5IYBO

Human core-pic in the open state
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
99
structure length
99
Chain Sequence
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna
total genus 27
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02268 TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain
O PF02751 TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.190 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5iybO01
2.30.18.10 Mainly Beta Roll TATA box binding Protein, subunit D; domain 2 Transcription factor IIA (TFIIA), beta-barrel domain 5iybO02
1YTFD 5IYBO 1RM1B 5IYCO 1NVPC 1NVPD 1RM1C 5IYDO 1NH2D 1NH2C 1YTFC
chains in the Genus database with same CATH superfamily
5JWPA 1OV9A 4W4LA 4GCZA 1IBKB 4WFGA 4FK5C 5LL6Y 4K35A 4B3MB 1D2DA 3T1HB 1AI4A 3OGCC 2VQEB 3CCJV 3OR7C 2EILB 5IY5C 1HW7A 3ZBHA 2Y4UA 3D8CA 5IWAO 2QWOB 4UFZA 3TK1A 2GTSA 1XOUA 3A8TA 3UKMA 2BTQA 3K0DA 4QPJA 2XOKG 2IW5A 2X7RB 1K97A 4LNUA 2WLJA 4K8ZA 4EEQA 1QU7A 4FMTA 5HFLA 3P3NA 1NH2C 3PJSK 4YIOA 1P84F 1OCZB 4FVMA 1W0JG 3K04A 1PP9H 1L1FA 2F93B 1Y74B 3ZMZA 1IXBA 1V55C 4X1YB 4FLUA 2PYLA 1FFXA 1NKDA 4UVAA 2F1MA 2QSAA 1R6TA 1JVMA 3SPJA 5IYDO 4FFKA 1IZ3A 1MSWD 1DLBA 4CZZA 4UXNA 2PI5A 4J80A 2GDSA 4PDRA 3ZHSA 4R6ZA 3BABA 2C2AA 4DV1O 2DMXA 2YC0A 1K33A 1QVGU 3CPWU 5KHJA 1GM7A 3JSNA 1HNZO 1VQKV 4DV5B 5B3SC 3K5MA 3K79A 1GN6A 1ZWIC 2GUZB 2EIKB 4I55A 3HKBA 5ITZA 1JCHA 2VQFB 3OEHG 3SGIA 4O4JA 2CTRA 3SYQA 4HAMA 2Y48A 2DYSC 1IXMA 4H44B 4JI3B 3B2EE 2D2CB 3JD3A 2XASA 3K08A 1N33B 4ZI7A 4IL6Z 1AJQA 5CA0B 5IJ9A 4FLYA 1H38A 5EBMC 5KUMA 1BE3H 2P6JA 1EN5A 4TUYB 2OCCC 1QCEA 3P30A 4YJ2A 1WB8A 4DR3B 1GTOA 2FYUH 2UXBB 3O65A 1RPRA 1IBLB 3K3WA 5C8YB 2XAFA 4BIOA 1S5JA 2QGNA 2HG5C 3J7AU 4YJ3A 3CCQV 1WP7A 2JS5A 1D5AA 4DW1A 5B66Z 3CSXA 2GV9A 1PM9A 4KHPO 2HVJC 1L0NH 2IJHA 1PPJH 1K5SA 4DR6B 1SQBH 1YVWA 4LF9O 1AJNA 3T1YO 4YY3O 1FJGB 2YXYA 5LXTA 3P3PA 2QKAA 1J5EB 3G67A 4AQYO 4X65B 1QLEC 5IDJA 2UUCO 5EC2C 3AG1C 4H0LB 3ABMB 5FPRA 2DYRB 2YEVB 4X64B 4MT8A 1TUBA 1IBMB 4WBNA 3JAMN 4J7JA 3BRCA 3RBZA 2EIMC 4W4KA 1XMOO 3JARB 1ORQC 4LF4B 4JYYA 1N36B 2W6IG 4E2LA 4E4EA 1AJPA 4NTYA 1AR4A 3QTCA 1HNXB 4LF8B 4JI4O 3OD4A 3FKSG 3JAWB 5CB4A 4MVRA 1MZEA 1HWYA 5KUKA 2IJIA 3QVNA 2AHYA 4CC5A 2A06H 2CAZC 1TVKA 1GK9A 1WA8A 1PNLA 3CJHA 3G6EV 4WF9V 5FNVA 1N32O 1QNMA 5HFMA 2ZIMA 2H94A 3I56V 1H2GA 3OTFA 5B1BC 3AK3A 3AEIA 2ITDC 4FM2A 1VQ9V 3N2GA 3E22A 4LFCB 3UCSC 1I08A 2WLKA 3HPLC 4JI0O 3FB7C 4O4IB 1JPXA 2ZE6A 1IBKO 1QR8A 4B3MO 1Y67A 3T1HO 5H2FZ 4DR5B 2VQEO 2CDYA 1SC5B 3CRAA 5A9GA 1TUEB 3JATA 4BIZA 1GN3A 1SZXA 3LUTB 2Q4PA 1PV0A 2BSKB 2M7WA 2X0LA 4FM1A 2Q5ZA 4NB5A 4B7KA 2QEXV 1GH6A 3G80A 1URFA 5K1XA 4GKJB 2ZQMA 4LFAB 2HLDG 3F5TA 1M5IA 3BCCH 3ICXA 1KP3A 4G27B 4MW8A 4X1IA 4P9OA 2KG7B 4U3FH 4TV8B 3Q4HA 3QO5A 2E3CA 4I50A 2IBZH 3CC7V 3BEHA 5BXZA 4JZ2A 5KAIZ 3K57A 2QM7A 2XTAA 5BR8B 1VARA 2V4DA 3BY6A 4NR1A 5CBFA 1S0VA 1IVSA 3AG3C 4DO2A 5EYPB 3DC5A 2A3QA 4JZGA 1K8AW 5GONA 1M57B 4QGPA 4DV5O 1OHHG 1VQ5V 1UPGA 2UUAB 3X2QB 1PNKA 2VQFO 1R6KA 3E8GA 2WA3A 3HB3B 3BHPA 3DGEA 4JI3O 3AG7A 4DV0B 1BHAA 3U0ZA 4L8JA 3WG7B 5LP6B 2CGOA 2Y0IA 4FFBA 4DV4B 3VQWA 1SESA 1N33O 3CC2V 1S77D 3K9AA 4GX1A 3SYPA 3RWRD 1YJ9V 1P4RA 3FB8C 5KA5A 1Q7YW 3RN4A 3CCUV 1NTKH 1R3KC 2P06A 2AHZA 1L8DA 4H37A 3S3WA 3K0GA 1V54B 3TGUH 4DR3O 5JCOA 3ETDA 2UXBO 3E35A 1IBLO 3IFXA 2WLIA 4PHZA 1RPOA 4J9YB 3JD0A 1YJWV 3IJ4A 3KKYA 4I0XA 5A2QN 3ZHTA 2KQXA 2X6BA 2IH1C 5LHIA 2B1IA 4Z2WA 2ODMA 3LNNA 3K5LA 4XDKA 2WLLA 3K58A 2YIBA 1G1XB 1ZAUA 3DC6A 3RYIA 1H2SB 1OCRB 5LA6B 1VIBA 4DR6O 2JJ1G 4MVOA 3F5WC 1YTFD 4RWUA 1FJGO 1RFYA 5KX5B 1YSCA 5GTHZ 1YJNV 1J5EO 1R3LC 1XILA 1D5NA 4TV9B 4OX9B 1R3JC 2F95B 4J41A 4X65O 4LR3A 1NVPC 4RQFA 3FAVB 2CUGA 4JV5B 4CH3A 4ZHQB 4X64O 1KP2A 1Y76A 3A0RA 1IBMO 1FXKC 2WLNA 5J2UA 1PKXA 4CS2A 1Q86W 1NI8A 4LF4O 2HEPA 1N36O 5LMUB 2A0LA 3E8BA 4UCSA 1YZBA 4AILC 3AK2A 1OCOC 1HNXO 4LF8O 1Q82W 2Z0AA 2R70A 2GBOA 2BE3A 4LC1A 4DV3B 1GN2A 1WAZA 1IDSA 3H1LH 1NS1A 1ZL8B 2EINB 1MG1A 3P32A 1PD3A 1F51A 4NKGB 1DF4A 4CC6A 3ZRSA 1SQVH 5EIBC 3FD9A 3U10A 1KKDA 2BOBC 3LSSA 1A32A 1GKFA 3MD0A 2HJFC 2EZPA 3FB5C 1FD9A 4IHJB 2K9PA 2YICA 3SJCC 4MVSA 4G2KA 4I7ZB 1FS0G 5IY5B 4LFCO 1DGSA 5LGNA 2ZNJA 4DK1A 3F7VC 1X59A 3RFRA 3L74H 4JI5B 1H8HG 1GM8A 2BTOA 3A0HZ 3TJTA 1AR5A 4DR5O 4Z1MG 1XMQB 2ZDIA 1JJOA 3CCSV 4JI4B 3H01A 1CP9A 2P7TC 4R8CA 1NH2B 2Q7HA 1H2LA 4TSFG 4NVPA 3SPHA 1TAEA 2FL4A 1V55B 4EB6A 3HKEB 3OTOB 4U7NA 4GKJO 2DN9A 4LFAO 3JASA 1Q81W 4GKKB 3JALB 4FZ1A 3U11A 2CGNA 3ABUA 3O9OA 2N74A 5BMVB 2BCCH 1RSOA 1KUQA 1NZ6A 5B1AC 5JQGB 2JK5C 3E8FA 2DOSA 2QM8A 4U3JA 5LYJB 2P22C 2XUMA 2MK3A 2JEXA 4QIWF 4RO2A 1W2BU 4JI0B 2G38A 1I94B 2DQ3A 3MHHC 2OWOA 5B3SB 5BR8O 3DXRB 1QR9A 4X1KB 2H3OA 3WB0A 4JYAO 3UO2A 1KD1W 3RT3C 3JD2A 1FXHA 3UT5A 2DYSB 2GTAA 3ASOC 2FB5A 2UXNA 3ZRWB 4I9QA 1SA0A 4PA4A 4FPPA 2YXHA 1CEZA 4P2ZA 4IIJA 2UUAO 1XL6A 3PN1A 1YCIA 2OCCB 3D3IA 3L70H 4RUFA 5FPOA 1RM1C 4DV0O 4GUNA 4O2BB 4FLVA 3I55V 3CP1A 2XNDG 3JAKB 4I9WA 4JAAA 4DV4O 4DR1B 1O9HA 2JS3A 1AP5A 1NBMG 2WLMA 1Q43A 1AR1B 4ZBMA 3STLC 1QHTA 4MVZA 2IJKA 2UXCB 2BOCC 3HKCB 5KMGB 2XAJA 3E83A 2YIDA 4Q20A 4LP8A 1ZSPA 1MSDA 5L3GA 5J9PC 3UM7A 4GLXA 2QE7G 1GO3F 5H9CA 3ZEDA 2Q7EA 2AZ2A 1Y74A 4JAVA 4KXRA 1P49A 2ZE5A 1BSMA 4X1YA 1M9NA 5DEDA 1NT2B 4NXMB 3ZHUA 3OGIB 3A0BZ 3HKBB 5ITZB 1VF7A 1PL4A 5H5NA 4BW9A 1QLEB 3LDDA 2ZR3A 3A2FA 2UXXA 3AG1B 1BZKA 4JYCA 4QJFB 1S76D 3KCXA 4KUMA 4ZI7B 3OMAB 4OX9O 2VS0A 1DTOA 2EIMB 1Y4MA 4Z1VA 2DE0X 5FLXN 2QTSA 1AILA 2GUZA 2JIZG 5K1PA 5CMUA 4JV5O 2B5UA 3EHBB 4I4TB 3CMAV 4ZIBA 1NU1H 1BHBA 1Q5OA 2IH3C 3ZMVA 1NH2D 3G4SV 3KG2A 1H2MA 5KAFZ 5LMUO 2OTLV 4RAIA 4TUYA 2JEUA 5CA1B 1H8EG 2RQ6A 1Z5WA 4LWSA 2F4VB 4F6RB 4DV3O 2ILMA 1ENVA 1OZ0A 3CCLV 2JDIG 3CCEV 4JAUA 1SQPH 2M6YA 5B1BB 3K03A 3B77A 3C3TA 2R9IA 1EFRG 5J2TA 4ABMA 2OT5A 3JCUZ 2ZR2A 1VEWA 3BFRA 4OXSA 2CTWA 2F43G 5IYZB 3CWBH 2JGDA 2N05A 4AI8A 4PA6A 5B1OA 2WWWA 4X9QA 4WBNB 2JGUA 3BA8A 1NR7A 4CH6A 3R65A 5L3BA 5C93A 3H1KH 4BR6A 5JVDA 4OPAA 2P5OA 4JI5O 1W59A 4I5SA 4PI0A 5DN6G 2ZE8A 2P90A 2Q73A 2KKWA 1Q6HA 1XMQO 4J9ZB 1HP8A 5KHGA 1IURA 2YEVA 3ZHVA 3D3QA 4YHHB 1QLNA 3OMIB 3SDLA 5LBQA 1SRYA 3CCRV 2AZ0A 1TVKB 2LW1A 3QO7A 4OGQB 2F23A 1N0NA 3OTOO 1VQNV 3E8HA 3JARA 4GKKO 2UXDB 2ADQB 5LGTA 3SYAA 5EBWC 4KFMA 4X62B 3FX7A 2W0FC 1VQ6V 3CRCA 3JAWA 4TWKA 5L3FA 4DR7B 4LFBO 1QQCA 3RYHA 2RMKB 3AG3B 1R1BA 2X6CA 4WCEV 1ZTEA 4IYHA 3J80N 4MTOA 1I94O 2QA4V 4UCVA 3LDEA 3WU2Z 3SJQC 4UVBA 2QWRB 2FKXA 1LUWA 3CXCU 1N34B 1SQQH 3FYEB 2QR4A 2YSUB 3JATB 2Q6AA 1S72V 2A7WA 2XAGA 1WP8A 1Y6XA 5IJ0B 3K06A 3D36A 4B3TB 1AP6A 4O4IA 1FAFA 1DK1A 4BW5A 5LMNB 5BZBA 4ZKIA 1G4YB 1N0JA 3K5OA 1MABG 4JI7B 2Y4TA 4FIPC 4A5UB 3ZRXA 2ZM6B 1M90W 3Q4HB 4DR1O 3JYCA 1M93A 3W7SA 3OW2U 1I5YA 1FFTB 2Q7GA 2UXCO 2EIJC 5EZYB 3C90A 2E5LB 2EULA 1FXVA 3K9SA 4HNAB 1AI7A 4TT3G 4F6EA 4JTAB 3B40A 1KMIZ 2HR3A 2KG7A 4TV8A 4JYAB 1ZX3A 1TGOA 4CS4A 4B7EA 2XHBA 1K92A 2R9AA 4K0KB 1DF5A 4FZ0A 2OYQA 2ARHA 5IE9A 4NXMO 1S5HC 1JR9A 4DV7B 4UV8A 1YTFC 5L3DA 1NVPB 4KP4A 4HBNA 3ABLC 3W7XA 1Q6IA 5TISZ 1AB3A 5AG2A 1EBOA 3D36C 1FXKB 4UB8Z 3NXSA 1WPXA 3MAQA 1BGYH 3CYOA 5IYBO 3ZMSA 4BIUA 4JF3A 5KA6A 2YDEA 3BPZA 2YS8A 1OCOB 3ETEA 4X66B 2E75B 4Q6GA 5KHKA 3SJBC 5LP6A 2XAHA 3WFVA 4O4HB 4JYBA 2ZNIA 4R50A 4J7ZA 1KKCA 2YI9A 4DRXB 3N2KA 1VQLV 3T2MA 2ZCEA 2EZOA 4PDMA 2WLLB 3UO3A 4QNHB 1XNRB 1F23A 3BVOA 3ABTA 2F4VO 5LOVB 2HFEC 2MW2B 3QO8A 3RYFA 3CHXA 4DK0A 3MHSC 4J7KA 1VMGA 1Z2GA 3M7MX 1CPYA 4JI2B 4JPRA 4TOIA 2RCVA 3W7WA 1VF6A 4X20B 5LA6A 4YXWG 3M8AA 5D5PA 3CC4V 4PELA 1K4CC 5KX5A 1JX9A 1R3IC 4MTGA 5IYCO 2L35A 3EFFK 3FFQA 3H1IH 3ETGA 1OCCC 3QG5A 4WFEA 4LF5B 4X8AA 5JCOC 3FAVA 4PA7A 2DWEC 4ZHQA 1NTZH 1K5QA 4O2AA 2LFRA 4YHHO 2W0XA 1SZTA 1SQFA 1M56C 4LCUC 4O4LB 5B1AB 2CH7B 4J42A 1P7BA 1XHZA 4UCUA 1VP7A 3RVYA 4FLZA 5JH7A 4BWAA 2UXDO 3HKDA 4WFBV 1WN7A 1YEWA 4X62O 2V7QG 4CH4A 3L73H 3WB2A 2QKSA 4DR7O 2UU9B 4WFHA 3ZN1A 2E76B 3OEEG 1ZL8A 1WJZA 1HR0B 3AG4C 3CCMV 1XREA 2DQ0A 4XDLA 1MOFA 5KHHA 3ASOB 3EVKA 2Q9LA 5B5EZ 3IGAC 4EFEA 5DM6V 2EBOA 1S3JA 4QE7A 1THZA 4UCTA 3B4SA 1VF6C 1N34O 1FKAO 3K59A 4IHJA 1JFFA 4J10A 4UCRA 3LDCA 1EZVH 1SKVA 1Y66A 2Q0AA 1RM1B 3CB2A 2ZD9A 1NVPD 1W0KG 1XBLA 4B3TO 2YIAA 2RNBA 1FPOA 3ABKC 2ZINA 4EB6B 3G6BA 1K34A 3B8NA 5LMNO 4KL1A 3SPIA 2Y69C 3W7TA 4JI7O 5L3CA 1XNQB 2E74B 2PGGA 2ZM6O 2LQTA 1KBHA 4DYLA 3I5DA 4LFBB 1FYJA 3RYCA 2D3OW 4C7UA 4GX5A 3RVZA 1GM9A 4ZOLB 2E5LO 2OTJV 3JALA 3L9DA 3JD4A 3E2EA 1VQOV 1YF2A 1AROP 3GB7C 1J95A 4EFBA 5BMVA 3UT5B 4K0KO 2H8PC 3ZJZA 5JQGA 4LF6B 2QWPB 1SA0B 3APQA 3OM3B 4DV7O 1Q3EA 3ZHRA 2BTQB 2IU0A 3J81N 4LNUB 3DXRA 2RDCA 1NJIW 2QM4A 2X6AA 3OUFA 4NXNB 4X1KA 1LUVA 2ZDIC 5CBHA 2PTMA 2IM9A 3SPCA 3CCVV 2W6JG 5BY1A 1B3QA 2EX3A 3ZRWA 1CXZB 1ZUQA 2CE4A 4JI8B 4DV6B 2CTPA 1FFXB 3ZRVA 1NQTA 3H1JH 3TETA 1VQMV 2ZXWC 2PYJA 3WB1A 3GWKC 3L71H 2ZT9B 4X66O 1UJWB 3ZMUA 4LH7A 4O2BA 4UB6Z 3OFNG 4H13B 3JAKA 1MNGA 3GVMA 2Q69A 1XHXA 5H6RA 2UUBB 5L3EA 1SETA 1ROPA 1R73A 4RQEA 5DECA 1BQ0A 3HKCA 5KMGA 3ZX6A 4DR2B 1XNRO 1E1RG 1YDXA 4EKWA 4I55B 3C3SA 1BCCH 4MW3A 2ITCC 4O4JB 2Q68A 3AG2C 3FB6C 4NTXA 2WSSG 1B6QA 1G6UA 4DW0A 2Z3YA 4JI6O 4GYCB 3CRMA 3ASNC 4JI2O 3T4DA 4MVMA 5KLVH 3VBBA 5IJ9B 1HNWB 5FL7G 4RUEA 1AI5A 4CBCA 1OJHA 3ZCCA 4YJ2B 2OIGA 2ZIOA 3QNEA 5JJJB 4P30A 2Q0OC 2EILC 1QVFU 4DUZB 1KU9A 4GX0A 3MDSA 4YJ3B 4B3RB 1M1KW 3KZIZ 5CA0A 2QWQB 3ML0A 2HP8A 1YIJV 4WFAV 4PJ0Z 1GAXA 1HDJA 1F4NA 4GX2A 4K8XA 4LF5O 3IC9A 3CRQA 2PF4E 4LWSB 4ASUG 4I4TA 3CX5F 1JOYA 3F7YC 1OCZC 4UUJC 1KB9F 2QJ1A 4JI1B 3SYCA 4HZ3A 2EJ7A 3E89A 5C8YA 4N21A 3E86A 3ZS8C 4JGSA 5LXTB 5J2TB 2CTQA 3LSUA 1O9GA 1YHQV 3OAAG 2XAQA 5D5QA 3SYOA 5EC1C 1VQ4V 5CA1A 4DV2B 4JTCB 4JTDB 3VQVA 2F66C 2JGDB 4F6RA 2UU9O 1LR1A 2LJ2A 2HVKC 2QWNB 1EN6A 3S3XA 4XBFA 1HR0O 1L0LH 1U97A 1TUBB 2WLHA 1IX9A 1XI1A 1BL8A 5JVDB 4MVQA 2KB1A 3W7UA 2EIKC 4NYKA 4DR4B 2FMLA 2LGWA 2IU3A 5IYZA 1COWG 3CMEV 1WPBA 1K7DA 1WLEA 2LO1A 2LW7A 3VQYA 5CB4B 2OCHA 1XDCA 4PI2A 1EZJA 4UVCA 1E1QG 1WA8B 4XDJA 2EIJB 3CJHB 4LF7B 5FNVB 2WAMA 2PI4A 1XUQA 1VQ7V 3HR0A 1XNQO 3OR6C 3ZN0A 2A9HA 1G8MA 3M99B 4PA9A 1JJ2U 4HYOA 3N2GB 3RYHB 3E22B 4X89A 1TA8A 2IJJA 1YI2V 2NLJC 2JJ2G 2PZSA 5JJEB 3B8MA 1K3EA 2Q8VA 1T5EA 3SPGA 3BAAA 3G71V 1YTFB 2GHYA 2A79B 3ABLB 5IT9N 4LF6O 2RJZA 4WFFA 3UQ8A 4D7TA 2WPDG 5H6QA 2K1EA 2P4KA 4B08A 4NTWA 4B3SB 4J11A 4MTFA 1V9PA 1K4DC 4NXNO 2PUSA 1Q90D 2P4VA 3ABMC 2DYRC 1EN4A 4X1IB 5IJ0A 2GSMB 4I50B 2QKCA 2HHHB 2BSKA 4JI8O 2YI8A 4DV6O 4MSWC 5GTIZ 2DW4A 2HJDA 2Q67A 1EM1A 1N8RW 2AGAA 3K5NA 4FLXA 4MTXA 1PNMA 3NR7A 1SF9A 1UFIA 4FLWA 1NR1A 1PL0A 4UCOA 3CD6V 3T1CA 4IGGA 1F7YA 5F2VO 2DJVA 2UUBO 4DUYB 1S5LZ 3TXQA 5GONB 5EZYA 4DR2O 1NTMH 3JSLA 2JVDA 4HNAA 3R66A 1US6A 4U7OA 1XEQA 3ZHQA 1U96A 3JCZA 2HKOA 1Z5VA 4FFBB 1I5XA 5IWAB 3BA9A 5EYPA 1GRJA 5CA3A 1SS3A 3RW0A 3CE2A 1HNWO 1AVMA 3IAYA 1OCCB 3STZC 4QPKA 3N27A 4TQDA 2OIEA 1JMKC 4GZRB 2AW9A 1P7GA 5JJNB 1VF5B 5LHHA 5CBGA 2WLIB 5B1NA 4DUZO 2WA4A 1FXKA 3OT7A 1M56B 4B3RO 1JQ0A 4I0XB 1WB7A 3N2KB 4IT5A 2ZKOA 1BMFG 3L75H 4R7CA 1F4MA 5E79Z 1GMGA 5EBLC 3L72H 4FLTA 4K3AA 3RYFB 3QF7A 1GN4A 3RYIB 4JI1O 5EK0A 2NR5A 2R9RB 4MS2A 2ETNA 2EJRA 4O4HA 2VRZA 3AG4B 4DV1B 5CN0A 3OUSA 4CS3A 4DRXA 3GWOA 3OMNB 4JI6B 1HNZB 4DV2O 2Y0PA 2NNUA 1I0HA 3JD1A 1Q6UA 4GT1A 5LOVA 3FYIB 1BT8A 2ATKC 3CRRA 5E1AC 1WNSA 5GW7A 2KSDA 2VWJA 1VQPV 1Y76B 2O57A 3DSQA 4AHCA 5J2UB 1M57C 3ABKB 4PD4F 4TV9A 2PY5A 2RN9A 3X2QC 3SR2C 4DR4O 4MVUA 1I7FA 2XT9A 3TXSA 1ZLZA 2Y69B 4X20A 4X88A 4O2AB 1X4TA 3WG7C 5LP6C 3OE7G 1K73W 1AI6A 2P67A 4PDVA 1KQSU 2YXLA 2B1GA 1BQZA 3CS5A 4UV9A 4DXWA 1N4CA 3THOA 5JH7B 4LF7O 2L6LA 1QBZA 3LNMB 3HKDB 1KC8W 1V54C 3DTUB 4H33A 4KHPB 3LSQA 4BAYA 4D6TH 4JASA 1JA8A 1MZFA 1H2NA 4O4LA 4LF9B 3T1YB 2CH7A 4YY3B 1M4UA 1E79G 4G28B 4QE9A 3RGBA 2NN4A 4TQFA 4AQYB 2R72A 2DWDC 1OCRC 1JFFB 1MMMA 2UUCB 1Q8IA 1RP3B 1K9MW 1XQ8A 2LFSA 5LHGA 3TCUA 3SJAC 4OPHA 3VOUA 4ICGA 4B3SO 3ZMTA 5LGUA 1SQGA 3JASB 1XMOB 3KCYA 4PA3A 3H9VA 1B04A 2V1DA 2ZXWB 1MA1A 3APOA 2N04A 4LBEC 3VQXA 1LNQA 4D7SA 3H1HH 1RSOB 4IYIA 2HHHO 3RYCB 2B9ZA 4CH5A 2ZE7A 3T4ZA 4PDLA 1R6NA 2LGQA 4U3JB 2FTKA 2ADPA 1VQ8V 4FM0A 1XL4A 5KHIA 3HKEA 4LH6A 3CXHF 1YXBA 3ZIAG 2VWKA 2AXTZ 1YITV 2LP7A 4YIPA 4L87A 1H2KA 4N23A 1KYOF 3IC7A 1N32B 2QTOA 2Z5UA 5EIBD 4FJCC 1SQXH 3B09A 2CK3G 3EXAA 2YIBD 2EINC 3AK1A 2YUAA 3AG2B 2QDOA 4DUYO 3CEIA 1SERA 3ETQA 4F4LA 2JRIA 4PV1B 5LYJA 4P9PA 1B06A 1BS3A 3ASNB 4ZOLA 4IIJB 1KECA
chains in the Genus database with same CATH topology
4GCZA 1YHQV 3OAAG 4WFGA 4FK5C 1KP2A 2XAQA 3JYCA 3SYOA 5EC1C 1VQ4V 3W7SA 3OW2U 3A0RA 1AI4A 3OGCC 1I5YA 1FFTB 4JTCB 1FXKC 2WLNA 4JTDB 3CCJV 2EIJC 3OR7C 2EILB 5IY5C 1PKXA 4XBFA 2HVKC 1FXVA 1Q86W 3TK1A 1AI7A 4TT3G 4JTAB 2HR3A 3UKMA 2WLHA 2A0LA 3E8BA 1OCOC 3K0DA 4QPJA 1Q82W 2XOKG 2IW5A 2X7RB 1BL8A 1K97A 1K92A 4MVQA 4LC1A 1DF5A 2WLJA 2KB1A 4FMTA 2EINB 3W7UA 5HFLA 2EIKC 1MG1A 3P32A 1S5HC 1NH2C 3PJSK 2IU3A 1PD3A 1COWG 1F51A 3CMEV 4UV8A 1OCZB 1DF4A 1K7DA 1WLEA 3ZRSA 1W0JG 3K04A 1YTFC 1L1FA 5L3DA 3ZMZA 1KKDA 2BOBC 1NVPB 1V55C 3LSSA 1GKFA 4KP4A 3MD0A 3ABLC 1NKDA 2HJFC 4UVAA 3W7XA 2EZPA 3FB5C 1JVMA 1EZJA 3SPJA 5IYDO 1MSWD 4UVCA 1EBOA 1DLBA 4CZZA 4MVSA 1E1QG 4UXNA 1FXKB 4XDJA 2PI5A 3NXSA 4G2KA 2EIJB 1FS0G 1WPXA 5IY5B 3CYOA 4PDRA 2WAMA 4R6ZA 2PI4A 5IYBO 5LGNA 1VQ7V 3ZMSA 2C2AA 3OR6C 4BIUA 1K33A 3F7VC 4JF3A 5KA6A 1QVGU 3ZN0A 1H8HG 2A9HA 1GM8A 1G8MA 1OCOB 3CPWU 3M99B 4PA9A 3ETEA 4HYOA 1JJ2U 1GM7A 4X89A 2IJJA 1YI2V 1VQKV 2NLJC 2JJ2G 4Z1MG 5B3SC 2ZDIA 3K79A 1ZWIC 2XAHA 3B8MA 3WFVA 3CCSV 3H01A 1K3EA 1CP9A 2EIKB 2P7TC 4R8CA 4JYBA 1NH2B 1JCHA 4R50A 3OEHG 3SPGA 1VQLV 3SYQA 4TSFG 3G71V 4HAMA 3T2MA 2Y48A 3SPHA 2DYSC 1IXMA 1YTFB 2GHYA 2EZOA 4PDMA 2WLLB 4QNHB 1V55B 1F23A 3JD3A 2A79B 2XASA 3ABTA 3ABLB 4U7NA 3K08A 2HFEC 1Q81W 1AJQA 3QO8A 4WFFA 1H38A 2WPDG 5EBMC 5H6QA 5KUMA 2K1EA 2P6JA 3MHSC 2OCCC 1QCEA 3P30A 3ABUA 4MTFA 1K4DC 1GTOA 5B1AC 1CPYA 1RPRA 2JK5C 3E8FA 4JPRA 3ABMC 2QM8A 3K3WA 2DYRC 2XAFA 2MK3A 2JEXA 4QIWF 4RO2A 1W2BU 2HG5C 3CCQV 3W7WA 2DQ3A 2GSMB 3MHHC 5B3SB 4YXWG 1QR9A 3CC4V 4PELA 1K4CC 1KD1W 4MSWC 1JX9A 1R3IC 4MTGA 5IYCO 3JD2A 3EFFK 2DW4A 1FXHA 2HVJC 2DYSB 2IJHA 2Q67A 3ASOC 1N8RW 2UXNA 3ZRWB 1K5SA 3ETGA 1OCCC 4PA4A 4FPPA 4WFEA 4MTXA 1CEZA 1PNMA 1AJNA 4P2ZA 4X8AA 1NR1A 1PL0A 3CD6V 1XL6A 3T1CA 4PA7A 2DWEC 1K5QA 2LFRA 2OCCB 3D3IA 1SZTA 4RUFA 1M56C 4LCUC 1RM1C 1QLEC 5B1AB 5IDJA 3I55V 3CP1A 5EC2C 1P7BA 2XNDG 3AG1C 4I9WA 3ABMB 2DYRB 2YEVB 3RVYA 4MT8A 1NBMG 2WLMA 1AR1B 4ZBMA 4U7OA 4WFBV 3STLC 4MVZA 2IJKA 2BOCC 2V7QG 2QKSA 3JCZA 2EIMC 3RBZA 4WFHA 2XAJA 3E83A 3ZN1A 2HKOA 3OEEG 4Q20A 4LP8A 1I5XA 1ORQC 3AG4C 5L3GA 2W6IG 4E2LA 5J9PC 3CCMV 5CA3A 3UM7A 3RW0A 2DQ0A 4XDLA 1MOFA 2QE7G 1GO3F 1AJPA 3ASOB 5H9CA 3FKSG 1OCCB 3STZC 4QPKA 3IGAC 4JAVA 1M9NA 5DM6V 4MVRA 2EBOA 1HWYA 1S3JA 4QE7A 5KUKA 1THZA 2IJIA 5LHHA 2AHYA 5CBGA 2WLIB 5B1NA 3LDCA 1GK9A 1Y66A 1FXKA 1PNLA 1M56B 1RM1B 3G6EV 1QLEB 2ZD9A 1JQ0A 3LDDA 1NVPD 2ZR3A 4WF9V 2UXXA 3AG1B 1W0KG 5HFMA 4JYCA 4QJFB 2H94A 3I56V 1S76D 1BMFG 1H2GA 3ABKC 4R7CA 1F4MA 5B1BC 4KUMA 3AEIA 1GMGA 5EBLC 2ITDC 1K34A 3B8NA 3OMAB 3SPIA 1VQ9V 1DTOA 2EIMB 5EK0A 2Y69C 1Y4MA 3W7TA 2WLKA 3HPLC 2R9RB 5L3CA 4MS2A 2EJRA 3FB7C 2JIZG 3AG4B 1JPXA 5CN0A 5CMUA 3OUSA 2B5UA 3EHBB 1QR8A 3GWOA 3OMNB 3CMAV 2D3OW 4GX5A 2NNUA 3RVZA 3JD1A 1TUEB 1BHBA 2IH3C 4GT1A 3ZMVA 3LUTB 1GM9A 4BIZA 1NH2D 2OTJV 3FYIB 3G4SV 3KG2A 2ATKC 5E1AC 5GW7A 3JD4A 1VQPV 3E2EA 2OTLV 2M7WA 1VQOV 2X0LA 1AROP 4RAIA 2JEUA 3GB7C 1H8EG 2QEXV 1J95A 2ZQMA 2H8PC 1M57C 3ZJZA 3ABKB 1ENVA 1OZ0A 3CCLV 2JDIG 3CCEV 2HLDG 4JAUA 5B1BB 3X2QC 3K03A 3B77A 1M90W 4MVUA 3OM3B 1KP3A 4G27B 4MW8A 4P9OA 2R9IA 1EFRG 2Y69B 3QO5A 2IU0A 2OT5A 4X88A 1NJIW 2ZR2A 3OUFA 2X6AA 2ZDIC 4OXSA 3WG7C 5CBHA 3CC7V 3OE7G 3BEHA 1K73W 2F43G 1AI6A 3SPCA 3CCVV 2W6JG 2P67A 4PDVA 1KQSU 2B1GA 2QM7A 3ZRWA 4UV9A 4DXWA 4PA6A 5B1OA 2WWWA 1QBZA 3LNMB 1KC8W 1V54C 3DTUB 1NR7A 3BY6A 3ZRVA 3R65A 1NQTA 4H33A 5L3BA 5C93A 5CBFA 3TETA 1S0VA 3LSQA 1VQMV 4BAYA 2ZXWC 3AG3C 4JASA 4I5SA 4DO2A 5DN6G 1K8AW 1UJWB 3ZMUA 2P90A 1M57B 3OFNG 1OHHG 1VQ5V 4J9ZB 1E79G 1PNKA 3X2QB 4G28B 4QE9A 2YEVA 2Q69A 5H6RA 1R6KA 3OMIB 1SETA 3E8GA 5L3EA 1ROPA 5LBQA 1R73A 1QLNA 3HB3B 1SRYA 3DGEA 4RQEA 3CCRV 2DWDC 1OCRC 1BHAA 3QO7A 3WG7B 1E1RG 1VQNV 1SESA 3E8HA 3CC2V 4EKWA 1S77D 1K9MW 3K9AA 4GX1A 3SYPA 2LFSA 4MW3A 2ITCC 5LHGA 1P4RA 3FB8C 3TCUA 5KA5A 5LGTA 1YJ9V 3SYAA 5EBWC 1Q7YW 4KFMA 2Q68A 3AG2C 2W0FC 3FB6C 3CCUV 3VOUA 1R3KC 2WSSG 1B6QA 1VQ6V 2AHZA 4H37A 4TWKA 3ZMTA 5L3FA 3K0GA 1V54B 5LGUA 2Z3YA 3ETDA 4PA3A 3E35A 3ASNC 2V1DA 2ZXWB 2WLIA 3AG3B 1RPOA 3IFXA 4J9YB 4MVMA 3T4DA 3VBBA 2X6CA 3JD0A 4WCEV 1YJWV 5FL7G 4LBEC 4RUEA 1AI5A 4CBCA 3ZCCA 1LNQA 4MTOA 2QA4V 3QNEA 3LDEA 4P30A 2X6BA 2IH1C 3SJQC 2EILC 4UVBA 5LHIA 2B1IA 3CXCU 3T4ZA 1QVFU 4PDLA 3FYEB 1R6NA 2WLLA 4XDKA 2FTKA 2YSUB 1VQ8V 4GX0A 1XL4A 2Q6AA 1S72V 3ZIAG 2XAGA 1YITV 2LP7A 4L87A 1OCRB 1M1KW 4N23A 3ML0A 1YIJV 4WFAV 3IC7A 2QTOA 2Z5UA 2JJ1G 3K06A 3D36A 4MVOA 1F4NA 3F5WC 1YTFD 4FJCC 4GX2A 1YSCA 2CK3G 2EINC 4BW5A 1YJNV 4ASUG 1R3LC 5BZBA 1JOYA 4ZKIA 3AG2B 3F7YC 1OCZC 1G4YB 4UUJC 3SYCA 1R3JC 1SERA 4HZ3A 4F4LA 3E89A 1MABG 4N21A 4P9PA 3E86A 4FIPC 1NVPC 3ZRXA 3ASNB 4RQFA 4JGSA 1KECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YTF D;  5IYB O;  1RM1 B;  5IYC O;  1NVP C;  1NVP D;  1RM1 C;  5IYD O;  1NH2 D;  1NH2 C;  1YTF C; 
#chains in the Genus database with same CATH topology
 5JWP A;  1OV9 A;  4W4L A;  4GCZ A;  1IBK B;  4WFG A;  4FK5 C;  5LL6 Y;  4K35 A;  4B3M B;  1D2D A;  3T1H B;  1AI4 A;  3OGC C;  2VQE B;  3CCJ V;  3OR7 C;  2EIL B;  5IY5 C;  1HW7 A;  3ZBH A;  2Y4U A;  3D8C A;  5IWA O;  2QWO B;  4UFZ A;  3TK1 A;  2GTS A;  1XOU A;  3A8T A;  3UKM A;  2BTQ A;  3K0D A;  4QPJ A;  2XOK G;  2IW5 A;  2X7R B;  1K97 A;  4LNU A;  2WLJ A;  4K8Z A;  4EEQ A;  1QU7 A;  4FMT A;  5HFL A;  3P3N A;  1NH2 C;  3PJS K;  4YIO A;  1P84 F;  1OCZ B;  4FVM A;  1W0J G;  3K04 A;  1PP9 H;  1L1F A;  2F93 B;  1Y74 B;  3ZMZ A;  1IXB A;  1V55 C;  4X1Y B;  4FLU A;  2PYL A;  1FFX A;  1NKD A;  4UVA A;  2F1M A;  2QSA A;  1R6T A;  1JVM A;  3SPJ A;  5IYD O;  4FFK A;  1IZ3 A;  1MSW D;  1DLB A;  4CZZ A;  4UXN A;  2PI5 A;  4J80 A;  2GDS A;  4PDR A;  3ZHS A;  4R6Z A;  3BAB A;  2C2A A;  4DV1 O;  2DMX A;  2YC0 A;  1K33 A;  1QVG U;  3CPW U;  5KHJ A;  1GM7 A;  3JSN A;  1HNZ O;  1VQK V;  4DV5 B;  5B3S C;  3K5M A;  3K79 A;  1GN6 A;  1ZWI C;  2GUZ B;  2EIK B;  4I55 A;  3HKB A;  5ITZ A;  1JCH A;  2VQF B;  3OEH G;  3SGI A;  4O4J A;  2CTR A;  3SYQ A;  4HAM A;  2Y48 A;  2DYS C;  1IXM A;  4H44 B;  4JI3 B;  3B2E E;  2D2C B;  3JD3 A;  2XAS A;  3K08 A;  1N33 B;  4ZI7 A;  4IL6 Z;  1AJQ A;  5CA0 B;  5IJ9 A;  4FLY A;  1H38 A;  5EBM C;  5KUM A;  1BE3 H;  2P6J A;  1EN5 A;  4TUY B;  2OCC C;  1QCE A;  3P30 A;  4YJ2 A;  1WB8 A;  4DR3 B;  1GTO A;  2FYU H;  2UXB B;  3O65 A;  1RPR A;  1IBL B;  3K3W A;  5C8Y B;  2XAF A;  4BIO A;  1S5J A;  2QGN A;  2HG5 C;  3J7A U;  4YJ3 A;  3CCQ V;  1WP7 A;  2JS5 A;  1D5A A;  4DW1 A;  5B66 Z;  3CSX A;  2GV9 A;  1PM9 A;  4KHP O;  2HVJ C;  1L0N H;  2IJH A;  1PPJ H;  1K5S A;  4DR6 B;  1SQB H;  1YVW A;  4LF9 O;  1AJN A;  3T1Y O;  4YY3 O;  1FJG B;  2YXY A;  5LXT A;  3P3P A;  2QKA A;  1J5E B;  3G67 A;  4AQY O;  4X65 B;  1QLE C;  5IDJ A;  2UUC O;  5EC2 C;  3AG1 C;  4H0L B;  3ABM B;  5FPR A;  2DYR B;  2YEV B;  4X64 B;  4MT8 A;  1TUB A;  1IBM B;  4WBN A;  3JAM N;  4J7J A;  3BRC A;  3RBZ A;  2EIM C;  4W4K A;  1XMO O;  3JAR B;  1ORQ C;  4LF4 B;  4JYY A;  1N36 B;  2W6I G;  4E2L A;  4E4E A;  1AJP A;  4NTY A;  1AR4 A;  3QTC A;  1HNX B;  4LF8 B;  4JI4 O;  3OD4 A;  3FKS G;  3JAW B;  5CB4 A;  4MVR A;  1MZE A;  1HWY A;  5KUK A;  2IJI A;  3QVN A;  2AHY A;  4CC5 A;  2A06 H;  2CAZ C;  1TVK A;  1GK9 A;  1WA8 A;  1PNL A;  3CJH A;  3G6E V;  4WF9 V;  5FNV A;  1N32 O;  1QNM A;  5HFM A;  2ZIM A;  2H94 A;  3I56 V;  1H2G A;  3OTF A;  5B1B C;  3AK3 A;  3AEI A;  2ITD C;  4FM2 A;  1VQ9 V;  3N2G A;  3E22 A;  4LFC B;  3UCS C;  1I08 A;  2WLK A;  3HPL C;  4JI0 O;  3FB7 C;  4O4I B;  1JPX A;  2ZE6 A;  1IBK O;  1QR8 A;  4B3M O;  1Y67 A;  3T1H O;  5H2F Z;  4DR5 B;  2VQE O;  2CDY A;  1SC5 B;  3CRA A;  5A9G A;  1TUE B;  3JAT A;  4BIZ A;  1GN3 A;  1SZX A;  3LUT B;  2Q4P A;  1PV0 A;  2BSK B;  2M7W A;  2X0L A;  4FM1 A;  2Q5Z A;  4NB5 A;  4B7K A;  2QEX V;  1GH6 A;  3G80 A;  1URF A;  5K1X A;  4GKJ B;  2ZQM A;  4LFA B;  2HLD G;  3F5T A;  1M5I A;  3BCC H;  3ICX A;  1KP3 A;  4G27 B;  4MW8 A;  4X1I A;  4P9O A;  2KG7 B;  4U3F H;  4TV8 B;  3Q4H A;  3QO5 A;  2E3C A;  4I50 A;  2IBZ H;  3CC7 V;  3BEH A;  5BXZ A;  4JZ2 A;  5KAI Z;  3K57 A;  2QM7 A;  2XTA A;  5BR8 B;  1VAR A;  2V4D A;  3BY6 A;  4NR1 A;  5CBF A;  1S0V A;  1IVS A;  3AG3 C;  4DO2 A;  5EYP B;  3DC5 A;  2A3Q A;  4JZG A;  1K8A W;  5GON A;  1M57 B;  4QGP A;  4DV5 O;  1OHH G;  1VQ5 V;  1UPG A;  2UUA B;  3X2Q B;  1PNK A;  2VQF O;  1R6K A;  3E8G A;  2WA3 A;  3HB3 B;  3BHP A;  3DGE A;  4JI3 O;  3AG7 A;  4DV0 B;  1BHA A;  3U0Z A;  4L8J A;  3WG7 B;  5LP6 B;  2CGO A;  2Y0I A;  4FFB A;  4DV4 B;  3VQW A;  1SES A;  1N33 O;  3CC2 V;  1S77 D;  3K9A A;  4GX1 A;  3SYP A;  3RWR D;  1YJ9 V;  1P4R A;  3FB8 C;  5KA5 A;  1Q7Y W;  3RN4 A;  3CCU V;  1NTK H;  1R3K C;  2P06 A;  2AHZ A;  1L8D A;  4H37 A;  3S3W A;  3K0G A;  1V54 B;  3TGU H;  4DR3 O;  5JCO A;  3ETD A;  2UXB O;  3E35 A;  1IBL O;  3IFX A;  2WLI A;  4PHZ A;  1RPO A;  4J9Y B;  3JD0 A;  1YJW V;  3IJ4 A;  3KKY A;  4I0X A;  5A2Q N;  3ZHT A;  2KQX A;  2X6B A;  2IH1 C;  5LHI A;  2B1I A;  4Z2W A;  2ODM A;  3LNN A;  3K5L A;  4XDK A;  2WLL A;  3K58 A;  2YIB A;  1G1X B;  1ZAU A;  3DC6 A;  3RYI A;  1H2S B;  1OCR B;  5LA6 B;  1VIB A;  4DR6 O;  2JJ1 G;  4MVO A;  3F5W C;  1YTF D;  4RWU A;  1FJG O;  1RFY A;  5KX5 B;  1YSC A;  5GTH Z;  1YJN V;  1J5E O;  1R3L C;  1XIL A;  1D5N A;  4TV9 B;  4OX9 B;  1R3J C;  2F95 B;  4J41 A;  4X65 O;  4LR3 A;  1NVP C;  4RQF A;  3FAV B;  2CUG A;  4JV5 B;  4CH3 A;  4ZHQ B;  4X64 O;  1KP2 A;  1Y76 A;  3A0R A;  1IBM O;  1FXK C;  2WLN A;  5J2U A;  1PKX A;  4CS2 A;  1Q86 W;  1NI8 A;  4LF4 O;  2HEP A;  1N36 O;  5LMU B;  2A0L A;  3E8B A;  4UCS A;  1YZB A;  4AIL C;  3AK2 A;  1OCO C;  1HNX O;  4LF8 O;  1Q82 W;  2Z0A A;  2R70 A;  2GBO A;  2BE3 A;  4LC1 A;  4DV3 B;  1GN2 A;  1WAZ A;  1IDS A;  3H1L H;  1NS1 A;  1ZL8 B;  2EIN B;  1MG1 A;  3P32 A;  1PD3 A;  1F51 A;  4NKG B;  1DF4 A;  4CC6 A;  3ZRS A;  1SQV H;  5EIB C;  3FD9 A;  3U10 A;  1KKD A;  2BOB C;  3LSS A;  1A32 A;  1GKF A;  3MD0 A;  2HJF C;  2EZP A;  3FB5 C;  1FD9 A;  4IHJ B;  2K9P A;  2YIC A;  3SJC C;  4MVS A;  4G2K A;  4I7Z B;  1FS0 G;  5IY5 B;  4LFC O;  1DGS A;  5LGN A;  2ZNJ A;  4DK1 A;  3F7V C;  1X59 A;  3RFR A;  3L74 H;  4JI5 B;  1H8H G;  1GM8 A;  2BTO A;  3A0H Z;  3TJT A;  1AR5 A;  4DR5 O;  4Z1M G;  1XMQ B;  2ZDI A;  1JJO A;  3CCS V;  4JI4 B;  3H01 A;  1CP9 A;  2P7T C;  4R8C A;  1NH2 B;  2Q7H A;  1H2L A;  4TSF G;  4NVP A;  3SPH A;  1TAE A;  2FL4 A;  1V55 B;  4EB6 A;  3HKE B;  3OTO B;  4U7N A;  4GKJ O;  2DN9 A;  4LFA O;  3JAS A;  1Q81 W;  4GKK B;  3JAL B;  4FZ1 A;  3U11 A;  2CGN A;  3ABU A;  3O9O A;  2N74 A;  5BMV B;  2BCC H;  1RSO A;  1KUQ A;  1NZ6 A;  5B1A C;  5JQG B;  2JK5 C;  3E8F A;  2DOS A;  2QM8 A;  4U3J A;  5LYJ B;  2P22 C;  2XUM A;  2MK3 A;  2JEX A;  4QIW F;  4RO2 A;  1W2B U;  4JI0 B;  2G38 A;  1I94 B;  2DQ3 A;  3MHH C;  2OWO A;  5B3S B;  5BR8 O;  3DXR B;  1QR9 A;  4X1K B;  2H3O A;  3WB0 A;  4JYA O;  3UO2 A;  1KD1 W;  3RT3 C;  3JD2 A;  1FXH A;  3UT5 A;  2DYS B;  2GTA A;  3ASO C;  2FB5 A;  2UXN A;  3ZRW B;  4I9Q A;  1SA0 A;  4PA4 A;  4FPP A;  2YXH A;  1CEZ A;  4P2Z A;  4IIJ A;  2UUA O;  1XL6 A;  3PN1 A;  1YCI A;  2OCC B;  3D3I A;  3L70 H;  4RUF A;  5FPO A;  1RM1 C;  4DV0 O;  4GUN A;  4O2B B;  4FLV A;  3I55 V;  3CP1 A;  2XND G;  3JAK B;  4I9W A;  4JAA A;  4DV4 O;  4DR1 B;  1O9H A;  2JS3 A;  1AP5 A;  1NBM G;  2WLM A;  1Q43 A;  1AR1 B;  4ZBM A;  3STL C;  1QHT A;  4MVZ A;  2IJK A;  2UXC B;  2BOC C;  3HKC B;  5KMG B;  2XAJ A;  3E83 A;  2YID A;  4Q20 A;  4LP8 A;  1ZSP A;  1MSD A;  5L3G A;  5J9P C;  3UM7 A;  4GLX A;  2QE7 G;  1GO3 F;  5H9C A;  3ZED A;  2Q7E A;  2AZ2 A;  1Y74 A;  4JAV A;  4KXR A;  1P49 A;  2ZE5 A;  1BSM A;  4X1Y A;  1M9N A;  5DED A;  1NT2 B;  4NXM B;  3ZHU A;  3OGI B;  3A0B Z;  3HKB B;  5ITZ B;  1VF7 A;  1PL4 A;  5H5N A;  4BW9 A;  1QLE B;  3LDD A;  2ZR3 A;  3A2F A;  2UXX A;  3AG1 B;  1BZK A;  4JYC A;  4QJF B;  1S76 D;  3KCX A;  4KUM A;  4ZI7 B;  3OMA B;  4OX9 O;  2VS0 A;  1DTO A;  2EIM B;  1Y4M A;  4Z1V A;  2DE0 X;  5FLX N;  2QTS A;  1AIL A;  2GUZ A;  2JIZ G;  5K1P A;  5CMU A;  4JV5 O;  2B5U A;  3EHB B;  4I4T B;  3CMA V;  4ZIB A;  1NU1 H;  1BHB A;  1Q5O A;  2IH3 C;  3ZMV A;  1NH2 D;  3G4S V;  3KG2 A;  1H2M A;  5KAF Z;  5LMU O;  2OTL V;  4RAI A;  4TUY A;  2JEU A;  5CA1 B;  1H8E G;  2RQ6 A;  1Z5W A;  4LWS A;  2F4V B;  4F6R B;  4DV3 O;  2ILM A;  1ENV A;  1OZ0 A;  3CCL V;  2JDI G;  3CCE V;  4JAU A;  1SQP H;  2M6Y A;  5B1B B;  3K03 A;  3B77 A;  3C3T A;  2R9I A;  1EFR G;  5J2T A;  4ABM A;  2OT5 A;  3JCU Z;  2ZR2 A;  1VEW A;  3BFR A;  4OXS A;  2CTW A;  2F43 G;  5IYZ B;  3CWB H;  2JGD A;  2N05 A;  4AI8 A;  4PA6 A;  5B1O A;  2WWW A;  4X9Q A;  4WBN B;  2JGU A;  3BA8 A;  1NR7 A;  4CH6 A;  3R65 A;  5L3B A;  5C93 A;  3H1K H;  4BR6 A;  5JVD A;  4OPA A;  2P5O A;  4JI5 O;  1W59 A;  4I5S A;  4PI0 A;  5DN6 G;  2ZE8 A;  2P90 A;  2Q73 A;  2KKW A;  1Q6H A;  1XMQ O;  4J9Z B;  1HP8 A;  5KHG A;  1IUR A;  2YEV A;  3ZHV A;  3D3Q A;  4YHH B;  1QLN A;  3OMI B;  3SDL A;  5LBQ A;  1SRY A;  3CCR V;  2AZ0 A;  1TVK B;  2LW1 A;  3QO7 A;  4OGQ B;  2F23 A;  1N0N A;  3OTO O;  1VQN V;  3E8H A;  3JAR A;  4GKK O;  2UXD B;  2ADQ B;  5LGT A;  3SYA A;  5EBW C;  4KFM A;  4X62 B;  3FX7 A;  2W0F C;  1VQ6 V;  3CRC A;  3JAW A;  4TWK A;  5L3F A;  4DR7 B;  4LFB O;  1QQC A;  3RYH A;  2RMK B;  3AG3 B;  1R1B A;  2X6C A;  4WCE V;  1ZTE A;  4IYH A;  3J80 N;  4MTO A;  1I94 O;  2QA4 V;  4UCV A;  3LDE A;  3WU2 Z;  3SJQ C;  4UVB A;  2QWR B;  2FKX A;  1LUW A;  3CXC U;  1N34 B;  1SQQ H;  3FYE B;  2QR4 A;  2YSU B;  3JAT B;  2Q6A A;  1S72 V;  2A7W A;  2XAG A;  1WP8 A;  1Y6X A;  5IJ0 B;  3K06 A;  3D36 A;  4B3T B;  1AP6 A;  4O4I A;  1FAF A;  1DK1 A;  4BW5 A;  5LMN B;  5BZB A;  4ZKI A;  1G4Y B;  1N0J A;  3K5O A;  1MAB G;  4JI7 B;  2Y4T A;  4FIP C;  4A5U B;  3ZRX A;  2ZM6 B;  1M90 W;  3Q4H B;  4DR1 O;  3JYC A;  1M93 A;  3W7S A;  3OW2 U;  1I5Y A;  1FFT B;  2Q7G A;  2UXC O;  2EIJ C;  5EZY B;  3C90 A;  2E5L B;  2EUL A;  1FXV A;  3K9S A;  4HNA B;  1AI7 A;  4TT3 G;  4F6E A;  4JTA B;  3B40 A;  1KMI Z;  2HR3 A;  2KG7 A;  4TV8 A;  4JYA B;  1ZX3 A;  1TGO A;  4CS4 A;  4B7E A;  2XHB A;  1K92 A;  2R9A A;  4K0K B;  1DF5 A;  4FZ0 A;  2OYQ A;  2ARH A;  5IE9 A;  4NXM O;  1S5H C;  1JR9 A;  4DV7 B;  4UV8 A;  1YTF C;  5L3D A;  1NVP B;  4KP4 A;  4HBN A;  3ABL C;  3W7X A;  1Q6I A;  5TIS Z;  1AB3 A;  5AG2 A;  1EBO A;  3D36 C;  1FXK B;  4UB8 Z;  3NXS A;  1WPX A;  3MAQ A;  1BGY H;  3CYO A;  5IYB O;  3ZMS A;  4BIU A;  4JF3 A;  5KA6 A;  2YDE A;  3BPZ A;  2YS8 A;  1OCO B;  3ETE A;  4X66 B;  2E75 B;  4Q6G A;  5KHK A;  3SJB C;  5LP6 A;  2XAH A;  3WFV A;  4O4H B;  4JYB A;  2ZNI A;  4R50 A;  4J7Z A;  1KKC A;  2YI9 A;  4DRX B;  3N2K A;  1VQL V;  3T2M A;  2ZCE A;  2EZO A;  4PDM A;  2WLL B;  3UO3 A;  4QNH B;  1XNR B;  1F23 A;  3BVO A;  3ABT A;  2F4V O;  5LOV B;  2HFE C;  2MW2 B;  3QO8 A;  3RYF A;  3CHX A;  4DK0 A;  3MHS C;  4J7K A;  1VMG A;  1Z2G A;  3M7M X;  1CPY A;  4JI2 B;  4JPR A;  4TOI A;  2RCV A;  3W7W A;  1VF6 A;  4X20 B;  5LA6 A;  4YXW G;  3M8A A;  5D5P A;  3CC4 V;  4PEL A;  1K4C C;  5KX5 A;  1JX9 A;  1R3I C;  4MTG A;  5IYC O;  2L35 A;  3EFF K;  3FFQ A;  3H1I H;  3ETG A;  1OCC C;  3QG5 A;  4WFE A;  4LF5 B;  4X8A A;  5JCO C;  3FAV A;  4PA7 A;  2DWE C;  4ZHQ A;  1NTZ H;  1K5Q A;  4O2A A;  2LFR A;  4YHH O;  2W0X A;  1SZT A;  1SQF A;  1M56 C;  4LCU C;  4O4L B;  5B1A B;  2CH7 B;  4J42 A;  1P7B A;  1XHZ A;  4UCU A;  1VP7 A;  3RVY A;  4FLZ A;  5JH7 A;  4BWA A;  2UXD O;  3HKD A;  4WFB V;  1WN7 A;  1YEW A;  4X62 O;  2V7Q G;  4CH4 A;  3L73 H;  3WB2 A;  2QKS A;  4DR7 O;  2UU9 B;  4WFH A;  3ZN1 A;  2E76 B;  3OEE G;  1ZL8 A;  1WJZ A;  1HR0 B;  3AG4 C;  3CCM V;  1XRE A;  2DQ0 A;  4XDL A;  1MOF A;  5KHH A;  3ASO B;  3EVK A;  2Q9L A;  5B5E Z;  3IGA C;  4EFE A;  5DM6 V;  2EBO A;  1S3J A;  4QE7 A;  1THZ A;  4UCT A;  3B4S A;  1VF6 C;  1N34 O;  1FKA O;  3K59 A;  4IHJ A;  1JFF A;  4J10 A;  4UCR A;  3LDC A;  1EZV H;  1SKV A;  1Y66 A;  2Q0A A;  1RM1 B;  3CB2 A;  2ZD9 A;  1NVP D;  1W0K G;  1XBL A;  4B3T O;  2YIA A;  2RNB A;  1FPO A;  3ABK C;  2ZIN A;  4EB6 B;  3G6B A;  1K34 A;  3B8N A;  5LMN O;  4KL1 A;  3SPI A;  2Y69 C;  3W7T A;  4JI7 O;  5L3C A;  1XNQ B;  2E74 B;  2PGG A;  2ZM6 O;  2LQT A;  1KBH A;  4DYL A;  3I5D A;  4LFB B;  1FYJ A;  3RYC A;  2D3O W;  4C7U A;  4GX5 A;  3RVZ A;  1GM9 A;  4ZOL B;  2E5L O;  2OTJ V;  3JAL A;  3L9D A;  3JD4 A;  3E2E A;  1VQO V;  1YF2 A;  1ARO P;  3GB7 C;  1J95 A;  4EFB A;  5BMV A;  3UT5 B;  4K0K O;  2H8P C;  3ZJZ A;  5JQG A;  4LF6 B;  2QWP B;  1SA0 B;  3APQ A;  3OM3 B;  4DV7 O;  1Q3E A;  3ZHR A;  2BTQ B;  2IU0 A;  3J81 N;  4LNU B;  3DXR A;  2RDC A;  1NJI W;  2QM4 A;  2X6A A;  3OUF A;  4NXN B;  4X1K A;  1LUV A;  2ZDI C;  5CBH A;  2PTM A;  2IM9 A;  3SPC A;  3CCV V;  2W6J G;  5BY1 A;  1B3Q A;  2EX3 A;  3ZRW A;  1CXZ B;  1ZUQ A;  2CE4 A;  4JI8 B;  4DV6 B;  2CTP A;  1FFX B;  3ZRV A;  1NQT A;  3H1J H;  3TET A;  1VQM V;  2ZXW C;  2PYJ A;  3WB1 A;  3GWK C;  3L71 H;  2ZT9 B;  4X66 O;  1UJW B;  3ZMU A;  4LH7 A;  4O2B A;  4UB6 Z;  3OFN G;  4H13 B;  3JAK A;  1MNG A;  3GVM A;  2Q69 A;  1XHX A;  5H6R A;  2UUB B;  5L3E A;  1SET A;  1ROP A;  1R73 A;  4RQE A;  5DEC A;  1BQ0 A;  3HKC A;  5KMG A;  3ZX6 A;  4DR2 B;  1XNR O;  1E1R G;  1YDX A;  4EKW A;  4I55 B;  3C3S A;  1BCC H;  4MW3 A;  2ITC C;  4O4J B;  2Q68 A;  3AG2 C;  3FB6 C;  4NTX A;  2WSS G;  1B6Q A;  1G6U A;  4DW0 A;  2Z3Y A;  4JI6 O;  4GYC B;  3CRM A;  3ASN C;  4JI2 O;  3T4D A;  4MVM A;  5KLV H;  3VBB A;  5IJ9 B;  1HNW B;  5FL7 G;  4RUE A;  1AI5 A;  4CBC A;  1OJH A;  3ZCC A;  4YJ2 B;  2OIG A;  2ZIO A;  3QNE A;  5JJJ B;  4P30 A;  2Q0O C;  2EIL C;  1QVF U;  4DUZ B;  1KU9 A;  4GX0 A;  3MDS A;  4YJ3 B;  4B3R B;  1M1K W;  3KZI Z;  5CA0 A;  2QWQ B;  3ML0 A;  2HP8 A;  1YIJ V;  4WFA V;  4PJ0 Z;  1GAX A;  1HDJ A;  1F4N A;  4GX2 A;  4K8X A;  4LF5 O;  3IC9 A;  3CRQ A;  2PF4 E;  4LWS B;  4ASU G;  4I4T A;  3CX5 F;  1JOY A;  3F7Y C;  1OCZ C;  4UUJ C;  1KB9 F;  2QJ1 A;  4JI1 B;  3SYC A;  4HZ3 A;  2EJ7 A;  3E89 A;  5C8Y A;  4N21 A;  3E86 A;  3ZS8 C;  4JGS A;  5LXT B;  5J2T B;  2CTQ A;  3LSU A;  1O9G A;  1YHQ V;  3OAA G;  2XAQ A;  5D5Q A;  3SYO A;  5EC1 C;  1VQ4 V;  5CA1 A;  4DV2 B;  4JTC B;  4JTD B;  3VQV A;  2F66 C;  2JGD B;  4F6R A;  2UU9 O;  1LR1 A;  2LJ2 A;  2HVK C;  2QWN B;  1EN6 A;  3S3X A;  4XBF A;  1HR0 O;  1L0L H;  1U97 A;  1TUB B;  2WLH A;  1IX9 A;  1XI1 A;  1BL8 A;  5JVD B;  4MVQ A;  2KB1 A;  3W7U A;  2EIK C;  4NYK A;  4DR4 B;  2FML A;  2LGW A;  2IU3 A;  5IYZ A;  1COW G;  3CME V;  1WPB A;  1K7D A;  1WLE A;  2LO1 A;  2LW7 A;  3VQY A;  5CB4 B;  2OCH A;  1XDC A;  4PI2 A;  1EZJ A;  4UVC A;  1E1Q G;  1WA8 B;  4XDJ A;  2EIJ B;  3CJH B;  4LF7 B;  5FNV B;  2WAM A;  2PI4 A;  1XUQ A;  1VQ7 V;  3HR0 A;  1XNQ O;  3OR6 C;  3ZN0 A;  2A9H A;  1G8M A;  3M99 B;  4PA9 A;  1JJ2 U;  4HYO A;  3N2G B;  3RYH B;  3E22 B;  4X89 A;  1TA8 A;  2IJJ A;  1YI2 V;  2NLJ C;  2JJ2 G;  2PZS A;  5JJE B;  3B8M A;  1K3E A;  2Q8V A;  1T5E A;  3SPG A;  3BAA A;  3G71 V;  1YTF B;  2GHY A;  2A79 B;  3ABL B;  5IT9 N;  4LF6 O;  2RJZ A;  4WFF A;  3UQ8 A;  4D7T A;  2WPD G;  5H6Q A;  2K1E A;  2P4K A;  4B08 A;  4NTW A;  4B3S B;  4J11 A;  4MTF A;  1V9P A;  1K4D C;  4NXN O;  2PUS A;  1Q90 D;  2P4V A;  3ABM C;  2DYR C;  1EN4 A;  4X1I B;  5IJ0 A;  2GSM B;  4I50 B;  2QKC A;  2HHH B;  2BSK A;  4JI8 O;  2YI8 A;  4DV6 O;  4MSW C;  5GTI Z;  2DW4 A;  2HJD A;  2Q67 A;  1EM1 A;  1N8R W;  2AGA A;  3K5N A;  4FLX A;  4MTX A;  1PNM A;  3NR7 A;  1SF9 A;  1UFI A;  4FLW A;  1NR1 A;  1PL0 A;  4UCO A;  3CD6 V;  3T1C A;  4IGG A;  1F7Y A;  5F2V O;  2DJV A;  2UUB O;  4DUY B;  1S5L Z;  3TXQ A;  5GON B;  5EZY A;  4DR2 O;  1NTM H;  3JSL A;  2JVD A;  4HNA A;  3R66 A;  1US6 A;  4U7O A;  1XEQ A;  3ZHQ A;  1U96 A;  3JCZ A;  2HKO A;  1Z5V A;  4FFB B;  1I5X A;  5IWA B;  3BA9 A;  5EYP A;  1GRJ A;  5CA3 A;  1SS3 A;  3RW0 A;  3CE2 A;  1HNW O;  1AVM A;  3IAY A;  1OCC B;  3STZ C;  4QPK A;  3N27 A;  4TQD A;  2OIE A;  1JMK C;  4GZR B;  2AW9 A;  1P7G A;  5JJN B;  1VF5 B;  5LHH A;  5CBG A;  2WLI B;  5B1N A;  4DUZ O;  2WA4 A;  1FXK A;  3OT7 A;  1M56 B;  4B3R O;  1JQ0 A;  4I0X B;  1WB7 A;  3N2K B;  4IT5 A;  2ZKO A;  1BMF G;  3L75 H;  4R7C A;  1F4M A;  5E79 Z;  1GMG A;  5EBL C;  3L72 H;  4FLT A;  4K3A A;  3RYF B;  3QF7 A;  1GN4 A;  3RYI B;  4JI1 O;  5EK0 A;  2NR5 A;  2R9R B;  4MS2 A;  2ETN A;  2EJR A;  4O4H A;  2VRZ A;  3AG4 B;  4DV1 B;  5CN0 A;  3OUS A;  4CS3 A;  4DRX A;  3GWO A;  3OMN B;  4JI6 B;  1HNZ B;  4DV2 O;  2Y0P A;  2NNU A;  1I0H A;  3JD1 A;  1Q6U A;  4GT1 A;  5LOV A;  3FYI B;  1BT8 A;  2ATK C;  3CRR A;  5E1A C;  1WNS A;  5GW7 A;  2KSD A;  2VWJ A;  1VQP V;  1Y76 B;  2O57 A;  3DSQ A;  4AHC A;  5J2U B;  1M57 C;  3ABK B;  4PD4 F;  4TV9 A;  2PY5 A;  2RN9 A;  3X2Q C;  3SR2 C;  4DR4 O;  4MVU A;  1I7F A;  2XT9 A;  3TXS A;  1ZLZ A;  2Y69 B;  4X20 A;  4X88 A;  4O2A B;  1X4T A;  3WG7 C;  5LP6 C;  3OE7 G;  1K73 W;  1AI6 A;  2P67 A;  4PDV A;  1KQS U;  2YXL A;  2B1G A;  1BQZ A;  3CS5 A;  4UV9 A;  4DXW A;  1N4C A;  3THO A;  5JH7 B;  4LF7 O;  2L6L A;  1QBZ A;  3LNM B;  3HKD B;  1KC8 W;  1V54 C;  3DTU B;  4H33 A;  4KHP B;  3LSQ A;  4BAY A;  4D6T H;  4JAS A;  1JA8 A;  1MZF A;  1H2N A;  4O4L A;  4LF9 B;  3T1Y B;  2CH7 A;  4YY3 B;  1M4U A;  1E79 G;  4G28 B;  4QE9 A;  3RGB A;  2NN4 A;  4TQF A;  4AQY B;  2R72 A;  2DWD C;  1OCR C;  1JFF B;  1MMM A;  2UUC B;  1Q8I A;  1RP3 B;  1K9M W;  1XQ8 A;  2LFS A;  5LHG A;  3TCU A;  3SJA C;  4OPH A;  3VOU A;  4ICG A;  4B3S O;  3ZMT A;  5LGU A;  1SQG A;  3JAS B;  1XMO B;  3KCY A;  4PA3 A;  3H9V A;  1B04 A;  2V1D A;  2ZXW B;  1MA1 A;  3APO A;  2N04 A;  4LBE C;  3VQX A;  1LNQ A;  4D7S A;  3H1H H;  1RSO B;  4IYI A;  2HHH O;  3RYC B;  2B9Z A;  4CH5 A;  2ZE7 A;  3T4Z A;  4PDL A;  1R6N A;  2LGQ A;  4U3J B;  2FTK A;  2ADP A;  1VQ8 V;  4FM0 A;  1XL4 A;  5KHI A;  3HKE A;  4LH6 A;  3CXH F;  1YXB A;  3ZIA G;  2VWK A;  2AXT Z;  1YIT V;  2LP7 A;  4YIP A;  4L87 A;  1H2K A;  4N23 A;  1KYO F;  3IC7 A;  1N32 B;  2QTO A;  2Z5U A;  5EIB D;  4FJC C;  1SQX H;  3B09 A;  2CK3 G;  3EXA A;  2YIB D;  2EIN C;  3AK1 A;  2YUA A;  3AG2 B;  2QDO A;  4DUY O;  3CEI A;  1SER A;  3ETQ A;  4F4L A;  2JRI A;  4PV1 B;  5LYJ A;  4P9P A;  1B06 A;  1BS3 A;  3ASN B;  4ZOL A;  4IIJ B;  1KEC A; 
#chains in the Genus database with same CATH homology
 4GCZ A;  1YHQ V;  3OAA G;  4WFG A;  4FK5 C;  1KP2 A;  2XAQ A;  3JYC A;  3SYO A;  5EC1 C;  1VQ4 V;  3W7S A;  3OW2 U;  3A0R A;  1AI4 A;  3OGC C;  1I5Y A;  1FFT B;  4JTC B;  1FXK C;  2WLN A;  4JTD B;  3CCJ V;  2EIJ C;  3OR7 C;  2EIL B;  5IY5 C;  1PKX A;  4XBF A;  2HVK C;  1FXV A;  1Q86 W;  3TK1 A;  1AI7 A;  4TT3 G;  4JTA B;  2HR3 A;  3UKM A;  2WLH A;  2A0L A;  3E8B A;  1OCO C;  3K0D A;  4QPJ A;  1Q82 W;  2XOK G;  2IW5 A;  2X7R B;  1BL8 A;  1K97 A;  1K92 A;  4MVQ A;  4LC1 A;  1DF5 A;  2WLJ A;  2KB1 A;  4FMT A;  2EIN B;  3W7U A;  5HFL A;  2EIK C;  1MG1 A;  3P32 A;  1S5H C;  1NH2 C;  3PJS K;  2IU3 A;  1PD3 A;  1COW G;  1F51 A;  3CME V;  4UV8 A;  1OCZ B;  1DF4 A;  1K7D A;  1WLE A;  3ZRS A;  1W0J G;  3K04 A;  1YTF C;  1L1F A;  5L3D A;  3ZMZ A;  1KKD A;  2BOB C;  1NVP B;  1V55 C;  3LSS A;  1GKF A;  4KP4 A;  3MD0 A;  3ABL C;  1NKD A;  2HJF C;  4UVA A;  3W7X A;  2EZP A;  3FB5 C;  1JVM A;  1EZJ A;  3SPJ A;  5IYD O;  1MSW D;  4UVC A;  1EBO A;  1DLB A;  4CZZ A;  4MVS A;  1E1Q G;  4UXN A;  1FXK B;  4XDJ A;  2PI5 A;  3NXS A;  4G2K A;  2EIJ B;  1FS0 G;  1WPX A;  5IY5 B;  3CYO A;  4PDR A;  2WAM A;  4R6Z A;  2PI4 A;  5IYB O;  5LGN A;  1VQ7 V;  3ZMS A;  2C2A A;  3OR6 C;  4BIU A;  1K33 A;  3F7V C;  4JF3 A;  5KA6 A;  1QVG U;  3ZN0 A;  1H8H G;  2A9H A;  1GM8 A;  1G8M A;  1OCO B;  3CPW U;  3M99 B;  4PA9 A;  3ETE A;  4HYO A;  1JJ2 U;  1GM7 A;  4X89 A;  2IJJ A;  1YI2 V;  1VQK V;  2NLJ C;  2JJ2 G;  4Z1M G;  5B3S C;  2ZDI A;  3K79 A;  1ZWI C;  2XAH A;  3B8M A;  3WFV A;  3CCS V;  3H01 A;  1K3E A;  1CP9 A;  2EIK B;  2P7T C;  4R8C A;  4JYB A;  1NH2 B;  1JCH A;  4R50 A;  3OEH G;  3SPG A;  1VQL V;  3SYQ A;  4TSF G;  3G71 V;  4HAM A;  3T2M A;  2Y48 A;  3SPH A;  2DYS C;  1IXM A;  1YTF B;  2GHY A;  2EZO A;  4PDM A;  2WLL B;  4QNH B;  1V55 B;  1F23 A;  3JD3 A;  2A79 B;  2XAS A;  3ABT A;  3ABL B;  4U7N A;  3K08 A;  2HFE C;  1Q81 W;  1AJQ A;  3QO8 A;  4WFF A;  1H38 A;  2WPD G;  5EBM C;  5H6Q A;  5KUM A;  2K1E A;  2P6J A;  3MHS C;  2OCC C;  1QCE A;  3P30 A;  3ABU A;  4MTF A;  1K4D C;  1GTO A;  5B1A C;  1CPY A;  1RPR A;  2JK5 C;  3E8F A;  4JPR A;  3ABM C;  2QM8 A;  3K3W A;  2DYR C;  2XAF A;  2MK3 A;  2JEX A;  4QIW F;  4RO2 A;  1W2B U;  2HG5 C;  3CCQ V;  3W7W A;  2DQ3 A;  2GSM B;  3MHH C;  5B3S B;  4YXW G;  1QR9 A;  3CC4 V;  4PEL A;  1K4C C;  1KD1 W;  4MSW C;  1JX9 A;  1R3I C;  4MTG A;  5IYC O;  3JD2 A;  3EFF K;  2DW4 A;  1FXH A;  2HVJ C;  2DYS B;  2IJH A;  2Q67 A;  3ASO C;  1N8R W;  2UXN A;  3ZRW B;  1K5S A;  3ETG A;  1OCC C;  4PA4 A;  4FPP A;  4WFE A;  4MTX A;  1CEZ A;  1PNM A;  1AJN A;  4P2Z A;  4X8A A;  1NR1 A;  1PL0 A;  3CD6 V;  1XL6 A;  3T1C A;  4PA7 A;  2DWE C;  1K5Q A;  2LFR A;  2OCC B;  3D3I A;  1SZT A;  4RUF A;  1M56 C;  4LCU C;  1RM1 C;  1QLE C;  5B1A B;  5IDJ A;  3I55 V;  3CP1 A;  5EC2 C;  1P7B A;  2XND G;  3AG1 C;  4I9W A;  3ABM B;  2DYR B;  2YEV B;  3RVY A;  4MT8 A;  1NBM G;  2WLM A;  1AR1 B;  4ZBM A;  4U7O A;  4WFB V;  3STL C;  4MVZ A;  2IJK A;  2BOC C;  2V7Q G;  2QKS A;  3JCZ A;  2EIM C;  3RBZ A;  4WFH A;  2XAJ A;  3E83 A;  3ZN1 A;  2HKO A;  3OEE G;  4Q20 A;  4LP8 A;  1I5X A;  1ORQ C;  3AG4 C;  5L3G A;  2W6I G;  4E2L A;  5J9P C;  3CCM V;  5CA3 A;  3UM7 A;  3RW0 A;  2DQ0 A;  4XDL A;  1MOF A;  2QE7 G;  1GO3 F;  1AJP A;  3ASO B;  5H9C A;  3FKS G;  1OCC B;  3STZ C;  4QPK A;  3IGA C;  4JAV A;  1M9N A;  5DM6 V;  4MVR A;  2EBO A;  1HWY A;  1S3J A;  4QE7 A;  5KUK A;  1THZ A;  2IJI A;  5LHH A;  2AHY A;  5CBG A;  2WLI B;  5B1N A;  3LDC A;  1GK9 A;  1Y66 A;  1FXK A;  1PNL A;  1M56 B;  1RM1 B;  3G6E V;  1QLE B;  2ZD9 A;  1JQ0 A;  3LDD A;  1NVP D;  2ZR3 A;  4WF9 V;  2UXX A;  3AG1 B;  1W0K G;  5HFM A;  4JYC A;  4QJF B;  2H94 A;  3I56 V;  1S76 D;  1BMF G;  1H2G A;  3ABK C;  4R7C A;  1F4M A;  5B1B C;  4KUM A;  3AEI A;  1GMG A;  5EBL C;  2ITD C;  1K34 A;  3B8N A;  3OMA B;  3SPI A;  1VQ9 V;  1DTO A;  2EIM B;  5EK0 A;  2Y69 C;  1Y4M A;  3W7T A;  2WLK A;  3HPL C;  2R9R B;  5L3C A;  4MS2 A;  2EJR A;  3FB7 C;  2JIZ G;  3AG4 B;  1JPX A;  5CN0 A;  5CMU A;  3OUS A;  2B5U A;  3EHB B;  1QR8 A;  3GWO A;  3OMN B;  3CMA V;  2D3O W;  4GX5 A;  2NNU A;  3RVZ A;  3JD1 A;  1TUE B;  1BHB A;  2IH3 C;  4GT1 A;  3ZMV A;  3LUT B;  1GM9 A;  4BIZ A;  1NH2 D;  2OTJ V;  3FYI B;  3G4S V;  3KG2 A;  2ATK C;  5E1A C;  5GW7 A;  3JD4 A;  1VQP V;  3E2E A;  2OTL V;  2M7W A;  1VQO V;  2X0L A;  1ARO P;  4RAI A;  2JEU A;  3GB7 C;  1H8E G;  2QEX V;  1J95 A;  2ZQM A;  2H8P C;  1M57 C;  3ZJZ A;  3ABK B;  1ENV A;  1OZ0 A;  3CCL V;  2JDI G;  3CCE V;  2HLD G;  4JAU A;  5B1B B;  3X2Q C;  3K03 A;  3B77 A;  1M90 W;  4MVU A;  3OM3 B;  1KP3 A;  4G27 B;  4MW8 A;  4P9O A;  2R9I A;  1EFR G;  2Y69 B;  3QO5 A;  2IU0 A;  2OT5 A;  4X88 A;  1NJI W;  2ZR2 A;  3OUF A;  2X6A A;  2ZDI C;  4OXS A;  3WG7 C;  5CBH A;  3CC7 V;  3OE7 G;  3BEH A;  1K73 W;  2F43 G;  1AI6 A;  3SPC A;  3CCV V;  2W6J G;  2P67 A;  4PDV A;  1KQS U;  2B1G A;  2QM7 A;  3ZRW A;  4UV9 A;  4DXW A;  4PA6 A;  5B1O A;  2WWW A;  1QBZ A;  3LNM B;  1KC8 W;  1V54 C;  3DTU B;  1NR7 A;  3BY6 A;  3ZRV A;  3R65 A;  1NQT A;  4H33 A;  5L3B A;  5C93 A;  5CBF A;  3TET A;  1S0V A;  3LSQ A;  1VQM V;  4BAY A;  2ZXW C;  3AG3 C;  4JAS A;  4I5S A;  4DO2 A;  5DN6 G;  1K8A W;  1UJW B;  3ZMU A;  2P90 A;  1M57 B;  3OFN G;  1OHH G;  1VQ5 V;  4J9Z B;  1E79 G;  1PNK A;  3X2Q B;  4G28 B;  4QE9 A;  2YEV A;  2Q69 A;  5H6R A;  1R6K A;  3OMI B;  1SET A;  3E8G A;  5L3E A;  1ROP A;  5LBQ A;  1R73 A;  1QLN A;  3HB3 B;  1SRY A;  3DGE A;  4RQE A;  3CCR V;  2DWD C;  1OCR C;  1BHA A;  3QO7 A;  3WG7 B;  1E1R G;  1VQN V;  1SES A;  3E8H A;  3CC2 V;  4EKW A;  1S77 D;  1K9M W;  3K9A A;  4GX1 A;  3SYP A;  2LFS A;  4MW3 A;  2ITC C;  5LHG A;  1P4R A;  3FB8 C;  3TCU A;  5KA5 A;  5LGT A;  1YJ9 V;  3SYA A;  5EBW C;  1Q7Y W;  4KFM A;  2Q68 A;  3AG2 C;  2W0F C;  3FB6 C;  3CCU V;  3VOU A;  1R3K C;  2WSS G;  1B6Q A;  1VQ6 V;  2AHZ A;  4H37 A;  4TWK A;  3ZMT A;  5L3F A;  3K0G A;  1V54 B;  5LGU A;  2Z3Y A;  3ETD A;  4PA3 A;  3E35 A;  3ASN C;  2V1D A;  2ZXW B;  2WLI A;  3AG3 B;  1RPO A;  3IFX A;  4J9Y B;  4MVM A;  3T4D A;  3VBB A;  2X6C A;  3JD0 A;  4WCE V;  1YJW V;  5FL7 G;  4LBE C;  4RUE A;  1AI5 A;  4CBC A;  3ZCC A;  1LNQ A;  4MTO A;  2QA4 V;  3QNE A;  3LDE A;  4P30 A;  2X6B A;  2IH1 C;  3SJQ C;  2EIL C;  4UVB A;  5LHI A;  2B1I A;  3CXC U;  3T4Z A;  1QVF U;  4PDL A;  3FYE B;  1R6N A;  2WLL A;  4XDK A;  2FTK A;  2YSU B;  1VQ8 V;  4GX0 A;  1XL4 A;  2Q6A A;  1S72 V;  3ZIA G;  2XAG A;  1YIT V;  2LP7 A;  4L87 A;  1OCR B;  1M1K W;  4N23 A;  3ML0 A;  1YIJ V;  4WFA V;  3IC7 A;  2QTO A;  2Z5U A;  2JJ1 G;  3K06 A;  3D36 A;  4MVO A;  1F4N A;  3F5W C;  1YTF D;  4FJC C;  4GX2 A;  1YSC A;  2CK3 G;  2EIN C;  4BW5 A;  1YJN V;  4ASU G;  1R3L C;  5BZB A;  1JOY A;  4ZKI A;  3AG2 B;  3F7Y C;  1OCZ C;  1G4Y B;  4UUJ C;  3SYC A;  1R3J C;  1SER A;  4HZ3 A;  4F4L A;  3E89 A;  1MAB G;  4N21 A;  4P9P A;  3E86 A;  4FIP C;  1NVP C;  3ZRX A;  3ASN B;  4RQF A;  4JGS A;  1KEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...