5IY5H

Electron transfer complex of cytochrome c and cytochrome c oxidase at 2.0 angstrom resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Complex structure of cytochrome c-cytochrome c oxidase reveals a novel protein-protein interaction mode
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 26
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 5iy5H00
3ABMH 5B1AH 3ASOH 1OCOH 3ABLH 3WG7H 2EIKH 3AG2H 1OCRH 2ZXWH 2EINH 2OCCH 1OCZH 2DYRH 3ABKH 2EIMH 2EILH 3ASNH 2EIJH 1V55H 2Y69H 3X2QH 1OCCH 5B1BH 3AG1H 2DYSH 5IY5H 3AG4H 5B3SH 3AG3H 1V54H
chains in the Genus database with same CATH superfamily
2V26A 2XGXA 3H5RA 3GFLA 4CXFA 2JA7J 3FXOA 2EA2A 2DFHA 4D5CA 2PMZN 5E8IA 4XONA 2Z33A 2F4IA 2CQQA 4XK4A 1MNMC 1LDDA 4U88A 3RCOA 3ZMTA 1WFXA 1WH5A 1R00A 4GCVA 2DDAA 3JRDA 3HOXJ 1UB9A 2L7KA 4EEFG 1LVAA 2NAZA 1A6QA 1QVUA 2HEOA 3GW2A 1WH7A 5EG0A 3PQKA 5CVIA 3MMYB 2A6TA 1AHDP 1WVRA 1MJ9A 3A0BC 5D4SA 2XSDC 4P96A 2VQCA 3CTAA 3NRVA 1KU7A 1IUFA 5AONA 2AS5F 4Y15A 4RLQA 5HLHA 1QZYA 3BR2A 4OIRF 4CICA 4A3MJ 1KONA 4U87A 2IA2A 3QU6A 5L3GA 3F8BA 4OIOF 1EKEA 3PNTA 4OAZA 1U5TC 3DBRB 1S9HA 1V4RA 2O5RA 4PSWA 2WB1A 5LHHA 2K86A 2LR8A 4G6QA 4XOPA 1U9NA 1TW2A 4BJ5C 1Z21A 4F52A 4M6XA 3CO6C 2AQEA 3BZKA 3B02A 4PSXA 3D0SA 3FDYA 3K70C 4FE4A 5J6XA 1U6GA 4QTRA 3Q9VA 4JQFA 3TP3A 4GXOA 1EH7A 2UXXA 5LHGA 1Y0UA 3A1YA 4CZZA 4DZJA 3DEWA 1YRNB 1BR2A 2LY2A 5C4JJ 2ETHA 4L9NA 3LSRA 4CYDA 3FHNA 1R7JA 1RC9A 1X3UA 2LLKA 5E8GA 2DK8A 1MBKA 2X85A 1LVKA 1U78A 3OYCA 2PMZA 1X1BA 2KIMA 1T38A 3PFIA 2F4MB 4JOMA 2C6YA 2DLLA 2JRMA 3KE2A 1OQYA 5JLWA 2DMUA 4JBAA 1TWCJ 3N97A 3QOEA 2LVSA 4OMZA 5ED4A 2WY7Q 3MZ8A 1FTTA 2ZJRF 1ETXA 5EG0B 2Y30A 1D1AA 2H1KA 1T98A 3FM3A 1T33A 4D7NA 1U2WA 3AFHA 2RNJA 3L9FA 4G7HF 4ETSA 4ZH4F 3KCCA 3ZR8X 1T2KA 1FTZA 2LD5A 4HQEA 4PJLA 4P1WA 3ZOBA 2IT0A 1HOMA 2Z5UA 1SFEA 3PSFA 1O3QA 4PFOA 3TMOA 1WJEA 5B3SH 1X2NA 3C2HA 4DZPA 4UVCA 1V54H 2V6CA 3CCUI 1FYKA 6PAXA 1OCOH 2GOMA 2HQNA 3EQLF 1BM9A 5HDNA 3FX3A 1HDDC 1YW7A 4I2OA 1E0EA 2ZO4A 3PM1A 3V7CA 2HTSA 3HOTA 3CMYA 3S3OA 4LJZF 2MW8A 1PVEA 5CVVA 3DPLC 3MWMA 2LG4A 3V42A 2AXTC 1RETA 1D0ZA 3JREA 4BY7J 1HLVA 2E35A 4BEHA 1WZ2A 2ME6A 2L9VA 2QKLB 2R7OA 4IQJA 1O57A 2FU4A 4C2TA 3BP8A 3WTSC 2CMPA 3HOVJ 3M3YJ 3K6GA 5EJCA 1WSUA 2FMLA 2CGPA 3FXMA 5DUIA 3FXKA 4B09A 3OYDA 5D6EA 1XCVA 5DD4A 1Z3XA 3DLAA 2ISZA 1VF9A 1VQ8I 2KIFA 2EZKA 1X1AA 2W84A 3CLOA 4CA0A 2VT3A 1UCRA 1WGXA 2E34A 2IVMA 2L3DA 3DF8A 2VKDA 3BR1A 4MGRA 4CUGA 1LB2A 2JK3A 4ZYGA 1IN8A 2QYOA 5BNGA 1MSEC 4FISA 3ULQB 4J19A 1UHWA 2RVCA 2QQBA 5F0FA 5BMZA 3KP5A 3J80K 3K1NA 1KZHA 2M9HA 4HV6A 2DFEA 3E5UA 1ON1A 1W1WE 3KEOA 2K4BA 2OTLI 3A4CA 3FK6A 2CJJA 3F6VA 1X1DA 3IP4B 3OOUA 1D1CA 1JTXA 1ZRCA 1OKRA 1XSDA 4AVPA 1H88C 1A6IA 5BS6A 1D5YA 4CO8A 5ICEA 2VBWA 4G9YA 1TWHJ 5HNHA 1DU0A 1K78A 5DUKA 3LFUA 4AUXA 5CVRA 1FOKA 4HQMA 2R92J 2LY1A 4IJAA 1ITYA 2Q8KA 4A3FJ 4XMYA 3GYHX 4BUPA 4V19K 1YJ9I 4KJZA 5TGTA 1A35A 3AG3H 4XLCA 2EV6A 1LQ1A 2STWA 5J1UA 1RUNA 1FMVA 4AD9A 5EEHA 1QHHD 2ESNA 2HPMA 5FLVA 3O6BB 4E7IA 1G3WA 3VYTB 1ZG5A 1R71A 4FASD 3SJMA 2ZSHB 3ABUA 3K7AJ 3QRFF 5E18F 3GVAA 3ERED 5EF6A 3L2CA 4HPQA 1OJLA 3LQRA 1XDSA 4Y52J 2RN7A 4BEHB 1K4SA 4ZYHA 4M6YA 4BBSJ 2D45A 2AQFA 1OYYA 2HDWA 5FLXZ 2XGEA 3WG7H 3EETA 2LKPA 3F6OA 1FPQA 1HKSA 1MD0A 3WGIA 3OS1A 3JW4A 2VJ4A 3BTLA 2NOGA 3IRRA 3EUHC 3F8MA 2PMHA 1K79A 3WTTC 3AG1H 1KU9A 5KNLA 3JRHA 2H6BA 4PZJA 3CMMA 2KZVA 2XAJA 3LA3A 1YFHA 1VFCA 3ZPLA 1DGRM 5ILUA 4TV7A 4MEXF 1YLFA 3SZGA 3CP2A 1GT0C 1T39A 4QPQA 1B8IA 1G3SA 3EYIA 2P5KA 3W6KB 1X1CA 3QYEA 3E7LA 3HJEA 3EUHA 2MC4A 2XROA 1B9MA 5E3LA 3IAS2 3H5NA 2XIGA 4L0ZB 1RZ4A 1SVMA 3HOWJ 2R7FA 1GVDA 3CUOA 3JR9A 1BC7C 3G1LA 1JTYA 1HCRA 2MLGA 2EH3A 2R3SA 5J40A 4HF0A 3BJOA 1K78B 4CCLA 2D1VA 3HPGA 3OR1C 2X9DA 4F3QA 2PFBA 3DEUA 4FETA 4RGXA 1GLNA 2JA6J 2NS8A 4YELA 3FM5A 3CF5F 3HRTA 2MGQA 1O3RA 4L9VA 3I56I 1QA6A 3P9IA 3ABTA 2H94A 1EH6A 1GXPA 3VEPA 2EQRA 2Z1DA 4NBQA 1Z6RA 1K61A 2Y2ZA 2W00A 2Z3YA 2FF4A 4A3JJ 2HVQA 1TNTA 4ZYDA 3TP0A 1ZQ3P 3RYRA 4A3DJ 1AA7A 2FQ4A 4RA2A 3S32A 3MKYB 2CWEA 3BTIA 3ONQA 5IPAA 3OYFA 1J2XA 1E2XA 3E0JB 3VB2A 5FD5A 1H9GA 4MTDA 5ILSA 3F0CA 3OV8A 3R61A 2JTVA 1YW9A 3SYTA 1VQ7I 4DBQA 4G12A 5A2QZ 1K7AA 2XAHA 1EJ9A 3CO7C 3BQZA 4L5JA 4BDZA 1S7AA 1BI0A 3HKZN 2HDCA 2PLYA 3M1CA 1YW8A 3F22A 1FT9A 2LBFA 2RDPA 3QPLA 2CU7A 4OAYA 4LMYA 4E7LA 4PJNA 5FB2A 3OYLA 1HKQA 3HRUA 4YFKF 2EZIA 4UV8A 2ADUA 5E3NA 2VPLA 3IUOA 4ZZDA 4IHWA 3OS0A 3GXOA 1MMAA 2M45A 3L2RA 4HYEA 2OZUA 1D0YA 5AIQA 2RC4A 5JI6A 1BC8C 4C3IJ 1P6RA 2FD5A 4LD5A 5JHUA 5IT9Z 1I1SA 2W82A 2ZXWH 3JRAA 2VXDA 2PMUA 5GAGJ 5HODA 3BG7A 1B8IB 4FX0A 2MYSA 1J75A 1GV2A 2X6YA 2LRDA 4LOCA 3OYJA 1E17A 2L7FP 2O03A 2GIVA 2G0EA 3Q0VA 4E70A 2P7CB 3O2PE 4EQQA 4Y3OA 3CCVI 1D8KA 4HLXA 2LY9A 5BPDA 2FOKA 1FBQA 2XKPA 3K9TA 3FMRA 4HA8A 1IRXA 1YG2A 2HYJA 4ZZLA 2VONA 1Q1HA 5JVGF 1EA3A 1TL8A 3T5XA 2CUZA 2ICWG 2GQQA 1DPRA 1ZELA 4XORA 1T8IA 3ABKH 2QSGX 4X6AJ 1TLHB 3IWZA 2EJRA 1I50J 2DCEA 3BWGA 3A2KA 2QZ8A 3TOBA 4O6JA 4WK8F 1U8RA 1Z3YA 3AG4H 2L4MA 3EPZA 3FISA 3NWTA 1IJWC 1N75A 1JGSA 1FOYA 4XKBA 3GEZA 3COAC 1GUUA 2R5YA 5BPIA 1ETOA 3G2BA 5IYCJ 3FZVA 3GTLJ 3M07A 1JKPC 1DP7P 2Z99A 3CCSI 2WAEA 4ENJA 1RI7A 2A5YB 5EEAA 1MMDA 2VQGA 4LK1F 1FOXA 1OISA 4IOCF 2VQLA 4ENNA 2DOFA 2UV1A 2QENA 4Y7NJ 2M1BA 4M6VA 3GWZA 1FMWA 4A5MA 5J8CA 2XAUA 1XC5A 2ZKZA 2MG4A 4KUMA 1TTYA 2JN6A 3HKZA 1BOAA 3U1DA 1H0MA 2LBFB 3W6JB 3OS2A 3WU1B 4DBRA 3CF2A 1KYWA 3VYUB 1A31A 3CCEI 1KQ9A 4UUVA 3KP6A 2JVHA 3HUGA 3QYBA 3ABLH 4HBLA 1E3HA 1FP1D 3C1DA 4V2GA 2FMYA 1LKXA 1XMXA 3VSKA 2YX4A 5LHIA 3KP7A 3RKYA 1LDKB 5F0HA 1W36D 1N77A 2HXOA 5FRMA 1MNEA 3GBGA 4Q47A 4N9IA 2IP2A 2PG4A 3E6DA 4AWXB 2V7FA 3K0LA 2FXAA 1G3YA 1OR7A 2ZCWA 4KITB 4NDLA 3LAJA 5HLTA 2OU2A 2E60A 2L2OA 1AOYA 1R49A 3CCYA 2QVOA 2BOLA 2Y9YA 3MD2A 4GRIA 1HC8A 1LPQA 2VN2A 1NG7A 2W7NA 3CDHA 2PEXA 2ZNYA 4BHBA 3JSOA 1XMKA 4S04A 2GLOA 2E5NA 4U0YA 3QP5A 3FK7A 3MFKA 2IS1A 1HA8A 1R1TA 3SXYA 1XSVA 2ZXJA 1P2FA 2XUBA 3DPTA 5F04A 5KAFC 4Y4RA 2FJ1A 3N05A 3J81Z 2CQNA 4L5EA 1KA8A 1F1ZA 1BL0A 1Z9CA 3RKQA 2HYGD 2BY0A 2M8GX 5K5OA 3V8KA 2BY1A 3GTKJ 4A0YA 3F21A 1J5YA 2DMTA 1HW5A 4EVIA 1O3TA 2VODA 3KP2A 2R5YB 2WTEA 2Z9OA 3GZNB 2COBA 2ZB9A 3ZGKA 3SZPA 4XLFA 1JKRC 3K10A 3K4JA 4EM1A 2JUGA 1FIAA 4KIFA 2VL8A 5B1BH 5HS7A 2M4KA 4E4HA 5JFRA 2HDDA 1LDJA 4LIUA 3BJAA 1MNDA 2DTRA 1LE8A 3RIRA 1MBGA 1JGGA 4I0BA 3R4KA 2CUEA 3HOSA 3IH4A 5FKMA 3L7WA 3TDUC 2IXSA 4EJTA 2K5CA 1I6XA 3RI4A 2LYCA 1FSHA 2LFBA 3HUGB 2OCCH 2WC2A 3ROUA 1FYLA 3AAFA 1VQ6I 2QSFX 3W6VA 2MA3A 5JHFA 3H9GA 4E7HA 1L3LA 4BQAA 4BY1J 4UY8I 3HSRA 4AM3A 2CV1A 3S1MJ 3ZN1A 1OMIA 4RB1A 3WU2C 3RTRA 1ZLKA 1Y0NA 1JUPA 3D5RC 1XCBA 3Q9SA 3OYIA 1B1BA 1VQKI 3OOPA 5LEJA 2QA4I 5ILVA 1IAWA 1L0OC 3Q0UA 4IQ4A 3ZXSA 3J7YJ 4EATA 1ZAOA 2IEKA 2DYRH 3VPRA 4E7JA 2H27A 2XPWA 2ISYA 1KU3A 3GTPJ 1BOBA 3LFKA 1Q1VA 2A6EF 1BJZA 2PX9A 2BVMA 1B4AA 1FJLA 4E7KA 4M72A 2Q2EA 1HXDA 4PGHA 2ID6A 1WJBA 4Y17A 4C2MJ 1ULYA 5J4VA 1W5TA 3H36A 2VC0A 1OYIA 4ZTJA 4GYGA 4I09A 2KDZA 5CVUA 4HOBA 3IAM2 5ICGA 2EWNA 2HGCA 1MZBA 4D5FA 1QBJA 3BJ6A 4IL6C 2STTA 4F55A 4XKCA 3JAMZ 2EFOA 5LFAA 2GBYA 3VYRB 3W2VA 3NWSA 4LLNA 4DJAA 1OLTA 3ZMVA 4HNVA 4BYYA 2R7WA 4YRVA 4ESJA 3DV8A 2WADA 3CUQA 2R7VA 2XPVA 4FHTA 2FEZA 1LE8B 5FKKA 3UR3C 4DYQA 2WV1A 4FX4A 2I5UA 3P9KA 1XTAA 3RZOJ 1KYZA 2QF7A 2JMWA 1YJNI 4LGWA 1QRYA 1WJAA 1T08B 1J59A 2EA4A 3QOPA 2NNYA 1F5TA 3S17J 4RMNA 1CF7A 4AVZA 1MBJA 2QCOA 4NC7A 2NXNB 2XF7A 3IC7A 2X1CA 3DU6A 3PUFA 3VDXA 4UUTA 4S05A 3K4BA 4IRIA 3DBLB 2GXAA 2RQPA 4IX7A 2X51A 2LMDA 3LSIA 4JYKA 2DFIA 3BC8A 1BJAA 1U8BA 4BBRJ 3LSKA 3GTGJ 5LGNA 2O61A 3AKZA 2QQ9A 2IJLA 1IN4A 4IZZA 3AL0B 2EV0A 4J00A 3V8LA 1ZRFA 4ABZA 4DGWB 1I6HJ 3L2VA 1QNTA 2K40A 4JP0A 4R8HA 3KP4A 1TQMA 5HNFA 3K1MA 2OF7A 4PJ0C 1XDUA 2ID3A 2LP0A 3BTCA 2Q2EB 1IG7A 2KJCA 1ZLJA 3PNVA 2PBIA 5IYBJ 2V9PA 4XQFA 2IGNA 2OUMA 3CJNA 3DPUA 2KJBA 2CG4A 3RPQA 3JRCA 2XF6A 3NEUA 2RNGA 2E1CA 3C2GA 2O8KA 4P55A 2X6OA 3LOCA 4IF4A 1WI9A 1JT6A 2TRTA 2A05A 2UUZA 2WAFA 4GO1A 3ZRGA 5B5EC 4U7DA 3OYBA 1QU3A 4RBOA 3E5QA 4HRIA 2EIKH 5IP9J 1FOWA 1NG6A 3A03A 3OMYA 1BA5A 2MH2A 3CUQB 5GPCA 1S29A 3C18A 1UELB 5DYMA 2F48A 3X2QH 5IYDJ 1SANA 1SFKA 3I53A 2HZTA 2KIQA 5FO5A 5FD6A 3PNYA 2NYXA 3KZYA 5ICFA 1DUXC 3OYAA 3BR0A 5D5XB 3HGYA 1CF7B 1BW6A 1UJ8A 1USTA 3JCUC 4A3IJ 1TBXA 2K9LA 3OYKA 4U0WA 3SQNA 1ETVA 3MN2A 3O8GA 1QGPA 1YIOA 3CJQB 3ZQGA 5FKOA 1NH3A 2ZXIA 1Y8RB 4D1QA 5HOOA 3KETA 5K5QA 2UZKA 2NVYJ 1VQ5I 3GF2A 4B44A 2JSPA 1NK2P 3Q3SA 1ZREA 3MVPA 3JTGA 1SD6A 3S14J 2E1NA 4EJUA 3CMEI 5BOXA 1IRGA 4HX7A 4BH9A 3OL3A 1QPMA 4IHTA 2MFZA 1Y56A 1DGWY 4P9FA 4IHVA 1SD5A 3BG6A 4HDVA 2VOOA 4CH7A 1ZGWA 2K02A 3IH2A 1FBUA 1OYWA 1BN5A 3CCJI 4N4OB 1ETKA 1R1VA 4PK4A 4JX4A 3OSFA 2JVGA 1HKTA 2DK5A 4XN3A 5AIPA 2K9NA 2L4AA 1JXSA 3GTMJ 5E1WA 4N9HA 2O0YA 2VQHA 3TO6A 1VQLI 2BY3A 2YU3A 3ZQHA 5M5YJ 2RV8A 4IHXA 2VJJA 4RGRA 2G7HA 3V7RA 4DOZA 1TC3C 3RZDJ 4UVAA 5LEKA 3IKVA 3BZCA 2KRFA 2GXGA 4YIFA 1FWZA 4CGZA 5FROA 1W0UA 1AKHA 1J9IA 2P5LC 3B73A 3FXUA 1R5HA 4M73A 2HPIA 2VI6A 2M3AA 1BW5A 2M0MA 4RGUA 3GLLA 3R0AA 1S3JA 1H89C 1KGSA 1YI2I 2GOXB 2BE5F 2E5ZA 1WQ2A 2KRHA 1A04A 3OIPA 3S3MA 4RDUA 1ORKA 2OA4A 3M7GA 3NARA 2P0WA 2O3FA 3F9KA 1S7OA 3SZTA 2XV4S 3I4PA 2FX0A 4B4CA 3EUKL 4A6EA 2WA0A 5FJ8J 2GWRA 3H1CA 3B6CA 1WRJA 2HXIA 1M1EB 2E7XA 2IPQX 2DJIA 1PP7U 3G1OA 2QEXI 1OPCA 3OYEA 3BLYA 5IT3A 4XM3A 5L3FA 2YUSA 5HS8A 3SEQA 3CCLI 3MZHA 3TW6A 4BS9A 3BCBA 1WCMJ 2E71A 3R6SA 2BZTA 4II3A 4C9YA 1SFOJ 1C0WA 3IL2A 1Z1DA 3TGNA 4XICA 4OIPF 2W25A 3ZQLA 1ZG1A 4EM2A 1Y8QB 2DT5A 2FQ3A 2JJ7A 3UNGC 4AC0A 1CQTA 1B9NA 2HOSA 3TQNA 1VQ4I 1UG2A 3FXLA 2J5OA 2ZMEA 2R7UA 3U9GA 5F0CA 3TO9A 3DU5A 4XSXF 3JRGA 1YX5A 1FZPB 4XLNF 2BV6A 3REOA 4EV0A 2COMA 2L54A 2M7BA 1MW7A 2DU9A 3KZZA 4KN4X 5HDKA 3GUDA 4M3GA 2FUG2 2P81A 5KHDA 4DYCA 2IS6A 5M3MJ 1O3SA 2X0LA 2L02A 3HHGA 4FTHA 1YHQI 2MD0A 4LB6B 4NB5A 3OWTA 3LSMA 4XL9A 2VT2A 1LEBA 3WGHA 4J01A 1VZ0A 1AKHB 1OFCX 2KQRA 1UAAA 2Y0MA 2CUJA 3CD6I 3I64A 2Y75A 2W24A 2DT6A 1HW2A 4KT6A 2PQ8A 3BQYA 4XN0A 3WG9A 3F8NA 1V5FA 2O8XA 1I5ZA 4YG2F 4A3BJ 5DCFA 3E6BA 5K7FA 4PCQA 1TWAJ 1SAXA 2L9SA 3HOYJ 2A6HF 5B66C 2CH0A 1LJ9A 5HS9A 2LF7A 1I3QJ 4M9ZA 2XVCA 1TT5B 5M5WJ 1D8JA 4V2FA 5FKNA 4BXUA 3E6MA 3TEDA 1TWGJ 5KK1A 1MGTA 3KP3A 2XSJC 3M8JA 1B6AA 1TQIA 5K7ZA 1KQ8A 4UVBA 2EZLA 4KNYA 3S2WA 3LL7A 3R60A 2DA3A 4DYRA 3S93A 2JPCA 3QQAA 4Y13A 2E2JJ 2OAZA 1VQMI 2HI3A 4Z6YA 1GV5A 3JSPA 3I9V2 2X1DA 3ELKA 3PFYA 3IKTA 1NTCA 1TNSA 2CFXA 2Y31A 1UMQA 1TW3A 4PFPA 3GX4X 3JRBA 1XPXA 3ZQ7A 3WHCA 4I7HA 2YR2A 4AIHA 3CCRI 2Y69H 2H8RA 4MO7A 2KZGA 1RPWA 3QODA 1W36C 2ZMEB 2OQRA 3HL2A 2LREA 2M87A 1T6SA 2KDOA 3S3NA 1G3TA 3HOUJ 2IS4A 4D0PA 2EFNA 3J80Z 2DA4A 4XRFA 3OYMA 1U3EM 1IN5A 4JX5A 3OYGA 4BQNA 3DCFA 3ZCOA 4JK1X 1IF1A 1XGSA 4M3EA 5DTDA 4H4KC 1X2MA 1J0RA 2WBMA 2GZWA 3CC4I 3TKYA 1WHUA 1G8XA 2HQ5A 2BVLA 2M8EA 1TWFJ 1X1PA 4HSRA 4RAYA 4L0YB 2QUFA 3DKWA 1T0FA 3WTWC 2R7SA 3ABMH 4GGGA 1O4XA 2CRGA 1B59A 2RQQA 2KRCA 2V4JC 2G9WA 4BDYA 2JA8J 1XGNA 3K2ZA 1TT0A 1U9OA 4LLLA 5DV5A 1G2HA 5TJJA 3BPVA 5F6FA 3HGGA 4A0XA 1MMSA 2P5VA 3OL4A 1ETQA 5ERIA 4YEJA 1I3AA 2R7DA 2H09A 4HG2A 5DDGA 2L01A 1JT0A 1IN7A 4PUSA 2GXBA 1PUFA 5M5XJ 3KIOA 4I01A 3G6EI 4B8XA 2OC6A 3BG9A 1N78A 2M30A 4RGSA 2FNAA 1I1GA 5LD2C 3BR3A 4D9JA 5EEGA 1BBYA 5FKLA 4XBFA 3WTYC 2J5PA 2DMQA 3BR5A 5IOZA 1YO5C 5IY5H 3HSEA 1W5CC 4I0AA 4XLEA 1OR7C 4ASNA 3BR6A 5J1YA 2A07F 2QQ8A 5GADJ 3ZN0A 2MC3A 5FFZA 2LK2A 2LKSA 3TW7A 2B7EA 3ZQIA 3H0DA 3BPXA 1UG0A 2EZHA 4C3HJ 5E3OA 1X19A 1NHAA 3PO2J 3ML6A 1Z7UA 1HQCA 4OINF 5GTIC 5CYVA 1Y39A 1R36A 2V1DA 2JZYA 2K3PA 2F5FA 2L0KA 2K7LA 4ZTFA 1JKQC 3MZYA 3S1QJ 4CSWA 1BIAA 4ESFA 4MLOA 2IA0A 4HZFA 4JX6A 1D5VA 2DDBA 5DCMA 3DLLF 2P7VB 3ZQCA 4IOAF 1WJDA 4WXCA 5J3LA 2DFFA 5GAEJ 3KLOA 1MBEA 2F2EA 3C3WA 4XOTA 1UZCA 4UNOA 1Y6IA 4KMUX 4A0ZA 2FBHA 2KKOA 1MH3A 1SFUA 1HW1A 1OCTC 3I55I 5E79C 1YYVA 2FSWA 3F8CA 2BW3A 2XDVA 4B3XA 4RS8A 3N4MA 1R1UA 3F23A 2NVUB 4G6DA 3ZMSA 1ZTRA 1MJBA 1HSTA 4BHCA 1PP8F 2DOAA 1QHGA 2H6CA 1MBHA 2QKMB 4XR6A 1QVTA 3LA7A 4PGGA 2X4HA 3MKWB 2M2EA 4UV9A 4BHPA 4X0GA 2IRFG 4LFUA 3D5LA 4P5OA 2RREA 1PUFB 2Y0SN 3AG2H 3GTOJ 4BE1A 4LITA 1HF0A 4HSTA 2HTJA 2GM4A 2E2IJ 2P4WA 1D0XA 2XHKA 3DKXA 4ZJZA 4O3MA 2E1MB 2QLZA 2OJED 3A0HC 2DA7A 4G8XA 4UB8C 4XRSG 1CGPA 2ACJA 4NNJA 3MKZA 1ZK8A 4L18B 1DDNA 3H3ZA 2M34A 3WODF 2GA1A 2DA6A 3CP8A 2DW4A 2NOJB 1HBXG 1K6OA 3S16J 5L3EA 2K3FA 1DU6A 5C44J 2IGOA 1LNWA 4RLFA 4L5IA 3HSFA 2PJRA 5FLMJ 5EZHA 3G3ZA 1XMAA 3PL8A 4HEA2 2ZBKA 4DQ2A 3L2QA 2GIZA 3QPHA 2XGCA 3AL0C 1XSXA 3O8HA 3VYSB 2ESHA 2IAIA 5DS9A 1W5SA 5F1RA 3RPUA 2CS3A 1AWCA 1VI0A 3LQQA 4MEYF 4OOIA 2OV7A 2HVRA 4KFCA 1TZLA 4RAFA 4MFDA 3DBHB 3HYIA 3FMQA 1WJCA 3ECHA 5DCMB 2HVSA 1R58A 3RQ4A 5LLQA 3ASOH 2NRAC 2P8TA 4BKXA 4BE2A 1Z77A 1IGNA 3WHBA 4I99C 4N0BA 2JQ7A 3HZJA 4WWCA 1XX5A 2W48A 3M4OJ 1Y1VJ 1ETYA 1R4MB 2VKVA 2VE9A 2BW3B 1YITI 3I59A 1R5ID 3HRSA 3JRIA 5CQEA 4B1RA 5ICCA 3WTUC 2JWTA 5BQTA 1AU7A 4HAMA 3OIQA 4KYWA 2BGCA 3LNQA 1BR4A 1H9TA 3DP7A 3HOZJ 4BU2A 4CCNA 2DODA 3CUQC 4BXFA 2XB5A 4Q4ZF 2MLKA 4Z2YA 5J4YA 1ZGJA 2CYYA 4DIQA 2Y0SA 5CLSA 3PIPF 2DI3A 1EH8A 4HNTA 3OSGA 4XNFA 3PJRA 2E36A 2DTZA 1G6NA 4AIJA 2ELKA 1IXCA 4C2UA 1IC8A 2BHYA 4KIBA 2GA2A 4IO9F 3FIWA 3QPTA 3HPHA 4CZCA 4MNUA 3VODA 3HBLA 1I39A 2A69F 3WE2A 1RRJA 3RPUD 2PJRB 2LDUA 2EILH 3LSHA 2HKOA 2DA1A 1IV8A 3L2UA 3I4MJ 2O7OA 2G7UA 2X1EA 5GPAA 2ZJQF 1ZH5A 3W3CA 1F43A 1JHFA 3GZ5A 1W0TA 3NAUA 2XPUA 4HX8A 1BI2A 3G73A 1J09A 4DNCA 1Z6TA 4A3GJ 2CQXA 3MEXA 4AIDA 3FF5A 3E97A 2FBIA 4BQOA 1RIOH 2CV0A 3ASNH 3P5JA 1SMTA 2X6XA 3T1BA 1UHMA 2WY8Q 2ME0A 4XRSA 3MQ0A 2LH9A 4C30A 4AIKA 3NQOA 2PI0A 3I59B 4II2A 1KU2A 1T56A 5K7HA 3CMAI 1SAUA 5K1YA 2XRLA 3ZMUA 2VB6A 2IS2A 2O9LA 2LKXA 2KFDA 2QM3A 3W2WA 2K9SA 4I98B 2XC7A 3GMEA 2WWYA 3PIOF 1Z0XA 2FRHA 4MQVA 3CQZJ 2JA5J 1U5TA 3VWBA 4A2UA 1S6LA 1W7PA 4DW6A 5E17F 3EUAA 2R5ZA 1ZG3A 5FLXK 1A36A 4E6KG 3DXJF 1QQIA 3RYPA 2KL4A 2H8WA 3GFJA 5EGOA 4M3FA 1XN7A 4EM0B 5L3BA 2DAOA 1ODDA 2P6SA 2UXNA 4NC8A 3FKIJ 1F9NA 2EBIA 2BBYA 3GLXA 4OMYA 2VBYA 3IRQA 3HXLA 2PJPA 4ZDLA 2YX7A 1P7IA 5F27A 5JR3A 3JTHA 2DN0A 3E3VA 3IWFA 5D5VB 4KT5C 3S15J 2CO5A 3DEEA 3TDZC 4EGZA 2YU9J 2YSRA 3W2AA 4YFNF 4M9SA 2CW0F 2DPDA 3L09A 5H2FC 3KYCB 3FBIB 4QPOA 5C3EJ 2V9VA 3ERMA 1V3FA 5DM7F 4RAGA 3FXJA 3ESWB 4N4NB 2DMPA 3FHZA 1RNLA 1APLC 4UUSA 1SVLA 3HTUA 2R7QA 4IPAA 2FOWA 1IN6A 1ZR4A 2F6CA 1SMYF 3KPHA 3S1RJ 2AO9A 3IHUA 1X3ZB 3I71A 3P7NA 4M74A 3QYFA 2RKHA 2LOOA 3DTEA 4ZDOA 1E3PA 4ZC3A 3M9AA 1OCRH 4IKFA 3LSPA 2LSOA 1RKWA 3FWEA 3K4KA 1YJWI 1FNNA 1K83J 2OBPA 4MFEA 3WTZA 1K4TA 1FIPA 4MHGA 2DQRA 1WKMA 3CLQA 1IUYA 1W7PD 1R9TJ 2CW7A 3TL4X 1Z7LA 2VOPA 3SEZA 1FP2A 4WXDA 4CCMA 2I8DA 4CYCA 4XSZF 5HVQC 4WX9A 3D1NI 2O6GE 3OIOA 1R23A 1U5TB 3OR2C 5A2QK 1A5JA 4IRGA 1BI3A 1W7PB 5HLIA 3BROA 2HOTA 2R5ZB 2F5CA 1YIJI 1IRZA 2XASA 1EF4A 1UHSA 2EB7A 2M5WA 2HOEA 3QU3A 3WGGA 5F08A 3K69A 3K70D 3CC2I 2IGKA 2HS5A 2XAGA 5EGOB 5IP6A 3U2RA 1QZZA 4IEJA 4QLCU 2A5WA 3HDDA 4M71A 4B48A 1P9QC 4RM3A 1G59A 1ZHFA 3HIFA 3T8TA 2VKEA 3CDIA 2V1XA 2EV5A 4BJTA 3RSNA 4PJMA 4QWQA 2GAUA 1IXRC 1WJ5A 1ZYRF 2E1OA 1SEUA 2OCEA 5KCMA 4HV5A 3OYHA 1IZ1A 5IT9K 3I3LA 1TQPA 2ELHA 4I76A 3JRFA 1REPC 4CHUA 1K6YA 2QQAA 2X6WA 3I58A 3K4LA 1YS7A 4LLGF 1V5EA 4KIGA 4A5NA 2LC2A 2QBYA 4Y33A 1XS9A 3HEFA 5E20A 2QWWA 3V7SA 3IV5A 4BACA 2ZMEC 2ECBA 1P7JA 3LAPA 2V1UA 1KQ0A 1LEAA 3VFZA 4ENKA 1T95A 3CJTB 4IXAA 4RB0A 1EV7A 2R7TA 4MTEA 4M9XA 4BGDA 2CSOA 1B72A 3EDPA 4ANJA 4KDPA 2BHZA 3HTSB 1R6RA 1ACIA 2XRNA 3BDDA 1E3OC 1IDZA 4UUSB 3B6AA 2E7WA 2VUMJ 3P9CA 2CFOA 5B1AH 1USSA 2JUCA 4ESBA 4XKVA 4HDUA 4WCGA 3BOQA 4YIRX 1PUEE 1Z91A 3ZMZA 1BIBA 1F36A 3LSJA 3ZQFA 1LFUP 1P4AA 1JI8A 2ZJPF 3KZIC 2XAFA 2CQ7A 4W1UA 3PUBA 4EGYA 5EDNA 2FE3A 3LSTA 2HQAA 3LA2A 4LG3A 4UXNA 2KLOA 3VSLA 1YQAA 4F7ZA 2KHMA 4MQ9F 4A3KJ 2B63J 1DP3A 4LIVA 2M7AA 2ZXHA 1NK3P 3CJRB 2Y48A 4PJJA 2CW8A 2BXYA 4I6ZA 3BCAA 4BQQA 5FFXA 2QGUA 3H92A 2K85A 2HKXA 1PJRA 4XIDA 2L9RA 4CYCB 2V6EA 2R7ZJ 3E6CC 2Y9ZA 2NVQJ 2UWMA 2DJNA 2JRTA 3EYYA 1IV6A 1D3YA 1X4PA 5TISC 3PO3J 2HNHA 4NHJA 3OY9A 4U7BA 2M4GA 2FA5A 4BAYA 1QPIA 3WE3A 3WTXC 1MIJA 2TCTA 1P4WA 3J7AY 4XRMA 4H0EA 2W1OA 3FKJA 2ZNZA 1MBFA 2D2WA 3M8FA 3R0JA 5CJ9A 2NVTJ 1GXQA 3SFZA 1UFMA 4A93J 3CZ6A 2K4JA 2M0CA 3FXRA 2AXLA 2MSYA 2VJIA 5HLGA 3F72A 2VE8A 4U0VA 3H5AA 5LBQA 1O7FA 3DQVC 1XG1A 1ZRDA 2EK5A 2BEOA 4BXXJ 1VQNI 4NUBA 1FYMA 2B9SA 4RB2C 3GO5A 1FX7A 3CC7I 4A12A 5K5RA 2QBYB 4HF2A 1VQPI 3DWLE 4RM2A 1X4OA 1ZGAA 2DO7A 3G4SI 1YE9A 2WV0A 1POGA 1XGMA 2NNNA 5D4RA 1B72B 2EPFA 1QO0D 3ZMDA 4QSHA 2BXZA 3OYNA 3DFGA 3HG9A 3I5UA 1JJ6C 3SFIA 4BE0A 2Q1ZB 1R5GA 4RB3C 4G7OF 2B0LA 2XKOA 2X48A 1FBSA 2EIMH 2HFHA 2EFQA 1MKMA 3J81K 1OCCH 1JHHA 2H1LA 1O7LA 4WF2A 4LG0A 5GTHC 3L1PA 3J7AO 3QPSA 4A6DA 1SC7A 3GTQJ 4B43A 3KYDB 4OIQF 1JE8A 5LRSA 4HF1A 2TDXA 4L9TA 2DQLA 3BG3A 2JT1A 3LSGA 2A61A 2KMUA 3Q5FA 1MH4A 1V5GA 1LUJB 1T0FC 3ECOA 4C3JJ 1WJFA 1YTYA 5F64A 2IGMA 4AU7A 3QWLA 3DTIA 2BYVE 3VOEA 2Z2SB 4ZYAA 1YOVB 5CKTA 4EMSA 4G7ZF 4GFBA 3BTJA 5LGUA 1RR7A 3C7JA 3PQJA 3GFIA 2N8GA 5EYRA 4Q5SF 2XB0X 2R7RA 2R93J 5FRNA 1FC3A 4ZYEA 1YS6A 2L9NA 1JJ8C 5CQGA 2MH9A 2JPBA 4FE7A 4IHSA 5J47A 1ENHA 2ZFUA 4P9UA 3HC7A 1WPKA 3TO7A 1QZEA 3CDLA 3KLNA 3C2BA 1VQOI 5F1JA 1ZR2A 3QP6A 2E1MC 3WTVC 1TP4A 2VBXA 2RGVA 2EINH 1GDTA 4GYIA 3KYLA 5FGMA 3ZQQA 1J7KA 3GFMA 2EFPA 3I54A 5TRDA 1WWXA 5JLXA 3I0TA 1MSFC 1SVOA 1FSEA 4KICA 2YS9A 5IP7J 4XLHA 5E1ZB 1VQ9I 1IRFA 4K2EA 5EZGA 4R79A 1RUOA 3DTKA 4KN7X 1S5LC 4E7SA 2ELJA 1ON2A 4ENMA 2XGDA 3TOAA 2RAEA 1MDMA 4D7MA 4HNUA 5J1RA 2VC1A 3SDGA 1F4KA 3J7ZI 2A3SA 2VIXA 4HW0A 3A01A 1RESA 2HQRA 2VKHA 4F93B 2EIJH 2HR3A 2ZC2A 5D6FA 1ONVA 2KP6A 2L7ZA 2NS0A 4UHTA 4XLPF 4ZDPA 1SFXA 1PYVA 4IRHA 2VJ5A 5D8LB 4LG0B 3ZP5A 5J8FA 1GVJA 4ON0A 4YFXF 2A68F 4A3CJ 2V1NA 4EJOA 1LFPA 2PN6A 4LB5A 4KA4A 2HWVA 2E2HJ 3F8FA 3LWFA 1YX3A 1S7EA 5GP9A 4M3BA 1N25A 3HB9A 4IVNA 5H6RA 2R0QC 2K9MA 2JSCA 1XD7A 1WI3A 2OPTA 4FQGA 4G94A 4NC6A 2HOAA 2K27A 3JAMK 5D8KB 2LTPA 3A02A 2DYSH 2BY2A 3V4GA 1FY7A 1W4MA 2DT7B 3L00A 3DKYA 2LF8A 4L9JA 3CESA 3H9QA 4HLYA 2DBBA 3BG5A 3K4NA 2DPUA 2OTJI 4UB6C 1Z67A 5L3DA 5JVTA 1SD4A 9ANTA 4BL0B 4HX4A 3H9JA 3S1NJ 2F5DA 3HRMA 3KEYA 4Q48A 2DA5A 3K2AA 4FT8A 4XKWA 1G4DA 3RQIA 4AYBN 2MABA 2VXZA 2ZSIB 3S2DJ 2V79A 4A3LJ 5DEQA 1P4XA 2VPRA 3WU0A 1RR8C 4X1EA 3UKGA 4E7ZA 1IW7F 3K4CA 5HDGA 1V55H 4CCJA 4EJVA 2WAQN 4LK0F 2F5EA 2IBDA 2KPMA 2LNBA 1DQUA 1IO2A 1MMNA 2L5QA 1VNDA 3F3XA 2E19A 4NQWA 5LGTA 4I02A 3U21A 2ZFWA 5CVJA 2EFWA 2HYFA 4A69C 4KMFA 4YIIA 3TBIA 2R7XA 1XGOA 4KISA 2NVXJ 2KT0A 3V8JA 2CQKA 3RJPA 1R22A 4F92B 2F4OB 4R1HA 2Q0OA 3FXQA 1FLIA 5IOYA 1MDMB 2CUFA 2DXIA 3E1SA 1LFBA 3L2WA 3MAJA 1U0JA 5H6QA 1PDNC 3K4MA 3A01B 2VBZA 4XLAA 1VTNC 1ZARA 4FCYA 1MJAA 1HSJA 2ZJ2A 2W85A 1XB4A 3KFWX 1R4NB 4B47A 2QSHX 1IDYA 3RDIA 1JKOC 1JUMA 3E5XA 4CDGA 4M3DA 1ERDA 1S8NA 3KEQA 4F91B 5E3MA 2OQGA 2AHQA 3D5SC 3O3KA 3I4NJ 1IXSB 5H20A 4W97A 1ZN2A 5KVRA 4WXHA 3BZ6A 2IW5A 4OWRB 4GDFA 2L7MP 2JA2A 3U1KA 3G71I 2DA2A 4B3AA 2KIUA 3FBNB 1S72I 3S2HJ 2W4SA 3M1EA 2YPRA 4O5VA 1Y1WJ 1FEXA 4CCOA 4OU0A 2D5VA 4RAZA 5M3FJ 2IA1A 2FNPA 2DOEA 5LRRA 4QIWN 2DMNA 1DPUA 4PDKA 4A3EJ 5CPRB 3SHFA 5D5WB 1X3WB 1RKTA 3T0YA 5GAHJ 4CCKA 2FBKA 1STZA 3SDBA 3PSIA 1GHCA 3K1PA 1OCZH 4G6TB 5D5UB 5KAIC 1BR1A 2I10A 2MBFA 2V9KA 3HM5A 2HU9A 4ITVA 4BNCA 3LMMA 5DM6F 4AYBA 3BY6A 2MD5A 4BJ6C 2WB1N 3GCMA 5DD8A 1X58A 2KISA 1HDPA 4EJWA 3QAHA 2WAQA 3GZ6A 3Q0WA 2D1HA 5E1XA 3CCQI 2P6TA 2VLAA 2HZDA 1JUSA 2OD5A 3BT9A 4NQWB 3RKXA 3GTJJ 5L3CA 2OZ6A 2XAQA 1SD7A 2XF5A 2F5VA 1MMGA 1D1BA 3G1MA 2CV2A 2ECCA 3RKWA 1P92A 4IHYA 3H3VK 3KX2A 1I27A 3MCZA 2NS7A 3ISPA 3MKLA 3H0GJ 2W57A 4S0HB 3IH3A 2Z16A 2VASA 5C4XJ 3FMSA 1OCPA 1ETWA 1ZKGA 3HHHA 2R4GA 1BI1A 1Z05A 2K9QA 4MIMA 3T8RA 1YRNA 3S8PA 3CCMI 1H8AC 3H3UA 3M8EA 3H35A
chains in the Genus database with same CATH topology
3ABMH 5B1AH 3ASOH 1OCOH 3ABLH 3WG7H 2EIKH 3AG2H 1OCRH 2ZXWH 2EINH 2OCCH 1OCZH 2DYRH 3ABKH 2EIMH 2EILH 3ASNH 2EIJH 1V55H 2Y69H 3X2QH 1OCCH 5B1BH 3AG1H 2DYSH 5IY5H 3AG4H 5B3SH 3AG3H 1V54H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABM H;  5B1A H;  3ASO H;  1OCO H;  3ABL H;  3WG7 H;  2EIK H;  3AG2 H;  1OCR H;  2ZXW H;  2EIN H;  2OCC H;  1OCZ H;  2DYR H;  3ABK H;  2EIM H;  2EIL H;  3ASN H;  2EIJ H;  1V55 H;  2Y69 H;  3X2Q H;  1OCC H;  5B1B H;  3AG1 H;  2DYS H;  5IY5 H;  3AG4 H;  5B3S H;  3AG3 H;  1V54 H; 
#chains in the Genus database with same CATH topology
 2V26 A;  2XGX A;  3H5R A;  3GFL A;  4CXF A;  2JA7 J;  3FXO A;  2EA2 A;  2DFH A;  4D5C A;  2PMZ N;  5E8I A;  4XON A;  2Z33 A;  2F4I A;  2CQQ A;  4XK4 A;  1MNM C;  1LDD A;  4U88 A;  3RCO A;  3ZMT A;  1WFX A;  1WH5 A;  1R00 A;  4GCV A;  2DDA A;  3JRD A;  3HOX J;  1UB9 A;  2L7K A;  4EEF G;  1LVA A;  2NAZ A;  1A6Q A;  1QVU A;  2HEO A;  3GW2 A;  1WH7 A;  5EG0 A;  3PQK A;  5CVI A;  3MMY B;  2A6T A;  1AHD P;  1WVR A;  1MJ9 A;  3A0B C;  5D4S A;  2XSD C;  4P96 A;  2VQC A;  3CTA A;  3NRV A;  1KU7 A;  1IUF A;  5AON A;  2AS5 F;  4Y15 A;  4RLQ A;  5HLH A;  1QZY A;  3BR2 A;  4OIR F;  4CIC A;  4A3M J;  1KON A;  4U87 A;  2IA2 A;  3QU6 A;  5L3G A;  3F8B A;  4OIO F;  1EKE A;  3PNT A;  4OAZ A;  1U5T C;  3DBR B;  1S9H A;  1V4R A;  2O5R A;  4PSW A;  2WB1 A;  5LHH A;  2K86 A;  2LR8 A;  4G6Q A;  4XOP A;  1U9N A;  1TW2 A;  4BJ5 C;  1Z21 A;  4F52 A;  4M6X A;  3CO6 C;  2AQE A;  3BZK A;  3B02 A;  4PSX A;  3D0S A;  3FDY A;  3K70 C;  4FE4 A;  5J6X A;  1U6G A;  4QTR A;  3Q9V A;  4JQF A;  3TP3 A;  4GXO A;  1EH7 A;  2UXX A;  5LHG A;  1Y0U A;  3A1Y A;  4CZZ A;  4DZJ A;  3DEW A;  1YRN B;  1BR2 A;  2LY2 A;  5C4J J;  2ETH A;  4L9N A;  3LSR A;  4CYD A;  3FHN A;  1R7J A;  1RC9 A;  1X3U A;  2LLK A;  5E8G A;  2DK8 A;  1MBK A;  2X85 A;  1LVK A;  1U78 A;  3OYC A;  2PMZ A;  1X1B A;  2KIM A;  1T38 A;  3PFI A;  2F4M B;  4JOM A;  2C6Y A;  2DLL A;  2JRM A;  3KE2 A;  1OQY A;  5JLW A;  2DMU A;  4JBA A;  1TWC J;  3N97 A;  3QOE A;  2LVS A;  4OMZ A;  5ED4 A;  2WY7 Q;  3MZ8 A;  1FTT A;  2ZJR F;  1ETX A;  5EG0 B;  2Y30 A;  1D1A A;  2H1K A;  1T98 A;  3FM3 A;  1T33 A;  4D7N A;  1U2W A;  3AFH A;  2RNJ A;  3L9F A;  4G7H F;  4ETS A;  4ZH4 F;  3KCC A;  3ZR8 X;  1T2K A;  1FTZ A;  2LD5 A;  4HQE A;  4PJL A;  4P1W A;  3ZOB A;  2IT0 A;  1HOM A;  2Z5U A;  1SFE A;  3PSF A;  1O3Q A;  4PFO A;  3TMO A;  1WJE A;  5B3S H;  1X2N A;  3C2H A;  4DZP A;  4UVC A;  1V54 H;  2V6C A;  3CCU I;  1FYK A;  6PAX A;  1OCO H;  2GOM A;  2HQN A;  3EQL F;  1BM9 A;  5HDN A;  3FX3 A;  1HDD C;  1YW7 A;  4I2O A;  1E0E A;  2ZO4 A;  3PM1 A;  3V7C A;  2HTS A;  3HOT A;  3CMY A;  3S3O A;  4LJZ F;  2MW8 A;  1PVE A;  5CVV A;  3DPL C;  3MWM A;  2LG4 A;  3V42 A;  2AXT C;  1RET A;  1D0Z A;  3JRE A;  4BY7 J;  1HLV A;  2E35 A;  4BEH A;  1WZ2 A;  2ME6 A;  2L9V A;  2QKL B;  2R7O A;  4IQJ A;  1O57 A;  2FU4 A;  4C2T A;  3BP8 A;  3WTS C;  2CMP A;  3HOV J;  3M3Y J;  3K6G A;  5EJC A;  1WSU A;  2FML A;  2CGP A;  3FXM A;  5DUI A;  3FXK A;  4B09 A;  3OYD A;  5D6E A;  1XCV A;  5DD4 A;  1Z3X A;  3DLA A;  2ISZ A;  1VF9 A;  1VQ8 I;  2KIF A;  2EZK A;  1X1A A;  2W84 A;  3CLO A;  4CA0 A;  2VT3 A;  1UCR A;  1WGX A;  2E34 A;  2IVM A;  2L3D A;  3DF8 A;  2VKD A;  3BR1 A;  4MGR A;  4CUG A;  1LB2 A;  2JK3 A;  4ZYG A;  1IN8 A;  2QYO A;  5BNG A;  1MSE C;  4FIS A;  3ULQ B;  4J19 A;  1UHW A;  2RVC A;  2QQB A;  5F0F A;  5BMZ A;  3KP5 A;  3J80 K;  3K1N A;  1KZH A;  2M9H A;  4HV6 A;  2DFE A;  3E5U A;  1ON1 A;  1W1W E;  3KEO A;  2K4B A;  2OTL I;  3A4C A;  3FK6 A;  2CJJ A;  3F6V A;  1X1D A;  3IP4 B;  3OOU A;  1D1C A;  1JTX A;  1ZRC A;  1OKR A;  1XSD A;  4AVP A;  1H88 C;  1A6I A;  5BS6 A;  1D5Y A;  4CO8 A;  5ICE A;  2VBW A;  4G9Y A;  1TWH J;  5HNH A;  1DU0 A;  1K78 A;  5DUK A;  3LFU A;  4AUX A;  5CVR A;  1FOK A;  4HQM A;  2R92 J;  2LY1 A;  4IJA A;  1ITY A;  2Q8K A;  4A3F J;  4XMY A;  3GYH X;  4BUP A;  4V19 K;  1YJ9 I;  4KJZ A;  5TGT A;  1A35 A;  3AG3 H;  4XLC A;  2EV6 A;  1LQ1 A;  2STW A;  5J1U A;  1RUN A;  1FMV A;  4AD9 A;  5EEH A;  1QHH D;  2ESN A;  2HPM A;  5FLV A;  3O6B B;  4E7I A;  1G3W A;  3VYT B;  1ZG5 A;  1R71 A;  4FAS D;  3SJM A;  2ZSH B;  3ABU A;  3K7A J;  3QRF F;  5E18 F;  3GVA A;  3ERE D;  5EF6 A;  3L2C A;  4HPQ A;  1OJL A;  3LQR A;  1XDS A;  4Y52 J;  2RN7 A;  4BEH B;  1K4S A;  4ZYH A;  4M6Y A;  4BBS J;  2D45 A;  2AQF A;  1OYY A;  2HDW A;  5FLX Z;  2XGE A;  3WG7 H;  3EET A;  2LKP A;  3F6O A;  1FPQ A;  1HKS A;  1MD0 A;  3WGI A;  3OS1 A;  3JW4 A;  2VJ4 A;  3BTL A;  2NOG A;  3IRR A;  3EUH C;  3F8M A;  2PMH A;  1K79 A;  3WTT C;  3AG1 H;  1KU9 A;  5KNL A;  3JRH A;  2H6B A;  4PZJ A;  3CMM A;  2KZV A;  2XAJ A;  3LA3 A;  1YFH A;  1VFC A;  3ZPL A;  1DGR M;  5ILU A;  4TV7 A;  4MEX F;  1YLF A;  3SZG A;  3CP2 A;  1GT0 C;  1T39 A;  4QPQ A;  1B8I A;  1G3S A;  3EYI A;  2P5K A;  3W6K B;  1X1C A;  3QYE A;  3E7L A;  3HJE A;  3EUH A;  2MC4 A;  2XRO A;  1B9M A;  5E3L A;  3IAS 2;  3H5N A;  2XIG A;  4L0Z B;  1RZ4 A;  1SVM A;  3HOW J;  2R7F A;  1GVD A;  3CUO A;  3JR9 A;  1BC7 C;  3G1L A;  1JTY A;  1HCR A;  2MLG A;  2EH3 A;  2R3S A;  5J40 A;  4HF0 A;  3BJO A;  1K78 B;  4CCL A;  2D1V A;  3HPG A;  3OR1 C;  2X9D A;  4F3Q A;  2PFB A;  3DEU A;  4FET A;  4RGX A;  1GLN A;  2JA6 J;  2NS8 A;  4YEL A;  3FM5 A;  3CF5 F;  3HRT A;  2MGQ A;  1O3R A;  4L9V A;  3I56 I;  1QA6 A;  3P9I A;  3ABT A;  2H94 A;  1EH6 A;  1GXP A;  3VEP A;  2EQR A;  2Z1D A;  4NBQ A;  1Z6R A;  1K61 A;  2Y2Z A;  2W00 A;  2Z3Y A;  2FF4 A;  4A3J J;  2HVQ A;  1TNT A;  4ZYD A;  3TP0 A;  1ZQ3 P;  3RYR A;  4A3D J;  1AA7 A;  2FQ4 A;  4RA2 A;  3S32 A;  3MKY B;  2CWE A;  3BTI A;  3ONQ A;  5IPA A;  3OYF A;  1J2X A;  1E2X A;  3E0J B;  3VB2 A;  5FD5 A;  1H9G A;  4MTD A;  5ILS A;  3F0C A;  3OV8 A;  3R61 A;  2JTV A;  1YW9 A;  3SYT A;  1VQ7 I;  4DBQ A;  4G12 A;  5A2Q Z;  1K7A A;  2XAH A;  1EJ9 A;  3CO7 C;  3BQZ A;  4L5J A;  4BDZ A;  1S7A A;  1BI0 A;  3HKZ N;  2HDC A;  2PLY A;  3M1C A;  1YW8 A;  3F22 A;  1FT9 A;  2LBF A;  2RDP A;  3QPL A;  2CU7 A;  4OAY A;  4LMY A;  4E7L A;  4PJN A;  5FB2 A;  3OYL A;  1HKQ A;  3HRU A;  4YFK F;  2EZI A;  4UV8 A;  2ADU A;  5E3N A;  2VPL A;  3IUO A;  4ZZD A;  4IHW A;  3OS0 A;  3GXO A;  1MMA A;  2M45 A;  3L2R A;  4HYE A;  2OZU A;  1D0Y A;  5AIQ A;  2RC4 A;  5JI6 A;  1BC8 C;  4C3I J;  1P6R A;  2FD5 A;  4LD5 A;  5JHU A;  5IT9 Z;  1I1S A;  2W82 A;  2ZXW H;  3JRA A;  2VXD A;  2PMU A;  5GAG J;  5HOD A;  3BG7 A;  1B8I B;  4FX0 A;  2MYS A;  1J75 A;  1GV2 A;  2X6Y A;  2LRD A;  4LOC A;  3OYJ A;  1E17 A;  2L7F P;  2O03 A;  2GIV A;  2G0E A;  3Q0V A;  4E70 A;  2P7C B;  3O2P E;  4EQQ A;  4Y3O A;  3CCV I;  1D8K A;  4HLX A;  2LY9 A;  5BPD A;  2FOK A;  1FBQ A;  2XKP A;  3K9T A;  3FMR A;  4HA8 A;  1IRX A;  1YG2 A;  2HYJ A;  4ZZL A;  2VON A;  1Q1H A;  5JVG F;  1EA3 A;  1TL8 A;  3T5X A;  2CUZ A;  2ICW G;  2GQQ A;  1DPR A;  1ZEL A;  4XOR A;  1T8I A;  3ABK H;  2QSG X;  4X6A J;  1TLH B;  3IWZ A;  2EJR A;  1I50 J;  2DCE A;  3BWG A;  3A2K A;  2QZ8 A;  3TOB A;  4O6J A;  4WK8 F;  1U8R A;  1Z3Y A;  3AG4 H;  2L4M A;  3EPZ A;  3FIS A;  3NWT A;  1IJW C;  1N75 A;  1JGS A;  1FOY A;  4XKB A;  3GEZ A;  3COA C;  1GUU A;  2R5Y A;  5BPI A;  1ETO A;  3G2B A;  5IYC J;  3FZV A;  3GTL J;  3M07 A;  1JKP C;  1DP7 P;  2Z99 A;  3CCS I;  2WAE A;  4ENJ A;  1RI7 A;  2A5Y B;  5EEA A;  1MMD A;  2VQG A;  4LK1 F;  1FOX A;  1OIS A;  4IOC F;  2VQL A;  4ENN A;  2DOF A;  2UV1 A;  2QEN A;  4Y7N J;  2M1B A;  4M6V A;  3GWZ A;  1FMW A;  4A5M A;  5J8C A;  2XAU A;  1XC5 A;  2ZKZ A;  2MG4 A;  4KUM A;  1TTY A;  2JN6 A;  3HKZ A;  1BOA A;  3U1D A;  1H0M A;  2LBF B;  3W6J B;  3OS2 A;  3WU1 B;  4DBR A;  3CF2 A;  1KYW A;  3VYU B;  1A31 A;  3CCE I;  1KQ9 A;  4UUV A;  3KP6 A;  2JVH A;  3HUG A;  3QYB A;  3ABL H;  4HBL A;  1E3H A;  1FP1 D;  3C1D A;  4V2G A;  2FMY A;  1LKX A;  1XMX A;  3VSK A;  2YX4 A;  5LHI A;  3KP7 A;  3RKY A;  1LDK B;  5F0H A;  1W36 D;  1N77 A;  2HXO A;  5FRM A;  1MNE A;  3GBG A;  4Q47 A;  4N9I A;  2IP2 A;  2PG4 A;  3E6D A;  4AWX B;  2V7F A;  3K0L A;  2FXA A;  1G3Y A;  1OR7 A;  2ZCW A;  4KIT B;  4NDL A;  3LAJ A;  5HLT A;  2OU2 A;  2E60 A;  2L2O A;  1AOY A;  1R49 A;  3CCY A;  2QVO A;  2BOL A;  2Y9Y A;  3MD2 A;  4GRI A;  1HC8 A;  1LPQ A;  2VN2 A;  1NG7 A;  2W7N A;  3CDH A;  2PEX A;  2ZNY A;  4BHB A;  3JSO A;  1XMK A;  4S04 A;  2GLO A;  2E5N A;  4U0Y A;  3QP5 A;  3FK7 A;  3MFK A;  2IS1 A;  1HA8 A;  1R1T A;  3SXY A;  1XSV A;  2ZXJ A;  1P2F A;  2XUB A;  3DPT A;  5F04 A;  5KAF C;  4Y4R A;  2FJ1 A;  3N05 A;  3J81 Z;  2CQN A;  4L5E A;  1KA8 A;  1F1Z A;  1BL0 A;  1Z9C A;  3RKQ A;  2HYG D;  2BY0 A;  2M8G X;  5K5O A;  3V8K A;  2BY1 A;  3GTK J;  4A0Y A;  3F21 A;  1J5Y A;  2DMT A;  1HW5 A;  4EVI A;  1O3T A;  2VOD A;  3KP2 A;  2R5Y B;  2WTE A;  2Z9O A;  3GZN B;  2COB A;  2ZB9 A;  3ZGK A;  3SZP A;  4XLF A;  1JKR C;  3K10 A;  3K4J A;  4EM1 A;  2JUG A;  1FIA A;  4KIF A;  2VL8 A;  5B1B H;  5HS7 A;  2M4K A;  4E4H A;  5JFR A;  2HDD A;  1LDJ A;  4LIU A;  3BJA A;  1MND A;  2DTR A;  1LE8 A;  3RIR A;  1MBG A;  1JGG A;  4I0B A;  3R4K A;  2CUE A;  3HOS A;  3IH4 A;  5FKM A;  3L7W A;  3TDU C;  2IXS A;  4EJT A;  2K5C A;  1I6X A;  3RI4 A;  2LYC A;  1FSH A;  2LFB A;  3HUG B;  2OCC H;  2WC2 A;  3ROU A;  1FYL A;  3AAF A;  1VQ6 I;  2QSF X;  3W6V A;  2MA3 A;  5JHF A;  3H9G A;  4E7H A;  1L3L A;  4BQA A;  4BY1 J;  4UY8 I;  3HSR A;  4AM3 A;  2CV1 A;  3S1M J;  3ZN1 A;  1OMI A;  4RB1 A;  3WU2 C;  3RTR A;  1ZLK A;  1Y0N A;  1JUP A;  3D5R C;  1XCB A;  3Q9S A;  3OYI A;  1B1B A;  1VQK I;  3OOP A;  5LEJ A;  2QA4 I;  5ILV A;  1IAW A;  1L0O C;  3Q0U A;  4IQ4 A;  3ZXS A;  3J7Y J;  4EAT A;  1ZAO A;  2IEK A;  2DYR H;  3VPR A;  4E7J A;  2H27 A;  2XPW A;  2ISY A;  1KU3 A;  3GTP J;  1BOB A;  3LFK A;  1Q1V A;  2A6E F;  1BJZ A;  2PX9 A;  2BVM A;  1B4A A;  1FJL A;  4E7K A;  4M72 A;  2Q2E A;  1HXD A;  4PGH A;  2ID6 A;  1WJB A;  4Y17 A;  4C2M J;  1ULY A;  5J4V A;  1W5T A;  3H36 A;  2VC0 A;  1OYI A;  4ZTJ A;  4GYG A;  4I09 A;  2KDZ A;  5CVU A;  4HOB A;  3IAM 2;  5ICG A;  2EWN A;  2HGC A;  1MZB A;  4D5F A;  1QBJ A;  3BJ6 A;  4IL6 C;  2STT A;  4F55 A;  4XKC A;  3JAM Z;  2EFO A;  5LFA A;  2GBY A;  3VYR B;  3W2V A;  3NWS A;  4LLN A;  4DJA A;  1OLT A;  3ZMV A;  4HNV A;  4BYY A;  2R7W A;  4YRV A;  4ESJ A;  3DV8 A;  2WAD A;  3CUQ A;  2R7V A;  2XPV A;  4FHT A;  2FEZ A;  1LE8 B;  5FKK A;  3UR3 C;  4DYQ A;  2WV1 A;  4FX4 A;  2I5U A;  3P9K A;  1XTA A;  3RZO J;  1KYZ A;  2QF7 A;  2JMW A;  1YJN I;  4LGW A;  1QRY A;  1WJA A;  1T08 B;  1J59 A;  2EA4 A;  3QOP A;  2NNY A;  1F5T A;  3S17 J;  4RMN A;  1CF7 A;  4AVZ A;  1MBJ A;  2QCO A;  4NC7 A;  2NXN B;  2XF7 A;  3IC7 A;  2X1C A;  3DU6 A;  3PUF A;  3VDX A;  4UUT A;  4S05 A;  3K4B A;  4IRI A;  3DBL B;  2GXA A;  2RQP A;  4IX7 A;  2X51 A;  2LMD A;  3LSI A;  4JYK A;  2DFI A;  3BC8 A;  1BJA A;  1U8B A;  4BBR J;  3LSK A;  3GTG J;  5LGN A;  2O61 A;  3AKZ A;  2QQ9 A;  2IJL A;  1IN4 A;  4IZZ A;  3AL0 B;  2EV0 A;  4J00 A;  3V8L A;  1ZRF A;  4ABZ A;  4DGW B;  1I6H J;  3L2V A;  1QNT A;  2K40 A;  4JP0 A;  4R8H A;  3KP4 A;  1TQM A;  5HNF A;  3K1M A;  2OF7 A;  4PJ0 C;  1XDU A;  2ID3 A;  2LP0 A;  3BTC A;  2Q2E B;  1IG7 A;  2KJC A;  1ZLJ A;  3PNV A;  2PBI A;  5IYB J;  2V9P A;  4XQF A;  2IGN A;  2OUM A;  3CJN A;  3DPU A;  2KJB A;  2CG4 A;  3RPQ A;  3JRC A;  2XF6 A;  3NEU A;  2RNG A;  2E1C A;  3C2G A;  2O8K A;  4P55 A;  2X6O A;  3LOC A;  4IF4 A;  1WI9 A;  1JT6 A;  2TRT A;  2A05 A;  2UUZ A;  2WAF A;  4GO1 A;  3ZRG A;  5B5E C;  4U7D A;  3OYB A;  1QU3 A;  4RBO A;  3E5Q A;  4HRI A;  2EIK H;  5IP9 J;  1FOW A;  1NG6 A;  3A03 A;  3OMY A;  1BA5 A;  2MH2 A;  3CUQ B;  5GPC A;  1S29 A;  3C18 A;  1UEL B;  5DYM A;  2F48 A;  3X2Q H;  5IYD J;  1SAN A;  1SFK A;  3I53 A;  2HZT A;  2KIQ A;  5FO5 A;  5FD6 A;  3PNY A;  2NYX A;  3KZY A;  5ICF A;  1DUX C;  3OYA A;  3BR0 A;  5D5X B;  3HGY A;  1CF7 B;  1BW6 A;  1UJ8 A;  1UST A;  3JCU C;  4A3I J;  1TBX A;  2K9L A;  3OYK A;  4U0W A;  3SQN A;  1ETV A;  3MN2 A;  3O8G A;  1QGP A;  1YIO A;  3CJQ B;  3ZQG A;  5FKO A;  1NH3 A;  2ZXI A;  1Y8R B;  4D1Q A;  5HOO A;  3KET A;  5K5Q A;  2UZK A;  2NVY J;  1VQ5 I;  3GF2 A;  4B44 A;  2JSP A;  1NK2 P;  3Q3S A;  1ZRE A;  3MVP A;  3JTG A;  1SD6 A;  3S14 J;  2E1N A;  4EJU A;  3CME I;  5BOX A;  1IRG A;  4HX7 A;  4BH9 A;  3OL3 A;  1QPM A;  4IHT A;  2MFZ A;  1Y56 A;  1DGW Y;  4P9F A;  4IHV A;  1SD5 A;  3BG6 A;  4HDV A;  2VOO A;  4CH7 A;  1ZGW A;  2K02 A;  3IH2 A;  1FBU A;  1OYW A;  1BN5 A;  3CCJ I;  4N4O B;  1ETK A;  1R1V A;  4PK4 A;  4JX4 A;  3OSF A;  2JVG A;  1HKT A;  2DK5 A;  4XN3 A;  5AIP A;  2K9N A;  2L4A A;  1JXS A;  3GTM J;  5E1W A;  4N9H A;  2O0Y A;  2VQH A;  3TO6 A;  1VQL I;  2BY3 A;  2YU3 A;  3ZQH A;  5M5Y J;  2RV8 A;  4IHX A;  2VJJ A;  4RGR A;  2G7H A;  3V7R A;  4DOZ A;  1TC3 C;  3RZD J;  4UVA A;  5LEK A;  3IKV A;  3BZC A;  2KRF A;  2GXG A;  4YIF A;  1FWZ A;  4CGZ A;  5FRO A;  1W0U A;  1AKH A;  1J9I A;  2P5L C;  3B73 A;  3FXU A;  1R5H A;  4M73 A;  2HPI A;  2VI6 A;  2M3A A;  1BW5 A;  2M0M A;  4RGU A;  3GLL A;  3R0A A;  1S3J A;  1H89 C;  1KGS A;  1YI2 I;  2GOX B;  2BE5 F;  2E5Z A;  1WQ2 A;  2KRH A;  1A04 A;  3OIP A;  3S3M A;  4RDU A;  1ORK A;  2OA4 A;  3M7G A;  3NAR A;  2P0W A;  2O3F A;  3F9K A;  1S7O A;  3SZT A;  2XV4 S;  3I4P A;  2FX0 A;  4B4C A;  3EUK L;  4A6E A;  2WA0 A;  5FJ8 J;  2GWR A;  3H1C A;  3B6C A;  1WRJ A;  2HXI A;  1M1E B;  2E7X A;  2IPQ X;  2DJI A;  1PP7 U;  3G1O A;  2QEX I;  1OPC A;  3OYE A;  3BLY A;  5IT3 A;  4XM3 A;  5L3F A;  2YUS A;  5HS8 A;  3SEQ A;  3CCL I;  3MZH A;  3TW6 A;  4BS9 A;  3BCB A;  1WCM J;  2E71 A;  3R6S A;  2BZT A;  4II3 A;  4C9Y A;  1SFO J;  1C0W A;  3IL2 A;  1Z1D A;  3TGN A;  4XIC A;  4OIP F;  2W25 A;  3ZQL A;  1ZG1 A;  4EM2 A;  1Y8Q B;  2DT5 A;  2FQ3 A;  2JJ7 A;  3UNG C;  4AC0 A;  1CQT A;  1B9N A;  2HOS A;  3TQN A;  1VQ4 I;  1UG2 A;  3FXL A;  2J5O A;  2ZME A;  2R7U A;  3U9G A;  5F0C A;  3TO9 A;  3DU5 A;  4XSX F;  3JRG A;  1YX5 A;  1FZP B;  4XLN F;  2BV6 A;  3REO A;  4EV0 A;  2COM A;  2L54 A;  2M7B A;  1MW7 A;  2DU9 A;  3KZZ A;  4KN4 X;  5HDK A;  3GUD A;  4M3G A;  2FUG 2;  2P81 A;  5KHD A;  4DYC A;  2IS6 A;  5M3M J;  1O3S A;  2X0L A;  2L02 A;  3HHG A;  4FTH A;  1YHQ I;  2MD0 A;  4LB6 B;  4NB5 A;  3OWT A;  3LSM A;  4XL9 A;  2VT2 A;  1LEB A;  3WGH A;  4J01 A;  1VZ0 A;  1AKH B;  1OFC X;  2KQR A;  1UAA A;  2Y0M A;  2CUJ A;  3CD6 I;  3I64 A;  2Y75 A;  2W24 A;  2DT6 A;  1HW2 A;  4KT6 A;  2PQ8 A;  3BQY A;  4XN0 A;  3WG9 A;  3F8N A;  1V5F A;  2O8X A;  1I5Z A;  4YG2 F;  4A3B J;  5DCF A;  3E6B A;  5K7F A;  4PCQ A;  1TWA J;  1SAX A;  2L9S A;  3HOY J;  2A6H F;  5B66 C;  2CH0 A;  1LJ9 A;  5HS9 A;  2LF7 A;  1I3Q J;  4M9Z A;  2XVC A;  1TT5 B;  5M5W J;  1D8J A;  4V2F A;  5FKN A;  4BXU A;  3E6M A;  3TED A;  1TWG J;  5KK1 A;  1MGT A;  3KP3 A;  2XSJ C;  3M8J A;  1B6A A;  1TQI A;  5K7Z A;  1KQ8 A;  4UVB A;  2EZL A;  4KNY A;  3S2W A;  3LL7 A;  3R60 A;  2DA3 A;  4DYR A;  3S93 A;  2JPC A;  3QQA A;  4Y13 A;  2E2J J;  2OAZ A;  1VQM I;  2HI3 A;  4Z6Y A;  1GV5 A;  3JSP A;  3I9V 2;  2X1D A;  3ELK A;  3PFY A;  3IKT A;  1NTC A;  1TNS A;  2CFX A;  2Y31 A;  1UMQ A;  1TW3 A;  4PFP A;  3GX4 X;  3JRB A;  1XPX A;  3ZQ7 A;  3WHC A;  4I7H A;  2YR2 A;  4AIH A;  3CCR I;  2Y69 H;  2H8R A;  4MO7 A;  2KZG A;  1RPW A;  3QOD A;  1W36 C;  2ZME B;  2OQR A;  3HL2 A;  2LRE A;  2M87 A;  1T6S A;  2KDO A;  3S3N A;  1G3T A;  3HOU J;  2IS4 A;  4D0P A;  2EFN A;  3J80 Z;  2DA4 A;  4XRF A;  3OYM A;  1U3E M;  1IN5 A;  4JX5 A;  3OYG A;  4BQN A;  3DCF A;  3ZCO A;  4JK1 X;  1IF1 A;  1XGS A;  4M3E A;  5DTD A;  4H4K C;  1X2M A;  1J0R A;  2WBM A;  2GZW A;  3CC4 I;  3TKY A;  1WHU A;  1G8X A;  2HQ5 A;  2BVL A;  2M8E A;  1TWF J;  1X1P A;  4HSR A;  4RAY A;  4L0Y B;  2QUF A;  3DKW A;  1T0F A;  3WTW C;  2R7S A;  3ABM H;  4GGG A;  1O4X A;  2CRG A;  1B59 A;  2RQQ A;  2KRC A;  2V4J C;  2G9W A;  4BDY A;  2JA8 J;  1XGN A;  3K2Z A;  1TT0 A;  1U9O A;  4LLL A;  5DV5 A;  1G2H A;  5TJJ A;  3BPV A;  5F6F A;  3HGG A;  4A0X A;  1MMS A;  2P5V A;  3OL4 A;  1ETQ A;  5ERI A;  4YEJ A;  1I3A A;  2R7D A;  2H09 A;  4HG2 A;  5DDG A;  2L01 A;  1JT0 A;  1IN7 A;  4PUS A;  2GXB A;  1PUF A;  5M5X J;  3KIO A;  4I01 A;  3G6E I;  4B8X A;  2OC6 A;  3BG9 A;  1N78 A;  2M30 A;  4RGS A;  2FNA A;  1I1G A;  5LD2 C;  3BR3 A;  4D9J A;  5EEG A;  1BBY A;  5FKL A;  4XBF A;  3WTY C;  2J5P A;  2DMQ A;  3BR5 A;  5IOZ A;  1YO5 C;  5IY5 H;  3HSE A;  1W5C C;  4I0A A;  4XLE A;  1OR7 C;  4ASN A;  3BR6 A;  5J1Y A;  2A07 F;  2QQ8 A;  5GAD J;  3ZN0 A;  2MC3 A;  5FFZ A;  2LK2 A;  2LKS A;  3TW7 A;  2B7E A;  3ZQI A;  3H0D A;  3BPX A;  1UG0 A;  2EZH A;  4C3H J;  5E3O A;  1X19 A;  1NHA A;  3PO2 J;  3ML6 A;  1Z7U A;  1HQC A;  4OIN F;  5GTI C;  5CYV A;  1Y39 A;  1R36 A;  2V1D A;  2JZY A;  2K3P A;  2F5F A;  2L0K A;  2K7L A;  4ZTF A;  1JKQ C;  3MZY A;  3S1Q J;  4CSW A;  1BIA A;  4ESF A;  4MLO A;  2IA0 A;  4HZF A;  4JX6 A;  1D5V A;  2DDB A;  5DCM A;  3DLL F;  2P7V B;  3ZQC A;  4IOA F;  1WJD A;  4WXC A;  5J3L A;  2DFF A;  5GAE J;  3KLO A;  1MBE A;  2F2E A;  3C3W A;  4XOT A;  1UZC A;  4UNO A;  1Y6I A;  4KMU X;  4A0Z A;  2FBH A;  2KKO A;  1MH3 A;  1SFU A;  1HW1 A;  1OCT C;  3I55 I;  5E79 C;  1YYV A;  2FSW A;  3F8C A;  2BW3 A;  2XDV A;  4B3X A;  4RS8 A;  3N4M A;  1R1U A;  3F23 A;  2NVU B;  4G6D A;  3ZMS A;  1ZTR A;  1MJB A;  1HST A;  4BHC A;  1PP8 F;  2DOA A;  1QHG A;  2H6C A;  1MBH A;  2QKM B;  4XR6 A;  1QVT A;  3LA7 A;  4PGG A;  2X4H A;  3MKW B;  2M2E A;  4UV9 A;  4BHP A;  4X0G A;  2IRF G;  4LFU A;  3D5L A;  4P5O A;  2RRE A;  1PUF B;  2Y0S N;  3AG2 H;  3GTO J;  4BE1 A;  4LIT A;  1HF0 A;  4HST A;  2HTJ A;  2GM4 A;  2E2I J;  2P4W A;  1D0X A;  2XHK A;  3DKX A;  4ZJZ A;  4O3M A;  2E1M B;  2QLZ A;  2OJE D;  3A0H C;  2DA7 A;  4G8X A;  4UB8 C;  4XRS G;  1CGP A;  2ACJ A;  4NNJ A;  3MKZ A;  1ZK8 A;  4L18 B;  1DDN A;  3H3Z A;  2M34 A;  3WOD F;  2GA1 A;  2DA6 A;  3CP8 A;  2DW4 A;  2NOJ B;  1HBX G;  1K6O A;  3S16 J;  5L3E A;  2K3F A;  1DU6 A;  5C44 J;  2IGO A;  1LNW A;  4RLF A;  4L5I A;  3HSF A;  2PJR A;  5FLM J;  5EZH A;  3G3Z A;  1XMA A;  3PL8 A;  4HEA 2;  2ZBK A;  4DQ2 A;  3L2Q A;  2GIZ A;  3QPH A;  2XGC A;  3AL0 C;  1XSX A;  3O8H A;  3VYS B;  2ESH A;  2IAI A;  5DS9 A;  1W5S A;  5F1R A;  3RPU A;  2CS3 A;  1AWC A;  1VI0 A;  3LQQ A;  4MEY F;  4OOI A;  2OV7 A;  2HVR A;  4KFC A;  1TZL A;  4RAF A;  4MFD A;  3DBH B;  3HYI A;  3FMQ A;  1WJC A;  3ECH A;  5DCM B;  2HVS A;  1R58 A;  3RQ4 A;  5LLQ A;  3ASO H;  2NRA C;  2P8T A;  4BKX A;  4BE2 A;  1Z77 A;  1IGN A;  3WHB A;  4I99 C;  4N0B A;  2JQ7 A;  3HZJ A;  4WWC A;  1XX5 A;  2W48 A;  3M4O J;  1Y1V J;  1ETY A;  1R4M B;  2VKV A;  2VE9 A;  2BW3 B;  1YIT I;  3I59 A;  1R5I D;  3HRS A;  3JRI A;  5CQE A;  4B1R A;  5ICC A;  3WTU C;  2JWT A;  5BQT A;  1AU7 A;  4HAM A;  3OIQ A;  4KYW A;  2BGC A;  3LNQ A;  1BR4 A;  1H9T A;  3DP7 A;  3HOZ J;  4BU2 A;  4CCN A;  2DOD A;  3CUQ C;  4BXF A;  2XB5 A;  4Q4Z F;  2MLK A;  4Z2Y A;  5J4Y A;  1ZGJ A;  2CYY A;  4DIQ A;  2Y0S A;  5CLS A;  3PIP F;  2DI3 A;  1EH8 A;  4HNT A;  3OSG A;  4XNF A;  3PJR A;  2E36 A;  2DTZ A;  1G6N A;  4AIJ A;  2ELK A;  1IXC A;  4C2U A;  1IC8 A;  2BHY A;  4KIB A;  2GA2 A;  4IO9 F;  3FIW A;  3QPT A;  3HPH A;  4CZC A;  4MNU A;  3VOD A;  3HBL A;  1I39 A;  2A69 F;  3WE2 A;  1RRJ A;  3RPU D;  2PJR B;  2LDU A;  2EIL H;  3LSH A;  2HKO A;  2DA1 A;  1IV8 A;  3L2U A;  3I4M J;  2O7O A;  2G7U A;  2X1E A;  5GPA A;  2ZJQ F;  1ZH5 A;  3W3C A;  1F43 A;  1JHF A;  3GZ5 A;  1W0T A;  3NAU A;  2XPU A;  4HX8 A;  1BI2 A;  3G73 A;  1J09 A;  4DNC A;  1Z6T A;  4A3G J;  2CQX A;  3MEX A;  4AID A;  3FF5 A;  3E97 A;  2FBI A;  4BQO A;  1RIO H;  2CV0 A;  3ASN H;  3P5J A;  1SMT A;  2X6X A;  3T1B A;  1UHM A;  2WY8 Q;  2ME0 A;  4XRS A;  3MQ0 A;  2LH9 A;  4C30 A;  4AIK A;  3NQO A;  2PI0 A;  3I59 B;  4II2 A;  1KU2 A;  1T56 A;  5K7H A;  3CMA I;  1SAU A;  5K1Y A;  2XRL A;  3ZMU A;  2VB6 A;  2IS2 A;  2O9L A;  2LKX A;  2KFD A;  2QM3 A;  3W2W A;  2K9S A;  4I98 B;  2XC7 A;  3GME A;  2WWY A;  3PIO F;  1Z0X A;  2FRH A;  4MQV A;  3CQZ J;  2JA5 J;  1U5T A;  3VWB A;  4A2U A;  1S6L A;  1W7P A;  4DW6 A;  5E17 F;  3EUA A;  2R5Z A;  1ZG3 A;  5FLX K;  1A36 A;  4E6K G;  3DXJ F;  1QQI A;  3RYP A;  2KL4 A;  2H8W A;  3GFJ A;  5EGO A;  4M3F A;  1XN7 A;  4EM0 B;  5L3B A;  2DAO A;  1ODD A;  2P6S A;  2UXN A;  4NC8 A;  3FKI J;  1F9N A;  2EBI A;  2BBY A;  3GLX A;  4OMY A;  2VBY A;  3IRQ A;  3HXL A;  2PJP A;  4ZDL A;  2YX7 A;  1P7I A;  5F27 A;  5JR3 A;  3JTH A;  2DN0 A;  3E3V A;  3IWF A;  5D5V B;  4KT5 C;  3S15 J;  2CO5 A;  3DEE A;  3TDZ C;  4EGZ A;  2YU9 J;  2YSR A;  3W2A A;  4YFN F;  4M9S A;  2CW0 F;  2DPD A;  3L09 A;  5H2F C;  3KYC B;  3FBI B;  4QPO A;  5C3E J;  2V9V A;  3ERM A;  1V3F A;  5DM7 F;  4RAG A;  3FXJ A;  3ESW B;  4N4N B;  2DMP A;  3FHZ A;  1RNL A;  1APL C;  4UUS A;  1SVL A;  3HTU A;  2R7Q A;  4IPA A;  2FOW A;  1IN6 A;  1ZR4 A;  2F6C A;  1SMY F;  3KPH A;  3S1R J;  2AO9 A;  3IHU A;  1X3Z B;  3I71 A;  3P7N A;  4M74 A;  3QYF A;  2RKH A;  2LOO A;  3DTE A;  4ZDO A;  1E3P A;  4ZC3 A;  3M9A A;  1OCR H;  4IKF A;  3LSP A;  2LSO A;  1RKW A;  3FWE A;  3K4K A;  1YJW I;  1FNN A;  1K83 J;  2OBP A;  4MFE A;  3WTZ A;  1K4T A;  1FIP A;  4MHG A;  2DQR A;  1WKM A;  3CLQ A;  1IUY A;  1W7P D;  1R9T J;  2CW7 A;  3TL4 X;  1Z7L A;  2VOP A;  3SEZ A;  1FP2 A;  4WXD A;  4CCM A;  2I8D A;  4CYC A;  4XSZ F;  5HVQ C;  4WX9 A;  3D1N I;  2O6G E;  3OIO A;  1R23 A;  1U5T B;  3OR2 C;  5A2Q K;  1A5J A;  4IRG A;  1BI3 A;  1W7P B;  5HLI A;  3BRO A;  2HOT A;  2R5Z B;  2F5C A;  1YIJ I;  1IRZ A;  2XAS A;  1EF4 A;  1UHS A;  2EB7 A;  2M5W A;  2HOE A;  3QU3 A;  3WGG A;  5F08 A;  3K69 A;  3K70 D;  3CC2 I;  2IGK A;  2HS5 A;  2XAG A;  5EGO B;  5IP6 A;  3U2R A;  1QZZ A;  4IEJ A;  4QLC U;  2A5W A;  3HDD A;  4M71 A;  4B48 A;  1P9Q C;  4RM3 A;  1G59 A;  1ZHF A;  3HIF A;  3T8T A;  2VKE A;  3CDI A;  2V1X A;  2EV5 A;  4BJT A;  3RSN A;  4PJM A;  4QWQ A;  2GAU A;  1IXR C;  1WJ5 A;  1ZYR F;  2E1O A;  1SEU A;  2OCE A;  5KCM A;  4HV5 A;  3OYH A;  1IZ1 A;  5IT9 K;  3I3L A;  1TQP A;  2ELH A;  4I76 A;  3JRF A;  1REP C;  4CHU A;  1K6Y A;  2QQA A;  2X6W A;  3I58 A;  3K4L A;  1YS7 A;  4LLG F;  1V5E A;  4KIG A;  4A5N A;  2LC2 A;  2QBY A;  4Y33 A;  1XS9 A;  3HEF A;  5E20 A;  2QWW A;  3V7S A;  3IV5 A;  4BAC A;  2ZME C;  2ECB A;  1P7J A;  3LAP A;  2V1U A;  1KQ0 A;  1LEA A;  3VFZ A;  4ENK A;  1T95 A;  3CJT B;  4IXA A;  4RB0 A;  1EV7 A;  2R7T A;  4MTE A;  4M9X A;  4BGD A;  2CSO A;  1B72 A;  3EDP A;  4ANJ A;  4KDP A;  2BHZ A;  3HTS B;  1R6R A;  1ACI A;  2XRN A;  3BDD A;  1E3O C;  1IDZ A;  4UUS B;  3B6A A;  2E7W A;  2VUM J;  3P9C A;  2CFO A;  5B1A H;  1USS A;  2JUC A;  4ESB A;  4XKV A;  4HDU A;  4WCG A;  3BOQ A;  4YIR X;  1PUE E;  1Z91 A;  3ZMZ A;  1BIB A;  1F36 A;  3LSJ A;  3ZQF A;  1LFU P;  1P4A A;  1JI8 A;  2ZJP F;  3KZI C;  2XAF A;  2CQ7 A;  4W1U A;  3PUB A;  4EGY A;  5EDN A;  2FE3 A;  3LST A;  2HQA A;  3LA2 A;  4LG3 A;  4UXN A;  2KLO A;  3VSL A;  1YQA A;  4F7Z A;  2KHM A;  4MQ9 F;  4A3K J;  2B63 J;  1DP3 A;  4LIV A;  2M7A A;  2ZXH A;  1NK3 P;  3CJR B;  2Y48 A;  4PJJ A;  2CW8 A;  2BXY A;  4I6Z A;  3BCA A;  4BQQ A;  5FFX A;  2QGU A;  3H92 A;  2K85 A;  2HKX A;  1PJR A;  4XID A;  2L9R A;  4CYC B;  2V6E A;  2R7Z J;  3E6C C;  2Y9Z A;  2NVQ J;  2UWM A;  2DJN A;  2JRT A;  3EYY A;  1IV6 A;  1D3Y A;  1X4P A;  5TIS C;  3PO3 J;  2HNH A;  4NHJ A;  3OY9 A;  4U7B A;  2M4G A;  2FA5 A;  4BAY A;  1QPI A;  3WE3 A;  3WTX C;  1MIJ A;  2TCT A;  1P4W A;  3J7A Y;  4XRM A;  4H0E A;  2W1O A;  3FKJ A;  2ZNZ A;  1MBF A;  2D2W A;  3M8F A;  3R0J A;  5CJ9 A;  2NVT J;  1GXQ A;  3SFZ A;  1UFM A;  4A93 J;  3CZ6 A;  2K4J A;  2M0C A;  3FXR A;  2AXL A;  2MSY A;  2VJI A;  5HLG A;  3F72 A;  2VE8 A;  4U0V A;  3H5A A;  5LBQ A;  1O7F A;  3DQV C;  1XG1 A;  1ZRD A;  2EK5 A;  2BEO A;  4BXX J;  1VQN I;  4NUB A;  1FYM A;  2B9S A;  4RB2 C;  3GO5 A;  1FX7 A;  3CC7 I;  4A12 A;  5K5R A;  2QBY B;  4HF2 A;  1VQP I;  3DWL E;  4RM2 A;  1X4O A;  1ZGA A;  2DO7 A;  3G4S I;  1YE9 A;  2WV0 A;  1POG A;  1XGM A;  2NNN A;  5D4R A;  1B72 B;  2EPF A;  1QO0 D;  3ZMD A;  4QSH A;  2BXZ A;  3OYN A;  3DFG A;  3HG9 A;  3I5U A;  1JJ6 C;  3SFI A;  4BE0 A;  2Q1Z B;  1R5G A;  4RB3 C;  4G7O F;  2B0L A;  2XKO A;  2X48 A;  1FBS A;  2EIM H;  2HFH A;  2EFQ A;  1MKM A;  3J81 K;  1OCC H;  1JHH A;  2H1L A;  1O7L A;  4WF2 A;  4LG0 A;  5GTH C;  3L1P A;  3J7A O;  3QPS A;  4A6D A;  1SC7 A;  3GTQ J;  4B43 A;  3KYD B;  4OIQ F;  1JE8 A;  5LRS A;  4HF1 A;  2TDX A;  4L9T A;  2DQL A;  3BG3 A;  2JT1 A;  3LSG A;  2A61 A;  2KMU A;  3Q5F A;  1MH4 A;  1V5G A;  1LUJ B;  1T0F C;  3ECO A;  4C3J J;  1WJF A;  1YTY A;  5F64 A;  2IGM A;  4AU7 A;  3QWL A;  3DTI A;  2BYV E;  3VOE A;  2Z2S B;  4ZYA A;  1YOV B;  5CKT A;  4EMS A;  4G7Z F;  4GFB A;  3BTJ A;  5LGU A;  1RR7 A;  3C7J A;  3PQJ A;  3GFI A;  2N8G A;  5EYR A;  4Q5S F;  2XB0 X;  2R7R A;  2R93 J;  5FRN A;  1FC3 A;  4ZYE A;  1YS6 A;  2L9N A;  1JJ8 C;  5CQG A;  2MH9 A;  2JPB A;  4FE7 A;  4IHS A;  5J47 A;  1ENH A;  2ZFU A;  4P9U A;  3HC7 A;  1WPK A;  3TO7 A;  1QZE A;  3CDL A;  3KLN A;  3C2B A;  1VQO I;  5F1J A;  1ZR2 A;  3QP6 A;  2E1M C;  3WTV C;  1TP4 A;  2VBX A;  2RGV A;  2EIN H;  1GDT A;  4GYI A;  3KYL A;  5FGM A;  3ZQQ A;  1J7K A;  3GFM A;  2EFP A;  3I54 A;  5TRD A;  1WWX A;  5JLX A;  3I0T A;  1MSF C;  1SVO A;  1FSE A;  4KIC A;  2YS9 A;  5IP7 J;  4XLH A;  5E1Z B;  1VQ9 I;  1IRF A;  4K2E A;  5EZG A;  4R79 A;  1RUO A;  3DTK A;  4KN7 X;  1S5L C;  4E7S A;  2ELJ A;  1ON2 A;  4ENM A;  2XGD A;  3TOA A;  2RAE A;  1MDM A;  4D7M A;  4HNU A;  5J1R A;  2VC1 A;  3SDG A;  1F4K A;  3J7Z I;  2A3S A;  2VIX A;  4HW0 A;  3A01 A;  1RES A;  2HQR A;  2VKH A;  4F93 B;  2EIJ H;  2HR3 A;  2ZC2 A;  5D6F A;  1ONV A;  2KP6 A;  2L7Z A;  2NS0 A;  4UHT A;  4XLP F;  4ZDP A;  1SFX A;  1PYV A;  4IRH A;  2VJ5 A;  5D8L B;  4LG0 B;  3ZP5 A;  5J8F A;  1GVJ A;  4ON0 A;  4YFX F;  2A68 F;  4A3C J;  2V1N A;  4EJO A;  1LFP A;  2PN6 A;  4LB5 A;  4KA4 A;  2HWV A;  2E2H J;  3F8F A;  3LWF A;  1YX3 A;  1S7E A;  5GP9 A;  4M3B A;  1N25 A;  3HB9 A;  4IVN A;  5H6R A;  2R0Q C;  2K9M A;  2JSC A;  1XD7 A;  1WI3 A;  2OPT A;  4FQG A;  4G94 A;  4NC6 A;  2HOA A;  2K27 A;  3JAM K;  5D8K B;  2LTP A;  3A02 A;  2DYS H;  2BY2 A;  3V4G A;  1FY7 A;  1W4M A;  2DT7 B;  3L00 A;  3DKY A;  2LF8 A;  4L9J A;  3CES A;  3H9Q A;  4HLY A;  2DBB A;  3BG5 A;  3K4N A;  2DPU A;  2OTJ I;  4UB6 C;  1Z67 A;  5L3D A;  5JVT A;  1SD4 A;  9ANT A;  4BL0 B;  4HX4 A;  3H9J A;  3S1N J;  2F5D A;  3HRM A;  3KEY A;  4Q48 A;  2DA5 A;  3K2A A;  4FT8 A;  4XKW A;  1G4D A;  3RQI A;  4AYB N;  2MAB A;  2VXZ A;  2ZSI B;  3S2D J;  2V79 A;  4A3L J;  5DEQ A;  1P4X A;  2VPR A;  3WU0 A;  1RR8 C;  4X1E A;  3UKG A;  4E7Z A;  1IW7 F;  3K4C A;  5HDG A;  1V55 H;  4CCJ A;  4EJV A;  2WAQ N;  4LK0 F;  2F5E A;  2IBD A;  2KPM A;  2LNB A;  1DQU A;  1IO2 A;  1MMN A;  2L5Q A;  1VND A;  3F3X A;  2E19 A;  4NQW A;  5LGT A;  4I02 A;  3U21 A;  2ZFW A;  5CVJ A;  2EFW A;  2HYF A;  4A69 C;  4KMF A;  4YII A;  3TBI A;  2R7X A;  1XGO A;  4KIS A;  2NVX J;  2KT0 A;  3V8J A;  2CQK A;  3RJP A;  1R22 A;  4F92 B;  2F4O B;  4R1H A;  2Q0O A;  3FXQ A;  1FLI A;  5IOY A;  1MDM B;  2CUF A;  2DXI A;  3E1S A;  1LFB A;  3L2W A;  3MAJ A;  1U0J A;  5H6Q A;  1PDN C;  3K4M A;  3A01 B;  2VBZ A;  4XLA A;  1VTN C;  1ZAR A;  4FCY A;  1MJA A;  1HSJ A;  2ZJ2 A;  2W85 A;  1XB4 A;  3KFW X;  1R4N B;  4B47 A;  2QSH X;  1IDY A;  3RDI A;  1JKO C;  1JUM A;  3E5X A;  4CDG A;  4M3D A;  1ERD A;  1S8N A;  3KEQ A;  4F91 B;  5E3M A;  2OQG A;  2AHQ A;  3D5S C;  3O3K A;  3I4N J;  1IXS B;  5H20 A;  4W97 A;  1ZN2 A;  5KVR A;  4WXH A;  3BZ6 A;  2IW5 A;  4OWR B;  4GDF A;  2L7M P;  2JA2 A;  3U1K A;  3G71 I;  2DA2 A;  4B3A A;  2KIU A;  3FBN B;  1S72 I;  3S2H J;  2W4S A;  3M1E A;  2YPR A;  4O5V A;  1Y1W J;  1FEX A;  4CCO A;  4OU0 A;  2D5V A;  4RAZ A;  5M3F J;  2IA1 A;  2FNP A;  2DOE A;  5LRR A;  4QIW N;  2DMN A;  1DPU A;  4PDK A;  4A3E J;  5CPR B;  3SHF A;  5D5W B;  1X3W B;  1RKT A;  3T0Y A;  5GAH J;  4CCK A;  2FBK A;  1STZ A;  3SDB A;  3PSI A;  1GHC A;  3K1P A;  1OCZ H;  4G6T B;  5D5U B;  5KAI C;  1BR1 A;  2I10 A;  2MBF A;  2V9K A;  3HM5 A;  2HU9 A;  4ITV A;  4BNC A;  3LMM A;  5DM6 F;  4AYB A;  3BY6 A;  2MD5 A;  4BJ6 C;  2WB1 N;  3GCM A;  5DD8 A;  1X58 A;  2KIS A;  1HDP A;  4EJW A;  3QAH A;  2WAQ A;  3GZ6 A;  3Q0W A;  2D1H A;  5E1X A;  3CCQ I;  2P6T A;  2VLA A;  2HZD A;  1JUS A;  2OD5 A;  3BT9 A;  4NQW B;  3RKX A;  3GTJ J;  5L3C A;  2OZ6 A;  2XAQ A;  1SD7 A;  2XF5 A;  2F5V A;  1MMG A;  1D1B A;  3G1M A;  2CV2 A;  2ECC A;  3RKW A;  1P92 A;  4IHY A;  3H3V K;  3KX2 A;  1I27 A;  3MCZ A;  2NS7 A;  3ISP A;  3MKL A;  3H0G J;  2W57 A;  4S0H B;  3IH3 A;  2Z16 A;  2VAS A;  5C4X J;  3FMS A;  1OCP A;  1ETW A;  1ZKG A;  3HHH A;  2R4G A;  1BI1 A;  1Z05 A;  2K9Q A;  4MIM A;  3T8R A;  1YRN A;  3S8P A;  3CCM I;  1H8A C;  3H3U A;  3M8E A;  3H35 A; 
#chains in the Genus database with same CATH homology
 3ABM H;  5B1A H;  3ASO H;  1OCO H;  3ABL H;  3WG7 H;  2EIK H;  3AG2 H;  1OCR H;  2ZXW H;  2EIN H;  2OCC H;  1OCZ H;  2DYR H;  3ABK H;  2EIM H;  2EIL H;  3ASN H;  2EIJ H;  1V55 H;  2Y69 H;  3X2Q H;  1OCC H;  5B1B H;  3AG1 H;  2DYS H;  5IY5 H;  3AG4 H;  5B3S H;  3AG3 H;  1V54 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...