4BHC A;  4CDG A;  4YG2 F;  4BY1 J;  1I5Z A;  5J8C A;  1JTX A;  2HZD A;  3C18 A;  3V8J A;  3HRS A;  2HGC A;  4IL6 C;  3EDP A;  2XGE A;  3EUH C;  2VOO A;  4JK1 X;  4BQO A;  2V4J C;  4GCV A;  5JVT A;  1HW2 A;  4XL9 A;  2JPC A;  3F6V A;  3DLA A;  2JSC A;  2R7D A;  2K3P A;  5JFR A;  1OR7 A;  1S3J A;  4ZYG A;  4CSW A;  1RUO A;  4BHP A;  4CO8 A;  1JKR C;  5JVG F;  3PQK A;  5C44 J;  1S6L A;  4F52 A;  1LDK B;  2XF5 A;  4CCN A;  4CZC A;  4Y52 J;  2RVC A;  1D8K A;  1YRN B;  1MW7 A;  5ICF A;  3R61 A;  4L18 B;  2JZY A;  2EFP A;  1R23 A;  4RB3 C;  4A0Z A;  3E0J B;  3ERE D;  2PN6 A;  3DQV C;  2X6O A;  3M1E A;  4XKC A;  4L5E A;  4J19 A;  2LKX A;  1D0Z A;  2E7W A;  1BI1 A;  1XD7 A;  2R7S A;  3DP7 A;  2A5Y B;  4A3M J;  2X6X A;  1W7P A;  2IXS A;  1H9G A;  2ZB9 A;  4G9Y A;  4HEA 2;  3CCV I;  3IRQ A;  4HSR A;  1TT5 B;  3LA7 A;  5L3C A;  2NVU B;  5DCM A;  4PFO A;  2BY2 A;  4C3J J;  2HPI A;  3E3V A;  3RQI A;  1D1B A;  3OYJ A;  4L0Y B;  3NWT A;  5F0H A;  2H6C A;  2Q1Z B;  3K10 A;  3MKZ A;  4QPO A;  3OYC A;  4A3C J;  4E7K A;  2YR2 A;  2ZME A;  3BY6 A;  5F1R A;  4B3A A;  2XSJ C;  3BR2 A;  1OKR A;  1BW6 A;  2WAE A;  1TW2 A;  1LVK A;  3D5L A;  5DD8 A;  3HHG A;  3TKY A;  3E7L A;  3GME A;  3MMY B;  3O8H A;  3KYD B;  3BRO A;  4GDF A;  2CQX A;  5IYB J;  4ETS A;  4QSH A;  2GWR A;  1LJ9 A;  2H1K A;  2QQA A;  2V9P A;  2JA8 J;  1UHM A;  5D5U B;  2M0C A;  1MD0 A;  4PCQ A;  3N97 A;  1SMY F;  4IF4 A;  3Q9S A;  3RZD J;  3H1C A;  4A0Y A;  4HAM A;  3SFZ A;  4AU7 A;  3I55 I;  3RPQ A;  4F55 A;  2DA7 A;  2VI6 A;  2OF7 A;  2R4G A;  4BXU A;  2QSG X;  2R7R A;  2DMU A;  4I01 A;  1VQP I;  1LKX A;  2FBH A;  4RA2 A;  2O61 A;  2W4S A;  1PYV A;  3TED A;  1N77 A;  1U5T C;  2WAD A;  2L01 A;  1MMD A;  1Z3X A;  1ETY A;  2DT7 B;  1OYW A;  3BTC A;  4I7H A;  2DMP A;  1SFO J;  3ZQG A;  1WH7 A;  4C3I J;  4PZJ A;  2R0Q C;  2PG4 A;  3CF2 A;  1R22 A;  4AIH A;  1H8A C;  1L0O C;  1QVU A;  2DBB A;  3I64 A;  3H35 A;  3HYI A;  3HOX J;  4Q48 A;  1I6H J;  2M7A A;  3V7S A;  2P6T A;  3RYP A;  4G7Z F;  2ME6 A;  1K78 A;  3HSF A;  1EH8 A;  1Z1D A;  4DW6 A;  3KP7 A;  4LB6 B;  5HS9 A;  4EGZ A;  1FT9 A;  3COA C;  1SD5 A;  4ZJZ A;  3BG9 A;  4JX4 A;  2VJJ A;  1KYW A;  2PMZ N;  3F8F A;  1D5Y A;  5K5O A;  2R5Z A;  2HKX A;  1MJ9 A;  3R60 A;  3CJT B;  1MBF A;  1WJD A;  4H4K C;  2IS2 A;  1WJC A;  5EG0 A;  4AID A;  2E5N A;  3I56 I;  2YPR A;  1TWC J;  2KIU A;  3IWF A;  4RAY A;  4B4C A;  5M5W J;  4L5J A;  2MD5 A;  2XDV A;  4LIT A;  2M4K A;  2QVO A;  3DKY A;  2ZCW A;  1IRG A;  3H36 A;  2WA0 A;  3TDU C;  4RMN A;  4D7N A;  3WG9 A;  2IT0 A;  1XB4 A;  3N05 A;  1T0F A;  3P9I A;  2LSO A;  3VWB A;  2Z16 A;  4CH7 A;  3IRR A;  1TC3 C;  5LEK A;  4E7I A;  1MMG A;  3MQ0 A;  3GEZ A;  1OCR H;  2XKP A;  1DP3 A;  3G1L A;  3EQL F;  3GFL A;  5HLT A;  2LKS A;  2HVR A;  3L2Q A;  2Y2Z A;  3L2V A;  2K9Q A;  2XPU A;  2DFI A;  2KZG A;  3B73 A;  3LQR A;  3PFY A;  3VOE A;  4FTH A;  5KK1 A;  3B02 A;  1K61 A;  4NHJ A;  3FK6 A;  3PNY A;  3FWE A;  1T6S A;  5F04 A;  1K83 J;  3FK7 A;  2M8E A;  5J6X A;  4I2O A;  2K27 A;  1B9M A;  3OR2 C;  4I6Z A;  4JYK A;  1R6R A;  1B9N A;  2VXZ A;  3RCO A;  3JCU C;  5FLM J;  3X2Q H;  2OCC H;  3CDH A;  5LGU A;  3HTS B;  3L09 A;  4LIV A;  2XC7 A;  4AUX A;  1OR7 C;  1TT0 A;  2K85 A;  2MSY A;  4Y3O A;  1XG1 A;  3OY9 A;  1O3T A;  2DAO A;  2OV7 A;  5D8L B;  3RDI A;  3BJ6 A;  2D2W A;  1FYL A;  1X2M A;  4EEF G;  3OYA A;  3HZJ A;  3HRT A;  5LHI A;  2LFB A;  3DPL C;  2VPL A;  3RZO J;  1LE8 A;  4DZJ A;  2PQ8 A;  3BQZ A;  5E17 F;  1T39 A;  4Y7N J;  1TLH B;  4S05 A;  2IA0 A;  1OYY A;  3DU5 A;  1S7O A;  1AHD P;  4XN0 A;  1BBY A;  1VTN C;  2L0K A;  1B8I B;  2UXN A;  2ZNY A;  2M3A A;  1FBS A;  2GAU A;  1PDN C;  2ME0 A;  2VIX A;  4G8X A;  3CCL I;  1YTY A;  2VBY A;  5A2Q Z;  2FE3 A;  4AYB A;  2M7B A;  5KAF C;  2PJR A;  4JOM A;  1YYV A;  1SAU A;  4WXC A;  2NVX J;  3JW4 A;  3QYF A;  2QQ8 A;  2MW8 A;  3OOP A;  2DA1 A;  4C30 A;  4XOP A;  4DOZ A;  3KZY A;  2BY3 A;  2EIM H;  1QGP A;  2NS7 A;  1P4X A;  1ZGA A;  5E8I A;  4FX0 A;  2ZME C;  4XIC A;  1HSJ A;  3ZQF A;  3DCF A;  1RKT A;  2YS9 A;  2M8G X;  5LHG A;  2IVM A;  4HLY A;  4II2 A;  5FLV A;  1FSH A;  2B9S A;  4KMU X;  4F93 B;  4BJ5 C;  1IV6 A;  1ZH5 A;  2OUM A;  2Y30 A;  2XAJ A;  2R7O A;  3K6G A;  4O3M A;  4A3L J;  3B6A A;  3Q9V A;  1AWC A;  4QWQ A;  2KJC A;  2M1B A;  1V4R A;  4YRV A;  2XKO A;  4LOC A;  5J40 A;  1KYZ A;  3CC7 I;  3I54 A;  4FET A;  4ZDO A;  3VDX A;  3V7R A;  5H20 A;  3BTI A;  2XVC A;  2QQ9 A;  2CUF A;  3C3W A;  2Y9Z A;  1MMN A;  5HS8 A;  2O9L A;  1HLV A;  2BY1 A;  1Z0X A;  2L2O A;  2OAZ A;  3LNQ A;  4DYQ A;  2WAF A;  4CA0 A;  1Z67 A;  4RLF A;  4BAY A;  3WU1 B;  3ROU A;  1HOM A;  3FXR A;  3MEX A;  1J7K A;  1BJA A;  3BDD A;  4PK4 A;  5EGO A;  1O3R A;  3RQ4 A;  3L1P A;  3B6C A;  1JTY A;  1I3Q J;  3BT9 A;  4MTD A;  2LF8 A;  2VQH A;  4DIQ A;  3H3V K;  5E20 A;  2V1U A;  3ZQL A;  1KQ9 A;  1EF4 A;  2NVY J;  3L2W A;  1TZL A;  1JJ6 C;  1FX7 A;  3MKY B;  2H8W A;  1PP8 F;  3UNG C;  4YIF A;  3FF5 A;  2QWW A;  2BW3 B;  2LYC A;  3OYM A;  1KU7 A;  1T56 A;  3P5J A;  2ISZ A;  1SVL A;  3BR6 A;  1YW9 A;  2XAG A;  3LSM A;  4G12 A;  1QA6 A;  3A03 A;  2PX9 A;  3O8G A;  2PI0 A;  2Q2E B;  2FJ1 A;  1GHC A;  1QNT A;  1ZYR F;  3WTT C;  2GZW A;  2W48 A;  3CP2 A;  2JSP A;  2Y48 A;  5E3M A;  3G4S I;  4XQF A;  4HPQ A;  4ESJ A;  4C2U A;  3AG2 H;  1GV5 A;  1LDJ A;  4JX6 A;  3FXU A;  1FOW A;  2LBF B;  1MBK A;  4G6D A;  3L2R A;  3JRD A;  5FFZ A;  2OPT A;  4IRG A;  3J81 K;  2MFZ A;  1A31 A;  4A3G J;  2XGX A;  3RSN A;  2M30 A;  1YG2 A;  3M8E A;  2K86 A;  3KEY A;  1ZRF A;  2V7F A;  4ZC3 A;  3TO7 A;  1GV2 A;  1T0F C;  1AOY A;  2FOK A;  1FOK A;  1LNW A;  1VFC A;  2D5V A;  1HC8 A;  1YI2 I;  1ETV A;  1YE9 A;  4LJZ F;  3C2B A;  1HQC A;  4LFU A;  1DDN A;  3ZMT A;  4M74 A;  4XN3 A;  2WBM A;  1AA7 A;  3F21 A;  5F6F A;  2UZK A;  1BA5 A;  3GF2 A;  1XGN A;  4M73 A;  1QVT A;  3I5U A;  1KU2 A;  3ESW B;  5FD6 A;  1WCM J;  4KDP A;  3DWL E;  2IPQ X;  4NC7 A;  5AIP A;  3WTU C;  4W1U A;  3WHB A;  1W5C C;  3J80 K;  3SHF A;  4M3G A;  2HOE A;  5LGT A;  3HDD A;  1R7J A;  2OA4 A;  3BZC A;  4MGR A;  3CME I;  2A68 F;  2HQN A;  1B59 A;  4WK8 F;  1R58 A;  2DPD A;  4D0P A;  2R3S A;  4KYW A;  4OMY A;  4L9N A;  4YII A;  2GOM A;  1Y39 A;  3PNT A;  2RGV A;  2E2J J;  2L7F P;  2JQ7 A;  1SD6 A;  4U7D A;  2IS4 A;  1DPR A;  1T98 A;  2NXN B;  2FQ4 A;  2EH3 A;  4XLE A;  1B72 B;  2KDZ A;  5HNF A;  3F8N A;  2Y9Y A;  4NBQ A;  4ON0 A;  4XSX F;  4KUM A;  2D1H A;  3OV8 A;  1MSE C;  3CDL A;  1ZTR A;  1OCC H;  3OYE A;  3ZRG A;  2DJI A;  1ZRD A;  4CYC A;  2DA5 A;  4ZZL A;  5TIS C;  4RM2 A;  2LNB A;  1WWX A;  1WSU A;  1F43 A;  4IHS A;  3Q0U A;  2KJB A;  2MD0 A;  1CQT A;  4OIO F;  2P5L C;  4FT8 A;  3GX4 X;  1QZY A;  3GLX A;  2F5D A;  4ITV A;  4B3X A;  4EV0 A;  3BOQ A;  3GZ5 A;  1K6Y A;  2LF7 A;  3OL4 A;  2M5W A;  5DTD A;  3V8K A;  4OMZ A;  1MBH A;  1R1V A;  4BQQ A;  1BI2 A;  4EAT A;  3BG3 A;  1Y1W J;  2X1E A;  2VKD A;  1UB9 A;  2VE8 A;  2CW8 A;  5BPD A;  2FF4 A;  5M5Y J;  3S93 A;  1JUM A;  4WWC A;  3K4M A;  4B48 A;  3IKV A;  5E1X A;  1R9T J;  4HRI A;  5M3F J;  5IT9 Z;  2COB A;  5FB2 A;  4EM2 A;  1W36 D;  1G6N A;  3DBR B;  5HDN A;  2XF6 A;  1QO0 D;  1R5H A;  2HQA A;  3OSG A;  3UKG A;  2L9S A;  3JRI A;  3KEQ A;  4UB6 C;  5D4R A;  1J5Y A;  3HGY A;  2ELH A;  4IKF A;  3ZOB A;  2STW A;  4XK4 A;  3BG5 A;  1E3H A;  2ICW G;  3KYC B;  3FX3 A;  4GRI A;  2FBK A;  4CCL A;  5ICC A;  3IP4 B;  5DM7 F;  2LDU A;  3SEQ A;  3WOD F;  1WI9 A;  1SVO A;  2ELJ A;  2ZJP F;  4EGY A;  4DQ2 A;  1W0T A;  1U5T B;  5ILS A;  2B63 J;  1HDD C;  2H1L A;  2R7X A;  3QOE A;  4JP0 A;  4CCM A;  5LRS A;  3KET A;  3LST A;  3IC7 A;  4BJ6 C;  1CGP A;  1I50 J;  2XHK A;  4BNC A;  1S72 I;  4M9X A;  3EYI A;  5E18 F;  3MFK A;  2DT5 A;  3CUQ A;  3VPR A;  4AYB N;  3BJA A;  3BZK A;  1Y8Q B;  4AD9 A;  3I0T A;  5HVQ C;  4B47 A;  4Y33 A;  3JRG A; 
#chains in the Genus database with same CATH homology
 2EIL H;  3ABL H;  1OCC H;  2EIJ H;  3ABK H;  3ABM H;  2DYS H;  3AG2 H;  3AG4 H;  5B1A H;  2EIK H;  1V54 H;  1OCO H;  1OCZ H;  2EIM H;  3WG7 H;  5B3S H;  5B1B H;  3AG3 H;  3ASN H;  2DYR H;  2ZXW H;  1V55 H;  2EIN H;  2Y69 H;  3X2Q H;  2OCC H;  3ASO H;  1OCR H;  5IY5 H;  3AG1 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...