5IY5H

Electron transfer complex of cytochrome c and cytochrome c oxidase at 2.0 angstrom resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex structure of cytochrome c-cytochrome c oxidase reveals a novel protein-protein interaction mode
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 26
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 5iy5H00
2DYRH 1V55H 1OCZH 5IY5H 2ZXWH 2EIKH 1OCRH 2Y69H 3X2QH 3ABKH 3ABLH 1OCCH 2EINH 3ASNH 3ABMH 2DYSH 5B1AH 3AG4H 2EIMH 3ASOH 1V54H 2OCCH 5B1BH 5B3SH 2EILH 1OCOH 3WG7H 2EIJH 3AG2H 3AG1H 3AG3H
chains in the Genus database with same CATH superfamily
3L2VA 3DTEA 5FD6A 1STZA 5J1UA 2M3AA 1USSA 4GXOA 4GGGA 4OU0A 1MIJA 3CDIA 3X2QH 3KP4A 3S3NA 2M45A 3HRTA 1DU6A 2XKOA 2R7QA 3H0DA 5F1RA 5GAGJ 2B9SA 2OAZA 4UXNA 1LFPA 1V3FA 3SDGA 5L3BA 3MKYB 3WTXC 2DT7B 2EILH 2EBIA 3CMAI 4E7JA 2DFHA 3LA2A 2A69F 3O3KA 3LFKA 2WBMA 2LKPA 3Q5FA 4Y3OA 1GV2A 2ADUA 3NARA 3BLYA 1YS7A 2MH9A 3J81Z 3G73A 5J8CA 4II2A 1W1WE 4RGXA 4IHWA 1KYZA 4DW6A 3OYDA 2LKXA 1TW2A 1R9TJ 1J75A 4PJ0C 5LGTA 3LQRA 1D1AA 4RS8A 4E7HA 2V1DA 5F04A 1HDPA 3WTSC 1TWGJ 2A5YB 4F3QA 3S3MA 2FMYA 2WY7Q 4QTRA 5F64A 3E5QA 3DU6A 2R3SA 5L3EA 2LOOA 3A01A 3S1RJ 4XLCA 4B8XA 1YRNB 4HYEA 2DT6A 1CGPA 2FBHA 2GAUA 3K4CA 3OR1C 4E70A 3I4PA 3I58A 4A12A 1SEUA 2R7ZJ 5LBQA 3KCCA 4NUBA 3W2VA 2HWVA 4YIFA 1RUNA 5J6XA 2VN2A 4FX0A 4XOPA 3ROUA 4BY1J 4JBAA 2L7MP 1S9HA 4IOCF 5DCFA 2VBYA 3DKYA 2O03A 5EEHA 3GWZA 2R5YA 1ZARA 2KRHA 2BEOA 4DJAA 2DOFA 5LEKA 2PBIA 4KDPA 5KAFC 4BQAA 2FOWA 2DA4A 4QPOA 3VPRA 2M1BA 4G7HF 2ISYA 5FRNA 3V7SA 1YFHA 2HOSA 1D8JA 2NXNB 2P5LC 4RMNA 1OLTA 2EZIA 4HX7A 3JAMZ 2UWMA 1YIOA 3BROA 3M7GA 5F08A 5KNLA 1IAWA 4CGZA 2QZ8A 2V1XA 2XAFA 2R7FA 2KIUA 1Q1VA 3BJAA 2TRTA 1IDZA 2EA4A 2GIZA 5FKLA 3BDDA 2AXTC 3LMMA 3HHHA 4ENKA 5H6RA 2LP0A 5DV5A 2FBIA 4BYYA 1QZZA 4O3MA 1R4NB 2VONA 3FHZA 3R61A 5J1YA 3W6KB 1A04A 4C9YA 4XR6A 3SDBA 1MBEA 2L9RA 3O8HA 1AHDP 1BR2A 4MHGA 4AYBN 3CTAA 5M3FJ 3HHGA 1SAXA 1J59A 2VI6A 2GXAA 4P96A 3OYJA 2PMHA 2LKSA 3H5NA 3ABMH 3GXOA 3OYHA 3I9V2 2G7HA 4II3A 3TDUC 3ZGKA 3CCJI 2IVMA 1XS9A 2X6OA 1K6YA 3H9GA 1D5YA 1R22A 1WJ5A 2KIMA 1ZRCA 2HI3A 2H6BA 1ZG1A 2A61A 2E35A 2MBFA 3HXLA 1WSUA 2Q1ZB 1YHQI 3JSOA 4OOIA 1W0TA 1SFKA 2LY2A 4XRFA 3ZQQA 4D1QA 3F6VA 5DD4A 4E7KA 3ECOA 2NRAC 4IHTA 2E71A 3QQAA 3HRUA 3P5JA 2NVYJ 5IT9K 3ZPLA 1T6SA 5L3GA 3ZN0A 1MSEC 2BBYA 5DYMA 1LJ9A 1JE8A 4IXAA 2EA2A 1R4MB 3DV8A 2OBPA 3FISA 4HNUA 4MTDA 3QPLA 1Z0XA 5J40A 4A3DJ 4M9ZA 3DP7A 1Y56A 4FCYA 2FQ3A 1PUFB 4HSTA 4BUPA 2HZDA 1ZH5A 1VQNI 4BQNA 4RGRA 4FE4A 5HLGA 2KFDA 3LAPA 2V1UA 3WHBA 3BZ6A 5C44J 1UB9A 2DMUA 4BU2A 3C2HA 4HNTA 1RR8C 4YEJA 2L7ZA 3D5RC 2VQLA 2X6XA 2X0LA 1BM9A 2DJIA 2Z5UA 3H1CA 1X4OA 1MNEA 3HOWJ 1BN5A 2CW7A 2DK8A 2JT1A 1JUSA 1FEXA 5HNFA 1XGSA 3KEQA 4P5OA 1IN4A 3FM5A 1X2MA 5F0HA 1U9OA 1IXCA 3CDHA 4RB3C 5M5WJ 3VODA 2BZTA 1HW1A 1LDDA 4RLFA 1XG1A 2R5ZA 4BBSJ 4LG0A 3U1KA 3FXLA 2FU4A 1XC5A 4MGRA 2X1DA 4BXFA 1K61A 3V8KA 2Z1DA 3S17J 2DPDA 3S32A 4E7ZA 2OQRA 2CQ7A 3BWGA 3EETA 1CF7A 3HKZN 1ETKA 3I4NJ 2PMZN 4HA8A 1VFCA 1WI3A 2KIFA 2Y75A 1SMYF 3K4LA 2NVXJ 5E17F 4P1WA 3CCVI 1O4XA 2KDOA 2OUMA 1TNTA 2M8EA 3KP7A 3WU0A 3KETA 2P4WA 5EZGA 2OA4A 2DQLA 3V42A 4C3HJ 4HDVA 1HLVA 4CXFA 3GW2A 1F9NA 5J4YA 1H88C 4F91B 1SD5A 1MBJA 1YG2A 3LOCA 1NK2P 5FD5A 3GEZA 1IN7A 1IUFA 5GP9A 1ZG5A 2IGMA 5IPAA 4NDLA 2R7UA 4MO7A 2K85A 4XKVA 4M6YA 1BC8C 1ORKA 3H9JA 3GTOJ 1KQ9A 3OYKA 1SFOJ 2BY3A 3F0CA 3GTPJ 5B1BH 3ESWB 3KFWX 3L7WA 1GVDA 4JX4A 2IEKA 4EVIA 3HKZA 2IW5A 1ZK8A 3AG3H 1G3WA 3ZQCA 1VF9A 2XGDA 1S8NA 2QSHX 1QVUA 3W6VA 5EF6A 1X3WB 1U8RA 1A31A 3HBLA 2L5QA 2LNBA 5DTDA 2ZB9A 2P7VB 3PO2J 3DEWA 3K4JA 1UHMA 1XPXA 2VPRA 3LNQA 3K4NA 1Z77A 2HKXA 4M6VA 4HQEA 2ZJ2A 1B9MA 1UZCA 1FBSA 4HG2A 1PUEE 2NVQJ 2K5CA 3V8JA 5HDNA 1OCTC 1FT9A 3HOYJ 4BQOA 4IRHA 3OR2C 3SZPA 3P7NA 1W36C 4Q4ZF 3WG9A 1U0JA 2NS7A 2XVCA 3CC7I 1HSTA 2Z9OA 2VUMJ 3CD6I 2EIKH 1S3JA 2CG4A 2MW8A 3TDZC 2MLKA 3K9TA 3S2HJ 1IZ1A 5E3LA 4ENMA 1B4AA 4CICA 1VQPI 2XF6A 3ERMA 2DT5A 2HFHA 5GTHC 3S3OA 4A0ZA 1GUUA 3FF5A 2VOOA 3G3ZA 5K7FA 3H5RA 4BBRJ 2YX4A 2LY1A 3H92A 5HOOA 2R7SA 2ZFWA 1LE8A 2QF7A 2OZUA 5F27A 1RR7A 1YIJI 5AIPA 3GZ5A 3G1LA 1K4TA 2HOTA 2FE3A 2ECCA 2IS6A 2FX0A 4DBRA 3DEEA 2FD5A 5D5WB 4P9UA 4FHTA 1VZ0A 3CLOA 1FOWA 2QVOA 4RGSA 1UMQA 1K4SA 2KMUA 5D5XB 5TGTA 4D7MA 1PP7U 1WRJA 3V7RA 1IRXA 5JHFA 3S14J 4DOZA 3S2DJ 3DTIA 2DBBA 4PFOA 5J1RA 2M0CA 1S29A 5IOYA 1LVAA 3DWLE 5HS8A 3GBGA 4DYRA 1O3RA 1FSEA 2MD5A 3DKWA 3RPQA 4B47A 1WVRA 3M07A 3FIWA 1EH7A 3ELKA 1PP8F 4AD9A 3HEFA 4FETA 4I01A 4BXUA 3OMYA 3RI4A 2LY9A 3W6JB 3VOEA 3CCRI 3HPHA 2NYXA 3BP8A 3C2GA 1MH3A 3CCEI 4RBOA 1A36A 1QA6A 3HOXJ 4A3FJ 2DMNA 2F5CA 2CSOA 2ZXHA 3K2ZA 3Q9SA 2BVLA 1T2KA 4D5CA 1YE9A 4NC8A 1GT0C 3I59A 2WB1A 2EK5A 1GV5A 3AG1H 1HCRA 4FT8A 3RYRA 2E2IJ 2XGXA 1YW8A 1POGA 5M5XJ 1OR7A 1MGTA 1X1DA 5F1JA 4BJTA 3W3CA 1F5TA 4UV8A 1HF0A 1TT0A 2HYGD 5LRRA 1LDKB 2MA3A 3HSFA 3BR3A 5FKOA 4ZYDA 2XIGA 1K6OA 2NAZA 5FLVA 2FSWA 3OIQA 4BL0B 2K9LA 1R1TA 2IA1A 1W4MA 2KJBA 1L0OC 1BR4A 2V1NA 2XGCA 1EA3A 4KA4A 2DU9A 2XPWA 5EYRA 4M73A 1A6IA 1Z1DA 2O0YA 3WU1B 1LFBA 2LF8A 4EM0B 1YITI 1DDNA 1HXDA 3OWTA 3OIPA 3OYBA 2I8DA 3D5LA 5E3NA 4HSRA 1I6HJ 3BG9A 2XUBA 3HL2A 2FMLA 1SAUA 3FWEA 1G4DA 1X2NA 1IO2A 4LFUA 4RB1A 1GVJA 2YU3A 2Z16A 3HUGB 2EPFA 2M9HA 4ZH4F 1LEAA 3DLAA 4ZJZA 5K5QA 2WTEA 5LEJA 3S15J 1W5TA 2LBFB 1DP7P 5J3LA 2ZSIB 2VBWA 4WXCA 4XRSG 4KNYA 4CSWA 1VQKI 5HS7A 3G71I 4E7SA 3BZKA 1R5GA 3LA7A 3PNYA 2FNAA 4ITVA 2R5YB 1MH4A 2ME0A 4NQWA 2ZSHB 3MKWB 2CV2A 1TW3A 5IP7J 3ZXSA 4IHXA 1N78A 5CVIA 2O8KA 3L2QA 4KFCA 2QGUA 2KKOA 3KP3A 3QYBA 5EG0A 1J2XA 5BMZA 2KZGA 1YRNA 2LBFA 2DA7A 3PQJA 2PJPA 1I6XA 2K9MA 1A35A 5FROA 4DYCA 1AKHA 5KK1A 1UAAA 4PJJA 3ZQGA 1T0FA 1WH5A 2J5PA 3U21A 3AKZA 1FLIA 3ABKH 1IJWC 3OYLA 4XLAA 4GFBA 3H0GJ 3QRFF 3BY6A 2DA1A 1TWFJ 3EQLF 3JW4A 3VDXA 5C3EJ 4PFPA 5EJCA 2M2EA 5D6FA 5TJJA 3VYUB 1Z9CA 4U0VA 5FFZA 2QQAA 4BJ5C 1I1SA 1B9NA 3F22A 4A3IJ 1EH8A 4PUSA 1R71A 4KN7X 2IAIA 3MCZA 1SD4A 5F6FA 4KYWA 2M7AA 1V5EA 2PJRB 3ZMZA 1BW5A 2ZMEC 3GUDA 2E5ZA 4D7NA 5CJ9A 1X1CA 3DKXA 4XK4A 5EEGA 1U2WA 2YSRA 4IX7A 3I64A 3QYFA 4WXHA 3F8NA 4A5NA 2HPMA 1N25A 1WFXA 3K4KA 3G1OA 3VB2A 3TEDA 1HDDC 1ETOA 2H1KA 2KL4A 3EYIA 2B0LA 3GLXA 1P7JA 5DUIA 4I76A 1BBYA 1MMGA 1ON2A 2W00A 1JUPA 4G6TB 3RKYA 4S0HB 5KHDA 1LFUP 2E2HJ 2PQ8A 3C2BA 4WXDA 3PO3J 5FB2A 1MJBA 1ZGAA 3HGGA 3IUOA 4A3CJ 3MZ8A 4XN3A 2XF5A 1ETWA 3ZMDA 3IWFA 1Z67A 3V7CA 3HRMA 3JCUC 2IGNA 1U5TC 5ILSA 3CJQB 2CFXA 3WE2A 1YO5C 2LYCA 4UUTA 2JVHA 3JRHA 1I27A 4IJAA 3IAS2 2VE8A 4HAMA 5C4XJ 3HRSA 4KIGA 3IH3A 2MD0A 4A3EJ 1VQ5I 1SVOA 4Y13A 3GTJJ 5ICFA 1SC7A 3CMEI 3BPVA 1FZPB 3K4BA 5CQGA 1WJCA 2NS8A 4NC7A 2XHKA 4M9XA 5A2QZ 2JA5J 3K2AA 3HDDA 2NVTJ 2LLKA 4HZFA 4HV5A 3TP0A 5E20A 1W7PA 3GZNB 1T08B 3I3LA 1H8AC 1R36A 1E3PA 1XX5A 3ERED 3G4SI 4F55A 1ZR2A 1A5JA 1LVKA 4R79A 5K7HA 3TP3A 4W97A 3AFHA 2VLAA 1P4WA 2DA6A 3ABTA 3BQYA 1G8XA 1R5ID 3M3YJ 4AWXB 4V2GA 4BDYA 1U6GA 3P9IA 1MJAA 3VFZA 1I3QJ 2BW3A 1HQCA 2MG4A 4KMUX 3C7JA 4RAFA 3GFIA 1JI8A 5IOZA 2RC4A 3J7ZI 2JA6J 4X0GA 3KX2A 5LGNA 2LD5A 3ZMUA 2OJED 3FMSA 1R58A 2R4GA 1RRJA 2R5ZB 1K78A 5FKMA 1CQTA 4EJTA 2MH2A 1MW7A 4YFXF 2K40A 2VBZA 4EM2A 4UVBA 3FZVA 1PJRA 2HVQA 2XROA 1IG7A 3CCQI 4M6XA 1RUOA 5LLQA 3RQIA 3RPUA 3B73A 2IP2A 2RGVA 3VYSB 1S7AA 4HW0A 5JFRA 1ZN2A 2KRFA 3K4MA 2MSYA 3PJRA 3J80Z 3A0HC 2ZXWH 3CCMI 1BIAA 6PAXA 3GTQJ 2XB5A 2ECBA 2VBXA 2DA5A 2F5DA 1JKQC 3IC7A 5E79C 4ASNA 1X58A 3OYGA 3DBRB 1DUXC 3S16J 5HS9A 1YQAA 5C4JJ 2OQGA 4IZZA 3OYNA 3OSGA 1B8IA 4UUVA 2L0KA 1R49A 3A2KA 4ZDPA 1FNNA 2OF7A 5E3MA 3MFKA 4EATA 4BDZA 4LLNA 1JHHA 2RNJA 4HF2A 1EF4A 5LD2C 5L3CA 4KIFA 5HDGA 2W4SA 1HKQA 3FXMA 2XAUA 3KYLA 3GTMJ 3FXUA 4QSHA 5GAHJ 4XNFA 4ZYEA 3JRIA 1B72B 3CZ6A 1YW7A 4HDUA 1C0WA 1JKPC 3PFIA 1IN8A 1D0ZA 2CQQA 1YX3A 2BXYA 3JRBA 1P7IA 2FXAA 1KZHA 3QYEA 2DPUA 3UKGA 2EQRA 3SEQA 1O7LA 1AKHB 4LG0B 4ZYGA 2QYOA 3R60A 1XN7A 1WCMJ 1Z05A 3F21A 3A02A 4KIBA 1D5VA 1S5LC 3S1MJ 3RIRA 3OOPA 4W1UA 2PLYA 4MLOA 4J01A 3H3UA 2STWA 2JSPA 1OCOH 4XORA 2ZC2A 1Y1WJ 2VOPA 2CUFA 4Y17A 4I6ZA 5E8IA 1J0RA 4HF1A 5TISC 1RPWA 4MFDA 3AL0B 1OCRH 1X3UA 3FK6A 3HOZJ 2VKVA 3CJNA 2R7TA 1EV7A 4B3XA 3KE2A 2E7WA 3P9KA 3BCAA 3LSIA 5FRMA 1BOBA 3SFZA 3MN2A 5DCMA 3WGGA 3LSTA 3KP6A 4KICA 4O6JA 4CZZA 2CMPA 5J4VA 1YJNI 4WWCA 3F23A 5K7ZA 2PI0A 3KLOA 2B7EA 4N0BA 2DAOA 2K27A 1M1EB 2QUFA 4WF2A 5AIQA 5FFXA 4WCGA 5IP6A 2VIXA 3LSGA 3OYFA 4YIIA 3WU2C 2R7VA 1W7PD 3F8FA 2XAQA 2WADA 2CRGA 2MFZA 2ME6A 1IV8A 4U88A 3UR3C 2R92J 2VL8A 1I39A 4YELA 2WAFA 4K2EA 2DN0A 2DO7A 1ZREA 4BXXJ 2MGQA 4CUGA 1ZRFA 4C2TA 5E18F 5BPDA 1QU3A 1TZLA 2ISZA 3TO6A 4XONA 4Y4RA 3G1MA 2P5KA 2FNPA 3RQ4A 3GTLJ 2Y48A 3MWMA 1FOXA 3ZOBA 2HGCA 3LA3A 1FP1D 2ZJPF 3F6OA 5JR3A 3NWTA 1MBHA 1X1PA 2DW4A 1S72I 4IKFA 3CQZJ 1YI2I 3KP2A 1A6QA 2UUZA 2CS3A 2DDAA 2IA2A 2XAJA 3B6CA 3DFGA 3Q3SA 5BQTA 3KLNA 2VJ5A 3BG7A 2JA8J 5ICCA 1WWXA 2JMWA 2JRMA 2GXGA 2RNGA 5FLXK 4D9JA 5JI6A 4PJMA 4A0YA 2VE9A 2Q2EB 2PG4A 3J7AY 1G3SA 3BC8A 2NS0A 2ZNZA 2W57A 2R7WA 2MABA 3VSKA 4CCMA 4A69C 4GCVA 1Z21A 1XB4A 1KU3A 4U0YA 4IRGA 4D5FA 5DDGA 2XAHA 2HXIA 3LSRA 4YRVA 4LMYA 3ONQA 4ESJA 1OQYA 2G7UA 4EV0A 2JUCA 1Z7UA 1VI0A 4B43A 3L09A 1YJWI 3CESA 2YR2A 4M3GA 2ICWG 2B63J 5H2FC 5ILVA 5H6QA 2NVUB 5F0FA 4JQFA 4XLFA 3A01B 4L0ZB 2UZKA 2E1MC 2DYRH 1E17A 4HLYA 3I54A 1UJ8A 1QPMA 1BOAA 4U87A 1IV6A 1T38A 1BL0A 4QIWN 1FYKA 1GLNA 2Z99A 5CYVA 2BW3B 1W36D 2E5NA 3K70C 2O3FA 4LD5A 2H6CA 4L18B 5B1AH 2L4AA 1JT0A 3I0TA 4X6AJ 5FKKA 3H35A 4FX4A 5EEAA 4H4KC 2IGKA 1MMAA 4UV9A 1V55H 4UVCA 4Q47A 2BGCA 4BE2A 1Z3YA 4Y7NJ 4ON0A 2WWYA 1UFMA 3HTUA 1KU2A 1NHAA 1Z3XA 1QPIA 2EFQA 4BAYA 4PJLA 1WJAA 3L00A 2H27A 2RVCA 1BI2A 2Y2ZA 2GA2A 1YS6A 1O7FA 3H9QA 4OIQF 3DU5A 2AHQA 2CUEA 3S93A 1SVLA 1XTAA 2EWNA 3ZCOA 2ETHA 4IPAA 1SD7A 2AO9A 2DODA 2KDZA 3T5XA 2EFPA 2A6HF 2UXNA 2FBKA 2F4IA 5LRSA 3T8TA 3PM1A 2Y0SN 4LK1F 4CZCA 3CCYA 3MZYA 3QODA 2X85A 1FBQA 3E6BA 2QWWA 3LL7A 4I98B 4HV6A 1H9TA 3S8PA 2LF7A 3U2RA 3BR2A 5HLTA 2HYJA 3EYYA 1X19A 2Y30A 3RZOJ 3E6DA 2EIJH 2FA5A 2P6SA 4EJVA 2GQQA 3LWFA 1XCBA 4KN4X 2CUJA 5CPRB 2XRLA 4G8XA 1P4XA 2QKLB 1BR1A 4MQ9F 2BXZA 1T8IA 2VJJA 4XRSA 5D4RA 3I59B 4A2UA 4CCLA 2JA7J 2V7FA 2VC1A 1F1ZA 3BG5A 2G9WA 3KEYA 5DM6F 3D5SC 1SVMA 1HBXG 2L4MA 4AVZA 2R0QC 2BHZA 4FISA 2RQQA 5E3OA 5DCMB 1B1BA 3QAHA 4O5VA 2RN7A 3E5UA 2NOJB 4JK1X 2BOLA 3TW6A 3OYEA 3S1QJ 3RPUD 4U7BA 2HVRA 4B1RA 3MKLA 5CQEA 2KIQA 1VQLI 2V26A 3BR1A 3F8MA 1MNDA 2O5RA 3I53A 2K7LA 4ANJA 2M0MA 2AS5F 1D3YA 1D1CA 1Z91A 2L3DA 2F5FA 3HM5A 1D1BA 4RM2A 1TWHJ 3I55I 2GA1A 4G9YA 2LFBA 2AQEA 3IRQA 2LTPA 5EDNA 2P8TA 2V9VA 1DP3A 2M7BA 3CP2A 1MMNA 3FXKA 2P7CB 3OIOA 3TL4X 1OYYA 2VT2A 2XPVA 4CYCA 2ZMEB 1OCZH 2V9KA 2FUG2 2WAQN 4BHPA 2EV6A 4RAGA 3V8LA 1LUJB 1LKXA 4YIRX 3B6AA 4BGDA 4LG3A 2QQ8A 2VKEA 4N4NB 2KISA 5IT3A 4N4OB 4WK8F 5BS6A 3O6BB 4ESFA 1D0YA 1K83J 4BEHA 1FWZA 3R0JA 1FC3A 2M30A 3GF2A 2QQBA 4LGWA 4XBFA 3ZR8X 1JGGA 4CHUA 1KQ8A 4CYDA 2W7NA 1BI0A 2FF4A 2E1NA 2FQ4A 4I99C 4A3JJ 2CYYA 2OU2A 3GTKJ 3RKXA 4FTHA 1IXSB 4UUSA 4CDGA 2F5VA 2HQ5A 2PMUA 4LOCA 4B09A 1ETYA 3TBIA 1BI1A 3M9AA 2EFOA 2CW8A 1RIOH 3WTUC 1TNSA 1U5TA 4XICA 3TO9A 3BTIA 1UCRA 3DBHB 4NC6A 2BHYA 1VQOI 1S7OA 3CUQA 4DGWB 5ERIA 3FX3A 1K78B 1R00A 1XGNA 2EV5A 1YYVA 2LC2A 4ZDLA 4L9VA 1VTNC 2A3SA 4UUSB 1R23A 4CCKA 2Y9YA 2HVSA 2MC3A 4AIHA 1IDYA 2CQNA 1OPCA 3RYPA 5FLXZ 2ESNA 2VC0A 4UHTA 2JPBA 4JX5A 3C1DA 4XSXF 3DCFA 4IF4A 1W0UA 3DLLF 3QPTA 5FLMJ 1JKRC 1SD6A 4OINF 3ZP5A 1BI3A 1N77A 5B3SH 4C2UA 3HTSB 2I5UA 4BNCA 1TTYA 4OMYA 2XASA 3RTRA 1H89C 2GBYA 5EGOB 2O6GE 5JVTA 1BW6A 1SANA 2ZCWA 3CC2I 2BV6A 4HF0A 4HOBA 1NTCA 3CP8A 3TW7A 4BS9A 2DFFA 3E6MA 3IHUA 1ONVA 3HOTA 2DXIA 3WTVC 3VYTB 1V5GA 2EV0A 4C30A 3E97A 2K4JA 4MFEA 3L2WA 3OYAA 1OISA 2JSCA 1R6RA 3KEOA 4ABZA 3BTJA 4PGHA 2BY1A 2M8GX 4HRIA 5DS9A 2W82A 1JGSA 2VKHA 3QPSA 4XOTA 1MSFC 1X3ZB 1PVEA 1JKOC 2L7FP 1RETA 3FXRA 4XLHA 4A6EA 2ELJA 1DU0A 4ZDOA 1P6RA 3KZYA 1ZLKA 5K5OA 3R4KA 2QLZA 3GFJA 4GYGA 3COAC 1CF7B 3ASNH 1NK3P 4L0YB 3WTYC 4D0PA 1V5FA 3AAFA 2DFEA 2BE5F 4C3JJ 4AIJA 5LHHA 2V79A 3BCBA 3LSPA 2O7OA 3WG7H 4ESBA 1PYVA 3VEPA 5K1YA 2QBYA 2XGEA 3SEZA 2HEOA 4OIRF 1VQ9I 4HBLA 4BKXA 5D5UB 3P9CA 1YOVB 1R1VA 2JRTA 4QLCU 1AU7A 3IRRA 4Y15A 3DPLC 2D1VA 2EJRA 4P9FA 1IRFA 1P9QC 3HOUJ 1X4PA 1MMDA 3WTZA 3TQNA 4Z6YA 4CCJA 3JRAA 1FBUA 3OL4A 4AC0A 4IOAF 2KJCA 4PDKA 4F92B 1T39A 1G59A 1EJ9A 2RAEA 1OR7C 4B48A 3JTGA 2KZVA 2P5VA 2M87A 3SXYA 4U7DA 3ZMSA 3L1PA 2NOGA 4A5MA 5GADJ 1I50J 4XLNF 4XLPF 3FXQA 3CC4I 2DOEA 4Q5SF 3OS0A 3CO6C 3PNVA 3HUGA 4B3AA 4OAYA 2YPRA 2K9NA 3F72A 1RC9A 2VT3A 2W24A 2OTLI 1RI7A 2W85A 1K79A 1PDNC 3BTLA 2VJ4A 3RCOA 4XSZF 3ZMTA 2IPQX 1TL8A 2XAGA 3FDYA 3M8EA 3QWLA 4ENJA 1ZG3A 3BT9A 1P2FA 2WB1N 3GCMA 3PL8A 2F48A 4U0WA 2DI3A 3IV5A 1KYWA 2VJIA 4IO9F 2FRHA 2JUGA 1JT6A 2JZYA 3M8JA 3D0SA 2M34A 3LSHA 4JYKA 3JRFA 3ZQLA 1XMAA 5DM7F 2HR3A 1JJ8C 3SZGA 4UB8C 3DTKA 4DIQA 3FBIB 3VSLA 3JRDA 3JTHA 2LK2A 1F43A 2ID6A 4E7LA 1TBXA 4M71A 4I0BA 1G2HA 1DPRA 2Y0MA 2PJRA 2CJJA 2YS9A 2K3PA 1VQ6I 4OIOF 5TRDA 2OCCH 2WV0A 4EJUA 1HKTA 4RB2C 1U3EM 3GTGJ 4EGZA 4HQMA 5BOXA 2L9VA 5EZHA 3T1BA 1IRGA 1U78A 2HXOA 3IKVA 2H94A 1WKMA 2QSFX 1OJLA 3BR5A 3TOAA 3L9FA 2ID3A 4FASD 4BE0A 1GXPA 4CH7A 1IUYA 3JAMK 1V4RA 4KISA 4B44A 4L9JA 1Q1HA 1TT5B 1JTXA 2OCEA 2XDVA 1RESA 4N9IA 4P55A 4I02A 4Y52J 1HA8A 3IH2A 1OCPA 3A0BC 5D5VB 2R93J 2Y31A 3TKYA 3KIOA 3L2UA 3GFLA 5DUKA 1VQ4I 1T95A 2JWTA 4XMYA 1O3QA 1P4AA 1BJZA 4CCNA 3S1NJ 2CGPA 5E1WA 3MEXA 1S6LA 2CU7A 4NNJA 4FE7A 3E0JB 1FIAA 4A3GJ 4NQWB 1LEBA 2QA4I 3K0LA 4PK4A 3RKQA 1TLHB 3DEUA 5D8LB 1B72A 3RZDJ 2XB0X 1D0XA 5D4SA 3NWSA 2TDXA 2L2OA 4L5JA 4C2MJ 1BC7C 1ZRDA 2ELHA 4IQ4A 4PZJA 3ZQ7A 1LQ1A 1G3TA 1ERDA 5IYCJ 3ZQIA 1IXRC 3ZQHA 2DCEA 3F8CA 4J00A 2O61A 3IP4B 1HW5A 3GYHX 3MAJA 3MD2A 3J81K 4LLLA 3WGHA 1ITYA 1ZYRF 4JP0A 2FOKA 1UELB 2LREA 1I5ZA 2IA0A 3LSKA 2DA2A 2CFOA 2HZTA 2X51A 4S05A 1ODDA 1J7KA 5IYDJ 1QQIA 1RNLA 2WA0A 2K3FA 2K9SA 4ENNA 2VB6A 3BR0A 1LDJA 4XN0A 5ED4A 1SMTA 1ZGWA 4NBQA 2P0WA 5JVGF 1Y39A 3CCUI 3I5UA 3I71A 2LDUA 3Q9VA 4XLEA 3BG6A 3JSPA 2A05A 2F5EA 4KT5C 4UNOA 4EGYA 1IGNA 2MLGA 3EUHA 3ZRGA 4M9SA 1Z6TA 2F2EA 2VKDA 2X6WA 3V4GA 1AWCA 4A3BJ 2E34A 4BY7J 1B6AA 1XMKA 2GM4A 3ECHA 1YW9A 3EUKL 3HGYA 2LRDA 1EKEA 1ETQA 3OS1A 3PIOF 3CF5F 4AM3A 5D8KB 4HLXA 2M5WA 3T8RA 1SFXA 2W84A 2I10A 4JX6A 3GO5A 3NEUA 4AIKA 1L3LA 1NH3A 3E5XA 3DXJF 2O8XA 1ZELA 3SFIA 1FIPA 1BA5A 2Y69H 3K6GA 4EMSA 1T0FC 2CO5A 3PQKA 2FEZA 3PUFA 5EG0B 2L9SA 3BJ6A 1RKTA 5ICEA 3ULQB 2LH9A 3DPUA 1ETXA 3KYDB 4KJZA 2L02A 4MEXF 4M3BA 3RKWA 1DQUA 2G0EA 2DFIA 3HB9A 2K4BA 4I2OA 2W1OA 3BPXA 3QPHA 3U9GA 1PUFA 3LSMA 3J7AO 9ANTA 2DJNA 3FK7A 2R7XA 2Q8KA 1U9NA 2E1OA 3PSFA 2OTJI 2FJ1A 1ZLJA 4EJWA 3HOSA 3IH4A 3VYRB 4EJOA 1MBFA 3M4OJ 3J7YJ 5HNHA 1FPQA 2QM3A 3B02A 4LITA 1WJBA 4WX9A 3FXOA 1IN5A 1X1BA 3WTTC 4V2FA 4G7OF 1ACIA 3MZHA 3N4MA 2CH0A 1QHHD 3EPZA 3R6SA 1FOYA 2VXZA 2IS2A 4Z2YA 4M3EA 1TWAJ 3HPGA 3OSFA 3K70D 3GZ6A 2Q0OA 2COMA 3PNTA 4AYBA 2ZXJA 1FP2A 1GDTA 2GZWA 5E8GA 4H0EA 1MNMC 3RDIA 2OC6A 2NNNA 3FMRA 4CO8A 2CV1A 3LQQA 1JUMA 3OV8A 4MQVA 1NG7A 2XPUA 4IEJA 4X1EA 4AVPA 1QGPA 2KPMA 1QNTA 4F7ZA 3EDPA 3U1DA 2JPCA 4IHSA 2D5VA 2VQHA 3ISPA 4BHBA 3SHFA 4KUMA 3BTCA 4DQ2A 1Z6RA 2JQ7A 5GAEJ 4Y33A 1XD7A 3FMQA 1I3AA 1R5HA 1QZEA 1E3HA 4IVNA 1RZ4A 2DMQA 2AXLA 1OFCX 4CYCB 3WODF 2HNHA 2BY0A 4ZZDA 1OYIA 3BQZA 1YLFA 2V4JC 1WH7A 2ACJA 3IL2A 2EZKA 2V9PA 5KAIC 1FJLA 4RAYA 1UHSA 4TV7A 5EGOA 3CO7C 1WJDA 4GRIA 4F93B 2P6TA 4A3KJ 1GHCA 3F9KA 1FYMA 3I4MJ 2BY2A 2HOAA 4DZPA 2RREA 3N97A 3FBNB 3Q0VA 3HC7A 3ML6A 4L5EA 1TC3C 1X1AA 4R1HA 1SFEA 3QP5A 3CDLA 5GPAA 1IF1A 1KGSA 1HKSA 2W25A 2RV8A 3H5AA 3RJPA 1KU9A 1WJEA 3OYCA 4LJZF 3SQNA 5K5RA 3HSEA 5CVJA 2JA2A 3T0YA 1FTTA 3VWBA 5DD8A 2MYSA 1QZYA 2NNYA 4IQJA 2QENA 4RA2A 1R7JA 4G12A 5L3FA 4HNVA 1MKMA 2HQNA 3CLQA 4YFNF 3H36A 1VNDA 4GDFA 2F4MB 1IN6A 3E1SA 2N8GA 2LSOA 1T33A 3E3VA 4L9TA 2V6CA 5IYBJ 2HDDA 2XF7A 2XSJC 2TCTA 1O57A 5CVVA 1WHUA 5FKNA 2WV1A 3K1PA 4B4CA 4OWRB 3HYIA 2E19A 4GO1A 4RM3A 2D45A 4LK0F 4OIPF 3EUAA 1J09A 1Y8QB 4BEHB 2ZJRF 2XSDC 1Y6IA 4HX8A 5CKTA 4QPQA 3CMMA 1F4KA 3AL0C 1FMWA 1MD0A 4HX4A 1G6NA 3Q0WA 2VPLA 1E2XA 1VQMI 3ABUA 1WZ2A 1Y8RB 2VQGA 1KONA 1JHFA 3JREA 1U8BA 4OAZA 2X4HA 2LMDA 2HDCA 1XSXA 3L2RA 4G6QA 2QBYB 4PJNA 4AUXA 5HODA 3GVAA 4CA0A 1IRZA 3F8BA 3MMYB 5HDKA 4M3FA 4BE1A 4FQGA 1U5TB 2KLOA 2ZJQF 1OCCH 3M1EA 4MEYF 2DYSH 4ZYAA 5BNGA 2ZFUA 4F52A 2EIMH 2GOMA 5ICGA 3ASOH 5J8FA 3HOVJ 2E2JJ 2EZHA 3OL3A 1HW2A 3PUBA 4XQFA 2DOAA 1VQ8I 1TQMA 3CUQB 1ON1A 1FMVA 3MKZA 3ZQFA 2VQCA 2XV4S 2A6EF 4LLGF 5E1XA 1MDMB 5IT9Z 5B5EC 4RDUA 1USTA 1KQ0A 4EM1A 2F4OB 3GLLA 4BJ6C 3K7AJ 3CMYA 3NAUA 2QCOA 1XGMA 3S2WA 2QEXI 5LHIA 2KHMA 2COBA 3JRGA 2CW0F 3KYCB 1I1GA 3CF2A 3OY9A 4L5IA 1FOKA 5HLIA 1LNWA 2Z3YA 4LB6B 2L01A 2ELKA 3FXJA 2IXSA 3WTWC 4M3DA 3CCLI 2F6CA 1TQPA 1XSVA 2ESHA 3HG9A 1XMXA 1FY7A 3GFMA 3CCSI 2H8WA 1H9GA 2IGOA 1BJAA 2OPTA 1WPKA 2A6TA 4LIUA 5JLWA 5CVRA 2PX9A 3LAJA 1ZAOA 1TQIA 2ZNYA 3W2WA 4KMFA 4DNCA 3DPTA 2BVMA 4E4HA 1ZKGA 3TGNA 1JTYA 4I0AA 5GPCA 2VODA 3G6EI 3OYIA 4CCOA 1MZBA 3DF8A 3MVPA 2IRFG 2EH3A 4OMZA 4EQQA 3FKIJ 3CJRB 1MBKA 1E0EA 1HOMA 3KZIC 3I56I 1APLC 3HJEA 2PMZA 1DGRM 1E3OC 1T56A 2DQRA 2R7OA 4ZC3A 3OS2A 3GX4X 2K86A 3A03A 3D1NI 4ZTJA 3N05A 1ZHFA 2XKPA 5FGMA 5H20A 2LVSA 2EB7A 3RSNA 2E36A 3O8GA 4R8HA 5LHGA 3FM3A 4QWQA 1BIBA 4XIDA 5M5YJ 2E1CA 2A5WA 4ZYHA 2WY8Q 4UB6C 1SFUA 3ZMVA 5IP9J 2HQRA 5M3MJ 4PSXA 1IC8A 2UV1A 2MC4A 1J5YA 3PIPF 3SJMA 5B66C 1WGXA 1MBGA 3R0AA 2OD5A 2IT0A 3QU6A 3HSRA 3NRVA 5HVQC 5FO5A 1XSDA 2YU9J 1ZR4A 1B59A 3QP6A 2HTSA 2ZKZA 4JOMA 4A3MJ 2A68F 3QOEA 2H09A 4UY8I 2R7DA 1UG2A 4V19K 4XRMA 2IS1A 4XKWA 1ENHA 4S04A 3AG4H 1WJFA 2W48A 1ETVA 3EUHC 2ZXIA 4XL9A 1TP4A 3SYTA 1D8KA 3TOBA 4I09A 2V6EA 1YJ9I 3AG2H 1OYWA 4YG2F 4NB5A 2X1CA 3FHNA 2GXBA 3OOUA 4L9NA 5E1ZB 1KA8A 4ETSA 3BOQA 2DTRA 4A0XA 3O2PE 3A4CA 1QHGA 1LPQA 3TO7A 4ZZLA 2WAQA 2J5OA 1Z7LA 1K7AA 2CV0A 4A6DA 4IHVA 3WE3A 4BHCA 2E1MB 3PFYA 2OV7A 3PSIA 2Z33A 1LB2A 2EFNA 3G2BA 1HC8A 1RKWA 5HLHA 4AU7A 2KT0A 3M8FA 5CVUA 4N9HA 4NHJA 4M74A 4RGUA 1JJ6C 1Y0UA 3CUOA 1R1UA 2P81A 2X48A 1HSJA 3KPHA 4XKCA 2HU9A 1B8IB 3E7LA 3CUQC 3E6CC 5KCMA 1WI9A 1O3TA 3F3XA 4UVAA 1ZGJA 2PFBA 1QBJA 5CLSA 2H1LA 5KVRA 2H8RA 4LB5A 1S7EA 4BH9A 3IAM2 2UXXA 1P92A 2DLLA 2Z2SB 1UG0A 1QVTA 3WGIA 4IRIA 2JTVA 4IHYA 2VXDA 4KT6A 2XC7A 5L3DA 2IBDA 2KP6A 2QQ9A 1LE8B 2CWEA 1AA7A 1J9IA 2RQPA 4XKBA 2VASA 2OZ6A 3WHCA 1ZQ3P 4BQQA 3DQVC 1KU7A 4G7ZF 3REOA 3J80K 2ZBKA 1GXQA 4J19A 3LFUA 2HS5A 2ZO4A 4EEFG 2RKHA 3TMOA 1FYLA 1FTZA 1N75A 2HPIA 1DPUA 5BPIA 2M4GA 2X9DA 2EZLA 2PN6A 2HOEA 2WC2A 2D1HA 4MIMA 4RLQA 1WQ2A 3JRCA 3JR9A 3K10A 2DK5A 1F36A 2DMTA 2RDPA 5AONA 5LFAA 1DGWY 3HZJA 5IY5H 4LIVA 3IWZA 2E7XA 4G6DA 2QSGX 1MDMA 3BR6A 2L9NA 2K02A 4G94A 2LR8A 5D6EA 3MQ0A 2IJLA 2A07F 5LGUA 3LSJA 3C18A 1REPC 3BG3A 2E60A 3HIFA 1V54H 4RAZA 4IL6C 2QKMB 4DZJA 2HKOA 1OKRA 5JHUA 2WAEA 2ZMEA 3IKTA 2DMPA 3A1YA 3OYMA 2JN6A 4KITB 2PEXA 4E6KG 1JXSA 2IS4A 2CQKA 5J47A 1FSHA 2GLOA 2GIVA 2HTJA 4BACA 4XM3A 2R7RA 3KZZA 1T98A 2M4KA 3ABLH 4Q48A 3BZCA 4DBQA 3UNGC 5A2QK 1TWCJ 2XRNA 3C3WA 2YUSA 1H0MA 1XDUA 1O3SA 1W5SA 1MJ9A 2K9QA 4C3IJ 2GWRA 2C6YA 3K69A 2L54A 1W7PB 3W2AA 1UHWA 3CJTB 4E7IA 1NG6A 3BJOA 4A3LJ 3M1CA 2X6YA 2BYVE 2JVGA 4M72A 5DEQA 4PSWA 1XGOA 2HYFA 1QRYA 2STTA 4A93J 2AQFA 3H3ZA 3ZN1A 4PCQA 2GOXB 4I7HA 2EFWA 4HPQA 1VQ7I 2KRCA 2DTZA 1QO0D 1YX5A 2Q2EA 3Q0UA 2JJ7A 3FKJA 4MTEA 2JK3A 2DDBA 5ILUA 2D2WA 2HDWA 4RB0A 4ZTFA 2CUZA 2YX7A 3QOPA 5JLXA 1ULYA 1Y0NA 3K1MA 3H3VK 2L7KA 4PGGA 2Y9ZA 3K1NA 1W5CC 1EH6A 2LG4A 3GMEA 1ZTRA 1XCVA 1G3YA 1IW7F 3KP5A 3QU3A 4MNUA 2X1EA 4HEA2 1XDSA 2EINH 2KQRA 1AOYA 1YTYA 3DBLB 1OMIA 5FJ8J 2Y0SA 4GYIA 2HQAA 2O9LA 2DA3A 4DYQA 2CQXA 3NQOA 5GTIC 1FX7A 4AIDA 1Y1VJ 3SZTA 3L2CA 1MMSA 4YFKF 5F0CA
chains in the Genus database with same CATH topology
2DYRH 1V55H 1OCZH 5IY5H 2ZXWH 2EIKH 1OCRH 2Y69H 3X2QH 3ABKH 3ABLH 1OCCH 2EINH 3ASNH 3ABMH 2DYSH 5B1AH 3AG4H 2EIMH 3ASOH 1V54H 2OCCH 5B1BH 5B3SH 2EILH 1OCOH 3WG7H 2EIJH 3AG2H 3AG1H 3AG3H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYR H;  1V55 H;  1OCZ H;  5IY5 H;  2ZXW H;  2EIK H;  1OCR H;  2Y69 H;  3X2Q H;  3ABK H;  3ABL H;  1OCC H;  2EIN H;  3ASN H;  3ABM H;  2DYS H;  5B1A H;  3AG4 H;  2EIM H;  3ASO H;  1V54 H;  2OCC H;  5B1B H;  5B3S H;  2EIL H;  1OCO H;  3WG7 H;  2EIJ H;  3AG2 H;  3AG1 H;  3AG3 H; 
#chains in the Genus database with same CATH topology
 3L2V A;  3DTE A;  5FD6 A;  1STZ A;  5J1U A;  2M3A A;  1USS A;  4GXO A;  4GGG A;  4OU0 A;  1MIJ A;  3CDI A;  3X2Q H;  3KP4 A;  3S3N A;  2M45 A;  3HRT A;  1DU6 A;  2XKO A;  2R7Q A;  3H0D A;  5F1R A;  5GAG J;  2B9S A;  2OAZ A;  4UXN A;  1LFP A;  1V3F A;  3SDG A;  5L3B A;  3MKY B;  3WTX C;  2DT7 B;  2EIL H;  2EBI A;  3CMA I;  4E7J A;  2DFH A;  3LA2 A;  2A69 F;  3O3K A;  3LFK A;  2WBM A;  2LKP A;  3Q5F A;  4Y3O A;  1GV2 A;  2ADU A;  3NAR A;  3BLY A;  1YS7 A;  2MH9 A;  3J81 Z;  3G73 A;  5J8C A;  4II2 A;  1W1W E;  4RGX A;  4IHW A;  1KYZ A;  4DW6 A;  3OYD A;  2LKX A;  1TW2 A;  1R9T J;  1J75 A;  4PJ0 C;  5LGT A;  3LQR A;  1D1A A;  4RS8 A;  4E7H A;  2V1D A;  5F04 A;  1HDP A;  3WTS C;  1TWG J;  2A5Y B;  4F3Q A;  3S3M A;  2FMY A;  2WY7 Q;  4QTR A;  5F64 A;  3E5Q A;  3DU6 A;  2R3S A;  5L3E A;  2LOO A;  3A01 A;  3S1R J;  4XLC A;  4B8X A;  1YRN B;  4HYE A;  2DT6 A;  1CGP A;  2FBH A;  2GAU A;  3K4C A;  3OR1 C;  4E70 A;  3I4P A;  3I58 A;  4A12 A;  1SEU A;  2R7Z J;  5LBQ A;  3KCC A;  4NUB A;  3W2V A;  2HWV A;  4YIF A;  1RUN A;  5J6X A;  2VN2 A;  4FX0 A;  4XOP A;  3ROU A;  4BY1 J;  4JBA A;  2L7M P;  1S9H A;  4IOC F;  5DCF A;  2VBY A;  3DKY A;  2O03 A;  5EEH A;  3GWZ A;  2R5Y A;  1ZAR A;  2KRH A;  2BEO A;  4DJA A;  2DOF A;  5LEK A;  2PBI A;  4KDP A;  5KAF C;  4BQA A;  2FOW A;  2DA4 A;  4QPO A;  3VPR A;  2M1B A;  4G7H F;  2ISY A;  5FRN A;  3V7S A;  1YFH A;  2HOS A;  1D8J A;  2NXN B;  2P5L C;  4RMN A;  1OLT A;  2EZI A;  4HX7 A;  3JAM Z;  2UWM A;  1YIO A;  3BRO A;  3M7G A;  5F08 A;  5KNL A;  1IAW A;  4CGZ A;  2QZ8 A;  2V1X A;  2XAF A;  2R7F A;  2KIU A;  1Q1V A;  3BJA A;  2TRT A;  1IDZ A;  2EA4 A;  2GIZ A;  5FKL A;  3BDD A;  2AXT C;  3LMM A;  3HHH A;  4ENK A;  5H6R A;  2LP0 A;  5DV5 A;  2FBI A;  4BYY A;  1QZZ A;  4O3M A;  1R4N B;  2VON A;  3FHZ A;  3R61 A;  5J1Y A;  3W6K B;  1A04 A;  4C9Y A;  4XR6 A;  3SDB A;  1MBE A;  2L9R A;  3O8H A;  1AHD P;  1BR2 A;  4MHG A;  4AYB N;  3CTA A;  5M3F J;  3HHG A;  1SAX A;  1J59 A;  2VI6 A;  2GXA A;  4P96 A;  3OYJ A;  2PMH A;  2LKS A;  3H5N A;  3ABM H;  3GXO A;  3OYH A;  3I9V 2;  2G7H A;  4II3 A;  3TDU C;  3ZGK A;  3CCJ I;  2IVM A;  1XS9 A;  2X6O A;  1K6Y A;  3H9G A;  1D5Y A;  1R22 A;  1WJ5 A;  2KIM A;  1ZRC A;  2HI3 A;  2H6B A;  1ZG1 A;  2A61 A;  2E35 A;  2MBF A;  3HXL A;  1WSU A;  2Q1Z B;  1YHQ I;  3JSO A;  4OOI A;  1W0T A;  1SFK A;  2LY2 A;  4XRF A;  3ZQQ A;  4D1Q A;  3F6V A;  5DD4 A;  4E7K A;  3ECO A;  2NRA C;  4IHT A;  2E71 A;  3QQA A;  3HRU A;  3P5J A;  2NVY J;  5IT9 K;  3ZPL A;  1T6S A;  5L3G A;  3ZN0 A;  1MSE C;  2BBY A;  5DYM A;  1LJ9 A;  1JE8 A;  4IXA A;  2EA2 A;  1R4M B;  3DV8 A;  2OBP A;  3FIS A;  4HNU A;  4MTD A;  3QPL A;  1Z0X A;  5J40 A;  4A3D J;  4M9Z A;  3DP7 A;  1Y56 A;  4FCY A;  2FQ3 A;  1PUF B;  4HST A;  4BUP A;  2HZD A;  1ZH5 A;  1VQN I;  4BQN A;  4RGR A;  4FE4 A;  5HLG A;  2KFD A;  3LAP A;  2V1U A;  3WHB A;  3BZ6 A;  5C44 J;  1UB9 A;  2DMU A;  4BU2 A;  3C2H A;  4HNT A;  1RR8 C;  4YEJ A;  2L7Z A;  3D5R C;  2VQL A;  2X6X A;  2X0L A;  1BM9 A;  2DJI A;  2Z5U A;  3H1C A;  1X4O A;  1MNE A;  3HOW J;  1BN5 A;  2CW7 A;  2DK8 A;  2JT1 A;  1JUS A;  1FEX A;  5HNF A;  1XGS A;  3KEQ A;  4P5O A;  1IN4 A;  3FM5 A;  1X2M A;  5F0H A;  1U9O A;  1IXC A;  3CDH A;  4RB3 C;  5M5W J;  3VOD A;  2BZT A;  1HW1 A;  1LDD A;  4RLF A;  1XG1 A;  2R5Z A;  4BBS J;  4LG0 A;  3U1K A;  3FXL A;  2FU4 A;  1XC5 A;  4MGR A;  2X1D A;  4BXF A;  1K61 A;  3V8K A;  2Z1D A;  3S17 J;  2DPD A;  3S32 A;  4E7Z A;  2OQR A;  2CQ7 A;  3BWG A;  3EET A;  1CF7 A;  3HKZ N;  1ETK A;  3I4N J;  2PMZ N;  4HA8 A;  1VFC A;  1WI3 A;  2KIF A;  2Y75 A;  1SMY F;  3K4L A;  2NVX J;  5E17 F;  4P1W A;  3CCV I;  1O4X A;  2KDO A;  2OUM A;  1TNT A;  2M8E A;  3KP7 A;  3WU0 A;  3KET A;  2P4W A;  5EZG A;  2OA4 A;  2DQL A;  3V42 A;  4C3H J;  4HDV A;  1HLV A;  4CXF A;  3GW2 A;  1F9N A;  5J4Y A;  1H88 C;  4F91 B;  1SD5 A;  1MBJ A;  1YG2 A;  3LOC A;  1NK2 P;  5FD5 A;  3GEZ A;  1IN7 A;  1IUF A;  5GP9 A;  1ZG5 A;  2IGM A;  5IPA A;  4NDL A;  2R7U A;  4MO7 A;  2K85 A;  4XKV A;  4M6Y A;  1BC8 C;  1ORK A;  3H9J A;  3GTO J;  1KQ9 A;  3OYK A;  1SFO J;  2BY3 A;  3F0C A;  3GTP J;  5B1B H;  3ESW B;  3KFW X;  3L7W A;  1GVD A;  4JX4 A;  2IEK A;  4EVI A;  3HKZ A;  2IW5 A;  1ZK8 A;  3AG3 H;  1G3W A;  3ZQC A;  1VF9 A;  2XGD A;  1S8N A;  2QSH X;  1QVU A;  3W6V A;  5EF6 A;  1X3W B;  1U8R A;  1A31 A;  3HBL A;  2L5Q A;  2LNB A;  5DTD A;  2ZB9 A;  2P7V B;  3PO2 J;  3DEW A;  3K4J A;  1UHM A;  1XPX A;  2VPR A;  3LNQ A;  3K4N A;  1Z77 A;  2HKX A;  4M6V A;  4HQE A;  2ZJ2 A;  1B9M A;  1UZC A;  1FBS A;  4HG2 A;  1PUE E;  2NVQ J;  2K5C A;  3V8J A;  5HDN A;  1OCT C;  1FT9 A;  3HOY J;  4BQO A;  4IRH A;  3OR2 C;  3SZP A;  3P7N A;  1W36 C;  4Q4Z F;  3WG9 A;  1U0J A;  2NS7 A;  2XVC A;  3CC7 I;  1HST A;  2Z9O A;  2VUM J;  3CD6 I;  2EIK H;  1S3J A;  2CG4 A;  2MW8 A;  3TDZ C;  2MLK A;  3K9T A;  3S2H J;  1IZ1 A;  5E3L A;  4ENM A;  1B4A A;  4CIC A;  1VQP I;  2XF6 A;  3ERM A;  2DT5 A;  2HFH A;  5GTH C;  3S3O A;  4A0Z A;  1GUU A;  3FF5 A;  2VOO A;  3G3Z A;  5K7F A;  3H5R A;  4BBR J;  2YX4 A;  2LY1 A;  3H92 A;  5HOO A;  2R7S A;  2ZFW A;  1LE8 A;  2QF7 A;  2OZU A;  5F27 A;  1RR7 A;  1YIJ I;  5AIP A;  3GZ5 A;  3G1L A;  1K4T A;  2HOT A;  2FE3 A;  2ECC A;  2IS6 A;  2FX0 A;  4DBR A;  3DEE A;  2FD5 A;  5D5W B;  4P9U A;  4FHT A;  1VZ0 A;  3CLO A;  1FOW A;  2QVO A;  4RGS A;  1UMQ A;  1K4S A;  2KMU A;  5D5X B;  5TGT A;  4D7M A;  1PP7 U;  1WRJ A;  3V7R A;  1IRX A;  5JHF A;  3S14 J;  4DOZ A;  3S2D J;  3DTI A;  2DBB A;  4PFO A;  5J1R A;  2M0C A;  1S29 A;  5IOY A;  1LVA A;  3DWL E;  5HS8 A;  3GBG A;  4DYR A;  1O3R A;  1FSE A;  2MD5 A;  3DKW A;  3RPQ A;  4B47 A;  1WVR A;  3M07 A;  3FIW A;  1EH7 A;  3ELK A;  1PP8 F;  4AD9 A;  3HEF A;  4FET A;  4I01 A;  4BXU A;  3OMY A;  3RI4 A;  2LY9 A;  3W6J B;  3VOE A;  3CCR I;  3HPH A;  2NYX A;  3BP8 A;  3C2G A;  1MH3 A;  3CCE I;  4RBO A;  1A36 A;  1QA6 A;  3HOX J;  4A3F J;  2DMN A;  2F5C A;  2CSO A;  2ZXH A;  3K2Z A;  3Q9S A;  2BVL A;  1T2K A;  4D5C A;  1YE9 A;  4NC8 A;  1GT0 C;  3I59 A;  2WB1 A;  2EK5 A;  1GV5 A;  3AG1 H;  1HCR A;  4FT8 A;  3RYR A;  2E2I J;  2XGX A;  1YW8 A;  1POG A;  5M5X J;  1OR7 A;  1MGT A;  1X1D A;  5F1J A;  4BJT A;  3W3C A;  1F5T A;  4UV8 A;  1HF0 A;  1TT0 A;  2HYG D;  5LRR A;  1LDK B;  2MA3 A;  3HSF A;  3BR3 A;  5FKO A;  4ZYD A;  2XIG A;  1K6O A;  2NAZ A;  5FLV A;  2FSW A;  3OIQ A;  4BL0 B;  2K9L A;  1R1T A;  2IA1 A;  1W4M A;  2KJB A;  1L0O C;  1BR4 A;  2V1N A;  2XGC A;  1EA3 A;  4KA4 A;  2DU9 A;  2XPW A;  5EYR A;  4M73 A;  1A6I A;  1Z1D A;  2O0Y A;  3WU1 B;  1LFB A;  2LF8 A;  4EM0 B;  1YIT I;  1DDN A;  1HXD A;  3OWT A;  3OIP A;  3OYB A;  2I8D A;  3D5L A;  5E3N A;  4HSR A;  1I6H J;  3BG9 A;  2XUB A;  3HL2 A;  2FML A;  1SAU A;  3FWE A;  1G4D A;  1X2N A;  1IO2 A;  4LFU A;  4RB1 A;  1GVJ A;  2YU3 A;  2Z16 A;  3HUG B;  2EPF A;  2M9H A;  4ZH4 F;  1LEA A;  3DLA A;  4ZJZ A;  5K5Q A;  2WTE A;  5LEJ A;  3S15 J;  1W5T A;  2LBF B;  1DP7 P;  5J3L A;  2ZSI B;  2VBW A;  4WXC A;  4XRS G;  4KNY A;  4CSW A;  1VQK I;  5HS7 A;  3G71 I;  4E7S A;  3BZK A;  1R5G A;  3LA7 A;  3PNY A;  2FNA A;  4ITV A;  2R5Y B;  1MH4 A;  2ME0 A;  4NQW A;  2ZSH B;  3MKW B;  2CV2 A;  1TW3 A;  5IP7 J;  3ZXS A;  4IHX A;  1N78 A;  5CVI A;  2O8K A;  3L2Q A;  4KFC A;  2QGU A;  2KKO A;  3KP3 A;  3QYB A;  5EG0 A;  1J2X A;  5BMZ A;  2KZG A;  1YRN A;  2LBF A;  2DA7 A;  3PQJ A;  2PJP A;  1I6X A;  2K9M A;  1A35 A;  5FRO A;  4DYC A;  1AKH A;  5KK1 A;  1UAA A;  4PJJ A;  3ZQG A;  1T0F A;  1WH5 A;  2J5P A;  3U21 A;  3AKZ A;  1FLI A;  3ABK H;  1IJW C;  3OYL A;  4XLA A;  4GFB A;  3H0G J;  3QRF F;  3BY6 A;  2DA1 A;  1TWF J;  3EQL F;  3JW4 A;  3VDX A;  5C3E J;  4PFP A;  5EJC A;  2M2E A;  5D6F A;  5TJJ A;  3VYU B;  1Z9C A;  4U0V A;  5FFZ A;  2QQA A;  4BJ5 C;  1I1S A;  1B9N A;  3F22 A;  4A3I J;  1EH8 A;  4PUS A;  1R71 A;  4KN7 X;  2IAI A;  3MCZ A;  1SD4 A;  5F6F A;  4KYW A;  2M7A A;  1V5E A;  2PJR B;  3ZMZ A;  1BW5 A;  2ZME C;  3GUD A;  2E5Z A;  4D7N A;  5CJ9 A;  1X1C A;  3DKX A;  4XK4 A;  5EEG A;  1U2W A;  2YSR A;  4IX7 A;  3I64 A;  3QYF A;  4WXH A;  3F8N A;  4A5N A;  2HPM A;  1N25 A;  1WFX A;  3K4K A;  3G1O A;  3VB2 A;  3TED A;  1HDD C;  1ETO A;  2H1K A;  2KL4 A;  3EYI A;  2B0L A;  3GLX A;  1P7J A;  5DUI A;  4I76 A;  1BBY A;  1MMG A;  1ON2 A;  2W00 A;  1JUP A;  4G6T B;  3RKY A;  4S0H B;  5KHD A;  1LFU P;  2E2H J;  2PQ8 A;  3C2B A;  4WXD A;  3PO3 J;  5FB2 A;  1MJB A;  1ZGA A;  3HGG A;  3IUO A;  4A3C J;  3MZ8 A;  4XN3 A;  2XF5 A;  1ETW A;  3ZMD A;  3IWF A;  1Z67 A;  3V7C A;  3HRM A;  3JCU C;  2IGN A;  1U5T C;  5ILS A;  3CJQ B;  2CFX A;  3WE2 A;  1YO5 C;  2LYC A;  4UUT A;  2JVH A;  3JRH A;  1I27 A;  4IJA A;  3IAS 2;  2VE8 A;  4HAM A;  5C4X J;  3HRS A;  4KIG A;  3IH3 A;  2MD0 A;  4A3E J;  1VQ5 I;  1SVO A;  4Y13 A;  3GTJ J;  5ICF A;  1SC7 A;  3CME I;  3BPV A;  1FZP B;  3K4B A;  5CQG A;  1WJC A;  2NS8 A;  4NC7 A;  2XHK A;  4M9X A;  5A2Q Z;  2JA5 J;  3K2A A;  3HDD A;  2NVT J;  2LLK A;  4HZF A;  4HV5 A;  3TP0 A;  5E20 A;  1W7P A;  3GZN B;  1T08 B;  3I3L A;  1H8A C;  1R36 A;  1E3P A;  1XX5 A;  3ERE D;  3G4S I;  4F55 A;  1ZR2 A;  1A5J A;  1LVK A;  4R79 A;  5K7H A;  3TP3 A;  4W97 A;  3AFH A;  2VLA A;  1P4W A;  2DA6 A;  3ABT A;  3BQY A;  1G8X A;  1R5I D;  3M3Y J;  4AWX B;  4V2G A;  4BDY A;  1U6G A;  3P9I A;  1MJA A;  3VFZ A;  1I3Q J;  2BW3 A;  1HQC A;  2MG4 A;  4KMU X;  3C7J A;  4RAF A;  3GFI A;  1JI8 A;  5IOZ A;  2RC4 A;  3J7Z I;  2JA6 J;  4X0G A;  3KX2 A;  5LGN A;  2LD5 A;  3ZMU A;  2OJE D;  3FMS A;  1R58 A;  2R4G A;  1RRJ A;  2R5Z B;  1K78 A;  5FKM A;  1CQT A;  4EJT A;  2MH2 A;  1MW7 A;  4YFX F;  2K40 A;  2VBZ A;  4EM2 A;  4UVB A;  3FZV A;  1PJR A;  2HVQ A;  2XRO A;  1IG7 A;  3CCQ I;  4M6X A;  1RUO A;  5LLQ A;  3RQI A;  3RPU A;  3B73 A;  2IP2 A;  2RGV A;  3VYS B;  1S7A A;  4HW0 A;  5JFR A;  1ZN2 A;  2KRF A;  3K4M A;  2MSY A;  3PJR A;  3J80 Z;  3A0H C;  2ZXW H;  3CCM I;  1BIA A;  6PAX A;  3GTQ J;  2XB5 A;  2ECB A;  2VBX A;  2DA5 A;  2F5D A;  1JKQ C;  3IC7 A;  5E79 C;  4ASN A;  1X58 A;  3OYG A;  3DBR B;  1DUX C;  3S16 J;  5HS9 A;  1YQA A;  5C4J J;  2OQG A;  4IZZ A;  3OYN A;  3OSG A;  1B8I A;  4UUV A;  2L0K A;  1R49 A;  3A2K A;  4ZDP A;  1FNN A;  2OF7 A;  5E3M A;  3MFK A;  4EAT A;  4BDZ A;  4LLN A;  1JHH A;  2RNJ A;  4HF2 A;  1EF4 A;  5LD2 C;  5L3C A;  4KIF A;  5HDG A;  2W4S A;  1HKQ A;  3FXM A;  2XAU A;  3KYL A;  3GTM J;  3FXU A;  4QSH A;  5GAH J;  4XNF A;  4ZYE A;  3JRI A;  1B72 B;  3CZ6 A;  1YW7 A;  4HDU A;  1C0W A;  1JKP C;  3PFI A;  1IN8 A;  1D0Z A;  2CQQ A;  1YX3 A;  2BXY A;  3JRB A;  1P7I A;  2FXA A;  1KZH A;  3QYE A;  2DPU A;  3UKG A;  2EQR A;  3SEQ A;  1O7L A;  1AKH B;  4LG0 B;  4ZYG A;  2QYO A;  3R60 A;  1XN7 A;  1WCM J;  1Z05 A;  3F21 A;  3A02 A;  4KIB A;  1D5V A;  1S5L C;  3S1M J;  3RIR A;  3OOP A;  4W1U A;  2PLY A;  4MLO A;  4J01 A;  3H3U A;  2STW A;  2JSP A;  1OCO H;  4XOR A;  2ZC2 A;  1Y1W J;  2VOP A;  2CUF A;  4Y17 A;  4I6Z A;  5E8I A;  1J0R A;  4HF1 A;  5TIS C;  1RPW A;  4MFD A;  3AL0 B;  1OCR H;  1X3U A;  3FK6 A;  3HOZ J;  2VKV A;  3CJN A;  2R7T A;  1EV7 A;  4B3X A;  3KE2 A;  2E7W A;  3P9K A;  3BCA A;  3LSI A;  5FRM A;  1BOB A;  3SFZ A;  3MN2 A;  5DCM A;  3WGG A;  3LST A;  3KP6 A;  4KIC A;  4O6J A;  4CZZ A;  2CMP A;  5J4V A;  1YJN I;  4WWC A;  3F23 A;  5K7Z A;  2PI0 A;  3KLO A;  2B7E A;  4N0B A;  2DAO A;  2K27 A;  1M1E B;  2QUF A;  4WF2 A;  5AIQ A;  5FFX A;  4WCG A;  5IP6 A;  2VIX A;  3LSG A;  3OYF A;  4YII A;  3WU2 C;  2R7V A;  1W7P D;  3F8F A;  2XAQ A;  2WAD A;  2CRG A;  2MFZ A;  2ME6 A;  1IV8 A;  4U88 A;  3UR3 C;  2R92 J;  2VL8 A;  1I39 A;  4YEL A;  2WAF A;  4K2E A;  2DN0 A;  2DO7 A;  1ZRE A;  4BXX J;  2MGQ A;  4CUG A;  1ZRF A;  4C2T A;  5E18 F;  5BPD A;  1QU3 A;  1TZL A;  2ISZ A;  3TO6 A;  4XON A;  4Y4R A;  3G1M A;  2P5K A;  2FNP A;  3RQ4 A;  3GTL J;  2Y48 A;  3MWM A;  1FOX A;  3ZOB A;  2HGC A;  3LA3 A;  1FP1 D;  2ZJP F;  3F6O A;  5JR3 A;  3NWT A;  1MBH A;  1X1P A;  2DW4 A;  1S72 I;  4IKF A;  3CQZ J;  1YI2 I;  3KP2 A;  1A6Q A;  2UUZ A;  2CS3 A;  2DDA A;  2IA2 A;  2XAJ A;  3B6C A;  3DFG A;  3Q3S A;  5BQT A;  3KLN A;  2VJ5 A;  3BG7 A;  2JA8 J;  5ICC A;  1WWX A;  2JMW A;  2JRM A;  2GXG A;  2RNG A;  5FLX K;  4D9J A;  5JI6 A;  4PJM A;  4A0Y A;  2VE9 A;  2Q2E B;  2PG4 A;  3J7A Y;  1G3S A;  3BC8 A;  2NS0 A;  2ZNZ A;  2W57 A;  2R7W A;  2MAB A;  3VSK A;  4CCM A;  4A69 C;  4GCV A;  1Z21 A;  1XB4 A;  1KU3 A;  4U0Y A;  4IRG A;  4D5F A;  5DDG A;  2XAH A;  2HXI A;  3LSR A;  4YRV A;  4LMY A;  3ONQ A;  4ESJ A;  1OQY A;  2G7U A;  4EV0 A;  2JUC A;  1Z7U A;  1VI0 A;  4B43 A;  3L09 A;  1YJW I;  3CES A;  2YR2 A;  4M3G A;  2ICW G;  2B63 J;  5H2F C;  5ILV A;  5H6Q A;  2NVU B;  5F0F A;  4JQF A;  4XLF A;  3A01 B;  4L0Z B;  2UZK A;  2E1M C;  2DYR H;  1E17 A;  4HLY A;  3I54 A;  1UJ8 A;  1QPM A;  1BOA A;  4U87 A;  1IV6 A;  1T38 A;  1BL0 A;  4QIW N;  1FYK A;  1GLN A;  2Z99 A;  5CYV A;  2BW3 B;  1W36 D;  2E5N A;  3K70 C;  2O3F A;  4LD5 A;  2H6C A;  4L18 B;  5B1A H;  2L4A A;  1JT0 A;  3I0T A;  4X6A J;  5FKK A;  3H35 A;  4FX4 A;  5EEA A;  4H4K C;  2IGK A;  1MMA A;  4UV9 A;  1V55 H;  4UVC A;  4Q47 A;  2BGC A;  4BE2 A;  1Z3Y A;  4Y7N J;  4ON0 A;  2WWY A;  1UFM A;  3HTU A;  1KU2 A;  1NHA A;  1Z3X A;  1QPI A;  2EFQ A;  4BAY A;  4PJL A;  1WJA A;  3L00 A;  2H27 A;  2RVC A;  1BI2 A;  2Y2Z A;  2GA2 A;  1YS6 A;  1O7F A;  3H9Q A;  4OIQ F;  3DU5 A;  2AHQ A;  2CUE A;  3S93 A;  1SVL A;  1XTA A;  2EWN A;  3ZCO A;  2ETH A;  4IPA A;  1SD7 A;  2AO9 A;  2DOD A;  2KDZ A;  3T5X A;  2EFP A;  2A6H F;  2UXN A;  2FBK A;  2F4I A;  5LRS A;  3T8T A;  3PM1 A;  2Y0S N;  4LK1 F;  4CZC A;  3CCY A;  3MZY A;  3QOD A;  2X85 A;  1FBQ A;  3E6B A;  2QWW A;  3LL7 A;  4I98 B;  4HV6 A;  1H9T A;  3S8P A;  2LF7 A;  3U2R A;  3BR2 A;  5HLT A;  2HYJ A;  3EYY A;  1X19 A;  2Y30 A;  3RZO J;  3E6D A;  2EIJ H;  2FA5 A;  2P6S A;  4EJV A;  2GQQ A;  3LWF A;  1XCB A;  4KN4 X;  2CUJ A;  5CPR B;  2XRL A;  4G8X A;  1P4X A;  2QKL B;  1BR1 A;  4MQ9 F;  2BXZ A;  1T8I A;  2VJJ A;  4XRS A;  5D4R A;  3I59 B;  4A2U A;  4CCL A;  2JA7 J;  2V7F A;  2VC1 A;  1F1Z A;  3BG5 A;  2G9W A;  3KEY A;  5DM6 F;  3D5S C;  1SVM A;  1HBX G;  2L4M A;  4AVZ A;  2R0Q C;  2BHZ A;  4FIS A;  2RQQ A;  5E3O A;  5DCM B;  1B1B A;  3QAH A;  4O5V A;  2RN7 A;  3E5U A;  2NOJ B;  4JK1 X;  2BOL A;  3TW6 A;  3OYE A;  3S1Q J;  3RPU D;  4U7B A;  2HVR A;  4B1R A;  3MKL A;  5CQE A;  2KIQ A;  1VQL I;  2V26 A;  3BR1 A;  3F8M A;  1MND A;  2O5R A;  3I53 A;  2K7L A;  4ANJ A;  2M0M A;  2AS5 F;  1D3Y A;  1D1C A;  1Z91 A;  2L3D A;  2F5F A;  3HM5 A;  1D1B A;  4RM2 A;  1TWH J;  3I55 I;  2GA1 A;  4G9Y A;  2LFB A;  2AQE A;  3IRQ A;  2LTP A;  5EDN A;  2P8T A;  2V9V A;  1DP3 A;  2M7B A;  3CP2 A;  1MMN A;  3FXK A;  2P7C B;  3OIO A;  3TL4 X;  1OYY A;  2VT2 A;  2XPV A;  4CYC A;  2ZME B;  1OCZ H;  2V9K A;  2FUG 2;  2WAQ N;  4BHP A;  2EV6 A;  4RAG A;  3V8L A;  1LUJ B;  1LKX A;  4YIR X;  3B6A A;  4BGD A;  4LG3 A;  2QQ8 A;  2VKE A;  4N4N B;  2KIS A;  5IT3 A;  4N4O B;  4WK8 F;  5BS6 A;  3O6B B;  4ESF A;  1D0Y A;  1K83 J;  4BEH A;  1FWZ A;  3R0J A;  1FC3 A;  2M30 A;  3GF2 A;  2QQB A;  4LGW A;  4XBF A;  3ZR8 X;  1JGG A;  4CHU A;  1KQ8 A;  4CYD A;  2W7N A;  1BI0 A;  2FF4 A;  2E1N A;  2FQ4 A;  4I99 C;  4A3J J;  2CYY A;  2OU2 A;  3GTK J;  3RKX A;  4FTH A;  1IXS B;  4UUS A;  4CDG A;  2F5V A;  2HQ5 A;  2PMU A;  4LOC A;  4B09 A;  1ETY A;  3TBI A;  1BI1 A;  3M9A A;  2EFO A;  2CW8 A;  1RIO H;  3WTU C;  1TNS A;  1U5T A;  4XIC A;  3TO9 A;  3BTI A;  1UCR A;  3DBH B;  4NC6 A;  2BHY A;  1VQO I;  1S7O A;  3CUQ A;  4DGW B;  5ERI A;  3FX3 A;  1K78 B;  1R00 A;  1XGN A;  2EV5 A;  1YYV A;  2LC2 A;  4ZDL A;  4L9V A;  1VTN C;  2A3S A;  4UUS B;  1R23 A;  4CCK A;  2Y9Y A;  2HVS A;  2MC3 A;  4AIH A;  1IDY A;  2CQN A;  1OPC A;  3RYP A;  5FLX Z;  2ESN A;  2VC0 A;  4UHT A;  2JPB A;  4JX5 A;  3C1D A;  4XSX F;  3DCF A;  4IF4 A;  1W0U A;  3DLL F;  3QPT A;  5FLM J;  1JKR C;  1SD6 A;  4OIN F;  3ZP5 A;  1BI3 A;  1N77 A;  5B3S H;  4C2U A;  3HTS B;  2I5U A;  4BNC A;  1TTY A;  4OMY A;  2XAS A;  3RTR A;  1H89 C;  2GBY A;  5EGO B;  2O6G E;  5JVT A;  1BW6 A;  1SAN A;  2ZCW A;  3CC2 I;  2BV6 A;  4HF0 A;  4HOB A;  1NTC A;  3CP8 A;  3TW7 A;  4BS9 A;  2DFF A;  3E6M A;  3IHU A;  1ONV A;  3HOT A;  2DXI A;  3WTV C;  3VYT B;  1V5G A;  2EV0 A;  4C30 A;  3E97 A;  2K4J A;  4MFE A;  3L2W A;  3OYA A;  1OIS A;  2JSC A;  1R6R A;  3KEO A;  4ABZ A;  3BTJ A;  4PGH A;  2BY1 A;  2M8G X;  4HRI A;  5DS9 A;  2W82 A;  1JGS A;  2VKH A;  3QPS A;  4XOT A;  1MSF C;  1X3Z B;  1PVE A;  1JKO C;  2L7F P;  1RET A;  3FXR A;  4XLH A;  4A6E A;  2ELJ A;  1DU0 A;  4ZDO A;  1P6R A;  3KZY A;  1ZLK A;  5K5O A;  3R4K A;  2QLZ A;  3GFJ A;  4GYG A;  3COA C;  1CF7 B;  3ASN H;  1NK3 P;  4L0Y B;  3WTY C;  4D0P A;  1V5F A;  3AAF A;  2DFE A;  2BE5 F;  4C3J J;  4AIJ A;  5LHH A;  2V79 A;  3BCB A;  3LSP A;  2O7O A;  3WG7 H;  4ESB A;  1PYV A;  3VEP A;  5K1Y A;  2QBY A;  2XGE A;  3SEZ A;  2HEO A;  4OIR F;  1VQ9 I;  4HBL A;  4BKX A;  5D5U B;  3P9C A;  1YOV B;  1R1V A;  2JRT A;  4QLC U;  1AU7 A;  3IRR A;  4Y15 A;  3DPL C;  2D1V A;  2EJR A;  4P9F A;  1IRF A;  1P9Q C;  3HOU J;  1X4P A;  1MMD A;  3WTZ A;  3TQN A;  4Z6Y A;  4CCJ A;  3JRA A;  1FBU A;  3OL4 A;  4AC0 A;  4IOA F;  2KJC A;  4PDK A;  4F92 B;  1T39 A;  1G59 A;  1EJ9 A;  2RAE A;  1OR7 C;  4B48 A;  3JTG A;  2KZV A;  2P5V A;  2M87 A;  3SXY A;  4U7D A;  3ZMS A;  3L1P A;  2NOG A;  4A5M A;  5GAD J;  1I50 J;  4XLN F;  4XLP F;  3FXQ A;  3CC4 I;  2DOE A;  4Q5S F;  3OS0 A;  3CO6 C;  3PNV A;  3HUG A;  4B3A A;  4OAY A;  2YPR A;  2K9N A;  3F72 A;  1RC9 A;  2VT3 A;  2W24 A;  2OTL I;  1RI7 A;  2W85 A;  1K79 A;  1PDN C;  3BTL A;  2VJ4 A;  3RCO A;  4XSZ F;  3ZMT A;  2IPQ X;  1TL8 A;  2XAG A;  3FDY A;  3M8E A;  3QWL A;  4ENJ A;  1ZG3 A;  3BT9 A;  1P2F A;  2WB1 N;  3GCM A;  3PL8 A;  2F48 A;  4U0W A;  2DI3 A;  3IV5 A;  1KYW A;  2VJI A;  4IO9 F;  2FRH A;  2JUG A;  1JT6 A;  2JZY A;  3M8J A;  3D0S A;  2M34 A;  3LSH A;  4JYK A;  3JRF A;  3ZQL A;  1XMA A;  5DM7 F;  2HR3 A;  1JJ8 C;  3SZG A;  4UB8 C;  3DTK A;  4DIQ A;  3FBI B;  3VSL A;  3JRD A;  3JTH A;  2LK2 A;  1F43 A;  2ID6 A;  4E7L A;  1TBX A;  4M71 A;  4I0B A;  1G2H A;  1DPR A;  2Y0M A;  2PJR A;  2CJJ A;  2YS9 A;  2K3P A;  1VQ6 I;  4OIO F;  5TRD A;  2OCC H;  2WV0 A;  4EJU A;  1HKT A;  4RB2 C;  1U3E M;  3GTG J;  4EGZ A;  4HQM A;  5BOX A;  2L9V A;  5EZH A;  3T1B A;  1IRG A;  1U78 A;  2HXO A;  3IKV A;  2H94 A;  1WKM A;  2QSF X;  1OJL A;  3BR5 A;  3TOA A;  3L9F A;  2ID3 A;  4FAS D;  4BE0 A;  1GXP A;  4CH7 A;  1IUY A;  3JAM K;  1V4R A;  4KIS A;  4B44 A;  4L9J A;  1Q1H A;  1TT5 B;  1JTX A;  2OCE A;  2XDV A;  1RES A;  4N9I A;  4P55 A;  4I02 A;  4Y52 J;  1HA8 A;  3IH2 A;  1OCP A;  3A0B C;  5D5V B;  2R93 J;  2Y31 A;  3TKY A;  3KIO A;  3L2U A;  3GFL A;  5DUK A;  1VQ4 I;  1T95 A;  2JWT A;  4XMY A;  1O3Q A;  1P4A A;  1BJZ A;  4CCN A;  3S1N J;  2CGP A;  5E1W A;  3MEX A;  1S6L A;  2CU7 A;  4NNJ A;  4FE7 A;  3E0J B;  1FIA A;  4A3G J;  4NQW B;  1LEB A;  2QA4 I;  3K0L A;  4PK4 A;  3RKQ A;  1TLH B;  3DEU A;  5D8L B;  1B72 A;  3RZD J;  2XB0 X;  1D0X A;  5D4S A;  3NWS A;  2TDX A;  2L2O A;  4L5J A;  4C2M J;  1BC7 C;  1ZRD A;  2ELH A;  4IQ4 A;  4PZJ A;  3ZQ7 A;  1LQ1 A;  1G3T A;  1ERD A;  5IYC J;  3ZQI A;  1IXR C;  3ZQH A;  2DCE A;  3F8C A;  4J00 A;  2O61 A;  3IP4 B;  1HW5 A;  3GYH X;  3MAJ A;  3MD2 A;  3J81 K;  4LLL A;  3WGH A;  1ITY A;  1ZYR F;  4JP0 A;  2FOK A;  1UEL B;  2LRE A;  1I5Z A;  2IA0 A;  3LSK A;  2DA2 A;  2CFO A;  2HZT A;  2X51 A;  4S05 A;  1ODD A;  1J7K A;  5IYD J;  1QQI A;  1RNL A;  2WA0 A;  2K3F A;  2K9S A;  4ENN A;  2VB6 A;  3BR0 A;  1LDJ A;  4XN0 A;  5ED4 A;  1SMT A;  1ZGW A;  4NBQ A;  2P0W A;  5JVG F;  1Y39 A;  3CCU I;  3I5U A;  3I71 A;  2LDU A;  3Q9V A;  4XLE A;  3BG6 A;  3JSP A;  2A05 A;  2F5E A;  4KT5 C;  4UNO A;  4EGY A;  1IGN A;  2MLG A;  3EUH A;  3ZRG A;  4M9S A;  1Z6T A;  2F2E A;  2VKD A;  2X6W A;  3V4G A;  1AWC A;  4A3B J;  2E34 A;  4BY7 J;  1B6A A;  1XMK A;  2GM4 A;  3ECH A;  1YW9 A;  3EUK L;  3HGY A;  2LRD A;  1EKE A;  1ETQ A;  3OS1 A;  3PIO F;  3CF5 F;  4AM3 A;  5D8K B;  4HLX A;  2M5W A;  3T8R A;  1SFX A;  2W84 A;  2I10 A;  4JX6 A;  3GO5 A;  3NEU A;  4AIK A;  1L3L A;  1NH3 A;  3E5X A;  3DXJ F;  2O8X A;  1ZEL A;  3SFI A;  1FIP A;  1BA5 A;  2Y69 H;  3K6G A;  4EMS A;  1T0F C;  2CO5 A;  3PQK A;  2FEZ A;  3PUF A;  5EG0 B;  2L9S A;  3BJ6 A;  1RKT A;  5ICE A;  3ULQ B;  2LH9 A;  3DPU A;  1ETX A;  3KYD B;  4KJZ A;  2L02 A;  4MEX F;  4M3B A;  3RKW A;  1DQU A;  2G0E A;  2DFI A;  3HB9 A;  2K4B A;  4I2O A;  2W1O A;  3BPX A;  3QPH A;  3U9G A;  1PUF A;  3LSM A;  3J7A O;  9ANT A;  2DJN A;  3FK7 A;  2R7X A;  2Q8K A;  1U9N A;  2E1O A;  3PSF A;  2OTJ I;  2FJ1 A;  1ZLJ A;  4EJW A;  3HOS A;  3IH4 A;  3VYR B;  4EJO A;  1MBF A;  3M4O J;  3J7Y J;  5HNH A;  1FPQ A;  2QM3 A;  3B02 A;  4LIT A;  1WJB A;  4WX9 A;  3FXO A;  1IN5 A;  1X1B A;  3WTT C;  4V2F A;  4G7O F;  1ACI A;  3MZH A;  3N4M A;  2CH0 A;  1QHH D;  3EPZ A;  3R6S A;  1FOY A;  2VXZ A;  2IS2 A;  4Z2Y A;  4M3E A;  1TWA J;  3HPG A;  3OSF A;  3K70 D;  3GZ6 A;  2Q0O A;  2COM A;  3PNT A;  4AYB A;  2ZXJ A;  1FP2 A;  1GDT A;  2GZW A;  5E8G A;  4H0E A;  1MNM C;  3RDI A;  2OC6 A;  2NNN A;  3FMR A;  4CO8 A;  2CV1 A;  3LQQ A;  1JUM A;  3OV8 A;  4MQV A;  1NG7 A;  2XPU A;  4IEJ A;  4X1E A;  4AVP A;  1QGP A;  2KPM A;  1QNT A;  4F7Z A;  3EDP A;  3U1D A;  2JPC A;  4IHS A;  2D5V A;  2VQH A;  3ISP A;  4BHB A;  3SHF A;  4KUM A;  3BTC A;  4DQ2 A;  1Z6R A;  2JQ7 A;  5GAE J;  4Y33 A;  1XD7 A;  3FMQ A;  1I3A A;  1R5H A;  1QZE A;  1E3H A;  4IVN A;  1RZ4 A;  2DMQ A;  2AXL A;  1OFC X;  4CYC B;  3WOD F;  2HNH A;  2BY0 A;  4ZZD A;  1OYI A;  3BQZ A;  1YLF A;  2V4J C;  1WH7 A;  2ACJ A;  3IL2 A;  2EZK A;  2V9P A;  5KAI C;  1FJL A;  4RAY A;  1UHS A;  4TV7 A;  5EGO A;  3CO7 C;  1WJD A;  4GRI A;  4F93 B;  2P6T A;  4A3K J;  1GHC A;  3F9K A;  1FYM A;  3I4M J;  2BY2 A;  2HOA A;  4DZP A;  2RRE A;  3N97 A;  3FBN B;  3Q0V A;  3HC7 A;  3ML6 A;  4L5E A;  1TC3 C;  1X1A A;  4R1H A;  1SFE A;  3QP5 A;  3CDL A;  5GPA A;  1IF1 A;  1KGS A;  1HKS A;  2W25 A;  2RV8 A;  3H5A A;  3RJP A;  1KU9 A;  1WJE A;  3OYC A;  4LJZ F;  3SQN A;  5K5R A;  3HSE A;  5CVJ A;  2JA2 A;  3T0Y A;  1FTT A;  3VWB A;  5DD8 A;  2MYS A;  1QZY A;  2NNY A;  4IQJ A;  2QEN A;  4RA2 A;  1R7J A;  4G12 A;  5L3F A;  4HNV A;  1MKM A;  2HQN A;  3CLQ A;  4YFN F;  3H36 A;  1VND A;  4GDF A;  2F4M B;  1IN6 A;  3E1S A;  2N8G A;  2LSO A;  1T33 A;  3E3V A;  4L9T A;  2V6C A;  5IYB J;  2HDD A;  2XF7 A;  2XSJ C;  2TCT A;  1O57 A;  5CVV A;  1WHU A;  5FKN A;  2WV1 A;  3K1P A;  4B4C A;  4OWR B;  3HYI A;  2E19 A;  4GO1 A;  4RM3 A;  2D45 A;  4LK0 F;  4OIP F;  3EUA A;  1J09 A;  1Y8Q B;  4BEH B;  2ZJR F;  2XSD C;  1Y6I A;  4HX8 A;  5CKT A;  4QPQ A;  3CMM A;  1F4K A;  3AL0 C;  1FMW A;  1MD0 A;  4HX4 A;  1G6N A;  3Q0W A;  2VPL A;  1E2X A;  1VQM I;  3ABU A;  1WZ2 A;  1Y8R B;  2VQG A;  1KON A;  1JHF A;  3JRE A;  1U8B A;  4OAZ A;  2X4H A;  2LMD A;  2HDC A;  1XSX A;  3L2R A;  4G6Q A;  2QBY B;  4PJN A;  4AUX A;  5HOD A;  3GVA A;  4CA0 A;  1IRZ A;  3F8B A;  3MMY B;  5HDK A;  4M3F A;  4BE1 A;  4FQG A;  1U5T B;  2KLO A;  2ZJQ F;  1OCC H;  3M1E A;  4MEY F;  2DYS H;  4ZYA A;  5BNG A;  2ZFU A;  4F52 A;  2EIM H;  2GOM A;  5ICG A;  3ASO H;  5J8F A;  3HOV J;  2E2J J;  2EZH A;  3OL3 A;  1HW2 A;  3PUB A;  4XQF A;  2DOA A;  1VQ8 I;  1TQM A;  3CUQ B;  1ON1 A;  1FMV A;  3MKZ A;  3ZQF A;  2VQC A;  2XV4 S;  2A6E F;  4LLG F;  5E1X A;  1MDM B;  5IT9 Z;  5B5E C;  4RDU A;  1UST A;  1KQ0 A;  4EM1 A;  2F4O B;  3GLL A;  4BJ6 C;  3K7A J;  3CMY A;  3NAU A;  2QCO A;  1XGM A;  3S2W A;  2QEX I;  5LHI A;  2KHM A;  2COB A;  3JRG A;  2CW0 F;  3KYC B;  1I1G A;  3CF2 A;  3OY9 A;  4L5I A;  1FOK A;  5HLI A;  1LNW A;  2Z3Y A;  4LB6 B;  2L01 A;  2ELK A;  3FXJ A;  2IXS A;  3WTW C;  4M3D A;  3CCL I;  2F6C A;  1TQP A;  1XSV A;  2ESH A;  3HG9 A;  1XMX A;  1FY7 A;  3GFM A;  3CCS I;  2H8W A;  1H9G A;  2IGO A;  1BJA A;  2OPT A;  1WPK A;  2A6T A;  4LIU A;  5JLW A;  5CVR A;  2PX9 A;  3LAJ A;  1ZAO A;  1TQI A;  2ZNY A;  3W2W A;  4KMF A;  4DNC A;  3DPT A;  2BVM A;  4E4H A;  1ZKG A;  3TGN A;  1JTY A;  4I0A A;  5GPC A;  2VOD A;  3G6E I;  3OYI A;  4CCO A;  1MZB A;  3DF8 A;  3MVP A;  2IRF G;  2EH3 A;  4OMZ A;  4EQQ A;  3FKI J;  3CJR B;  1MBK A;  1E0E A;  1HOM A;  3KZI C;  3I56 I;  1APL C;  3HJE A;  2PMZ A;  1DGR M;  1E3O C;  1T56 A;  2DQR A;  2R7O A;  4ZC3 A;  3OS2 A;  3GX4 X;  2K86 A;  3A03 A;  3D1N I;  4ZTJ A;  3N05 A;  1ZHF A;  2XKP A;  5FGM A;  5H20 A;  2LVS A;  2EB7 A;  3RSN A;  2E36 A;  3O8G A;  4R8H A;  5LHG A;  3FM3 A;  4QWQ A;  1BIB A;  4XID A;  5M5Y J;  2E1C A;  2A5W A;  4ZYH A;  2WY8 Q;  4UB6 C;  1SFU A;  3ZMV A;  5IP9 J;  2HQR A;  5M3M J;  4PSX A;  1IC8 A;  2UV1 A;  2MC4 A;  1J5Y A;  3PIP F;  3SJM A;  5B66 C;  1WGX A;  1MBG A;  3R0A A;  2OD5 A;  2IT0 A;  3QU6 A;  3HSR A;  3NRV A;  5HVQ C;  5FO5 A;  1XSD A;  2YU9 J;  1ZR4 A;  1B59 A;  3QP6 A;  2HTS A;  2ZKZ A;  4JOM A;  4A3M J;  2A68 F;  3QOE A;  2H09 A;  4UY8 I;  2R7D A;  1UG2 A;  4V19 K;  4XRM A;  2IS1 A;  4XKW A;  1ENH A;  4S04 A;  3AG4 H;  1WJF A;  2W48 A;  1ETV A;  3EUH C;  2ZXI A;  4XL9 A;  1TP4 A;  3SYT A;  1D8K A;  3TOB A;  4I09 A;  2V6E A;  1YJ9 I;  3AG2 H;  1OYW A;  4YG2 F;  4NB5 A;  2X1C A;  3FHN A;  2GXB A;  3OOU A;  4L9N A;  5E1Z B;  1KA8 A;  4ETS A;  3BOQ A;  2DTR A;  4A0X A;  3O2P E;  3A4C A;  1QHG A;  1LPQ A;  3TO7 A;  4ZZL A;  2WAQ A;  2J5O A;  1Z7L A;  1K7A A;  2CV0 A;  4A6D A;  4IHV A;  3WE3 A;  4BHC A;  2E1M B;  3PFY A;  2OV7 A;  3PSI A;  2Z33 A;  1LB2 A;  2EFN A;  3G2B A;  1HC8 A;  1RKW A;  5HLH A;  4AU7 A;  2KT0 A;  3M8F A;  5CVU A;  4N9H A;  4NHJ A;  4M74 A;  4RGU A;  1JJ6 C;  1Y0U A;  3CUO A;  1R1U A;  2P81 A;  2X48 A;  1HSJ A;  3KPH A;  4XKC A;  2HU9 A;  1B8I B;  3E7L A;  3CUQ C;  3E6C C;  5KCM A;  1WI9 A;  1O3T A;  3F3X A;  4UVA A;  1ZGJ A;  2PFB A;  1QBJ A;  5CLS A;  2H1L A;  5KVR A;  2H8R A;  4LB5 A;  1S7E A;  4BH9 A;  3IAM 2;  2UXX A;  1P92 A;  2DLL A;  2Z2S B;  1UG0 A;  1QVT A;  3WGI A;  4IRI A;  2JTV A;  4IHY A;  2VXD A;  4KT6 A;  2XC7 A;  5L3D A;  2IBD A;  2KP6 A;  2QQ9 A;  1LE8 B;  2CWE A;  1AA7 A;  1J9I A;  2RQP A;  4XKB A;  2VAS A;  2OZ6 A;  3WHC A;  1ZQ3 P;  4BQQ A;  3DQV C;  1KU7 A;  4G7Z F;  3REO A;  3J80 K;  2ZBK A;  1GXQ A;  4J19 A;  3LFU A;  2HS5 A;  2ZO4 A;  4EEF G;  2RKH A;  3TMO A;  1FYL A;  1FTZ A;  1N75 A;  2HPI A;  1DPU A;  5BPI A;  2M4G A;  2X9D A;  2EZL A;  2PN6 A;  2HOE A;  2WC2 A;  2D1H A;  4MIM A;  4RLQ A;  1WQ2 A;  3JRC A;  3JR9 A;  3K10 A;  2DK5 A;  1F36 A;  2DMT A;  2RDP A;  5AON A;  5LFA A;  1DGW Y;  3HZJ A;  5IY5 H;  4LIV A;  3IWZ A;  2E7X A;  4G6D A;  2QSG X;  1MDM A;  3BR6 A;  2L9N A;  2K02 A;  4G94 A;  2LR8 A;  5D6E A;  3MQ0 A;  2IJL A;  2A07 F;  5LGU A;  3LSJ A;  3C18 A;  1REP C;  3BG3 A;  2E60 A;  3HIF A;  1V54 H;  4RAZ A;  4IL6 C;  2QKM B;  4DZJ A;  2HKO A;  1OKR A;  5JHU A;  2WAE A;  2ZME A;  3IKT A;  2DMP A;  3A1Y A;  3OYM A;  2JN6 A;  4KIT B;  2PEX A;  4E6K G;  1JXS A;  2IS4 A;  2CQK A;  5J47 A;  1FSH A;  2GLO A;  2GIV A;  2HTJ A;  4BAC A;  4XM3 A;  2R7R A;  3KZZ A;  1T98 A;  2M4K A;  3ABL H;  4Q48 A;  3BZC A;  4DBQ A;  3UNG C;  5A2Q K;  1TWC J;  2XRN A;  3C3W A;  2YUS A;  1H0M A;  1XDU A;  1O3S A;  1W5S A;  1MJ9 A;  2K9Q A;  4C3I J;  2GWR A;  2C6Y A;  3K69 A;  2L54 A;  1W7P B;  3W2A A;  1UHW A;  3CJT B;  4E7I A;  1NG6 A;  3BJO A;  4A3L J;  3M1C A;  2X6Y A;  2BYV E;  2JVG A;  4M72 A;  5DEQ A;  4PSW A;  1XGO A;  2HYF A;  1QRY A;  2STT A;  4A93 J;  2AQF A;  3H3Z A;  3ZN1 A;  4PCQ A;  2GOX B;  4I7H A;  2EFW A;  4HPQ A;  1VQ7 I;  2KRC A;  2DTZ A;  1QO0 D;  1YX5 A;  2Q2E A;  3Q0U A;  2JJ7 A;  3FKJ A;  4MTE A;  2JK3 A;  2DDB A;  5ILU A;  2D2W A;  2HDW A;  4RB0 A;  4ZTF A;  2CUZ A;  2YX7 A;  3QOP A;  5JLX A;  1ULY A;  1Y0N A;  3K1M A;  3H3V K;  2L7K A;  4PGG A;  2Y9Z A;  3K1N A;  1W5C C;  1EH6 A;  2LG4 A;  3GME A;  1ZTR A;  1XCV A;  1G3Y A;  1IW7 F;  3KP5 A;  3QU3 A;  4MNU A;  2X1E A;  4HEA 2;  1XDS A;  2EIN H;  2KQR A;  1AOY A;  1YTY A;  3DBL B;  1OMI A;  5FJ8 J;  2Y0S A;  4GYI A;  2HQA A;  2O9L A;  2DA3 A;  4DYQ A;  2CQX A;  3NQO A;  5GTI C;  1FX7 A;  4AID A;  1Y1V J;  3SZT A;  3L2C A;  1MMS A;  4YFK F;  5F0C A; 
#chains in the Genus database with same CATH homology
 2DYR H;  1V55 H;  1OCZ H;  5IY5 H;  2ZXW H;  2EIK H;  1OCR H;  2Y69 H;  3X2Q H;  3ABK H;  3ABL H;  1OCC H;  2EIN H;  3ASN H;  3ABM H;  2DYS H;  5B1A H;  3AG4 H;  2EIM H;  3ASO H;  1V54 H;  2OCC H;  5B1B H;  5B3S H;  2EIL H;  1OCO H;  3WG7 H;  2EIJ H;  3AG2 H;  3AG1 H;  3AG3 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...