5IYBO

Human core-pic in the open state
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
99
structure length
99
Chain Sequence
b'MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna
total genus 27
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02268 TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain
O PF02751 TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.190 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5iybO01
2.30.18.10 Mainly Beta Roll TATA box binding Protein, subunit D; domain 2 Transcription factor IIA (TFIIA), beta-barrel domain 5iybO02
1RM1B 5IYDO 5IYCO 1NH2C 1YTFD 1NVPD 5IYBO 1NVPC 1RM1C 1YTFC 1NH2D
chains in the Genus database with same CATH superfamily
2YIAA 2M6YA 4FLZA 2Q0OC 3B77A 4R7CA 1JPXA 3JD2A 1M1KW 2X0LA 3QVNA 2Q4PA 1TVKA 4DV1B 1K33A 3SPGA 1VQOV 1BHAA 4Q6GA 2LQTA 4GX5A 1K5SA 4JI4O 3EFFK 2IU3A 1XQ8A 3ICXA 4LF7O 2DWEC 1VEWA 4CS4A 3RYCB 1H8HG 4YJ2A 3U11A 2X6AA 2XT9A 3NR7A 3U0ZA 3CC7V 2JIZG 4DR6B 2QKAA 4DUZO 2N05A 3FFQA 4O4JA 4LC1A 2QEXV 3W7XA 4PA7A 1YDXA 4P30A 1EFRG 4TUYA 2JEXA 4DV5B 3F7YC 4B3MB 2YI8A 3F5WC 2XNDG 3S3XA 2GTSA 4QIWF 5LHGA 3AK3A 1M56B 4FM0A 1Y4MA 4JYAB 5FL7G 2IU0A 3JARA 3B4SA 4K8ZA 5IE9A 4KHPO 4JASA 4CS3A 3IGAC 5LA6B 4WBNB 3SDLA 3HKBA 5LHHA 3CCMV 1TUBB 2V1DA 3FYIB 1Y66A 3R66A 1HDJA 5DEDA 2GSMB 4NR1A 1N36O 1BT8A 4J42A 4LH7A 4X20B 5DN6G 4G2KA 4H37A 3CCVV 1OZ0A 3DSQA 2ADQB 2F43G 2CK3G 2NN4A 5JVDB 1IVSA 5KMGB 4QE9A 3OD4A 5EC2C 2DYRB 2OTJV 4MTGA 1U96A 3OFNG 5LYJB 1B6QA 2V4DA 4GX2A 2HHHO 3EVKA 1KP3A 2JGDA 3CMEV 2EILC 2ZE6A 3IFXA 1VMGA 4DK1A 3HKDA 3D36C 1JA8A 4X62B 2CE4A 1P49A 2ZDIC 1QBZA 2WLHA 3UO2A 2DYRC 2PGGA 1FYJA 3ETGA 4MS2A 4DUYB 1J95A 2KG7A 1TVKB 1IBKO 4NYKA 2YICA 1YCIA 4JTDB 1KU9A 3CB2A 3K58A 1K97A 5KHJA 2YXYA 1KUQA 3JD4A 3SR2C 1K5QA 3QNEA 4B3RB 2Y0IA 1U97A 4FLTA 3F5TA 5D5PA 1H2KA 4YJ2B 2F95B 1MG1A 3APQA 5CBGA 1XMQO 4DR6O 1VF7A 1KYOF 3JAMN 1JCHA 1AI4A 1H2NA 3FB7C 3APOA 2EINB 3PJSK 4FLXA 3A8TA 4O4JB 3EXAA 4UV9A 4PA9A 1WB7A 2JGUA 2W0XA 1MZFA 4PHZA 4TUYB 2Z5UA 3G4SV 4ZHQA 5LGNA 4B3TB 1G6UA 4JI3B 2E5LO 1IBMB 1R6KA 1NTMH 2LGQA 4LBEC 5K1PA 2MW2B 3JARB 3RBZA 4C7UA 2WLNA 4GX1A 5JH7A 2FL4A 3RW0A 1FXHA 4F6RA 1KB9F 3G67A 1QVFU 4JV5B 4AQYB 1AJQA 3K5OA 5CA3A 1YJNV 4LF5O 3HKBB 2AW9A 1MSDA 2HVJC 4QPKA 2Q7EA 4AI8A 2DQ0A 1OCOC 2EIJB 1N32O 1ZWIC 5LGUA 4MVOA 5H2FZ 1UJWB 1AROP 3OMIB 4BW9A 4LNUA 5B3SB 2ZIOA 4GKJB 1QLEB 5KHIA 4JAAA 4GYCB 5LBQA 1N34O 1K4DC 4CZZA 1AJNA 2DYSC 1ZSPA 3FX7A 4PI2A 3ZMZA 2JGDB 1Q6UA 1M93A 3JCZA 3HKDB 4DR1O 1Q86W 1QLEC 3OM3B 1VQ9V 5EK0A 3M99B 1YF2A 1XL4A 3B2EE 2Y4TA 2KG7B 5KAIZ 4NXMO 3D3IA 1D5AA 1I7FA 3T1YO 4K3AA 3MD0A 2ZE5A 4B3RO 1GN2A 4K0KB 5L3BA 4UXNA 4B7KA 4DV0B 1VARA 5EIBC 5E1AC 2ITDC 4O2AA 1ZL8A 1IURA 3OEEG 5GTHZ 2RQ6A 3L70H 4DK0A 5CB4A 1V54B 1S3JA 5IDJA 3DXRA 2F4VO 3N27A 2Q7GA 4DR2B 1I94O 1YSCA 1WJZA 1AP6A 2WWWA 4PDRA 1G4YB 1J5EB 3KZIZ 2LGWA 1SQPH 1DGSA 1AI5A 1F51A 2XAFA 4K35A 2Q73A 4JTCB 4IT5A 1VF6C 3ASNB 3ZHTA 4BIOA 2XOKG 1YIJV 3LDDA 1WNSA 1GM8A 1VQKV 4ZHQB 4ZKIA 2AZ0A 2QGNA 2AXTZ 3K04A 3JALA 4JV5O 5GW7A 5JH7B 1HWYA 3ASNC 3ZS8C 1VQ8V 4LFBB 4X9QA 1I08A 4JZ2A 1M9NA 2VS0A 2BOBC 3RVZA 1K34A 2RDCA 2JRIA 3P3PA 4Z1MG 5JJEB 1OCRB 1PP9H 1XREA 3T4DA 3RYHA 2E75B 1VQ7V 1DF5A 5EBLC 5CN0A 1O9HA 3BVOA 1W0JG 3W7UA 3GWOA 3E83A 4LNUB 5J9PC 3CC2V 4LF6O 5C8YA 3E35A 5LMNB 3ZMTA 4FJCC 1BZKA 3BHPA 2XAQA 5IJ9A 4LCUC 2QTSA 4JPRA 2UUBO 3B40A 3RWRD 2IJJA 4B7EA 3W7TA 1VIBA 1SERA 5BR8O 4G27B 2LW7A 1SA0A 4R50A 5JWPA 3CWBH 1VQ5V 3AG2B 2O57A 1WA8A 3HB3B 1N33B 1YTFC 4FIPC 5IY5C 3B8MA 5A2QN 1NVPB 4XDKA 3E22A 4DV4O 3SPJA 2B1GA 1OJHA 3BEHA 1V55B 1MABG 1US6A 2CGNA 2XAGA 3ZEDA 1IDSA 4KL1A 2AGAA 4FM2A 3RVYA 4D7TA 3PN1A 2UXDO 3J80N 1MZEA 4JI8B 4O2AB 1ZL8B 3E8HA 4JI5B 4JAVA 1NVPC 5CB4B 4DV6B 4RWUA 2Q7HA 3DXRB 1YEWA 2PY5A 3R65A 1NI8A 2IW5A 2E74B 3M7MX 4CH5A 1OHHG 2Q6AA 2HG5C 4FMTA 1VQLV 3OMNB 2FMLA 5IYZA 2ILMA 4IGGA 4DV2B 1YZBA 1SS3A 1PV0A 4I0XA 5IYBO 1XNQB 1XDCA 2M7WA 2PUSA 3AK2A 5LGTA 3H9VA 5B1AB 2GDSA 3CRAA 3T1CA 2ZR2A 4GLXA 4LH6A 2Q69A 3DC6A 5CMUA 2EIMB 2ZINA 1CP9A 4EB6A 3ZHUA 5IWAO 5GONA 4JI7O 2QSAA 3G80A 3JD1A 5EZYA 5KLVH 1Q6HA 1JX9A 1EN6A 2ZT9B 3TGUH 4IHJA 2ODMA 2G38A 3JALB 4LFAO 1M57C 2ZM6O 2UUCO 4JI2B 2K9PA 3CCLV 5JJJB 4FPPA 2EZPA 4CS2A 5LMUO 1Z2GA 4X89A 2WA4A 3H1JH 1OCZC 3RYHB 1R3JC 4YY3B 1JR9A 3VBBA 2LO1A 3HKCA 3SPHA 2R9IA 4UCSA 2PF4E 4MVUA 4JI1O 4J7ZA 3BAAA 4FK5C 3RN4A 1VF5B 4B3SO 4YXWG 5C8YB 3K59A 3OAAG 4BIUA 3C3SA 1HW7A 2R9RB 5L3FA 5IJ9B 3T4ZA 3WG7B 3Q4HA 3K79A 3STZC 2WLJA 4LWSA 2DOSA 1IZ3A 1YVWA 2YDEA 1WB8A 3RT3C 1THZA 2XTAA 3SJBC 2ZCEA 2ZQMA 3UCSC 3RFRA 2CTRA 2JJ1G 1SA0B 3AG3B 3CCEV 2ZD9A 4TT3G 3A0BZ 1AI6A 1F4MA 4FZ0A 5IYDO 1WA8B 2RJZA 1FKAO 4H33A 4MW8A 4JAUA 2BCCH 1K3EA 1G1XB 4DV7B 5IJ0A 3OMAB 1F4NA 1SQFA 3E22B 2VQFB 1X4TA 1R3LC 1I5XA 2JDIG 1V9PA 4LF4B 1Q3EA 1R3KC 2P22C 4HBNA 2JK5C 3MHSC 2H3OA 2Y0PA 1BGYH 2B5UA 2L35A 1XNRO 4X64O 1GN6A 1GO3F 4HNAA 1R6NA 4WCEV 4KXRA 2Z3YA 1FXKA 3D3QA 1YTFD 4LF8B 4NXNB 2LFRA 2LFSA 4O4LA 2E76B 2R9AA 5B1NA 1XNQO 1M56C 5IYZB 2CDYA 1X59A 4DR4B 1QQCA 4I0XB 2NNUA 4RQFA 4HYOA 1NZ6A 1ZTEA 2Y69B 4DR3O 4FLUA 2CUGA 1VQMV 2Q5ZA 4JI6O 3KG2A 4EB6B 1HNZB 5CA1A 4FFBA 1XHZA 1NVPD 3RYIA 5GONB 2A3QA 3U10A 4X1KA 2EBOA 3K5LA 4L8JA 5KA5A 2P4KA 5EZYB 4TOIA 2B9ZA 3QTCA 1XOUA 5J2UA 4O4IA 2F23A 4IHJB 3CS5A 3SYPA 2OIEA 4N21A 4JI0O 1KQSU 1IXBA 2Y69C 4CC6A 1IBLO 2OT5A 4NKGB 1H2MA 4FFKA 3OGIB 3VQXA 1L0NH 1O9GA 4WFAV 1SQQH 1JJ2U 5KUMA 4QPJA 2OCCB 4DV1O 2QE7G 3L75H 1UPGA 1SRYA 3UKMA 4UCTA 3HKCB 1IXMA 2X6CA 4GUNA 4Z1VA 1L8DA 3ZMUA 4ZIBA 3RYFA 3JD3A 1HNXB 1NH2B 4DXWA 4BIZA 4ZI7A 5ITZA 5HFMA 3L71H 1SQGA 3ABUA 1E79G 3Q4HB 1AP5A 4LWSB 4BAYA 1JVMA 4R6ZA 1PKXA 3ZIAG 1XMOB 3A0HZ 4IYIA 1H2SB 4UCUA 3OT7A 2IJIA 1URFA 3JATA 3ETQA 5KHHA 4I55A 4KP4A 4N23A 1M4UA 5IJ0B 5IT9N 4DV5O 1VQ6V 1Q43A 3F7VC 1HR0B 1H2LA 4B3MO 2B1IA 4HZ3A 4LP8A 5H5NA 5LHIA 2P7TC 5A9GA 1Q5OA 2FB5A 2EINC 4UCRA 4JYAO 3ASOB 3WFVA 3OUSA 3E8FA 3ABLB 1LR1A 2GV9A 4UB8Z 4ASUG 2F93B 3AG4B 4WF9V 5L3EA 2VQEB 2HVKC 3CJHA 2LP7A 1KMIZ 2UXCB 4NTWA 1Y76A 3JASA 4J41A 4HNAB 3A0RA 2RN9A 4QNHB 1ORQC 4DV3B 4OX9B 1FXKB 1N0NA 3BPZA 3ZMSA 4O4LB 3ML0A 3S3WA 4DR4O 2UU9B 1S5HC 2GTAA 4H0LB 4RUEA 3LSUA 2KSDA 2ADPA 3TETA 1WAZA 2BSKA 1JFFA 1W59A 5F2VO 1HNZO 2PI4A 1FFTB 1FFXA 1AB3A 3J7AU 3L9DA 4X66B 5CA1B 5LP6A 4FFBB 1NS1A 3RYIB 1PNLA 5HFLA 5C93A 4PA6A 4X1KB 3JSLA 3H01A 4YIOA 2IJKA 1EBOA 3MAQA 1XILA 5J2UB 4O4IB 2VWJA 5B1BB 2EIJC 2PTMA 4D6TH 1SZTA 2Y48A 1GKFA 1RP3B 3LUTB 1HNWB 4X62O 2ZXWB 5EBWC 2YIBA 3LDEA 3I5DA 2IH3C 1COWG 5B3SC 2XHBA 4DUYO 4JZGA 1CEZA 4TQFA 1AI7A 1K4CC 3CCUV 2UUAB 1RSOA 1XEQA 3CEIA 4X1IA 2EULA 2QWPB 3CCQV 3JYCA 1QNMA 5KA6A 5KHGA 2N04A 5JCOA 3RYFB 4FZ1A 3ZRXA 4RO2A 4ZI7B 2F66C 5ITZB 1BMFG 4DRXA 4NB5A 4E2LA 2PI5A 1AILA 1FXVA 2KB1A 3VQYA 1AR1B 2WA3A 3FYEB 3STLC 5KUKA 2OCHA 3C3TA 2QDOA 3HR0A 4J7KA 3X2QB 3CP1A 3SJCC 3E8BA 2ZE8A 1I0HA 2FTKA 3BA8A 4UCOA 1GM9A 3K08A 3JATB 3CRCA 3K9AA 1QU7A 4I55B 2OIGA 4WFEA 5FPOA 1GM7A 4W4LA 3LNNA 1Y6XA 2YUAA 3SJQC 1FJGB 4AHCA 2HR3A 5E79Z 3X2QC 1QVGU 3H1KH 1V54C 4CH4A 3GWKC 4LF9B 4QE7A 2WLMA 4D7SA 2EJRA 1P84F 2H8PC 4B3TO 4JI3O 3UO3A 1NTZH 1IBMO 2HKOA 5KX5A 2AHZA 2UXCO 1NH2D 2GBOA 1BE3H 3OTOB 3I56V 1AR5A 3CJHB 1PL0A 4PA4A 2UXBB 1EN5A 4HAMA 1ZAUA 1Y76B 3JASB 4LR3A 4AQYO 1RM1B 2RNBA 4R8CA 3WB2A 4MVZA 2LJ2A 5J2TA 4JGSA 3ZHQA 2XAJA 1DTOA 4WFGA 1BL8A 2BSKB 1JFFB 1AR4A 4DR7B 4XBFA 1Q82W 2CTPA 2ETNA 2QKCA 4X66O 4UCVA 1FFXB 3DC5A 4U3FH 4IL6Z 3C90A 4GKJO 1S5LZ 5LP6B 5JJNB 4JYBA 1KKCA 4DO2A 4RQEA 3K3WA 1OCRC 2ZNJA 5CBFA 4FVMA 1OV9A 4MTXA 3CD6V 4PDVA 5FPRA 2YEVA 3L72H 1KC8W 3KCYA 1RSOB 1TUEB 4GKKB 4JI4B 2NLJC 2EIKB 4X1IB 2P67A 4UFZA 1BSMA 1Z5VA 1ZUQA 2BOCC 3AK1A 2FKXA 4K0KO 1H2GA 4UV8A 4BWAA 5H6QA 5CA0A 2Q9LA 3CCJV 3AG2C 4DV0O 5BY1A 4DRXB 1DF4A 3EHBB 2VWKA 1EZVH 1G8MA 4P2ZA 2OWOA 3AG7A 3T1HB 2ZKOA 1VQ4V 4Q20A 4X8AA 1XI1A 3K03A 5H9CA 4DR2O 4OPAA 3IC9A 3JSNA 1V55C 2QM7A 2V7QG 4I7ZB 1OCCB 1J5EO 4I4TA 2D3OW 1YXBA 2Q68A 2K1EA 5KAFZ 2JS3A 3TK1A 3QO7A 2DE0X 3AEIA 3E8GA 2LW1A 3K0GA 4J7JA 3K5MA 4TV8A 3ZRWA 1PNMA 2NR5A 3CE2A 4KHPB 2QJ1A 2P06A 4FLVA 3ZHSA 3OW2U 2H94A 1Q90D 5KX5B 3ABMB 4L87A 4DYLA 1PPJH 4AILC 2BE3A 5H6RA 1GAXA 4LFBO 1QR8A 2IJHA 4OGQB 5B1AC 4F6EA 1BQZA 3OR6C 3IC7A 5J2TB 4MTFA 3B09A 2EIMC 3SYCA 4FLYA 2HEPA 3LNMB 4ICGA 2WLIA 1QHTA 3QF7A 3QO5A 1E1QG 3D36A 3ABMC 1YJ9V 2ZDIA 1SKVA 1Q6IA 1I5YA 1N0JA 4UVAA 2IM9A 4G28B 3ZN1A 5LOVA 4IYHA 3I55V 3N2KA 1LUWA 1A32A 2R72A 2HHHB 2W6JG 5LMNO 3ZJZA 2PZSA 2HJDA 3WB0A 1WP7A 3P30A 3OGCC 2JEUA 1KD1W 1RPOA 3VOUA 4I9WA 3T2MA 2ZIMA 3FB8C 1M90W 3BCCH 4ZOLA 1IBKB 2EJ7A 3JAWA 4JYYA 2ARHA 2YEVB 3ZBHA 2WSSG 1N33O 2XUMA 4MVRA 1ROPA 1HP8A 2XASA 4OPHA 3WG7C 5DM6V 1K7DA 4QJFB 3D8CA 3OUFA 1BHBA 1PL4A 1S77D 4UVBA 1S76D 4TQDA 2EX3A 3AG3C 1P4RA 1XMQB 1AJPA 5CA0B 3CC4V 3T1HO 5FLXN 4JI8O 5JQGA 3QO8A 3SPCA 4JI5O 3ZRVA 1NTKH 1CPYA 4DV6O 3FB5C 1GTOA 2AHYA 2YIDA 1YITV 4P9OA 3P3NA 4J80A 1EN4A 1KKDA 4EKWA 4PA3A 4FM1A 4YHHB 4PV1B 4I4TB 2OYQA 1F23A 4DV2O 2QTOA 4EEQA 3G6EV 3IJ4A 1QLNA 3W7WA 1W2BU 2YIBD 3TJTA 1SESA 5BXZA 1LNQA 2E5LB 4W4KA 3K0DA 4OXSA 1R6TA 1SQVH 1GMGA 1BCCH 1K8AW 3JCUZ 4TV8B 1PD3A 3ZRWB 3CXHF 1XHXA 5GTIZ 3L74H 1WPBA 3H1HH 4FLWA 3HKEA 2BTQA 3W7SA 3IAYA 4LF5B 4X88A 3UM7A 1PNKA 3CYOA 3CMAV 4JI2O 2VRZA 1AVMA 5K1XA 1JQ0A 5EC1C 2GUZA 2EILB 1R3IC 2QM4A 2ZE7A 1N32B 2FYUH 1S5JA 2DMXA 3TXSA 2WLIB 1R73A 1BS3A 2JVDA 1NR1A 2DWDC 1MMMA 4YY3O 1EM1A 3ZHVA 5LOVB 4GX0A 1N34B 3N2KB 2YC0A 3THOA 3H1LH 4B08A 3RGBA 3HPLC 3ETEA 1Y67A 3CRMA 3SYQA 2KKWA 3FB6C 5BMVA 3LDCA 2OCCC 4DR1B 3FKSG 4GKKO 1XL6A 2A0LA 2JJ2G 3O9OA 3E86A 1YJWV 2CTQA 1B04A 1D5NA 4KUMA 5B66Z 4WFBV 1H8EG 3G6BA 3JAKA 1SQBH 4PJ0Z 4ZOLB 4GT1A 3JAWB 4MVQA 4U3JA 4NXMB 1NH2C 2YXHA 1FPOA 3T1YB 4NTXA 5EBMC 4DV7O 3SGIA 3AG1B 1VP7A 4ABMA 2RMKB 1Y74A 4YIPA 3O65A 5D5QA 2VQFO 2A79B 4J9ZB 1QR9A 1MA1A 2QWQB 1VF6A 3BABA 4LF4O 3CPWU 3ABTA 2ZNIA 1P7GA 2F4VB 3AG1C 1H38A 5JQGB 3WU2Z 3E89A 1I94B 1P7BA 1SZXA 1SF9A 5L3CA 5B1OA 1T5EA 4YHHO 3CRRA 4LF8O 4NXNO 3OR7C 4X65B 1TA8A 4UUJC 3MHHC 2IH1C 3FAVA 2MK3A 3ASOC 4UB6Z 2UXNA 3N2GA 3ABLC 3KCXA 5BZBA 3CXCU 1DLBA 3AG4C 4NVPA 2WAMA 1OCOB 3A2FA 2PYLA 2DW4A 1D2DA 1KECA 4CH6A 3VQWA 3JD0A 1K73W 4YJ3A 1FXKC 4P9PA 5FNVA 3CSXA 2BTOA 3L73H 2CGOA 1M5IA 2PYJA 2C2AA 3M8AA 4TSFG 3HKEB 1SETA 2BTQB 1GK9A 2F1MA 4PELA 4X1YA 4J10A 1WP8A 3NXSA 4U7OA 3QG5A 1ZX3A 2P4VA 1QCEA 2JS5A 4IIJA 2DYSB 3CX5F 2HJFC 4K8XA 3ZRSA 4BW5A 1DK1A 2GUZB 1L1FA 3CRQA 3SPIA 2W0FC 2RCVA 3ZX6A 2UXXA 1VQPV 1Z5WA 2Q0AA 4LF6B 5B1BC 2ITCC 1HNXO 4TWKA 2EZOA 1GN3A 3FD9A 1W0KG 1Q7YW 5CBHA 2P90A 2A7WA 2ZXWC 2UUBB 3ZCCA 5LXTA 3UT5A 1B3QA 4PDMA 2A06H 2YS8A 1LUVA 4ZBMA 5BR8B 4Z2WA 5BMVB 4PI0A 4LFCB 1B06A 1NKDA 4O2BA 5EYPA 3K5NA 3ZN0A 2WLKA 1MSWD 4RAIA 1XMOO 3JAKB 1F7YA 3OEHG 4DR5B 1FAFA 1WN7A 4U3JB 2OTLV 2L6LA 4NTYA 1K9MW 4DV4B 3BFRA 2P5OA 2WLLA 3MDSA 2CH7A 1Y74B 4GCZA 4TV9A 5AG2A 1HR0O 2R70A 2UXDB 4XDLA 1CXZB 1UFIA 1GN4A 3BA9A 3WB1A 2D2CB 1S0VA 2AZ2A 3K9SA 1KBHA 1BQ0A 2QM8A 2VQEO 2N74A 2HP8A 4I9QA 2Q67A 1GRJA 1E1RG 4H44B 4X65O 3OE7G 4DV3O 4OX9O 2QA4V 4E4EA 3GVMA 1MOFA 2UU9O 3FAVB 2X7RB 1N4CA 3N2GB 2CTWA 5L3DA 5IWAB 4RUFA 3SYOA 4JTAB 4JI7B 4GZRB 5IYCO 4O4HA 2IBZH 1RM1C 4I50A 1NJIW 4F6RB 4J11A 4YJ3B 3K06A 4LFAB 2ZM6B 5FNVB 2UUCB 2WPDG 1SC5B 3J81N 4MT8A 1IX9A 4U7NA 4CBCA 2ZR3A 4WFFA 1SQXH 1PM9A 4CH3A 3K57A 4X1YB 4QGPA 4PD4F 3ABKB 5LMUB 4F4LA 4IIJB 1HNWO 1XBLA 3CHXA 1JMKC 1RFYA 2A9HA 5LP6C 2DQ3A 2UUAO 4JI1B 3H1IH 1RPRA 4B3SB 3ABKC 1NR7A 3E2EA 4J9YB 3KKYA 3RYCA 1YTFB 3LSQA 2Y4UA 4LF7B 5IY5B 3TXQA 5KHKA 1FD9A 5B5EZ 5LXTB 3UT5B 3ZHRA 4LFCO 4MW3A 5DECA 1MNGA 2EIKC 1K92A 4O2BB 5EYPB 4DR5O 5L3GA 4DUZB 1Q81W 2DN9A 5JCOC 2Q8VA 2QWRB 4MSWC 4H13B 1ZLZA 2Z0AA 5TISZ 3ZMVA 2QWOB 2WLLB 3CCRV 2CH7B 1FJGO 4A5UB 3CCSV 4TV9B 4BR6A 2X6BA 3B8NA 4UVCA 4JYCA 1NQTA 4LF9O 2E3CA 2YSUB 3TCUA 4MTOA 1ENVA 1YHQV 2HFEC 1NT2B 4X64B 3SJAC 1XNRB 4DW0A 1OCCC 5LA6A 1Q8IA 3G71V 3P32A 1TAEA 3OTOO 4WBNA 3SYAA 2XAHA 2GHYA 1KP2A 2QWNB 1TUBA 2UXBO 4PDLA 1JJOA 1L0LH 1JOYA 1VQNV 3UQ8A 1M57B 2ATKC 4X20A 1TGOA 5LL6Y 3DTUB 4CC5A 1YI2V 1N36B 5EIBD 4EFBA 4DR3B 3DGEA 4DW1A 4I5SA 1EZJA 4XDJA 1R1BA 1NU1H 4JF3A 1S72V 3GB7C 1N8RW 4DR7O 5JVDA 4JI6B 4WFHA 4KFMA 5KMGA 1FS0G 3ETDA 1XUQA 2QKSA 1OCZB 4O4HB 2YXLA 4MVSA 1WLEA 4I50B 5LYJA 3OTFA 2DJVA 2HLDG 2QR4A 2W6IG 4JI0B 3VQVA 3BRCA 1IBLB 1GH6A 2YI9A 3LSSA 1NBMG 3BY6A 2P6JA 1WPXA 4MVMA 2KQXA 4EFEA 2CAZC
chains in the Genus database with same CATH topology
3GWOA 3E83A 5J9PC 3CC2V 4GX0A 2ZXWB 3B77A 5EBWC 3LDEA 4R7CA 3E35A 1JPXA 2IH3C 1COWG 3JD2A 5B3SC 1M1KW 2X0LA 3ZMTA 4FJCC 2XAQA 1K33A 3SPGA 1CEZA 1AI7A 1VQOV 1BHAA 1K4CC 3HPLC 3ETEA 4LCUC 3CCUV 4GX5A 4JPRA 3SYQA 1K5SA 3FB6C 2IJJA 3LDCA 3CCQV 2OCCC 3W7TA 3FKSG 3JYCA 1XL6A 2A0LA 2JJ2G 2IU3A 3EFFK 5KA6A 3E86A 1YJWV 1SERA 4G27B 4R50A 2DWEC 1VQ5V 4KUMA 3AG2B 3ZRXA 4RO2A 4WFBV 1H8EG 1H8HG 3HB3B 4GT1A 4MVQA 1NH2C 1BMFG 1YTFC 2PI5A 4E2LA 4FIPC 5IY5C 1FXVA 2KB1A 3B8MA 1NVPB 4XDKA 2X6AA 1AR1B 5EBMC 3AG1B 3FYEB 3CC7V 2JIZG 3STLC 5KUKA 3SPJA 3X2QB 2B1GA 3CP1A 3BEHA 3E8BA 1V55B 1MABG 2A79B 2XAGA 4J9ZB 1QR9A 3RVYA 4LC1A 2FTKA 2QEXV 3CPWU 1GM9A 3K08A 3ABTA 3W7XA 4PA7A 3E8HA 1NVPC 3K9AA 4JAVA 4P30A 4WFEA 1EFRG 2JEXA 3AG1C 1GM7A 1H38A 3SJQC 3E89A 3F7YC 1P7BA 2HR3A 3F5WC 2XNDG 3X2QC 1QVGU 1V54C 4QIWF 5LHGA 5L3CA 3R65A 1M56B 5B1OA 2IW5A 1Y4MA 4QE7A 2WLMA 1OHHG 2EJRA 5FL7G 2IU0A 2Q6AA 2HG5C 2H8PC 4FMTA 3OR7C 1VQLV 3OMNB 4UUJC 3MHHC 2HKOA 2IH1C 2MK3A 4JASA 2AHZA 5IYBO 2M7WA 1NH2D 3ASOC 2UXNA 5LGTA 3I56V 5B1AB 3ABLC 3T1CA 5BZBA 3IGAC 1PL0A 3CXCU 1DLBA 2ZR2A 4PA4A 4HAMA 3AG4C 1RM1B 2Q69A 2WAMA 4R8CA 1OCOB 2EIMB 5CMUA 1CP9A 5LHHA 2DW4A 2V1DA 4MVZA 3CCMV 3FYIB 1Y66A 1KECA 3JD1A 2GSMB 3JD0A 1K73W 4JGSA 1FXKC 4P9PA 1JX9A 5DN6G 2XAJA 1DTOA 4WFGA 4G2KA 4H37A 1BL8A 3CCVV 1OZ0A 1M57C 2C2AA 4TSFG 2F43G 1SETA 2CK3G 4XBFA 1GK9A 4PELA 1Q82W 3NXSA 4U7OA 3CCLV 4QE9A 1QCEA 4FPPA 2EZPA 2DYSB 5EC2C 2DYRB 2OTJV 2HJFC 4MTGA 4JYBA 3ZRSA 4BW5A 4X89A 3OFNG 1L1FA 3SPIA 4DO2A 1B6QA 2W0FC 4GX2A 1OCZC 4RQEA 3K3WA 1R3JC 1KP3A 3CMEV 2EILC 3IFXA 1OCRC 3VBBA 5CBFA 3SPHA 2R9IA 2UXXA 1VQPV 4MVUA 4MTXA 2ZDIC 3CD6V 5B1BC 4FK5C 1QBZA 2WLHA 2ITCC 2DYRC 4PDVA 3ETGA 4MS2A 2EZOA 4TWKA 4YXWG 1W0KG 1J95A 3OAAG 4BIUA 2YEVA 1Q7YW 5CBHA 2P90A 1KC8W 2ZXWC 2R9RB 4JTDB 5L3FA 3ZCCA 3T4ZA 3WG7B 3K79A 3STZC 4PDMA 1TUEB 2WLJA 1K97A 2NLJC 1THZA 2EIKB 4ZBMA 2ZQMA 2P67A 3JD4A 2JJ1G 3AG3B 1NKDA 2BOCC 2ZD9A 3CCEV 4TT3G 1K5QA 3ZN0A 3QNEA 1AI6A 1F4MA 5IYDO 2WLKA 1H2GA 4UV8A 1MSWD 4RAIA 5H6QA 4H33A 3OEHG 4MW8A 4JAUA 3CCJV 3AG2C 2OTLV 1K3EA 1MG1A 5CBGA 1DF4A 3OMAB 1F4NA 1K9MW 3EHBB 1G8MA 1JCHA 4P2ZA 1AI4A 2WLLA 3FB7C 1VQ4V 4Q20A 4X8AA 3K03A 4GCZA 1R3LC 2EINB 1I5XA 5H9CA 2JDIG 3PJSK 4XDLA 1R3KC 4UV9A 1V55C 2QM7A 2V7QG 1OCCB 4PA9A 2D3OW 2Q68A 2K1EA 2JK5C 3MHSC 1S0VA 2B5UA 3TK1A 3QO7A 2QM8A 1GO3F 3AEIA 2Z5UA 1R6NA 3E8GA 2Q67A 3G4SV 4WCEV 1E1RG 2Z3YA 1FXKA 5LGNA 3K0GA 1YTFD 2LFRA 2LFSA 3OE7G 1R6KA 3ZRWA 1PNMA 4LBEC 5B1NA 1M56C 2QA4V 3RBZA 2WLNA 1MOFA 2H94A 4GX1A 3OW2U 3RW0A 2X7RB 3ABMB 1FXHA 4L87A 2NNUA 4RQFA 4HYOA 5H6RA 1QVFU 1AJQA 2Y69B 5L3DA 5CA3A 4RUFA 1QR8A 3SYOA 1VQMV 1YJNV 2IJHA 4JTAB 5B1AC 5IYCO 2HVJC 3OR6C 3KG2A 4QPKA 3IC7A 4MTFA 1NVPD 1RM1C 2DQ0A 1NJIW 1OCOC 2EIMC 3SYCA 2EBOA 3LNMB 5KA5A 2EIJB 2WLIA 3K06A 3QO5A 1YJ9V 1E1QG 3D36A 3ABMC 1ZWIC 2ZDIA 2WPDG 5LGUA 4MVOA 4MT8A 1UJWB 3SYPA 4U7NA 1AROP 1I5YA 3OMIB 4N21A 4UVAA 4CBCA 1KQSU 2Y69C 2ZR3A 4WFFA 2OT5A 4G28B 5B3SB 3ZN1A 3ABKB 1QLEB 3W7UA 4F4LA 4WFAV 3I55V 5LBQA 1JJ2U 1K4DC 5KUMA 4CZZA 4QPJA 2W6JG 2OCCB 1AJNA 2DYSC 3ZJZA 2QE7G 2A9HA 2DQ3A 3ZMZA 1SRYA 3P30A 3UKMA 3JCZA 1IXMA 1RPRA 2X6CA 3OGCC 2JEUA 3ZMUA 1KD1W 1Q86W 3ABKC 1NR7A 1RPOA 1QLEC 3JD3A 4I9WA 3VOUA 1NH2B 3T2MA 3E2EA 3OM3B 4J9YB 3FB8C 1VQ9V 4DXWA 1M90W 1YTFB 3LSQA 5EK0A 4BIZA 5IY5B 3M99B 5HFMA 1XL4A 2YEVB 2WSSG 3ABUA 1E79G 3D3IA 4MVRA 1ROPA 2XASA 4BAYA 3MD0A 3WG7C 1JVMA 5DM6V 1K7DA 4MW3A 4R6ZA 4QJFB 1PKXA 2EIKC 3ZIAG 1K92A 3OUFA 5L3BA 1BHBA 4UXNA 5L3GA 1S77D 1Q81W 4UVBA 1S76D 3AG3C 1P4RA 2IJIA 5E1AC 2ITDC 1AJPA 3CC4V 3OEEG 4KP4A 4MSWC 4N23A 3QO8A 3SPCA 1V54B 1S3JA 5IDJA 3ZRVA 3ZMVA 1VQ6V 1CPYA 2WLLB 3CCRV 3F7VC 3FB5C 1GTOA 2AHYA 1YSCA 2B1IA 4HZ3A 1YITV 4P9OA 3CCSV 2WWWA 4PDRA 2X6BA 3B8NA 4UVCA 4LP8A 1G4YB 5LHIA 4JYCA 2P7TC 1NQTA 1KKDA 2EINC 4EKWA 2YSUB 3TCUA 3ASOB 4MTOA 3WFVA 1ENVA 3OUSA 3E8FA 4PA3A 3ABLB 1AI5A 2XAFA 1F23A 1F51A 4ASUG 1YHQV 2HFEC 3AG4B 4WF9V 4JTCB 5L3EA 2HVKC 2QTOA 3ASNB 1OCCC 3G6EV 1QLNA 2LP7A 3G71V 3P32A 3W7WA 1W2BU 2XOKG 1YIJV 3LDDA 3SYAA 2XAHA 2GHYA 1SESA 3A0RA 1KP2A 1LNQA 1GM8A 4QNHB 4PDLA 1VQKV 1ORQC 1FXKB 3K0DA 4OXSA 1JOYA 4ZKIA 3ZMSA 1GMGA 1K8AW 1VQNV 3ML0A 1PD3A 1S5HC 1M57B 2ATKC 3ZRWB 3K04A 4RUEA 3TETA 3DTUB 5GW7A 1YI2V 1HWYA 3ASNC 3DGEA 4I5SA 1EZJA 4XDJA 3W7SA 1VQ8V 4JF3A 1S72V 3GB7C 4X88A 1N8RW 3UM7A 2PI4A 1PNKA 4WFHA 4KFMA 1M9NA 1FS0G 3CYOA 1FFTB 3ETDA 3CMAV 2BOBC 3RVZA 1K34A 2QKSA 1JQ0A 1OCZB 4Z1MG 4MVSA 5EC1C 1PNLA 1WLEA 5HFLA 5C93A 2EILB 1R3IC 1OCRB 4PA6A 3T4DA 2HLDG 1VQ7V 2WLIB 1R73A 3H01A 2W6IG 2IJKA 1EBOA 1DF5A 5EBLC 5CN0A 1NR1A 5B1BB 2EIJC 3LSSA 1NBMG 2DWDC 3BY6A 2P6JA 1WPXA 4MVMA 1SZTA 2Y48A 1GKFA 1W0JG 3LUTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RM1 B;  5IYD O;  5IYC O;  1NH2 C;  1YTF D;  1NVP D;  5IYB O;  1NVP C;  1RM1 C;  1YTF C;  1NH2 D; 
#chains in the Genus database with same CATH topology
 2YIA A;  2M6Y A;  4FLZ A;  2Q0O C;  3B77 A;  4R7C A;  1JPX A;  3JD2 A;  1M1K W;  2X0L A;  3QVN A;  2Q4P A;  1TVK A;  4DV1 B;  1K33 A;  3SPG A;  1VQO V;  1BHA A;  4Q6G A;  2LQT A;  4GX5 A;  1K5S A;  4JI4 O;  3EFF K;  2IU3 A;  1XQ8 A;  3ICX A;  4LF7 O;  2DWE C;  1VEW A;  4CS4 A;  3RYC B;  1H8H G;  4YJ2 A;  3U11 A;  2X6A A;  2XT9 A;  3NR7 A;  3U0Z A;  3CC7 V;  2JIZ G;  4DR6 B;  2QKA A;  4DUZ O;  2N05 A;  3FFQ A;  4O4J A;  4LC1 A;  2QEX V;  3W7X A;  4PA7 A;  1YDX A;  4P30 A;  1EFR G;  4TUY A;  2JEX A;  4DV5 B;  3F7Y C;  4B3M B;  2YI8 A;  3F5W C;  2XND G;  3S3X A;  2GTS A;  4QIW F;  5LHG A;  3AK3 A;  1M56 B;  4FM0 A;  1Y4M A;  4JYA B;  5FL7 G;  2IU0 A;  3JAR A;  3B4S A;  4K8Z A;  5IE9 A;  4KHP O;  4JAS A;  4CS3 A;  3IGA C;  5LA6 B;  4WBN B;  3SDL A;  3HKB A;  5LHH A;  3CCM V;  1TUB B;  2V1D A;  3FYI B;  1Y66 A;  3R66 A;  1HDJ A;  5DED A;  2GSM B;  4NR1 A;  1N36 O;  1BT8 A;  4J42 A;  4LH7 A;  4X20 B;  5DN6 G;  4G2K A;  4H37 A;  3CCV V;  1OZ0 A;  3DSQ A;  2ADQ B;  2F43 G;  2CK3 G;  2NN4 A;  5JVD B;  1IVS A;  5KMG B;  4QE9 A;  3OD4 A;  5EC2 C;  2DYR B;  2OTJ V;  4MTG A;  1U96 A;  3OFN G;  5LYJ B;  1B6Q A;  2V4D A;  4GX2 A;  2HHH O;  3EVK A;  1KP3 A;  2JGD A;  3CME V;  2EIL C;  2ZE6 A;  3IFX A;  1VMG A;  4DK1 A;  3HKD A;  3D36 C;  1JA8 A;  4X62 B;  2CE4 A;  1P49 A;  2ZDI C;  1QBZ A;  2WLH A;  3UO2 A;  2DYR C;  2PGG A;  1FYJ A;  3ETG A;  4MS2 A;  4DUY B;  1J95 A;  2KG7 A;  1TVK B;  1IBK O;  4NYK A;  2YIC A;  1YCI A;  4JTD B;  1KU9 A;  3CB2 A;  3K58 A;  1K97 A;  5KHJ A;  2YXY A;  1KUQ A;  3JD4 A;  3SR2 C;  1K5Q A;  3QNE A;  4B3R B;  2Y0I A;  1U97 A;  4FLT A;  3F5T A;  5D5P A;  1H2K A;  4YJ2 B;  2F95 B;  1MG1 A;  3APQ A;  5CBG A;  1XMQ O;  4DR6 O;  1VF7 A;  1KYO F;  3JAM N;  1JCH A;  1AI4 A;  1H2N A;  3FB7 C;  3APO A;  2EIN B;  3PJS K;  4FLX A;  3A8T A;  4O4J B;  3EXA A;  4UV9 A;  4PA9 A;  1WB7 A;  2JGU A;  2W0X A;  1MZF A;  4PHZ A;  4TUY B;  2Z5U A;  3G4S V;  4ZHQ A;  5LGN A;  4B3T B;  1G6U A;  4JI3 B;  2E5L O;  1IBM B;  1R6K A;  1NTM H;  2LGQ A;  4LBE C;  5K1P A;  2MW2 B;  3JAR B;  3RBZ A;  4C7U A;  2WLN A;  4GX1 A;  5JH7 A;  2FL4 A;  3RW0 A;  1FXH A;  4F6R A;  1KB9 F;  3G67 A;  1QVF U;  4JV5 B;  4AQY B;  1AJQ A;  3K5O A;  5CA3 A;  1YJN V;  4LF5 O;  3HKB B;  2AW9 A;  1MSD A;  2HVJ C;  4QPK A;  2Q7E A;  4AI8 A;  2DQ0 A;  1OCO C;  2EIJ B;  1N32 O;  1ZWI C;  5LGU A;  4MVO A;  5H2F Z;  1UJW B;  1ARO P;  3OMI B;  4BW9 A;  4LNU A;  5B3S B;  2ZIO A;  4GKJ B;  1QLE B;  5KHI A;  4JAA A;  4GYC B;  5LBQ A;  1N34 O;  1K4D C;  4CZZ A;  1AJN A;  2DYS C;  1ZSP A;  3FX7 A;  4PI2 A;  3ZMZ A;  2JGD B;  1Q6U A;  1M93 A;  3JCZ A;  3HKD B;  4DR1 O;  1Q86 W;  1QLE C;  3OM3 B;  1VQ9 V;  5EK0 A;  3M99 B;  1YF2 A;  1XL4 A;  3B2E E;  2Y4T A;  2KG7 B;  5KAI Z;  4NXM O;  3D3I A;  1D5A A;  1I7F A;  3T1Y O;  4K3A A;  3MD0 A;  2ZE5 A;  4B3R O;  1GN2 A;  4K0K B;  5L3B A;  4UXN A;  4B7K A;  4DV0 B;  1VAR A;  5EIB C;  5E1A C;  2ITD C;  4O2A A;  1ZL8 A;  1IUR A;  3OEE G;  5GTH Z;  2RQ6 A;  3L70 H;  4DK0 A;  5CB4 A;  1V54 B;  1S3J A;  5IDJ A;  3DXR A;  2F4V O;  3N27 A;  2Q7G A;  4DR2 B;  1I94 O;  1YSC A;  1WJZ A;  1AP6 A;  2WWW A;  4PDR A;  1G4Y B;  1J5E B;  3KZI Z;  2LGW A;  1SQP H;  1DGS A;  1AI5 A;  1F51 A;  2XAF A;  4K35 A;  2Q73 A;  4JTC B;  4IT5 A;  1VF6 C;  3ASN B;  3ZHT A;  4BIO A;  2XOK G;  1YIJ V;  3LDD A;  1WNS A;  1GM8 A;  1VQK V;  4ZHQ B;  4ZKI A;  2AZ0 A;  2QGN A;  2AXT Z;  3K04 A;  3JAL A;  4JV5 O;  5GW7 A;  5JH7 B;  1HWY A;  3ASN C;  3ZS8 C;  1VQ8 V;  4LFB B;  4X9Q A;  1I08 A;  4JZ2 A;  1M9N A;  2VS0 A;  2BOB C;  3RVZ A;  1K34 A;  2RDC A;  2JRI A;  3P3P A;  4Z1M G;  5JJE B;  1OCR B;  1PP9 H;  1XRE A;  3T4D A;  3RYH A;  2E75 B;  1VQ7 V;  1DF5 A;  5EBL C;  5CN0 A;  1O9H A;  3BVO A;  1W0J G;  3W7U A;  3GWO A;  3E83 A;  4LNU B;  5J9P C;  3CC2 V;  4LF6 O;  5C8Y A;  3E35 A;  5LMN B;  3ZMT A;  4FJC C;  1BZK A;  3BHP A;  2XAQ A;  5IJ9 A;  4LCU C;  2QTS A;  4JPR A;  2UUB O;  3B40 A;  3RWR D;  2IJJ A;  4B7E A;  3W7T A;  1VIB A;  1SER A;  5BR8 O;  4G27 B;  2LW7 A;  1SA0 A;  4R50 A;  5JWP A;  3CWB H;  1VQ5 V;  3AG2 B;  2O57 A;  1WA8 A;  3HB3 B;  1N33 B;  1YTF C;  4FIP C;  5IY5 C;  3B8M A;  5A2Q N;  1NVP B;  4XDK A;  3E22 A;  4DV4 O;  3SPJ A;  2B1G A;  1OJH A;  3BEH A;  1V55 B;  1MAB G;  1US6 A;  2CGN A;  2XAG A;  3ZED A;  1IDS A;  4KL1 A;  2AGA A;  4FM2 A;  3RVY A;  4D7T A;  3PN1 A;  2UXD O;  3J80 N;  1MZE A;  4JI8 B;  4O2A B;  1ZL8 B;  3E8H A;  4JI5 B;  4JAV A;  1NVP C;  5CB4 B;  4DV6 B;  4RWU A;  2Q7H A;  3DXR B;  1YEW A;  2PY5 A;  3R65 A;  1NI8 A;  2IW5 A;  2E74 B;  3M7M X;  4CH5 A;  1OHH G;  2Q6A A;  2HG5 C;  4FMT A;  1VQL V;  3OMN B;  2FML A;  5IYZ A;  2ILM A;  4IGG A;  4DV2 B;  1YZB A;  1SS3 A;  1PV0 A;  4I0X A;  5IYB O;  1XNQ B;  1XDC A;  2M7W A;  2PUS A;  3AK2 A;  5LGT A;  3H9V A;  5B1A B;  2GDS A;  3CRA A;  3T1C A;  2ZR2 A;  4GLX A;  4LH6 A;  2Q69 A;  3DC6 A;  5CMU A;  2EIM B;  2ZIN A;  1CP9 A;  4EB6 A;  3ZHU A;  5IWA O;  5GON A;  4JI7 O;  2QSA A;  3G80 A;  3JD1 A;  5EZY A;  5KLV H;  1Q6H A;  1JX9 A;  1EN6 A;  2ZT9 B;  3TGU H;  4IHJ A;  2ODM A;  2G38 A;  3JAL B;  4LFA O;  1M57 C;  2ZM6 O;  2UUC O;  4JI2 B;  2K9P A;  3CCL V;  5JJJ B;  4FPP A;  2EZP A;  4CS2 A;  5LMU O;  1Z2G A;  4X89 A;  2WA4 A;  3H1J H;  1OCZ C;  3RYH B;  1R3J C;  4YY3 B;  1JR9 A;  3VBB A;  2LO1 A;  3HKC A;  3SPH A;  2R9I A;  4UCS A;  2PF4 E;  4MVU A;  4JI1 O;  4J7Z A;  3BAA A;  4FK5 C;  3RN4 A;  1VF5 B;  4B3S O;  4YXW G;  5C8Y B;  3K59 A;  3OAA G;  4BIU A;  3C3S A;  1HW7 A;  2R9R B;  5L3F A;  5IJ9 B;  3T4Z A;  3WG7 B;  3Q4H A;  3K79 A;  3STZ C;  2WLJ A;  4LWS A;  2DOS A;  1IZ3 A;  1YVW A;  2YDE A;  1WB8 A;  3RT3 C;  1THZ A;  2XTA A;  3SJB C;  2ZCE A;  2ZQM A;  3UCS C;  3RFR A;  2CTR A;  2JJ1 G;  1SA0 B;  3AG3 B;  3CCE V;  2ZD9 A;  4TT3 G;  3A0B Z;  1AI6 A;  1F4M A;  4FZ0 A;  5IYD O;  1WA8 B;  2RJZ A;  1FKA O;  4H33 A;  4MW8 A;  4JAU A;  2BCC H;  1K3E A;  1G1X B;  4DV7 B;  5IJ0 A;  3OMA B;  1F4N A;  1SQF A;  3E22 B;  2VQF B;  1X4T A;  1R3L C;  1I5X A;  2JDI G;  1V9P A;  4LF4 B;  1Q3E A;  1R3K C;  2P22 C;  4HBN A;  2JK5 C;  3MHS C;  2H3O A;  2Y0P A;  1BGY H;  2B5U A;  2L35 A;  1XNR O;  4X64 O;  1GN6 A;  1GO3 F;  4HNA A;  1R6N A;  4WCE V;  4KXR A;  2Z3Y A;  1FXK A;  3D3Q A;  1YTF D;  4LF8 B;  4NXN B;  2LFR A;  2LFS A;  4O4L A;  2E76 B;  2R9A A;  5B1N A;  1XNQ O;  1M56 C;  5IYZ B;  2CDY A;  1X59 A;  4DR4 B;  1QQC A;  4I0X B;  2NNU A;  4RQF A;  4HYO A;  1NZ6 A;  1ZTE A;  2Y69 B;  4DR3 O;  4FLU A;  2CUG A;  1VQM V;  2Q5Z A;  4JI6 O;  3KG2 A;  4EB6 B;  1HNZ B;  5CA1 A;  4FFB A;  1XHZ A;  1NVP D;  3RYI A;  5GON B;  2A3Q A;  3U10 A;  4X1K A;  2EBO A;  3K5L A;  4L8J A;  5KA5 A;  2P4K A;  5EZY B;  4TOI A;  2B9Z A;  3QTC A;  1XOU A;  5J2U A;  4O4I A;  2F23 A;  4IHJ B;  3CS5 A;  3SYP A;  2OIE A;  4N21 A;  4JI0 O;  1KQS U;  1IXB A;  2Y69 C;  4CC6 A;  1IBL O;  2OT5 A;  4NKG B;  1H2M A;  4FFK A;  3OGI B;  3VQX A;  1L0N H;  1O9G A;  4WFA V;  1SQQ H;  1JJ2 U;  5KUM A;  4QPJ A;  2OCC B;  4DV1 O;  2QE7 G;  3L75 H;  1UPG A;  1SRY A;  3UKM A;  4UCT A;  3HKC B;  1IXM A;  2X6C A;  4GUN A;  4Z1V A;  1L8D A;  3ZMU A;  4ZIB A;  3RYF A;  3JD3 A;  1HNX B;  1NH2 B;  4DXW A;  4BIZ A;  4ZI7 A;  5ITZ A;  5HFM A;  3L71 H;  1SQG A;  3ABU A;  1E79 G;  3Q4H B;  1AP5 A;  4LWS B;  4BAY A;  1JVM A;  4R6Z A;  1PKX A;  3ZIA G;  1XMO B;  3A0H Z;  4IYI A;  1H2S B;  4UCU A;  3OT7 A;  2IJI A;  1URF A;  3JAT A;  3ETQ A;  5KHH A;  4I55 A;  4KP4 A;  4N23 A;  1M4U A;  5IJ0 B;  5IT9 N;  4DV5 O;  1VQ6 V;  1Q43 A;  3F7V C;  1HR0 B;  1H2L A;  4B3M O;  2B1I A;  4HZ3 A;  4LP8 A;  5H5N A;  5LHI A;  2P7T C;  5A9G A;  1Q5O A;  2FB5 A;  2EIN C;  4UCR A;  4JYA O;  3ASO B;  3WFV A;  3OUS A;  3E8F A;  3ABL B;  1LR1 A;  2GV9 A;  4UB8 Z;  4ASU G;  2F93 B;  3AG4 B;  4WF9 V;  5L3E A;  2VQE B;  2HVK C;  3CJH A;  2LP7 A;  1KMI Z;  2UXC B;  4NTW A;  1Y76 A;  3JAS A;  4J41 A;  4HNA B;  3A0R A;  2RN9 A;  4QNH B;  1ORQ C;  4DV3 B;  4OX9 B;  1FXK B;  1N0N A;  3BPZ A;  3ZMS A;  4O4L B;  3ML0 A;  3S3W A;  4DR4 O;  2UU9 B;  1S5H C;  2GTA A;  4H0L B;  4RUE A;  3LSU A;  2KSD A;  2ADP A;  3TET A;  1WAZ A;  2BSK A;  1JFF A;  1W59 A;  5F2V O;  1HNZ O;  2PI4 A;  1FFT B;  1FFX A;  1AB3 A;  3J7A U;  3L9D A;  4X66 B;  5CA1 B;  5LP6 A;  4FFB B;  1NS1 A;  3RYI B;  1PNL A;  5HFL A;  5C93 A;  4PA6 A;  4X1K B;  3JSL A;  3H01 A;  4YIO A;  2IJK A;  1EBO A;  3MAQ A;  1XIL A;  5J2U B;  4O4I B;  2VWJ A;  5B1B B;  2EIJ C;  2PTM A;  4D6T H;  1SZT A;  2Y48 A;  1GKF A;  1RP3 B;  3LUT B;  1HNW B;  4X62 O;  2ZXW B;  5EBW C;  2YIB A;  3LDE A;  3I5D A;  2IH3 C;  1COW G;  5B3S C;  2XHB A;  4DUY O;  4JZG A;  1CEZ A;  4TQF A;  1AI7 A;  1K4C C;  3CCU V;  2UUA B;  1RSO A;  1XEQ A;  3CEI A;  4X1I A;  2EUL A;  2QWP B;  3CCQ V;  3JYC A;  1QNM A;  5KA6 A;  5KHG A;  2N04 A;  5JCO A;  3RYF B;  4FZ1 A;  3ZRX A;  4RO2 A;  4ZI7 B;  2F66 C;  5ITZ B;  1BMF G;  4DRX A;  4NB5 A;  4E2L A;  2PI5 A;  1AIL A;  1FXV A;  2KB1 A;  3VQY A;  1AR1 B;  2WA3 A;  3FYE B;  3STL C;  5KUK A;  2OCH A;  3C3T A;  2QDO A;  3HR0 A;  4J7K A;  3X2Q B;  3CP1 A;  3SJC C;  3E8B A;  2ZE8 A;  1I0H A;  2FTK A;  3BA8 A;  4UCO A;  1GM9 A;  3K08 A;  3JAT B;  3CRC A;  3K9A A;  1QU7 A;  4I55 B;  2OIG A;  4WFE A;  5FPO A;  1GM7 A;  4W4L A;  3LNN A;  1Y6X A;  2YUA A;  3SJQ C;  1FJG B;  4AHC A;  2HR3 A;  5E79 Z;  3X2Q C;  1QVG U;  3H1K H;  1V54 C;  4CH4 A;  3GWK C;  4LF9 B;  4QE7 A;  2WLM A;  4D7S A;  2EJR A;  1P84 F;  2H8P C;  4B3T O;  4JI3 O;  3UO3 A;  1NTZ H;  1IBM O;  2HKO A;  5KX5 A;  2AHZ A;  2UXC O;  1NH2 D;  2GBO A;  1BE3 H;  3OTO B;  3I56 V;  1AR5 A;  3CJH B;  1PL0 A;  4PA4 A;  2UXB B;  1EN5 A;  4HAM A;  1ZAU A;  1Y76 B;  3JAS B;  4LR3 A;  4AQY O;  1RM1 B;  2RNB A;  4R8C A;  3WB2 A;  4MVZ A;  2LJ2 A;  5J2T A;  4JGS A;  3ZHQ A;  2XAJ A;  1DTO A;  4WFG A;  1BL8 A;  2BSK B;  1JFF B;  1AR4 A;  4DR7 B;  4XBF A;  1Q82 W;  2CTP A;  2ETN A;  2QKC A;  4X66 O;  4UCV A;  1FFX B;  3DC5 A;  4U3F H;  4IL6 Z;  3C90 A;  4GKJ O;  1S5L Z;  5LP6 B;  5JJN B;  4JYB A;  1KKC A;  4DO2 A;  4RQE A;  3K3W A;  1OCR C;  2ZNJ A;  5CBF A;  4FVM A;  1OV9 A;  4MTX A;  3CD6 V;  4PDV A;  5FPR A;  2YEV A;  3L72 H;  1KC8 W;  3KCY A;  1RSO B;  1TUE B;  4GKK B;  4JI4 B;  2NLJ C;  2EIK B;  4X1I B;  2P67 A;  4UFZ A;  1BSM A;  1Z5V A;  1ZUQ A;  2BOC C;  3AK1 A;  2FKX A;  4K0K O;  1H2G A;  4UV8 A;  4BWA A;  5H6Q A;  5CA0 A;  2Q9L A;  3CCJ V;  3AG2 C;  4DV0 O;  5BY1 A;  4DRX B;  1DF4 A;  3EHB B;  2VWK A;  1EZV H;  1G8M A;  4P2Z A;  2OWO A;  3AG7 A;  3T1H B;  2ZKO A;  1VQ4 V;  4Q20 A;  4X8A A;  1XI1 A;  3K03 A;  5H9C A;  4DR2 O;  4OPA A;  3IC9 A;  3JSN A;  1V55 C;  2QM7 A;  2V7Q G;  4I7Z B;  1OCC B;  1J5E O;  4I4T A;  2D3O W;  1YXB A;  2Q68 A;  2K1E A;  5KAF Z;  2JS3 A;  3TK1 A;  3QO7 A;  2DE0 X;  3AEI A;  3E8G A;  2LW1 A;  3K0G A;  4J7J A;  3K5M A;  4TV8 A;  3ZRW A;  1PNM A;  2NR5 A;  3CE2 A;  4KHP B;  2QJ1 A;  2P06 A;  4FLV A;  3ZHS A;  3OW2 U;  2H94 A;  1Q90 D;  5KX5 B;  3ABM B;  4L87 A;  4DYL A;  1PPJ H;  4AIL C;  2BE3 A;  5H6R A;  1GAX A;  4LFB O;  1QR8 A;  2IJH A;  4OGQ B;  5B1A C;  4F6E A;  1BQZ A;  3OR6 C;  3IC7 A;  5J2T B;  4MTF A;  3B09 A;  2EIM C;  3SYC A;  4FLY A;  2HEP A;  3LNM B;  4ICG A;  2WLI A;  1QHT A;  3QF7 A;  3QO5 A;  1E1Q G;  3D36 A;  3ABM C;  1YJ9 V;  2ZDI A;  1SKV A;  1Q6I A;  1I5Y A;  1N0J A;  4UVA A;  2IM9 A;  4G28 B;  3ZN1 A;  5LOV A;  4IYH A;  3I55 V;  3N2K A;  1LUW A;  1A32 A;  2R72 A;  2HHH B;  2W6J G;  5LMN O;  3ZJZ A;  2PZS A;  2HJD A;  3WB0 A;  1WP7 A;  3P30 A;  3OGC C;  2JEU A;  1KD1 W;  1RPO A;  3VOU A;  4I9W A;  3T2M A;  2ZIM A;  3FB8 C;  1M90 W;  3BCC H;  4ZOL A;  1IBK B;  2EJ7 A;  3JAW A;  4JYY A;  2ARH A;  2YEV B;  3ZBH A;  2WSS G;  1N33 O;  2XUM A;  4MVR A;  1ROP A;  1HP8 A;  2XAS A;  4OPH A;  3WG7 C;  5DM6 V;  1K7D A;  4QJF B;  3D8C A;  3OUF A;  1BHB A;  1PL4 A;  1S77 D;  4UVB A;  1S76 D;  4TQD A;  2EX3 A;  3AG3 C;  1P4R A;  1XMQ B;  1AJP A;  5CA0 B;  3CC4 V;  3T1H O;  5FLX N;  4JI8 O;  5JQG A;  3QO8 A;  3SPC A;  4JI5 O;  3ZRV A;  1NTK H;  1CPY A;  4DV6 O;  3FB5 C;  1GTO A;  2AHY A;  2YID A;  1YIT V;  4P9O A;  3P3N A;  4J80 A;  1EN4 A;  1KKD A;  4EKW A;  4PA3 A;  4FM1 A;  4YHH B;  4PV1 B;  4I4T B;  2OYQ A;  1F23 A;  4DV2 O;  2QTO A;  4EEQ A;  3G6E V;  3IJ4 A;  1QLN A;  3W7W A;  1W2B U;  2YIB D;  3TJT A;  1SES A;  5BXZ A;  1LNQ A;  2E5L B;  4W4K A;  3K0D A;  4OXS A;  1R6T A;  1SQV H;  1GMG A;  1BCC H;  1K8A W;  3JCU Z;  4TV8 B;  1PD3 A;  3ZRW B;  3CXH F;  1XHX A;  5GTI Z;  3L74 H;  1WPB A;  3H1H H;  4FLW A;  3HKE A;  2BTQ A;  3W7S A;  3IAY A;  4LF5 B;  4X88 A;  3UM7 A;  1PNK A;  3CYO A;  3CMA V;  4JI2 O;  2VRZ A;  1AVM A;  5K1X A;  1JQ0 A;  5EC1 C;  2GUZ A;  2EIL B;  1R3I C;  2QM4 A;  2ZE7 A;  1N32 B;  2FYU H;  1S5J A;  2DMX A;  3TXS A;  2WLI B;  1R73 A;  1BS3 A;  2JVD A;  1NR1 A;  2DWD C;  1MMM A;  4YY3 O;  1EM1 A;  3ZHV A;  5LOV B;  4GX0 A;  1N34 B;  3N2K B;  2YC0 A;  3THO A;  3H1L H;  4B08 A;  3RGB A;  3HPL C;  3ETE A;  1Y67 A;  3CRM A;  3SYQ A;  2KKW A;  3FB6 C;  5BMV A;  3LDC A;  2OCC C;  4DR1 B;  3FKS G;  4GKK O;  1XL6 A;  2A0L A;  2JJ2 G;  3O9O A;  3E86 A;  1YJW V;  2CTQ A;  1B04 A;  1D5N A;  4KUM A;  5B66 Z;  4WFB V;  1H8E G;  3G6B A;  3JAK A;  1SQB H;  4PJ0 Z;  4ZOL B;  4GT1 A;  3JAW B;  4MVQ A;  4U3J A;  4NXM B;  1NH2 C;  2YXH A;  1FPO A;  3T1Y B;  4NTX A;  5EBM C;  4DV7 O;  3SGI A;  3AG1 B;  1VP7 A;  4ABM A;  2RMK B;  1Y74 A;  4YIP A;  3O65 A;  5D5Q A;  2VQF O;  2A79 B;  4J9Z B;  1QR9 A;  1MA1 A;  2QWQ B;  1VF6 A;  3BAB A;  4LF4 O;  3CPW U;  3ABT A;  2ZNI A;  1P7G A;  2F4V B;  3AG1 C;  1H38 A;  5JQG B;  3WU2 Z;  3E89 A;  1I94 B;  1P7B A;  1SZX A;  1SF9 A;  5L3C A;  5B1O A;  1T5E A;  4YHH O;  3CRR A;  4LF8 O;  4NXN O;  3OR7 C;  4X65 B;  1TA8 A;  4UUJ C;  3MHH C;  2IH1 C;  3FAV A;  2MK3 A;  3ASO C;  4UB6 Z;  2UXN A;  3N2G A;  3ABL C;  3KCX A;  5BZB A;  3CXC U;  1DLB A;  3AG4 C;  4NVP A;  2WAM A;  1OCO B;  3A2F A;  2PYL A;  2DW4 A;  1D2D A;  1KEC A;  4CH6 A;  3VQW A;  3JD0 A;  1K73 W;  4YJ3 A;  1FXK C;  4P9P A;  5FNV A;  3CSX A;  2BTO A;  3L73 H;  2CGO A;  1M5I A;  2PYJ A;  2C2A A;  3M8A A;  4TSF G;  3HKE B;  1SET A;  2BTQ B;  1GK9 A;  2F1M A;  4PEL A;  4X1Y A;  4J10 A;  1WP8 A;  3NXS A;  4U7O A;  3QG5 A;  1ZX3 A;  2P4V A;  1QCE A;  2JS5 A;  4IIJ A;  2DYS B;  3CX5 F;  2HJF C;  4K8X A;  3ZRS A;  4BW5 A;  1DK1 A;  2GUZ B;  1L1F A;  3CRQ A;  3SPI A;  2W0F C;  2RCV A;  3ZX6 A;  2UXX A;  1VQP V;  1Z5W A;  2Q0A A;  4LF6 B;  5B1B C;  2ITC C;  1HNX O;  4TWK A;  2EZO A;  1GN3 A;  3FD9 A;  1W0K G;  1Q7Y W;  5CBH A;  2P90 A;  2A7W A;  2ZXW C;  2UUB B;  3ZCC A;  5LXT A;  3UT5 A;  1B3Q A;  4PDM A;  2A06 H;  2YS8 A;  1LUV A;  4ZBM A;  5BR8 B;  4Z2W A;  5BMV B;  4PI0 A;  4LFC B;  1B06 A;  1NKD A;  4O2B A;  5EYP A;  3K5N A;  3ZN0 A;  2WLK A;  1MSW D;  4RAI A;  1XMO O;  3JAK B;  1F7Y A;  3OEH G;  4DR5 B;  1FAF A;  1WN7 A;  4U3J B;  2OTL V;  2L6L A;  4NTY A;  1K9M W;  4DV4 B;  3BFR A;  2P5O A;  2WLL A;  3MDS A;  2CH7 A;  1Y74 B;  4GCZ A;  4TV9 A;  5AG2 A;  1HR0 O;  2R70 A;  2UXD B;  4XDL A;  1CXZ B;  1UFI A;  1GN4 A;  3BA9 A;  3WB1 A;  2D2C B;  1S0V A;  2AZ2 A;  3K9S A;  1KBH A;  1BQ0 A;  2QM8 A;  2VQE O;  2N74 A;  2HP8 A;  4I9Q A;  2Q67 A;  1GRJ A;  1E1R G;  4H44 B;  4X65 O;  3OE7 G;  4DV3 O;  4OX9 O;  2QA4 V;  4E4E A;  3GVM A;  1MOF A;  2UU9 O;  3FAV B;  2X7R B;  1N4C A;  3N2G B;  2CTW A;  5L3D A;  5IWA B;  4RUF A;  3SYO A;  4JTA B;  4JI7 B;  4GZR B;  5IYC O;  4O4H A;  2IBZ H;  1RM1 C;  4I50 A;  1NJI W;  4F6R B;  4J11 A;  4YJ3 B;  3K06 A;  4LFA B;  2ZM6 B;  5FNV B;  2UUC B;  2WPD G;  1SC5 B;  3J81 N;  4MT8 A;  1IX9 A;  4U7N A;  4CBC A;  2ZR3 A;  4WFF A;  1SQX H;  1PM9 A;  4CH3 A;  3K57 A;  4X1Y B;  4QGP A;  4PD4 F;  3ABK B;  5LMU B;  4F4L A;  4IIJ B;  1HNW O;  1XBL A;  3CHX A;  1JMK C;  1RFY A;  2A9H A;  5LP6 C;  2DQ3 A;  2UUA O;  4JI1 B;  3H1I H;  1RPR A;  4B3S B;  3ABK C;  1NR7 A;  3E2E A;  4J9Y B;  3KKY A;  3RYC A;  1YTF B;  3LSQ A;  2Y4U A;  4LF7 B;  5IY5 B;  3TXQ A;  5KHK A;  1FD9 A;  5B5E Z;  5LXT B;  3UT5 B;  3ZHR A;  4LFC O;  4MW3 A;  5DEC A;  1MNG A;  2EIK C;  1K92 A;  4O2B B;  5EYP B;  4DR5 O;  5L3G A;  4DUZ B;  1Q81 W;  2DN9 A;  5JCO C;  2Q8V A;  2QWR B;  4MSW C;  4H13 B;  1ZLZ A;  2Z0A A;  5TIS Z;  3ZMV A;  2QWO B;  2WLL B;  3CCR V;  2CH7 B;  1FJG O;  4A5U B;  3CCS V;  4TV9 B;  4BR6 A;  2X6B A;  3B8N A;  4UVC A;  4JYC A;  1NQT A;  4LF9 O;  2E3C A;  2YSU B;  3TCU A;  4MTO A;  1ENV A;  1YHQ V;  2HFE C;  1NT2 B;  4X64 B;  3SJA C;  1XNR B;  4DW0 A;  1OCC C;  5LA6 A;  1Q8I A;  3G71 V;  3P32 A;  1TAE A;  3OTO O;  4WBN A;  3SYA A;  2XAH A;  2GHY A;  1KP2 A;  2QWN B;  1TUB A;  2UXB O;  4PDL A;  1JJO A;  1L0L H;  1JOY A;  1VQN V;  3UQ8 A;  1M57 B;  2ATK C;  4X20 A;  1TGO A;  5LL6 Y;  3DTU B;  4CC5 A;  1YI2 V;  1N36 B;  5EIB D;  4EFB A;  4DR3 B;  3DGE A;  4DW1 A;  4I5S A;  1EZJ A;  4XDJ A;  1R1B A;  1NU1 H;  4JF3 A;  1S72 V;  3GB7 C;  1N8R W;  4DR7 O;  5JVD A;  4JI6 B;  4WFH A;  4KFM A;  5KMG A;  1FS0 G;  3ETD A;  1XUQ A;  2QKS A;  1OCZ B;  4O4H B;  2YXL A;  4MVS A;  1WLE A;  4I50 B;  5LYJ A;  3OTF A;  2DJV A;  2HLD G;  2QR4 A;  2W6I G;  4JI0 B;  3VQV A;  3BRC A;  1IBL B;  1GH6 A;  2YI9 A;  3LSS A;  1NBM G;  3BY6 A;  2P6J A;  1WPX A;  4MVM A;  2KQX A;  4EFE A;  2CAZ C; 
#chains in the Genus database with same CATH homology
 3GWO A;  3E83 A;  5J9P C;  3CC2 V;  4GX0 A;  2ZXW B;  3B77 A;  5EBW C;  3LDE A;  4R7C A;  3E35 A;  1JPX A;  2IH3 C;  1COW G;  3JD2 A;  5B3S C;  1M1K W;  2X0L A;  3ZMT A;  4FJC C;  2XAQ A;  1K33 A;  3SPG A;  1CEZ A;  1AI7 A;  1VQO V;  1BHA A;  1K4C C;  3HPL C;  3ETE A;  4LCU C;  3CCU V;  4GX5 A;  4JPR A;  3SYQ A;  1K5S A;  3FB6 C;  2IJJ A;  3LDC A;  3CCQ V;  2OCC C;  3W7T A;  3FKS G;  3JYC A;  1XL6 A;  2A0L A;  2JJ2 G;  2IU3 A;  3EFF K;  5KA6 A;  3E86 A;  1YJW V;  1SER A;  4G27 B;  4R50 A;  2DWE C;  1VQ5 V;  4KUM A;  3AG2 B;  3ZRX A;  4RO2 A;  4WFB V;  1H8E G;  1H8H G;  3HB3 B;  4GT1 A;  4MVQ A;  1NH2 C;  1BMF G;  1YTF C;  2PI5 A;  4E2L A;  4FIP C;  5IY5 C;  1FXV A;  2KB1 A;  3B8M A;  1NVP B;  4XDK A;  2X6A A;  1AR1 B;  5EBM C;  3AG1 B;  3FYE B;  3CC7 V;  2JIZ G;  3STL C;  5KUK A;  3SPJ A;  3X2Q B;  2B1G A;  3CP1 A;  3BEH A;  3E8B A;  1V55 B;  1MAB G;  2A79 B;  2XAG A;  4J9Z B;  1QR9 A;  3RVY A;  4LC1 A;  2FTK A;  2QEX V;  3CPW U;  1GM9 A;  3K08 A;  3ABT A;  3W7X A;  4PA7 A;  3E8H A;  1NVP C;  3K9A A;  4JAV A;  4P30 A;  4WFE A;  1EFR G;  2JEX A;  3AG1 C;  1GM7 A;  1H38 A;  3SJQ C;  3E89 A;  3F7Y C;  1P7B A;  2HR3 A;  3F5W C;  2XND G;  3X2Q C;  1QVG U;  1V54 C;  4QIW F;  5LHG A;  5L3C A;  3R65 A;  1M56 B;  5B1O A;  2IW5 A;  1Y4M A;  4QE7 A;  2WLM A;  1OHH G;  2EJR A;  5FL7 G;  2IU0 A;  2Q6A A;  2HG5 C;  2H8P C;  4FMT A;  3OR7 C;  1VQL V;  3OMN B;  4UUJ C;  3MHH C;  2HKO A;  2IH1 C;  2MK3 A;  4JAS A;  2AHZ A;  5IYB O;  2M7W A;  1NH2 D;  3ASO C;  2UXN A;  5LGT A;  3I56 V;  5B1A B;  3ABL C;  3T1C A;  5BZB A;  3IGA C;  1PL0 A;  3CXC U;  1DLB A;  2ZR2 A;  4PA4 A;  4HAM A;  3AG4 C;  1RM1 B;  2Q69 A;  2WAM A;  4R8C A;  1OCO B;  2EIM B;  5CMU A;  1CP9 A;  5LHH A;  2DW4 A;  2V1D A;  4MVZ A;  3CCM V;  3FYI B;  1Y66 A;  1KEC A;  3JD1 A;  2GSM B;  3JD0 A;  1K73 W;  4JGS A;  1FXK C;  4P9P A;  1JX9 A;  5DN6 G;  2XAJ A;  1DTO A;  4WFG A;  4G2K A;  4H37 A;  1BL8 A;  3CCV V;  1OZ0 A;  1M57 C;  2C2A A;  4TSF G;  2F43 G;  1SET A;  2CK3 G;  4XBF A;  1GK9 A;  4PEL A;  1Q82 W;  3NXS A;  4U7O A;  3CCL V;  4QE9 A;  1QCE A;  4FPP A;  2EZP A;  2DYS B;  5EC2 C;  2DYR B;  2OTJ V;  2HJF C;  4MTG A;  4JYB A;  3ZRS A;  4BW5 A;  4X89 A;  3OFN G;  1L1F A;  3SPI A;  4DO2 A;  1B6Q A;  2W0F C;  4GX2 A;  1OCZ C;  4RQE A;  3K3W A;  1R3J C;  1KP3 A;  3CME V;  2EIL C;  3IFX A;  1OCR C;  3VBB A;  5CBF A;  3SPH A;  2R9I A;  2UXX A;  1VQP V;  4MVU A;  4MTX A;  2ZDI C;  3CD6 V;  5B1B C;  4FK5 C;  1QBZ A;  2WLH A;  2ITC C;  2DYR C;  4PDV A;  3ETG A;  4MS2 A;  2EZO A;  4TWK A;  4YXW G;  1W0K G;  1J95 A;  3OAA G;  4BIU A;  2YEV A;  1Q7Y W;  5CBH A;  2P90 A;  1KC8 W;  2ZXW C;  2R9R B;  4JTD B;  5L3F A;  3ZCC A;  3T4Z A;  3WG7 B;  3K79 A;  3STZ C;  4PDM A;  1TUE B;  2WLJ A;  1K97 A;  2NLJ C;  1THZ A;  2EIK B;  4ZBM A;  2ZQM A;  2P67 A;  3JD4 A;  2JJ1 G;  3AG3 B;  1NKD A;  2BOC C;  2ZD9 A;  3CCE V;  4TT3 G;  1K5Q A;  3ZN0 A;  3QNE A;  1AI6 A;  1F4M A;  5IYD O;  2WLK A;  1H2G A;  4UV8 A;  1MSW D;  4RAI A;  5H6Q A;  4H33 A;  3OEH G;  4MW8 A;  4JAU A;  3CCJ V;  3AG2 C;  2OTL V;  1K3E A;  1MG1 A;  5CBG A;  1DF4 A;  3OMA B;  1F4N A;  1K9M W;  3EHB B;  1G8M A;  1JCH A;  4P2Z A;  1AI4 A;  2WLL A;  3FB7 C;  1VQ4 V;  4Q20 A;  4X8A A;  3K03 A;  4GCZ A;  1R3L C;  2EIN B;  1I5X A;  5H9C A;  2JDI G;  3PJS K;  4XDL A;  1R3K C;  4UV9 A;  1V55 C;  2QM7 A;  2V7Q G;  1OCC B;  4PA9 A;  2D3O W;  2Q68 A;  2K1E A;  2JK5 C;  3MHS C;  1S0V A;  2B5U A;  3TK1 A;  3QO7 A;  2QM8 A;  1GO3 F;  3AEI A;  2Z5U A;  1R6N A;  3E8G A;  2Q67 A;  3G4S V;  4WCE V;  1E1R G;  2Z3Y A;  1FXK A;  5LGN A;  3K0G A;  1YTF D;  2LFR A;  2LFS A;  3OE7 G;  1R6K A;  3ZRW A;  1PNM A;  4LBE C;  5B1N A;  1M56 C;  2QA4 V;  3RBZ A;  2WLN A;  1MOF A;  2H94 A;  4GX1 A;  3OW2 U;  3RW0 A;  2X7R B;  3ABM B;  1FXH A;  4L87 A;  2NNU A;  4RQF A;  4HYO A;  5H6R A;  1QVF U;  1AJQ A;  2Y69 B;  5L3D A;  5CA3 A;  4RUF A;  1QR8 A;  3SYO A;  1VQM V;  1YJN V;  2IJH A;  4JTA B;  5B1A C;  5IYC O;  2HVJ C;  3OR6 C;  3KG2 A;  4QPK A;  3IC7 A;  4MTF A;  1NVP D;  1RM1 C;  2DQ0 A;  1NJI W;  1OCO C;  2EIM C;  3SYC A;  2EBO A;  3LNM B;  5KA5 A;  2EIJ B;  2WLI A;  3K06 A;  3QO5 A;  1YJ9 V;  1E1Q G;  3D36 A;  3ABM C;  1ZWI C;  2ZDI A;  2WPD G;  5LGU A;  4MVO A;  4MT8 A;  1UJW B;  3SYP A;  4U7N A;  1ARO P;  1I5Y A;  3OMI B;  4N21 A;  4UVA A;  4CBC A;  1KQS U;  2Y69 C;  2ZR3 A;  4WFF A;  2OT5 A;  4G28 B;  5B3S B;  3ZN1 A;  3ABK B;  1QLE B;  3W7U A;  4F4L A;  4WFA V;  3I55 V;  5LBQ A;  1JJ2 U;  1K4D C;  5KUM A;  4CZZ A;  4QPJ A;  2W6J G;  2OCC B;  1AJN A;  2DYS C;  3ZJZ A;  2QE7 G;  2A9H A;  2DQ3 A;  3ZMZ A;  1SRY A;  3P30 A;  3UKM A;  3JCZ A;  1IXM A;  1RPR A;  2X6C A;  3OGC C;  2JEU A;  3ZMU A;  1KD1 W;  1Q86 W;  3ABK C;  1NR7 A;  1RPO A;  1QLE C;  3JD3 A;  4I9W A;  3VOU A;  1NH2 B;  3T2M A;  3E2E A;  3OM3 B;  4J9Y B;  3FB8 C;  1VQ9 V;  4DXW A;  1M90 W;  1YTF B;  3LSQ A;  5EK0 A;  4BIZ A;  5IY5 B;  3M99 B;  5HFM A;  1XL4 A;  2YEV B;  2WSS G;  3ABU A;  1E79 G;  3D3I A;  4MVR A;  1ROP A;  2XAS A;  4BAY A;  3MD0 A;  3WG7 C;  1JVM A;  5DM6 V;  1K7D A;  4MW3 A;  4R6Z A;  4QJF B;  1PKX A;  2EIK C;  3ZIA G;  1K92 A;  3OUF A;  5L3B A;  1BHB A;  4UXN A;  5L3G A;  1S77 D;  1Q81 W;  4UVB A;  1S76 D;  3AG3 C;  1P4R A;  2IJI A;  5E1A C;  2ITD C;  1AJP A;  3CC4 V;  3OEE G;  4KP4 A;  4MSW C;  4N23 A;  3QO8 A;  3SPC A;  1V54 B;  1S3J A;  5IDJ A;  3ZRV A;  3ZMV A;  1VQ6 V;  1CPY A;  2WLL B;  3CCR V;  3F7V C;  3FB5 C;  1GTO A;  2AHY A;  1YSC A;  2B1I A;  4HZ3 A;  1YIT V;  4P9O A;  3CCS V;  2WWW A;  4PDR A;  2X6B A;  3B8N A;  4UVC A;  4LP8 A;  1G4Y B;  5LHI A;  4JYC A;  2P7T C;  1NQT A;  1KKD A;  2EIN C;  4EKW A;  2YSU B;  3TCU A;  3ASO B;  4MTO A;  3WFV A;  1ENV A;  3OUS A;  3E8F A;  4PA3 A;  3ABL B;  1AI5 A;  2XAF A;  1F23 A;  1F51 A;  4ASU G;  1YHQ V;  2HFE C;  3AG4 B;  4WF9 V;  4JTC B;  5L3E A;  2HVK C;  2QTO A;  3ASN B;  1OCC C;  3G6E V;  1QLN A;  2LP7 A;  3G71 V;  3P32 A;  3W7W A;  1W2B U;  2XOK G;  1YIJ V;  3LDD A;  3SYA A;  2XAH A;  2GHY A;  1SES A;  3A0R A;  1KP2 A;  1LNQ A;  1GM8 A;  4QNH B;  4PDL A;  1VQK V;  1ORQ C;  1FXK B;  3K0D A;  4OXS A;  1JOY A;  4ZKI A;  3ZMS A;  1GMG A;  1K8A W;  1VQN V;  3ML0 A;  1PD3 A;  1S5H C;  1M57 B;  2ATK C;  3ZRW B;  3K04 A;  4RUE A;  3TET A;  3DTU B;  5GW7 A;  1YI2 V;  1HWY A;  3ASN C;  3DGE A;  4I5S A;  1EZJ A;  4XDJ A;  3W7S A;  1VQ8 V;  4JF3 A;  1S72 V;  3GB7 C;  4X88 A;  1N8R W;  3UM7 A;  2PI4 A;  1PNK A;  4WFH A;  4KFM A;  1M9N A;  1FS0 G;  3CYO A;  1FFT B;  3ETD A;  3CMA V;  2BOB C;  3RVZ A;  1K34 A;  2QKS A;  1JQ0 A;  1OCZ B;  4Z1M G;  4MVS A;  5EC1 C;  1PNL A;  1WLE A;  5HFL A;  5C93 A;  2EIL B;  1R3I C;  1OCR B;  4PA6 A;  3T4D A;  2HLD G;  1VQ7 V;  2WLI B;  1R73 A;  3H01 A;  2W6I G;  2IJK A;  1EBO A;  1DF5 A;  5EBL C;  5CN0 A;  1NR1 A;  5B1B B;  2EIJ C;  3LSS A;  1NBM G;  2DWD C;  3BY6 A;  2P6J A;  1WPX A;  4MVM A;  1SZT A;  2Y48 A;  1GKF A;  1W0J G;  3LUT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...