5IYCH

Human core-pic in the initial transcribing state
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
150
structure length
150
Chain Sequence
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna
total genus 19
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5iycH01
4HIKA 1CKMA 1Y1VH 4A3KH 3K7AH 1SLJA 2F4VL 4OXPA 3J80c 1V9PA 3GTMH 4OO1I 1B70B 4JV5L 3CW2C 3TS0A 3UE1A 3S1NH 3PUZA 1N32L 1VQ9A 3TQYA 3HOVG 2UXBL 3AYHB 4A3MG 1WFQA 4Y7NH 1VQEA 4NB3A 5ELNA 1K8AC 1Z47A 4JI0L 4A3BG 4L5TA 2MQHA 2N78A 5JEAG 4LFBQ 4WJ3M 4LF7L 2HIVA 1N9WA 2HT1A 3S24A 1VQPA 4HIOA 2ZTDA 1L0WA 4B3SL 4DV1Q 2ZM6Q 3CCEA 3DM3A 1Q1BA 4GS3A 4DV4Q 4DV5L 1QUQB 2ZTCA 2UU9Q 5AJ3L 5H1SE 3DLLA 3CMEA 1TXYA 2A1AA 1SRUA 1HH2P 1I5FA 3M9BA 5IYCG 4X66Q 3BU2A 2R7ZG 4JYAQ 1KAWA 5C3EG 3HOVH 1A63A 4QL5A 2HHHL 4A3MH 2WB1E 3S1RH 5IY0A 4JI1L 2KENA 4HIDA 5GQOA 4A3BH 1YITA 4BBRG 1MJEA 3KLWA 1N8RC 4LFCL 1VQGA 4P71A 2UUBL 2B3GA 3NELA 2MO0A 3M85A 2K52A 1KXLA 4GKKQ 4A3EG 4YY3Q 2E2HH 4KI0A 1IBLL 4POFA 1EUJA 3G6EA 3J81c 4IJLA 2ES2A 3H15A 4DV6L 5IYCH 2R7ZH 4B3RQ 2JQOA 1UWVA 5C3EH 3M4QA 1KRTA 4GNXA 2JA7G 3S15H 4BA1I 1T9HA 5LMUL 3TRZA 3T1YL 3ULJA 2R6GA 4DAYB 4BBRH 3CCUA 1NMFA 3B6YA 3W1BA 1VQFA 4LF4Q 1PH2A 3PSIA 4A76A 4PZ6A 4LW1A 3G48A 1N34Q 3S1QH 1E7ZA 4A3EH 1IBML 1AH9A 2E8GA 1HJPA 2ALYB 3CAMA 1IL2A 3CCQA 1XNQL 3GTLH 3J81i 1VQDA 1YHQA 5C44G 3HKZE 2JA7H 2IHEA 3K8AA 1B7YB 1PH9A 4C3JH 2QGQA 3E9HA 3OYYA 4GOPC 1QVFA 3ULLA 3GTPH 2KHIA 3A74A 2CQOA 1EYGA 4LF6L 3EN2A 3CCRA 3TS2A 4OO1G 2UXDL 1SN8A 1S72A 5M5YH 1TWHH 2BA0A 1QVGA 3PUWA 4DR4L 4KHPQ 4GLXA 4R4IA 1SR3A 1I6HH 2VS1A 4GN4B 4LUZA 4DUYL 3LGJA 4A3JG 1YI2A 1OXVA 1WCMG 1AE2A 2H5XA 4DR5L 1I94Q 1P8LA 5IE8A 2CCZA 3H3VH 1BBUA 1N33L 1YHBA 5C44H 4EQ5A 4DR6Q 2R7FA 1PV4A 1KC8C 1NJIC 1CUKA 1XMQL 1E1TA 3GTKH 4A3CG 4YHHQ 1PH5A 2OTJA 3FKIG 3U4VA 4IOAA 2Z0SA 1VQOA 1U0LA 1B8AA 1VQAA 1XMOL 2UXCL 2MNAA 4GNXB 2YTXA 2VUMG 3K0XA 1MIUA 4JOIA 5GROA 3PIPA 4AQYL 1XNRL 3J7ZC 2E5LQ 4QQBX 4DR3L 4A4IA 3CD6A 4A3JH 1WCMH 4B3ML 1WI5A 1EQRA 1YZ6A 4OWXB 3U50C 4X62Q 4K0KQ 4JG2A 2I5HA 4LUVA 3MXNB 1PVOA 5M3MG 2NVQH 2ZTEA 1HNWL 1JMCA 2F4VQ 2QEXA 4A3CH 3A0JA 4A3FG 2PMZE 3FKIH 4NXML 4DR1L 4KHZA 4UP9A 2K75A 4HJ9A 3E0EA 3TREA 3CF5A 4HJ8A 4DR2L 2RCNA 3PF4A 3CCLA 1N32Q 2VUMH 3OTOL 1X55A 1HZAA 4LNQA 5JJIA 2GN5A 5JJKA 3RZDH 1VCIA 3NEMA 1TWGH 1VQ5A 1I3QH 1H95A 4A3IG 1NTGA 2NN6I 1L2FA 1D7QA 4A93G 4X64Q 1GKHA 1Q7YC 2DGYA 2A19A 4JI3L 3CP0A 5M3MH 4JI2L 2Z6KA 1TWFH 4YWMA 3T1HL 4QIWE 4A3FH 1Y1WG 2VQFL 1IBKQ 3L2PA 3KOJA 4LUOA 1YBYA 4AYBG 2VQEQ 1VQLA 5LMNL 3RLFA 1O7IA 3F2DA 3CMAA 2IX1A 1YNXA 2AHOB 2B63G 5C0XJ 1IZ6A 1IYJB 1VQCA 4DUZL 4JI1Q 3S2HH 4ALPA 2JK8A 4NXNL 1JJGA 4LFAL 2LSSA 1NMGA 4LF9Q 4A3IH 1Q82C 3VDYA 3SGIA 4UPAA 4YWKA 3KJPA 2YU9H 4A93H 3BZCA 4OX9L 2RHQB 3UE0A 2DUDA 4O2DA 3CCSA 1HR0L 1IBLQ 1Y1WH 4JI8L 1WJJA 2I5MX 4DV3L 2AKWB 5GAEC 4JBJA 4P72A 2EIFA 1HZ9A 4A3LG 2NZOA 2B63H 2JA6G 4X65L 1JJ2A 5LMUQ 3M4PA 4L5QA 2PI2E 4GLAC 5IYBG 4JI7L 5C0XI 3J7A5 3F2BA 4R1JA 1S3OA 1QVCA 2UUCQ 4JCVE 5JJLA 3HOWG 1Q12A 4DK3C 4B3TQ 3S14H 4R4CA 1U5KA 1KRSA 5IP7G 1X9NA 4JI4Q 3GO5A 1OXSC 4MZ9A 1N36L 3AFQA 1EOVA 1X6OA 1MJCA 3KF8B 5IYDG 4LF5Q 5K36G 1LYLA 1Q86C 3I4MG 2HQLA 4R4OA 1G6PA 1LM0A 1V43A 4PMWA 1M1KC 4A3LH 2JA6H 1GD7A 2F3IA 3I4OA 5IWAQ 2K14A 2R7DA 2JA5G 5IYBH 1W2BA 4DV7L 1E22A 1L1OA 1HNXQ 1VQHA 1FJGQ 1VQ6A 1E24A 3HOWH 1Q1EA 3GTGH 3CPWA 3TEHB 3S17H 4LWCA 3H0GG 5IP7H 1PH8A 4EX5A 1WYDA 4YCVA 2LXKA 1FGUA 4XIGS 1Q81C 1EIFA 4NPSA 1CKNA 3F1ZA 4IOCA 5IYDH 5IP9G 3Q8DA 3I4MH 4JI5L 4LFBL 3KYHC 2OQ0A 5DLQE 3HOUG 4BXXG 4APVA 4IFDJ 1C0AA 2D0OA 1XMQQ 4JBKA 3PUXA 2ZM6L 4DV1L 2JA5H 3MEFA 2VNUD 4DV4L 3CXCA 1Q8KA 1VQBA 1PH6A 1XMOQ 3NENA 4PG3A 4LF8Q 3H0GH 2I5LX 4AQYQ 5JEAJ 1YVCA 4X66L 1VQMA 4JYAL 4BBSG 5ELOA 3BZKA 2OTLA 4B3MQ 3GTJH 4XTCS 5IP9H 4L5RC 1CKOA 4POGA 2CKZB 1PHJA 1OXXK 2D62A 3PCOB 2Q2UA 3HOUH 4BXXH 3HOYG 3K7UC 5FJ8G 4QGUA 4IFDI 1D8LA 4NXMQ 5M3FG 4H02A 1HNZQ 4YY3L 1BVSA 3RLNA 2N49A 4DR2Q 1J5EQ 4P74A 1K8GA 1I50H 3GTOH 3OTOQ 4GKJL 2AWOA 4PZ8A 2VY3A 3A5ZB 3I4NG 4BBSH 4B3RL 1L1OB 5M5WH 1R9TH 2ZJRA 1VQ7A 1PYBA 4DR7Q 3I55A 3PGZA 5IT9c 3JAMi 2KHJA 1EWIA 3HOYH 4JI3Q 1J6QA 5FJ8H 4P75A 4AYBE 4C3HH 1YIJA 2V1CC 3T1HQ 2N8NA 1CKNB 2VQFQ 4BY7G 1FVIA 2NZHA 1N34L 2EXDA 5M3FH 2MFIA 1QZHA 3CC2A 3G4SA 1X3EA 5LMNQ 1RIPA 2WAQG 5GAHC 3PO3G 2Y0SE 1GM5A 4DV0L 4GNXC 1G51A 2JA9A 1L1OC 2IX0A 3PV0A 2UUAL 3I4NH 3PO2G 4HJ5A 4JV5Q 1X3FA 2VZAA 4IPHA 2BA1A 2FXQA 4HIMA 4IPCA 2E2IH 2D0PA 4JI0Q 2PQAA 1HZBA 4DV2L 4A3GG 2XGTA 4LF7Q 3FP9A 3HFZB 4OWWB 4B3SQ 2L15A 3F2CA 1ASZA 4RMFA 4JI8Q 4BY7H 4DV5Q 4DPGA 3STBC 3PO3H 5AJ3Q 2QA4A 3RNUA 4JI6L 1UE1A 2OCEA 4RG1A 1X3GA 3PIOA 3PO2H 4BA2I 3ZJYC 2HHHQ 2N3SA 4HJAA 1SMXA 5C4JH 1KL9A 2Y0SG 4A3GH 2ASBA 4C3IH 1N36Q 2WP8J 2Q2HA 4LFCQ 2UUBQ 4HJ7A 3D31A 5J3BA 2RHSB 3AQQA 4UY8C 5FLXc 1SFOH 3H3VI 1NY4A 1IXRA 1PYSB 4WJ4A 4X62L 1VQ4A 4MNOA 1CSQA 1EFWA 4K0KL 2IY5B 1E1OA 4DKAC 3K81C 4DV6Q 3PF5A 3STBD 4DV7Q 2NVXH 1A0IA 2HIXA 3JC66 4YCUA 1ASYA 4IFDG 1YEZA 3RN5A 4PZ7A 4JBWA 1C9OA 3I56A 1A8VA 3T1YQ 3FHWA 2KCMA 1EIYB 2K5NA 4JOIC 4GOPA 4GLVB 1K9MC 3HOZG 3M7NA 2F52A 1LTLA 1VQIA 1IBMQ 3D0FA 4JI5Q 2CWPA 2PQAB 2BH2A 1S40A 3I2ZA 4AH6A 5M5XH 3CCJA 1YJWA 1XNQQ 1TWAH 3KDFA 4P73A 1WOCA 3GD7A 5FLMG 2E2JH 5BR8L 3ERSX 2IHFA 4X64L 2ZJQA 3KF6A 1SE8A 3IRBA 1JE5A 3J80i 1IBKL 2YTVA 3RR5A 3KJOA 2JA8G 1K83H 3EIVA 1NBWA 2VQEL 3HOXG 1G291 4QY7A 4LF6Q 2K5VA 1X54A 2OQKA 2UXDQ 3HOZH 1LUZA 2JE6I 3K80C 3PUVA 4FDBA 4YCWA 4MTNA 4QJFA 3G71A 4DR4Q 1E3PA 3A5UA 4DUYQ 3U58A 2JEAI 5GAGC 5E7NA 4DR5Q 4LF9L 3ER0A 4GN5A 1KD1C 1QZGA 1N33Q 5FLMH 2B29A 2JJQA 1XTDA 2NN6G 1BKBA 2Z6KC 3E9IA 3GDEA 4UP8A 2R93G 2YV5A 1X56A 2KCTA 2JA8H 4GKJQ 2BH8A 3EBEA 1UE5A 2AWNA 3S1MH 3L7ZC 3HOXH 2UU9L 1VQ8A 2UXCQ 3CCVA 3OW2A 4DAMA 1Z9FA 1XNRQ 3AEVA 4DR3Q 3CQZH 2KBNA 3UDIA 3PUYA 1KQSA 4IO9A 1PH3A 1PH4A 1M90C 2UUCL 4GOPB 1UE6A 2Q2TA 4B3TL 2WAQE 3CC4A 2WB1G 4OONA 3JAMc 4JI4L 4A3DG 2R93H 1OXTA 1VQJA 4UP7A 2OWOA 1HNWQ 1VQKA 3NBHB 5EAYA 4AIMA 3KFUA 1P16A 1RL2A 2YYZA 1C7YA 4DV0Q 4LF5L 3KDFB 1JB7A 4DR1Q 2UUAQ 4GKKL 2JEBI 2UXBQ 1SROA 1KHIA 5LMNW 2MO1A 2K4KA 3KF6B 4R4QA 4TVAB 3BJUA 5IWAL 1K0RA 2RF4A 4GN3B 3L0OA 3WWVA 4R4TA 4DV2Q 2Q2IA 1JT8A 1Y14B 1HNXL 1FJGL 4J15A 1FL0A 4O0AA 4JC0A 2ATWA 5C0XG 2A8VA 3U4ZA 2GVAA 4A3DH 4LF4L 2R92G 2ZJPA 2IT1A 4JI2Q 4JI6Q 1PA6A 1HR0W 4L5SA 1NE3A 1YHAA 1W3SA 2C35B 2YTYA 2PI2A 4A75A 2K50A 3CC7A 4DUZQ 3ULPA 4NXNQ 1MKHA 1A62A 4LFAQ 3ICEA 1K73C 1Q46A 5HY6A 3S2DH 1V1QA 5HGQA 1HZCA 2PNHA 2WFWA 3HKZG 3W1GA 3RN2A 3W5OA 1DGSA 1GVPA 1XPOA 3HKSA 1EQQA 4LF8L 3M4OH 4OX9Q 3F8TA 1TWCH 2ID0A 2R92H 1PFSA 1KIXA 1HR0Q 4JBMA 2I0QA 5GADC 4KHPL 4YWLA 1QUQA 1OXUA 4IJHA 3RLOA 3AFPA 4DNIA 4IPGA 4DV3Q 4Y52H 2CFMA 4OWTB 2GVBA 3I7FA 1VS0A 3CPFA 4KLKA 1YJNA 4X65Q 1JJCB 1AE3A 4BY1G 1I94L 5C4XG 1UE7A 1X65A 4DK6C 2XTIA 2NVTH 4TQUS 1UEBA 4JI7Q 2LXJA 3S16H 1BBWA 1HNZL 1Y1VG 2VL6A 3UDXA 4A3KG 4DR6L 1J5EL 2EQSA 4YHHL 3GTQH 1CSPA 1XPRA 4ME3A 2VW9A 2AMCB 2K5HA 2NVYH 3UDFA 3CCMA 3RZOH 3M3YH 1VQNA 1XPUA 4DR7L 1OTCA 4IPDA 3UDGA 1YJ9A 2CWAA 5BR8Q 4C2MH 3J81j 1PH1A 1PH7A 2E5LL 1K3RA 1XJVA 1GO3E 5C4XH 4X6AH 4BY1H
chains in the Genus database with same CATH superfamily
4HIKA 1CA6A 4UAIA 3OMCA 1TS3A 1CQVA 1SLJA 1V9PA 3GTMH 4OO1I 4X3SA 5C5LA 2VXWA 4K2KA 1DYQA 5LL6X 3EJIA 4JI0L 1PFNA 3A55A 4OEMB 4L5TA 2PW7A 5BN5A 4LF7L 1N9WA 2HT1A 3S24A 3MC0B 2MP1A 4KD3A 4DV1Q 4KY5A 1DOKA 4HMJA 1Q3LA 2KQ3A 5H1SE 2A68C 1VMCA 2A1AA 4K5VA 1SRUA 1S5FD 1I5FA 3M9BA 5IYCG 3BU2A 1A3VA 4QL5A 4A3MH 2HHHL 1SNDA 3HOYB 4K8IA 4JI1L 4A3BH 1MJEA 3KLWA 4WJWA 1EYDA 2B3GA 4IN3A 2UUBL 2MO0A 3M85A 3HEJA 1B53A 3I4NB 5JPMC 1VF7A 1EUJA 4RFBA 3M4YA 3H15A 2E2DC 1UWVA 4DGZA 3M4QA 2A68D 5LMUL 1STGA 4BY7B 3HS0C 1Y8NB 2D5DA 3CCUA 3BVZA 2K1BA 4LF4Q 1PH2A 3MXNA 3S1QH 2N88A 4A3EH 1IBML 4F8MA 1SNOA 3GTLH 5C4JB 3Q23A 2LMCB 5ELFA 2RVLA 1PH9A 2QGQA 3E9HA 4K6LA 2X6GA 3ULLA 2F0EA 2HQEA 3T16A 4CDCC 1SFOB 3EN2A 4LF6L 4PQXA 1SN8A 4BY1B 1QVGA 1I6HH 4GLXA 4R4IA 4DUYL 4LUZA 1I4RA 2NVXB 4A3JG 1WCMG 1AE2A 1BCPB 2H5XA 1P8LA 5IE8A 1QCBD 4K8JA 1JICA 5C44H 2EJMA 4DR6Q 2RCFA 1CUKA 1NJIC 2HD3A 3FKIG 4IOAA 2BDOA 4DN4M 4EVOA 2MNAA 4GNXB 1TWAB 4KJOA 1GHJA 3PIPA 4AQYL 1XNRL 4G57A 2E5LQ 4A4IA 1O7LA 2L11A 1YZ6A 3E6ZX 3HOVB 1JMCA 3HOZB 1L0YB 2UXBL 3E0EA 3TREA 3QR8A 3KLSX 1I3QH 1NTGA 4ZLTF 2JA8B 4FF2A 1Q7YC 5KRUA 1GUWA 3W2DA 4ZAIA 3QJYA 4JI2L 1B3QA 2F0NA 4QIWE 2VQFL 1IBKQ 4P2CB 1PZID 4BBRB 3F2DA 1YNXA 2AHOB 1SJHD 1X3QA 2J7ZA 4B08A 1IYJB 1VQCA 1WTVA 1HUNA 1H9KA 4JI1Q 4ALPA 5D14A 2SNMA 4A3IH 1BBXC 1ET9A 2XWJB 3QOLA 2FINB 2YU9H 5CORA 4YWKA 3KJPA 1WTPA 2TMPA 4A93H 2F0QA 3BZCA 2RHQB 2B2YC 3CCSA 1RTNA 1Y1WH 1ZEQX 4QUFA 2I5MX 4DV3L 5GAEC 5C3XA 4P72A 1HZ9A 4OHJA 1AFPA 3C1FA 5LMUQ 1GUTA 2PI2E 4GLAC 3J7YW 4JI7L 3J7A5 5IGGA 4XQNA 1QVCA 2WIIB 4QF4A 1Q12A 3SVMA 1KRSA 4JI4Q 1X9NA 2CQAA 3KBGA 1EY5A 1XX8A 1HPCA 1M1KC 4A3LH 1F77A 3PQIA 4NKLA 3VYRA 3M4OB 1W2BA 4DV7L 4N9PA 1L1OA 2R92B 1FJGQ 1VQ6A 1WTRA 1Q1EA 1BQQT 1SNQA 3D3RA 1CA5A 4YCVA 3GV3A 1A2UA 1Q81C 1EIFA 4IOCA 5IYDH 2XRSD 1SJED 3Q8DA 5E4WC 4LFBL 2ENBA 1IL8A 4JBKA 2JA5H 2ZM6L 1DD2A 1H9JA 1VQBA 2KA7A 2NVYB 4AQYQ 2I5LX 5JEAJ 4C2MB 2A6HC 2NTSA 5IGEA 4IUQA 2Q2UA 3HOYG 1PRTB 5I6WA 3GTMB 1MGSA 4IFDI 3NBIA 4XQJA 1K8GA 3BVMA 4PZ8A 3I4NG 2M00A 5CV7A 4RH6A 4S3SA 3W3AA 5M5WH 1VQ7A 3I55A 3PGZA 1R4PB 2PCFB 3HRZC 5JOBA 4UDUC 1ICFB 1ESFA 1EZ8A 2L9HA 5FJ8H 4DA2A 2K5DA 2VQFQ 4BY7G 1N34L 5M3FH 5GAHC 4A3MB 4ULLA 2JSOA 2UUAL 4A3BB 4ODGA 2F0MA 5IT9L 1B1ZA 1EU4A 3IL8A 2FXQA 1EYAA 2E2IH 3WDNA 1HZBA 5EKIA 3HFZB 4OWWB 4B3SQ 4RMFA 4DV5Q 4QIWB 3PO3H 4Q5VA 2EE1A 4DAPA 1FD7D 3R3OA 1X3GA 4RG1A 1IKLA 1STBA 2EJFC 2F0TA 1O78A 1SMXA 4LMQD 3S1QB 4A3EB 1EY7A 2ASBA 4LFCQ 3OMGA 5I2YA 3GTLB 5J3BA 3H3VI 4FF1A 1IXRA 4X62L 4MNOA 4DKAC 2I46A 4DV6Q 1G2TA 4DV7Q 3WOEA 3E5SA 4PZ7A 4JBWA 3I56A 1I6HB 3FHWA 1EIYB 2K5NA 4JOIC 4RA8A 3HOZG 1PZKD 4KKSA 1LTLA 4M8AA 1IHZA 3GQBA 5C44B 4EGVA 4AH6A 2ZXPA 3MTSA 5FLMG 4H7BA 3ERSX 4X64L 2ZJQA 3KF6A 3IRBA 1ENAA 2JA8G 3QB3A 3RR5A 2EYFA 1NBWA 1IYVA 1KLGD 3H3VC 2X69A 2K5VA 3K80C 3PUVA 4QJFA 3G71A 3U58A 2JEAI 1F9SA 4DR5Q 4GN5A 1ZYRD 3SK6A 1N33Q 3MFYA 3I73A 2L5TA 4UP8A 5T1GA 2A6ED 1BCPF 3EBEA 1UE5A 3S1MH 3L7ZC 2F0UA 1HUMA 1I3QB 3TP5A 3CCVA 3OW2A 1JE4A 1EFID 2K01A 3CQZH 3PUYA 5FO7B 5CV6A 2RKSA 2WAQE 5CV4A 4B3TL 1SYBA 3JAMc 5JAVA 5A35A 2R93H 1OXTA 1VQJA 1HNWQ 3R2TA 5EAYA 1P16A 3TP6A 3KDFB 2UUAQ 2JEBI 3DUZA 3OIPA 5LMNW 4A3IB 2K4KA 3OWEB 1LACA 4GN3B 2IX3A 2YU9B 4A93B 1Y14B 1HNXL 2A74C 3K0YA 1Y1WB 3U9OA 2EY6A 2A8VA 4ZYSA 3U4ZA 2GVAA 3LX0A 3SEBA 2R92G 1JWMD 1JOQA 1LTBD 4F88A 2B2YA 1W3SA 2C35B 4RCNA 2PI2A 2PMZB 2EY1A 5KNDA 4A75A 2N55A 3CC7A 1HCZA 4CKEA 1KTKA 2EXZA 5FKAC 4NXNQ 1MKHA 2R61A 1A62A 1I4XA 1Q46A 5HGQA 2O4XA 5A2QL 3X3MA 5C0XH 5COYA 1TQOA 2B2VC 3F8TA 1B2TA 1PFSA 1HR0Q 2QDLA 2HCIA 3RLOA 1OXUA 4DNIA 1EY0A 2NWGA 1U4LA 1DCZA 2GVBA 3CPFA 4KLKA 1F2ZA 1TIID 2XTIA 2LXJA 1BBWA 1PZJD 4MHEA 2LFNA 3A8JE 2BCOA 4YHHL 2AMCB 2Q8RE 2K5HA 4EQNA 3M3YH 1XPUA 3K6OA 4BWGB 1OTCA 2L4NA 2JA5B 1V1PB 2DNCA 5KYLA 1GO3E 4BY1H 3MVVA 4PNYA 1CKMA 2E74C 3WOFA 3OW7A 3K7AH 2VB3X 4CJ1B 3J80c 4DAYA 3ONAB 2XVSA 3UE1A 1N32L 3I4LA 1VQ9A 2ZXRA 2F0PA 4A3MG 1WFQA 1VQEA 3IFDA 4NB3A 1JWSD 1Z47A 5ELNA 1K8AC 4A3BG 1LTAD 3SE0A 1KDBA 2C9OA 2HIVA 2IL8A 2KUMA 1VQPA 2ZTDA 3DM3A 1Q1BA 3I90A 5AJ3L 1ENCA 3DLLA 5KGUA 5M5WB 2PO4A 3CMEA 1TXYA 2IW3A 1HH2P 4HR7B 2F0DA 5DNFA 3HOVH 2WB1E 3S1RH 2NUCA 3FEWX 2RSOA 4HIDA 1E2VA 5M3FB 3M7GA 4CJ0B 1VQGA 1BO0A 3DXJC 1KXLA 1RTOA 3HG9A 4A3EG 4XXEA 2NTTA 4YY3Q 3G7LA 4KI0A 1Q8IA 4J1MA 1PRTF 2E2IB 2ES2A 2PNRC 4B3RQ 4ME5A 4RAUC 1TWCB 1VMPA 3S15H 2KOLA 5C5MA 3TRZA 3LWUA 4KK7A 4BBRH 1B4OA 2EVBA 3B6YA 3PO3B 2WAQB 3FVQA 3MEHA 3HGBA 1NR4A 1K28A 1Y69U 1HJPA 3J81i 1TR5A 1VQDA 1YHQA 5C44G 4RGMA 2JA7H 2Q8IB 1JB3A 2Z9HA 1A6XA 2XN9C 4GOPC 3GTPH 1F9PA 2KHIA 3A74A 1SNMA 4FXKC 1EYGA 3TS2A 2XWBB 1KDCA 1RDPD 3N52A 4L6TB 2BA0A 4DR4L 3CU7A 1EZ6A 2NYZD 1G91A 1SE3A 1V1OA 1YI2A 1OXVA 2K5QA 2QF7A 3IKJA 2CCZA 1BBUA 2Y0SB 4CKCA 3PIP3 5IGCA 1W6KA 4YHHQ 1PH5A 3NUCA 4RKLA 2L0CA 2K7VA 2Z0SA 1VQOA 1DZ1A 4OO1H 1LTSD 5CV9A 2F03A 1PTOD 1XYIA 2UXCL 4JOIA 4JPBW 2KHSA 4QQBX 4DR3L 3CD6A 4QCLA 1C4QA 4B3ML 1BXTA 3DEOA 4OWXB 2L1BA 4K0KQ 1A15A 3MXNB 3Q0AA 1PVOA 2LKVA 4A3CH 1VF5C 4NXML 4DR1L 4UP9A 2SNSA 2ZXOA 4DR2L 3CF5A 1N32Q 2RCNA 4ILWA 3L3OC 4ZKCB 1HZAA 5JVH3 3DEPA 3NEMA 1TWGH 3KF8A 1H95A 4A3IG 2BE5D 2NBFA 1L2FA 1SYCA 4A93G 4EQOA 3S1MB 2DGYA 2A19A 2EJGC 2TSSA 1IW7D 4KV6A 1TWFH 4YWMA 3T1HL 4A3FH 1Y1WG 2AQ2B 3KOJA 2VQEQ 1YBYA 3CQZB 3TP8A 4KY6A 4PMBA 3OHXC 1JJGA 4LFAL 1BF4A 1NMGA 3T56B 4LF9Q 2R93B 5EGTA 1Q82C 3SGIA 1WTWA 3J7AV 3KBXA 3EFXD 1F9RA 5L37A 2MHVA 3SXHA 4OX9L 3UE0A 4FXDA 4C3JB 3T13A 2KCCA 1WJJA 2AKWB 1G8ZD 1H9RA 4A3LG 4OIKA 3BDLA 4X65L 1JJ2A 3M4PA 4L5QA 3C2PA 2WB1B 4HMIA 3F2BA 4R1JA 1S3OA 3V2TA 5FLXL 4JCVE 2UUCQ 2J4XA 3DM1A 4DK3C 3S14H 1NAPA 2NB0A 1OXSC 5HGTA 2PPBC 3AFQA 1B9NA 5IYDG 1SE4A 1STNA 2JA5G 5IYBH 2B2UC 1E22A 1VQHA 3HOWH 3GTGH 3TEHB 3FMCA 5D3DA 5IP7H 1PH8A 1PDQA 4NPSA 4DNTB 3F1ZA 2OQ0A 3MA2B 4DXGA 5BN3A 4IFDJ 1UEAB 2D0OA 4KN4C 4H0LC 5BN4A 3V05A 2VNUD 1WD0A 1AN8A 4DV4L 2Z1CA 3M3YB 4ZK9B 1UUPA 4LF8Q 4ZCKA 1YVCA 4X66L 2MUYA 4JYAL 1EY8A 4KJNA 4B3MQ 3GTJH 3A8IE 4UHVA 4GZYC 2OF1A 4POGA 2CKZB 1OXXK 3K7AB 5FJ8G 2EYJA 2HDLA 4NXMQ 1S5ED 3K57A 5M3FG 1HNZQ 1BVSA 3RLNA 2N49A 4DR2Q 4F7XA 1I50H 3H94A 4GKJL 3NP8A 1O7YA 4IURA 3I91A 3I70A 1SAPA 1L1OB 3BS1A 5ELEA 1PRTC 1PYBA 1RD9D 1CHQD 2LS01 5IT9c 1STEA 3JAMi 2KHJA 1EWIA 1YIJA 4AYBE 2V1CC 3T1HQ 2N8NA 1FVIA 2MFIA 4O42A 3G4SA 2DNEA 1Q90A 4N8FA 2EYOA 2WAQG 3PO3G 1KDAA 2KJXA 3S1RB 4FYDA 2O5IC 4DV0L 1IKMA 1G51A 1U4RA 3PV0A 2IX0A 4XT1B 1X3FA 4IPHA 2VB2X 4NW2A 2F3WA 2BA1A 4IPCA 4JI0Q 4N8X1 2FMMA 2XGTA 4LF7Q 1SDFA 2L15A 1ASZA 1HHVA 3A56A 3R93A 4DPGA 1S5DD 3V96A 4JI6L 3S15B 4I7AA 1ENFA 1PYWD 3A8KE 3TSSA 1UAPA 3PIOA 4BA2I 2HHHQ 3VYUA 4HJAA 2Y0SG 4C3IH 2Q2HA 2UUBQ 2MJ8A 4G7OC 3BDOA 2JA7B 4WJ4A 1VQ4A 3VR5A 3GTPB 2RSNA 2H1EA 1NSNS 3VR6A 1DJRD 1K3BC 1A8VA 4HTHA 5IT9E 4GOPA 4GLVB 4CKBA 3VR3A 1GUOA 5C4HA 4I7ZC 1IBMQ 4BS9A 2CWPA 2BH2A 1SBBB 3I2ZA 3NBHA 5CV5A 4DNRB 3CCJA 4K2LA 1X3PA 2E2JH 2IHFA 1L0XB 3D4WA 4IFDH 1JE5A 3J80i 1EWCA 1K83H 1G291 3ITPA 4LF6Q 3EA6A 1X54A 4WFN3 4U68A 4FDBA 4YCWA 1B9MA 4YIJA 1Z7TA 3A5UA 1F2MA 1STYA 4DUYQ 5E7NA 3ER0A 1TKWB 4DFAA 3GDEA 1XTDA 1BKBA 1Y8PB 4ZUJA 1FNVA 2R93G 2FFKB 2KCTA 4GKJQ 3A54A 3O13A 1XWEA 3AMUA 2UU9L 1TWGB 1VQ8A 4DAMA 3OOCA 1XNRQ 1JOOA 2HCCA 2IPKD 4IO9A 1PH4A 1M90C 1UE6A 1TWFB 2JP1A 2KEEA 1ET6A 3EQLC 5KEEA 4R8IA 4A3FB 2Q2TA 2WB1G 2NN6H 5I6YA 4F87A 2OWOA 4FP5D 3KFUA 1RL2A 3SK8A 3VYTA 4LF5L 4DV0Q 1SYDA 1JB7A 2UXBQ 1SROA 1KNEA 3KF6B 4TVAB 5C4ZA 4ZRZA 5IWAL 2RDGA 1K0RA 2RF4A 1EY6A 4R4TA 2Q2IA 1E0BA 5CBEE 5HURA 5C0XG 4AYBB 2A6HD 4A3DH 2DN8A 3K59A 1EIHA 4JI2Q 4JI6Q 1HR0W 3HZXA 2D9UA 2AQ1B 3VA5A 3S14B 1YNNC 3ICEA 2CH4A 5HY6A 3AB9A 2PNHA 1MBYA 3W1GA 3W5OA 1DGSA 1EQQA 1HA5A 1TWCH 1AP0A 5KNBA 2I0QA 2O2LD 1QUQA 4DV3Q 4Y52H 3MXPA 2CHBD 3I7FA 1YJNA 1HFNA 1AE3A 2PQEA 4BY1G 1FYCA 1UE7A 1X65A 2J0TD 4L63B 3GTGB 3HOWB 4JI7Q 3S16H 5CBAE 3BDCA 1J5EL 1LLRD 2EQSA 4G4KA 2B2UA 4NDXA 1CSPA 3NWSA 2V4DA 1WD1A 4X3TA 3CCMA 4X3UA 3RZOH 2Z8LA 1E2WA 3H09A 1WTOA 1VQNA 1STAA 4DR7L 2B8FA 3MWYW 1RCVD 1XJVA 3MZ5A 5C4XH 4X6AH 1BDOA 1O80A 1RJTA 4LK1C 5E1FA 4WORA 2KCNA 1Y1VH 4A3KH 1HA6A 4KKTA 2F4VL 3GTJB 1B70B 5DM63 5ISRA 4JV5L 2F0SA 3TS0A 5D3IB 1SXTA 3HOVG 3AYHB 2JXMB 5A2QE 4Y7NH 1F2YA 3ND9A 1LTRD 2MQHA 2N78A 2AUKA 4LFBQ 4HIOA 1I50B 1L0WA 2ZM6Q 5EKKA 3CCEA 2ZTCA 2UU9Q 3Q22A 3K5NA 2K5WA 3CRKC 3D4DA 3NHHA 1HXYD 3VR4A 2D2CC 2KENA 1ILPA 5GQOA 3P1HA 4IUNA 5JEAH 4BBRG 2EY5A 1N8RC 4P71A 3K58A 3TBIB 1HQRD 3ERQA 2E2HH 4POFA 3S2DB 2PZWA 4IJLA 4X3KA 2PZUA 2R7ZH 2JQOA 5C3EH 1KRTA 2JA7G 1T9HA 1RHPA 4XDXA 4ABNA 3T1YL 4DAYB 4HN7A 4A76A 4PZ6A 3G48A 3J81L 1ML0D 1N34Q 1KAAA 2L12A 1IL2A 3CAMA 1XNQL 2OXPA 3CCQA 5EQ0A 1NR2A 1Z6HA 4I65A 5M9OA 1CZWA 4C3IB 2IHEA 2SEBD 3K8AA 1B7YB 4FXGC 4C3JH 4CBVA 1O7ZA 3FPPA 1CHPD 4OO1G 1I4HA 2UXDL 1S72A 5M5YH 1SNPA 3R2IA 4CDDC 2VS1A 4GN4B 2P5ZX 1DM0B 3N6RA 2R7FA 1PV4A 4A3CG 1E1TA 2OTJA 3S9WA 1U0LA 1VQAA 2HUGA 1NUCA 2YTXA 2E75C 3K0XA 5GROA 2E2JB 1F2LA 1J9OA 1T5XD 1EQRA 3KK7A 4X62Q 3U50C 3NTIA 4JG2A 1K83B 4LUVA 4HAEA 2ZTEA 2F4VQ 2QEXA 3OIQA 4A3FG 4C1NK 4HSVA 2H4OA 2G9DA 4HJ9A 2PYKA 3PF4A 2K6AA 3HP3A 3CCLA 2VUMH 3OTOL 3MFGA 1X55A 5JJIA 1HRJA 3RZDH 1VCIA 2A69C 2EOTA 5FK9C 1RKNA 1WTHA 4OIJA 1TT2A 3MXUA 4X64Q 1PTOH 5M3MH 2MGSA 4JI3L 4NMZA 2KVMA 4AYBG 5LMNL 3CMAA 4DUZL 1D6EC 2Z4HA 3S2HH 1MSHA 2LSSA 3VDYA 2G9HD 2A69D 1G2SA 2DUDA 4JI8L 2RDFA 4JBJA 2EIFA 3SR1A 1CTMA 1WTQA 3ND8A 2B63H 2XIWA 2XRQD 1BUVT 1SNCA 1TWHB 2R3ZA 5G3LF 5LL6S 5IYBG 5C0XI 4A3DB 4OGQC 5JJLA 5LHY1 3HOWG 4B3TQ 1LTID 4R4CA 1K8OA 5IP7G 4MZ9A 2DY7A 1I6VC 1JORA 2HDMA 1X6OA 3KF8B 2RBMA 2ICIA 5IGBA 1G6PA 4PMWA 3TZUA 2OT2A 2JA6H 1GD7A 1SEBD 3I4OA 2RA4A 1GUGA 2R7DA 1JQYD 5IODA 3C3LA 3Q24A 1HNXQ 1E24A 3G6JB 3CPWA 3S17H 2WKDA 3C1EA 2LXKA 1CKNA 5K36H 3I4MH 4JI5L 1CM9A 3S16B 3KYHC 5DLQE 4KMUC 4APVA 1G6ZA 1TVXA 1QNKA 3PUXA 4DV1L 4CGYB 1Q8KA 3RZOB 1U4PA 3T4AC 4KN7C 4PG3A 5FO9B 3H0GH 1LTTD 4J6HA 1HFGA 3P7JA 5ELOA 5FLXE 5C4XB 4CJ2C 2PZTA 4KY7A 4XTCS 5IP9H 1KLUD 1CKOA 4BXXH 1Y1VB 3PCOB 4A3KB 3HOUH 2E76C 1D8LA 4H02A 3UI2A 1JWUD 3P75A 3VA7A 2QW7A 4P74A 2F0HA 3GTOH 3OTOQ 2AWOA 4Y7NB 3K5OA 1FR3A 5ELCA 4BBSH 1MI2A 3JAML 1R9TH 1BCPC 2ZT9C 4IALA 4JI3Q 1J6QA 2DJGC 4C3HH 1RODA 2F4IA 1DXMA 2NZHA 5E3FA 1ONLA 1X3EA 2QDBA 4TKOB 1RIPA 5LMNQ 4HSPA 2AQ3B 2C5CA 2F0IA 4E6IA 4R8NA 1GM5A 4GNXC 1L1OC 2VZAA 2CW0C 1TY2A 1PMRA 2D0PA 2PQAA 1NCVA 4DV2L 2LY7A 3PIO3 4C3IG 5J1ZA 2E2HB 1XTCD 1SSOA 1BCPD 5C6AA 4JI8Q 3QIAA 2R7ZB 5AJ3Q 5C3EB 3RNUA 1MD2D 1UE1A 4HCSA 3TN2A 3PO2H 1D5XC 3ZJYC 2N3SA 2Q8TA 4A3GH 1K8MA 1I4QA 5F2DA 2WP8J 1AW7A 4HJ7A 1AZPA 2F0GA 2RHSB 3AQQA 4FF4A 1NY4A 3GV6A 1PYSB 5IGDA 2WV6D 2IY5B 2AUJD 3T53B 2SOBA 1UNSA 1X32A 2FHTA 1YEZA 3RN5A 4FF3A 4IFDG 5M5YB 4PMCA 3Q6SA 4XYOA 4M1UB 4RGTA 1K9MC 3M7NA 2F52A 3BG3A 4FVMA 4JI5Q 3DWQA 1S40A 5M5XH 1YJWA 4DK0A 4P73A 1AEXA 3J80L 3GD7A 4K5WA 5IOCA 5BR8L 2IJ0A 3NE5B 1SE8A 1IBKL 3KJOA 2EYLA 2FJ2A 2OQKA 5EPJA 3X3NA 2JE6I 4DR4Q 1E3PA 5EBCA 1IYUA 3MAQA 2B2VA 1EIGA 4MTKA 2Z6KC 2B29A 2JJQA 1MSGA 2NN6G 2YV5A 3KLSA 4EQPA 4JVZA 1X56A 3DWPA 2VUMB 4FNFA 3IFTA 2AWNA 1TS2A 3HOXH 3RZDB 1DOLA 2UXCQ 1H9SA 3AEVA 4DR3Q 4V190 1KQSA 1PTOB 5M3MB 2CH4W 2MPMA 4GOPB 5EJWA 4C1NI 3CC4A 4OONA 4JI4L 4A3DG 2NZ1D 1VQKA 3NBHB 1D7QA 2YYZA 1C7YA 5CC4A 4DR1Q 4GKKL 3S2HB 4IUVA 3L9AX 2MO1A 2XSCA 4R4QA 4CDFC 1HQMC 2F0VA 3L0OA 5I9PA 4DV2Q 1C8CA 1FJGL 4J15A 1FL0A 1EYCA 4O0AA 2ATWA 1CI3M 2DJFC 3I3CA 5ELDA 2ZJPA 2IT1A 2B63B 1PA6A 4L5SA 3EVQA 4LJZC 3QWNA 4OELB 5G3LD 2X6LA 5EPLA 2F0OA 2I07B 3ULPA 4LFAQ 1A3TA 1K73C 1PFMA 3S2DH 4QMGA 2WFWA 4Z9CB 3NWTA 3RN2A 1GVPA 3HKSA 1TS5A 4OX9Q 2ID0A 2O5JC 1KIXA 2JA6B 1PRTD 4KHPL 4YWLA 4IJHA 1QE6A 4K14A 1B50A 2BOSA 1HTPA 2CFMA 2K28A 4ID6A 3BZDB 4OWTB 1M4VA 3CHBD 5C4XG 1I94L 2B8GA 1JR0D 4X65Q 3QO2A 2NVTH 4TQUS 3S17B 1Y1VG 2VL6A 3UDXA 4A3KG 3GTQH 1XPRA 3I4MB 4ME3A 2VW9A 3UDFA 1CQFA 5KYIA 1TU2B 1GJXA 1GHKA 3UDGA 1YJ9A 5BR8Q 3J81j 1CK1A 5J39A 2BDNA 1LT6D 2KECA 2EYPA 5TSSA 3ZYYX 3H0GB 4IUPA 2DY8A 2ICEC 4OXPA 1GXDC 3CW2C 3OPOA 4NP5A 3S1NH 3PUZA 3TQYA 5I4DA 3HOUB 1W6JA 3D6CA 4XT3B 3TDQA 5JEAG 4WJ3M 1YNJC 4J8QA 4B3SL 3GTOB 2RDHA 1AZQA 4DV4Q 4GS3A 4DV5L 1QUQB 4BBSB 5CMDA 2B39A 4CDEC 2K03A 3A7AB 4G7ZC 1R9TB 4X66Q 4JYAQ 2R7ZG 1KAWA 3E3XA 5C3EG 1A63A 1EY4A 4C3HB 5IY0A 2F3VA 4U673 1YITA 1LT4D 1ICWA 3RMHA 2M2LA 4LFCL 1MHWC 4QB4A 3RD4A 3NELA 5ELBA 2K52A 4GKKQ 1J8IA 1YNJD 1IBLL 3G6EA 3J81c 1KNAA 4DV6L 5IYCH 4OL7A 4GNXA 1JC7A 4BA1I 4C3JG 1H9MA 1U9RA 3ULJA 2R6GA 1NMFA 3H91A 3W1BA 5C3WA 1M8AA 1VQFA 3PSIA 4C56C 1CZGA 4LW1A 1AH9A 1E7ZA 3PO2B 4DU9A 3DHQA 2E8GA 2ALYB 2XNAC 3SHLA 4A3GB 3HKZE 4L8JA 2K05A 3C46A 5J22A 3GP7A 3OYYA 1QVFA 2CQOA 3CCRA 1DOMA 3MXGA 1TWHH 4KHPQ 3PUWA 1R4QB 1SR3A 1D1IA 2B2WC 3LGJA 4DR5L 1I94Q 5I2XA 3H3VH 1N33L 1YHBA 4EQ5A 4Q0FA 1KC8C 4HEDA 1XMQL 3GTKH 5JVG3 1PFBA 3OSOA 3U4VA 3BVGA 3TZDA 3A7LA 1B8AA 1XMOL 3QG1A 5M5XB 2VUMG 1MIUA 2A5HA 2RQXA 3U9SA 3J7ZC 4A3JH 1WCMH 1WI5A 5EBDA 3NK9A 3J81E 5IIFA 1WTXA 2I5HA 5M3MG 2NVQH 1HNWL 4XYQA 3A0JA 2PMZE 5DEHA 3F2UA 3FKIH 2QILA 1EEID 4KHZA 2K75A 4IZ8A 4HJ8A 1U4MA 4LNQA 5FO8B 1YNND 2GN5A 3K5MA 5JJKA 1QJOA 1VQ5A 4H44C 4ZUIA 4JK1C 2NN6I 4RHSA 2EDGA 1GKHA 3HOXB 3CP0A 2Z6KA 3TP7A 1QWYA 3NSWA 4PV1C 3L2PA 3DMUA 4LUOA 5CGKA 1RF2D 1VQLA 1QB5D 3RLFA 1DONA 1O7IA 1A2TA 2IX1A 2B63G 5C0XJ 1IZ6A 1LV9A 2JK8A 1B3AA 4NXNL 1LT3D 5DAUA 4DAVA 3T51B 4UPAA 4O2DA 1HR0L 1IBLQ 4DF7A 2PW5A 2EPBA 1TY0A 1V8QA 3AU7A 3D4RA 2K33A 2NZOA 3I72A 2JA6G 1XXGA 1SMYC 1SYEA 1EU3A 1B44D 5IGFA 1ZYRC 1Y8OB 3QOJA 2WKCA 2B2TC 1U5KA 4JW0A 3GO5A 1N36L 5I9OA 1BNZA 1PTOF 4IUTA 2A6EC 1EOVA 4B9XA 1MJCA 5K36G 4LF5Q 1LYLA 3D8GA 1Q86C 3I4MG 2HQLA 4R4OA 1OO9B 1LM0A 1V43A 5AFWA 5CR3A 4MIUA 1T5EA 2F0KA 2F3IA 5IWAQ 2K14A 3VYSA 4K6DA 3P20A 1SMYD 4LWCA 3H0GG 4EX5A 1WYDA 1FGUA 4XIGS 3DWAA 1JOKA 1EQVA 5IP9G 2L55A 2NVTB 4BXXG 3HOUG 1D2BA 1C0AA 5FOBB 3HKZB 1XMQQ 3GTQB 2Z4IA 1I4GA 3MEFA 3MHBA 3CXCA 1PH6A 1XMOQ 5KIXA 3D6WA 3NENA 3VR2A 2EY2A 3KLRA 4KD4A 1VQMA 4BBSG 2JYOA 3BZKA 2OTLA 4L5RC 4DXFA 1CT1D 5CV8A 3KUPA 4RGNA 1PHJA 3J7AF 2D62A 2F0LA 3K7UC 4C3HG 4QGUA 1JCKB 4ZQ3A 2IWHA 4WRDA 1GUSA 5K5PA 1SYFA 3S1NB 4YY3L 1D5ZC 1J5EQ 1II3A 3NXWA 3EROA 3IAYA 3NTKA 1TS4A 2VY3A 3A5ZB 4B3RL 3SDZA 5T1IA 4FO2A 2ZJRA 4DR7Q 5EPKA 4G7HC 3HOYH 1D5MC 1PLFA 4P75A 3NQTA 1CKNB 1WVLA 2EXDA 1QZHA 3CC2A 1ZKOA 1EWHA 2Y0SE 2JA9A 4JV5Q 3I4NH 3PO2G 4HJ5A 2A73B 2G5DA 5D65A 4HIMA 2SDFA 1QILA 1QG7A 4A3GG 1SE2A 3FP9A 3URYA 1FNWA 3F2CA 4BY7H 4V0BA 4KTAA 3STBC 1BOSA 2QA4A 4DK1A 3SK4A 2OCEA 1ESRA 3FPUB 1VDZA 2Z6BA 3K5LA 5C4JH 1KL9A 1NNXA 3JAME 1N36Q 1K0SA 1S5BD 3D31A 1EQTA 4UY8C 1QNUA 5FLXc 1SFOH 1ZXTA 1EFWA 1CSQA 4K0KL 1E1OA 3PF5A 1QOHA 3K81C 3STBD 2NVXH 1A0IA 2HIXA 3JC66 4YCUA 1ASYA 2F0FA 3I8ZA 1C9OA 3T1YQ 2KCMA 2K32A 5NUCA 1LO5D 4IQZA 1VQIA 1HTLD 3D0FA 2PQAB 2F0JA 1C48A 1XNQQ 1TWAH 2B2WA 3KDFA 2F1MA 4ZKBB 3GTKB 1WOCA 3BYYB 3CRLC 4QUCA 1S5CD 3RUZA 2YTVA 3EIVA 2VQEL 3LWEA 4QY7A 3HOXG 4RHRA 4A3JB 1WCMB 2QKIC 2OEOA 2UXDQ 3FRPB 1LUZA 3HOZH 5JPNC 4MTNA 2WACA 3LNNA 5JJZA 2KEDA 1I4PA 5GAGC 4LF9L 4LAAA 3NQIA 1KD1C 2NVQB 1KABA 1QZGA 5FLMH 3FKIB 3E9IA 1EOTA 1EY9A 4K5XA 2K04A 3BYTB 1BR9A 2JA8H 2EYMA 2BH8A 2QEJC 1STHA 3TMEA 2EZVA 4KHVA 5KNCA 3SK5A 1Z9FA 4MN3A 1CFMA 5DM73 4RKBA 2KBNA 3UDIA 1A3UA 2WINB 1PH3A 5E4XA 2UUCL 1ILQA 4HCEA 2CVRA 2GA4B 4UP7A 4AIMA 3J80E 3FDTA 1FGBD 1KHIA 1GOZA 1SYGA 4RCOA 1PTOC 3BJUA 3WWVA 1GUNA 1EL0A 1JT8A 2FMCA 4JC0A 1V1PA 4KKUA 4H13C 3NPPA 4TRDA 4LF4L 1NE3A 1YHAA 3OWFA 2YTYA 4RGOS 2JN4A 2K50A 3R8BA 4DUZQ 4XQQA 2QCPX 1V1QA 2EYHA 1EEFD 3HKZG 1HZCA 2BE5C 3E0JA 1FNUA 4B9WA 1H9SB 4LF8L 3M4OH 1XPOA 2F0WA 2R92H 4JBMA 5CYUA 2B2TA 3CKIB 1IW7C 5GADC 3H6MA 2M9VA 3NTHA 3AFPA 4IPGA 4TSSA 4N9TA 1S4ZA 1VS0A 1JJCB 4DK6C 4RWSC 1PXUA 1UEBA 1LTGD 4DR6L 1LABA 1HNZL 1F9QA 1LT5D 2NVYH 2CW0D 3PMFA 1E2ZA 4R9WA 4IUUA 4CHTB 1D1KA 5EKLA 4IPDA 2E5LL 2CWAA 4C2MH 1PH1A 1PH7A 1K3RA 4O1NA
chains in the Genus database with same CATH topology
4HIKA 1CKMA 1Y1VH 4A3KH 3K7AH 1SLJA 2F4VL 4OXPA 3J80c 1V9PA 3GTMH 4OO1I 1B70B 4JV5L 3CW2C 3TS0A 3UE1A 3S1NH 3PUZA 1N32L 1VQ9A 3TQYA 3HOVG 2UXBL 3AYHB 4A3MG 1WFQA 4Y7NH 1VQEA 4NB3A 5ELNA 1K8AC 1Z47A 4JI0L 4A3BG 4L5TA 2MQHA 2N78A 5JEAG 4LFBQ 4WJ3M 4LF7L 2HIVA 1N9WA 2HT1A 3S24A 1VQPA 4HIOA 2ZTDA 1L0WA 4B3SL 4DV1Q 2ZM6Q 3CCEA 3DM3A 1Q1BA 4GS3A 4DV4Q 4DV5L 1QUQB 2ZTCA 2UU9Q 5AJ3L 5H1SE 3DLLA 3CMEA 1TXYA 2A1AA 1SRUA 1HH2P 1I5FA 3M9BA 5IYCG 4X66Q 3BU2A 2R7ZG 4JYAQ 1KAWA 5C3EG 3HOVH 1A63A 4QL5A 2HHHL 4A3MH 2WB1E 3S1RH 5IY0A 4JI1L 2KENA 4HIDA 5GQOA 4A3BH 1YITA 4BBRG 1MJEA 3KLWA 1N8RC 4LFCL 1VQGA 4P71A 2UUBL 2B3GA 3NELA 2MO0A 3M85A 2K52A 1KXLA 4GKKQ 4A3EG 4YY3Q 2E2HH 4KI0A 1IBLL 4POFA 1EUJA 3G6EA 3J81c 4IJLA 2ES2A 3H15A 4DV6L 5IYCH 2R7ZH 4B3RQ 2JQOA 1UWVA 5C3EH 3M4QA 1KRTA 4GNXA 2JA7G 3S15H 4BA1I 1T9HA 5LMUL 3TRZA 3T1YL 3ULJA 2R6GA 4DAYB 4BBRH 3CCUA 1NMFA 3B6YA 3W1BA 1VQFA 4LF4Q 1PH2A 3PSIA 4A76A 4PZ6A 4LW1A 3G48A 1N34Q 3S1QH 1E7ZA 4A3EH 1IBML 1AH9A 2E8GA 1HJPA 2ALYB 3CAMA 1IL2A 3CCQA 1XNQL 3GTLH 3J81i 1VQDA 1YHQA 5C44G 3HKZE 2JA7H 2IHEA 3K8AA 1B7YB 1PH9A 4C3JH 2QGQA 3E9HA 3OYYA 4GOPC 1QVFA 3ULLA 3GTPH 2KHIA 3A74A 2CQOA 1EYGA 4LF6L 3EN2A 3CCRA 3TS2A 4OO1G 2UXDL 1SN8A 1S72A 5M5YH 1TWHH 2BA0A 1QVGA 3PUWA 4DR4L 4KHPQ 4GLXA 4R4IA 1SR3A 1I6HH 2VS1A 4GN4B 4LUZA 4DUYL 3LGJA 4A3JG 1YI2A 1OXVA 1WCMG 1AE2A 2H5XA 4DR5L 1I94Q 1P8LA 5IE8A 2CCZA 3H3VH 1BBUA 1N33L 1YHBA 5C44H 4EQ5A 4DR6Q 2R7FA 1PV4A 1KC8C 1NJIC 1CUKA 1XMQL 1E1TA 3GTKH 4A3CG 4YHHQ 1PH5A 2OTJA 3FKIG 3U4VA 4IOAA 2Z0SA 1VQOA 1U0LA 1B8AA 1VQAA 1XMOL 2UXCL 2MNAA 4GNXB 2YTXA 2VUMG 3K0XA 1MIUA 4JOIA 5GROA 3PIPA 4AQYL 1XNRL 3J7ZC 2E5LQ 4QQBX 4DR3L 4A4IA 3CD6A 4A3JH 1WCMH 4B3ML 1WI5A 1EQRA 1YZ6A 4OWXB 3U50C 4X62Q 4K0KQ 4JG2A 2I5HA 4LUVA 3MXNB 1PVOA 5M3MG 2NVQH 2ZTEA 1HNWL 1JMCA 2F4VQ 2QEXA 4A3CH 3A0JA 4A3FG 2PMZE 3FKIH 4NXML 4DR1L 4KHZA 4UP9A 2K75A 4HJ9A 3E0EA 3TREA 3CF5A 4HJ8A 4DR2L 2RCNA 3PF4A 3CCLA 1N32Q 2VUMH 3OTOL 1X55A 1HZAA 4LNQA 5JJIA 2GN5A 5JJKA 3RZDH 1VCIA 3NEMA 1TWGH 1VQ5A 1I3QH 1H95A 4A3IG 1NTGA 2NN6I 1L2FA 1D7QA 4A93G 4X64Q 1GKHA 1Q7YC 2DGYA 2A19A 4JI3L 3CP0A 5M3MH 4JI2L 2Z6KA 1TWFH 4YWMA 3T1HL 4QIWE 4A3FH 1Y1WG 2VQFL 1IBKQ 3L2PA 3KOJA 4LUOA 1YBYA 4AYBG 2VQEQ 1VQLA 5LMNL 3RLFA 1O7IA 3F2DA 3CMAA 2IX1A 1YNXA 2AHOB 2B63G 5C0XJ 1IZ6A 1IYJB 1VQCA 4DUZL 4JI1Q 3S2HH 4ALPA 2JK8A 4NXNL 1JJGA 4LFAL 2LSSA 1NMGA 4LF9Q 4A3IH 1Q82C 3VDYA 3SGIA 4UPAA 4YWKA 3KJPA 2YU9H 4A93H 3BZCA 4OX9L 2RHQB 3UE0A 2DUDA 4O2DA 3CCSA 1HR0L 1IBLQ 1Y1WH 4JI8L 1WJJA 2I5MX 4DV3L 2AKWB 5GAEC 4JBJA 4P72A 2EIFA 1HZ9A 4A3LG 2NZOA 2B63H 2JA6G 4X65L 1JJ2A 5LMUQ 3M4PA 4L5QA 2PI2E 4GLAC 5IYBG 4JI7L 5C0XI 3J7A5 3F2BA 4R1JA 1S3OA 1QVCA 2UUCQ 4JCVE 5JJLA 3HOWG 1Q12A 4DK3C 4B3TQ 3S14H 4R4CA 1U5KA 1KRSA 5IP7G 1X9NA 4JI4Q 3GO5A 1OXSC 4MZ9A 1N36L 3AFQA 1EOVA 1X6OA 1MJCA 3KF8B 5IYDG 4LF5Q 5K36G 1LYLA 1Q86C 3I4MG 2HQLA 4R4OA 1G6PA 1LM0A 1V43A 4PMWA 1M1KC 4A3LH 2JA6H 1GD7A 2F3IA 3I4OA 5IWAQ 2K14A 2R7DA 2JA5G 5IYBH 1W2BA 4DV7L 1E22A 1L1OA 1HNXQ 1VQHA 1FJGQ 1VQ6A 1E24A 3HOWH 1Q1EA 3GTGH 3CPWA 3TEHB 3S17H 4LWCA 3H0GG 5IP7H 1PH8A 4EX5A 1WYDA 4YCVA 2LXKA 1FGUA 4XIGS 1Q81C 1EIFA 4NPSA 1CKNA 3F1ZA 4IOCA 5IYDH 5IP9G 3Q8DA 3I4MH 4JI5L 4LFBL 3KYHC 2OQ0A 5DLQE 3HOUG 4BXXG 4APVA 4IFDJ 1C0AA 2D0OA 1XMQQ 4JBKA 3PUXA 2ZM6L 4DV1L 2JA5H 3MEFA 2VNUD 4DV4L 3CXCA 1Q8KA 1VQBA 1PH6A 1XMOQ 3NENA 4PG3A 4LF8Q 3H0GH 2I5LX 4AQYQ 5JEAJ 1YVCA 4X66L 1VQMA 4JYAL 4BBSG 5ELOA 3BZKA 2OTLA 4B3MQ 3GTJH 4XTCS 5IP9H 4L5RC 1CKOA 4POGA 2CKZB 1PHJA 1OXXK 2D62A 3PCOB 2Q2UA 3HOUH 4BXXH 3HOYG 3K7UC 5FJ8G 4QGUA 4IFDI 1D8LA 4NXMQ 5M3FG 4H02A 1HNZQ 4YY3L 1BVSA 3RLNA 2N49A 4DR2Q 1J5EQ 4P74A 1K8GA 1I50H 3GTOH 3OTOQ 4GKJL 2AWOA 4PZ8A 2VY3A 3A5ZB 3I4NG 4BBSH 4B3RL 1L1OB 5M5WH 1R9TH 2ZJRA 1VQ7A 1PYBA 4DR7Q 3I55A 3PGZA 5IT9c 3JAMi 2KHJA 1EWIA 3HOYH 4JI3Q 1J6QA 5FJ8H 4P75A 4AYBE 4C3HH 1YIJA 2V1CC 3T1HQ 2N8NA 1CKNB 2VQFQ 4BY7G 1FVIA 2NZHA 1N34L 2EXDA 5M3FH 2MFIA 1QZHA 3CC2A 3G4SA 1X3EA 5LMNQ 1RIPA 2WAQG 5GAHC 3PO3G 2Y0SE 1GM5A 4DV0L 4GNXC 1G51A 2JA9A 1L1OC 2IX0A 3PV0A 2UUAL 3I4NH 3PO2G 4HJ5A 4JV5Q 1X3FA 2VZAA 4IPHA 2BA1A 2FXQA 4HIMA 4IPCA 2E2IH 2D0PA 4JI0Q 2PQAA 1HZBA 4DV2L 4A3GG 2XGTA 4LF7Q 3FP9A 3HFZB 4OWWB 4B3SQ 2L15A 3F2CA 1ASZA 4RMFA 4JI8Q 4BY7H 4DV5Q 4DPGA 3STBC 3PO3H 5AJ3Q 2QA4A 3RNUA 4JI6L 1UE1A 2OCEA 4RG1A 1X3GA 3PIOA 3PO2H 4BA2I 3ZJYC 2HHHQ 2N3SA 4HJAA 1SMXA 5C4JH 1KL9A 2Y0SG 4A3GH 2ASBA 4C3IH 1N36Q 2WP8J 2Q2HA 4LFCQ 2UUBQ 4HJ7A 3D31A 5J3BA 2RHSB 3AQQA 4UY8C 5FLXc 1SFOH 3H3VI 1NY4A 1IXRA 1PYSB 4WJ4A 4X62L 1VQ4A 4MNOA 1CSQA 1EFWA 4K0KL 2IY5B 1E1OA 4DKAC 3K81C 4DV6Q 3PF5A 3STBD 4DV7Q 2NVXH 1A0IA 2HIXA 3JC66 4YCUA 1ASYA 4IFDG 1YEZA 3RN5A 4PZ7A 4JBWA 1C9OA 3I56A 1A8VA 3T1YQ 3FHWA 2KCMA 1EIYB 2K5NA 4JOIC 4GOPA 4GLVB 1K9MC 3HOZG 3M7NA 2F52A 1LTLA 1VQIA 1IBMQ 3D0FA 4JI5Q 2CWPA 2PQAB 2BH2A 1S40A 3I2ZA 4AH6A 5M5XH 3CCJA 1YJWA 1XNQQ 1TWAH 3KDFA 4P73A 1WOCA 3GD7A 5FLMG 2E2JH 5BR8L 3ERSX 2IHFA 4X64L 2ZJQA 3KF6A 1SE8A 3IRBA 1JE5A 3J80i 1IBKL 2YTVA 3RR5A 3KJOA 2JA8G 1K83H 3EIVA 1NBWA 2VQEL 3HOXG 1G291 4QY7A 4LF6Q 2K5VA 1X54A 2OQKA 2UXDQ 3HOZH 1LUZA 2JE6I 3K80C 3PUVA 4FDBA 4YCWA 4MTNA 4QJFA 3G71A 4DR4Q 1E3PA 3A5UA 4DUYQ 3U58A 2JEAI 5GAGC 5E7NA 4DR5Q 4LF9L 3ER0A 4GN5A 1KD1C 1QZGA 1N33Q 5FLMH 2B29A 2JJQA 1XTDA 2NN6G 1BKBA 2Z6KC 3E9IA 3GDEA 4UP8A 2R93G 2YV5A 1X56A 2KCTA 2JA8H 4GKJQ 2BH8A 3EBEA 1UE5A 2AWNA 3S1MH 3L7ZC 3HOXH 2UU9L 1VQ8A 2UXCQ 3CCVA 3OW2A 4DAMA 1Z9FA 1XNRQ 3AEVA 4DR3Q 3CQZH 2KBNA 3UDIA 3PUYA 1KQSA 4IO9A 1PH3A 1PH4A 1M90C 2UUCL 4GOPB 1UE6A 2Q2TA 4B3TL 2WAQE 3CC4A 2WB1G 4OONA 3JAMc 4JI4L 4A3DG 2R93H 1OXTA 1VQJA 4UP7A 2OWOA 1HNWQ 1VQKA 3NBHB 5EAYA 4AIMA 3KFUA 1P16A 1RL2A 2YYZA 1C7YA 4DV0Q 4LF5L 3KDFB 1JB7A 4DR1Q 2UUAQ 4GKKL 2JEBI 2UXBQ 1SROA 1KHIA 5LMNW 2MO1A 2K4KA 3KF6B 4R4QA 4TVAB 3BJUA 5IWAL 1K0RA 2RF4A 4GN3B 3L0OA 3WWVA 4R4TA 4DV2Q 2Q2IA 1JT8A 1Y14B 1HNXL 1FJGL 4J15A 1FL0A 4O0AA 4JC0A 2ATWA 5C0XG 2A8VA 3U4ZA 2GVAA 4A3DH 4LF4L 2R92G 2ZJPA 2IT1A 4JI2Q 4JI6Q 1PA6A 1HR0W 4L5SA 1NE3A 1YHAA 1W3SA 2C35B 2YTYA 2PI2A 4A75A 2K50A 3CC7A 4DUZQ 3ULPA 4NXNQ 1MKHA 1A62A 4LFAQ 3ICEA 1K73C 1Q46A 5HY6A 3S2DH 1V1QA 5HGQA 1HZCA 2PNHA 2WFWA 3HKZG 3W1GA 3RN2A 3W5OA 1DGSA 1GVPA 1XPOA 3HKSA 1EQQA 4LF8L 3M4OH 4OX9Q 3F8TA 1TWCH 2ID0A 2R92H 1PFSA 1KIXA 1HR0Q 4JBMA 2I0QA 5GADC 4KHPL 4YWLA 1QUQA 1OXUA 4IJHA 3RLOA 3AFPA 4DNIA 4IPGA 4DV3Q 4Y52H 2CFMA 4OWTB 2GVBA 3I7FA 1VS0A 3CPFA 4KLKA 1YJNA 4X65Q 1JJCB 1AE3A 4BY1G 1I94L 5C4XG 1UE7A 1X65A 4DK6C 2XTIA 2NVTH 4TQUS 1UEBA 4JI7Q 2LXJA 3S16H 1BBWA 1HNZL 1Y1VG 2VL6A 3UDXA 4A3KG 4DR6L 1J5EL 2EQSA 4YHHL 3GTQH 1CSPA 1XPRA 4ME3A 2VW9A 2AMCB 2K5HA 2NVYH 3UDFA 3CCMA 3RZOH 3M3YH 1VQNA 1XPUA 4DR7L 1OTCA 4IPDA 3UDGA 1YJ9A 2CWAA 5BR8Q 4C2MH 3J81j 1PH1A 1PH7A 2E5LL 1K3RA 1XJVA 1GO3E 5C4XH 4X6AH 4BY1H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HIK A;  1CKM A;  1Y1V H;  4A3K H;  3K7A H;  1SLJ A;  2F4V L;  4OXP A;  3J80 c;  1V9P A;  3GTM H;  4OO1 I;  1B70 B;  4JV5 L;  3CW2 C;  3TS0 A;  3UE1 A;  3S1N H;  3PUZ A;  1N32 L;  1VQ9 A;  3TQY A;  3HOV G;  2UXB L;  3AYH B;  4A3M G;  1WFQ A;  4Y7N H;  1VQE A;  4NB3 A;  5ELN A;  1K8A C;  1Z47 A;  4JI0 L;  4A3B G;  4L5T A;  2MQH A;  2N78 A;  5JEA G;  4LFB Q;  4WJ3 M;  4LF7 L;  2HIV A;  1N9W A;  2HT1 A;  3S24 A;  1VQP A;  4HIO A;  2ZTD A;  1L0W A;  4B3S L;  4DV1 Q;  2ZM6 Q;  3CCE A;  3DM3 A;  1Q1B A;  4GS3 A;  4DV4 Q;  4DV5 L;  1QUQ B;  2ZTC A;  2UU9 Q;  5AJ3 L;  5H1S E;  3DLL A;  3CME A;  1TXY A;  2A1A A;  1SRU A;  1HH2 P;  1I5F A;  3M9B A;  5IYC G;  4X66 Q;  3BU2 A;  2R7Z G;  4JYA Q;  1KAW A;  5C3E G;  3HOV H;  1A63 A;  4QL5 A;  2HHH L;  4A3M H;  2WB1 E;  3S1R H;  5IY0 A;  4JI1 L;  2KEN A;  4HID A;  5GQO A;  4A3B H;  1YIT A;  4BBR G;  1MJE A;  3KLW A;  1N8R C;  4LFC L;  1VQG A;  4P71 A;  2UUB L;  2B3G A;  3NEL A;  2MO0 A;  3M85 A;  2K52 A;  1KXL A;  4GKK Q;  4A3E G;  4YY3 Q;  2E2H H;  4KI0 A;  1IBL L;  4POF A;  1EUJ A;  3G6E A;  3J81 c;  4IJL A;  2ES2 A;  3H15 A;  4DV6 L;  5IYC H;  2R7Z H;  4B3R Q;  2JQO A;  1UWV A;  5C3E H;  3M4Q A;  1KRT A;  4GNX A;  2JA7 G;  3S15 H;  4BA1 I;  1T9H A;  5LMU L;  3TRZ A;  3T1Y L;  3ULJ A;  2R6G A;  4DAY B;  4BBR H;  3CCU A;  1NMF A;  3B6Y A;  3W1B A;  1VQF A;  4LF4 Q;  1PH2 A;  3PSI A;  4A76 A;  4PZ6 A;  4LW1 A;  3G48 A;  1N34 Q;  3S1Q H;  1E7Z A;  4A3E H;  1IBM L;  1AH9 A;  2E8G A;  1HJP A;  2ALY B;  3CAM A;  1IL2 A;  3CCQ A;  1XNQ L;  3GTL H;  3J81 i;  1VQD A;  1YHQ A;  5C44 G;  3HKZ E;  2JA7 H;  2IHE A;  3K8A A;  1B7Y B;  1PH9 A;  4C3J H;  2QGQ A;  3E9H A;  3OYY A;  4GOP C;  1QVF A;  3ULL A;  3GTP H;  2KHI A;  3A74 A;  2CQO A;  1EYG A;  4LF6 L;  3EN2 A;  3CCR A;  3TS2 A;  4OO1 G;  2UXD L;  1SN8 A;  1S72 A;  5M5Y H;  1TWH H;  2BA0 A;  1QVG A;  3PUW A;  4DR4 L;  4KHP Q;  4GLX A;  4R4I A;  1SR3 A;  1I6H H;  2VS1 A;  4GN4 B;  4LUZ A;  4DUY L;  3LGJ A;  4A3J G;  1YI2 A;  1OXV A;  1WCM G;  1AE2 A;  2H5X A;  4DR5 L;  1I94 Q;  1P8L A;  5IE8 A;  2CCZ A;  3H3V H;  1BBU A;  1N33 L;  1YHB A;  5C44 H;  4EQ5 A;  4DR6 Q;  2R7F A;  1PV4 A;  1KC8 C;  1NJI C;  1CUK A;  1XMQ L;  1E1T A;  3GTK H;  4A3C G;  4YHH Q;  1PH5 A;  2OTJ A;  3FKI G;  3U4V A;  4IOA A;  2Z0S A;  1VQO A;  1U0L A;  1B8A A;  1VQA A;  1XMO L;  2UXC L;  2MNA A;  4GNX B;  2YTX A;  2VUM G;  3K0X A;  1MIU A;  4JOI A;  5GRO A;  3PIP A;  4AQY L;  1XNR L;  3J7Z C;  2E5L Q;  4QQB X;  4DR3 L;  4A4I A;  3CD6 A;  4A3J H;  1WCM H;  4B3M L;  1WI5 A;  1EQR A;  1YZ6 A;  4OWX B;  3U50 C;  4X62 Q;  4K0K Q;  4JG2 A;  2I5H A;  4LUV A;  3MXN B;  1PVO A;  5M3M G;  2NVQ H;  2ZTE A;  1HNW L;  1JMC A;  2F4V Q;  2QEX A;  4A3C H;  3A0J A;  4A3F G;  2PMZ E;  3FKI H;  4NXM L;  4DR1 L;  4KHZ A;  4UP9 A;  2K75 A;  4HJ9 A;  3E0E A;  3TRE A;  3CF5 A;  4HJ8 A;  4DR2 L;  2RCN A;  3PF4 A;  3CCL A;  1N32 Q;  2VUM H;  3OTO L;  1X55 A;  1HZA A;  4LNQ A;  5JJI A;  2GN5 A;  5JJK A;  3RZD H;  1VCI A;  3NEM A;  1TWG H;  1VQ5 A;  1I3Q H;  1H95 A;  4A3I G;  1NTG A;  2NN6 I;  1L2F A;  1D7Q A;  4A93 G;  4X64 Q;  1GKH A;  1Q7Y C;  2DGY A;  2A19 A;  4JI3 L;  3CP0 A;  5M3M H;  4JI2 L;  2Z6K A;  1TWF H;  4YWM A;  3T1H L;  4QIW E;  4A3F H;  1Y1W G;  2VQF L;  1IBK Q;  3L2P A;  3KOJ A;  4LUO A;  1YBY A;  4AYB G;  2VQE Q;  1VQL A;  5LMN L;  3RLF A;  1O7I A;  3F2D A;  3CMA A;  2IX1 A;  1YNX A;  2AHO B;  2B63 G;  5C0X J;  1IZ6 A;  1IYJ B;  1VQC A;  4DUZ L;  4JI1 Q;  3S2H H;  4ALP A;  2JK8 A;  4NXN L;  1JJG A;  4LFA L;  2LSS A;  1NMG A;  4LF9 Q;  4A3I H;  1Q82 C;  3VDY A;  3SGI A;  4UPA A;  4YWK A;  3KJP A;  2YU9 H;  4A93 H;  3BZC A;  4OX9 L;  2RHQ B;  3UE0 A;  2DUD A;  4O2D A;  3CCS A;  1HR0 L;  1IBL Q;  1Y1W H;  4JI8 L;  1WJJ A;  2I5M X;  4DV3 L;  2AKW B;  5GAE C;  4JBJ A;  4P72 A;  2EIF A;  1HZ9 A;  4A3L G;  2NZO A;  2B63 H;  2JA6 G;  4X65 L;  1JJ2 A;  5LMU Q;  3M4P A;  4L5Q A;  2PI2 E;  4GLA C;  5IYB G;  4JI7 L;  5C0X I;  3J7A 5;  3F2B A;  4R1J A;  1S3O A;  1QVC A;  2UUC Q;  4JCV E;  5JJL A;  3HOW G;  1Q12 A;  4DK3 C;  4B3T Q;  3S14 H;  4R4C A;  1U5K A;  1KRS A;  5IP7 G;  1X9N A;  4JI4 Q;  3GO5 A;  1OXS C;  4MZ9 A;  1N36 L;  3AFQ A;  1EOV A;  1X6O A;  1MJC A;  3KF8 B;  5IYD G;  4LF5 Q;  5K36 G;  1LYL A;  1Q86 C;  3I4M G;  2HQL A;  4R4O A;  1G6P A;  1LM0 A;  1V43 A;  4PMW A;  1M1K C;  4A3L H;  2JA6 H;  1GD7 A;  2F3I A;  3I4O A;  5IWA Q;  2K14 A;  2R7D A;  2JA5 G;  5IYB H;  1W2B A;  4DV7 L;  1E22 A;  1L1O A;  1HNX Q;  1VQH A;  1FJG Q;  1VQ6 A;  1E24 A;  3HOW H;  1Q1E A;  3GTG H;  3CPW A;  3TEH B;  3S17 H;  4LWC A;  3H0G G;  5IP7 H;  1PH8 A;  4EX5 A;  1WYD A;  4YCV A;  2LXK A;  1FGU A;  4XIG S;  1Q81 C;  1EIF A;  4NPS A;  1CKN A;  3F1Z A;  4IOC A;  5IYD H;  5IP9 G;  3Q8D A;  3I4M H;  4JI5 L;  4LFB L;  3KYH C;  2OQ0 A;  5DLQ E;  3HOU G;  4BXX G;  4APV A;  4IFD J;  1C0A A;  2D0O A;  1XMQ Q;  4JBK A;  3PUX A;  2ZM6 L;  4DV1 L;  2JA5 H;  3MEF A;  2VNU D;  4DV4 L;  3CXC A;  1Q8K A;  1VQB A;  1PH6 A;  1XMO Q;  3NEN A;  4PG3 A;  4LF8 Q;  3H0G H;  2I5L X;  4AQY Q;  5JEA J;  1YVC A;  4X66 L;  1VQM A;  4JYA L;  4BBS G;  5ELO A;  3BZK A;  2OTL A;  4B3M Q;  3GTJ H;  4XTC S;  5IP9 H;  4L5R C;  1CKO A;  4POG A;  2CKZ B;  1PHJ A;  1OXX K;  2D62 A;  3PCO B;  2Q2U A;  3HOU H;  4BXX H;  3HOY G;  3K7U C;  5FJ8 G;  4QGU A;  4IFD I;  1D8L A;  4NXM Q;  5M3F G;  4H02 A;  1HNZ Q;  4YY3 L;  1BVS A;  3RLN A;  2N49 A;  4DR2 Q;  1J5E Q;  4P74 A;  1K8G A;  1I50 H;  3GTO H;  3OTO Q;  4GKJ L;  2AWO A;  4PZ8 A;  2VY3 A;  3A5Z B;  3I4N G;  4BBS H;  4B3R L;  1L1O B;  5M5W H;  1R9T H;  2ZJR A;  1VQ7 A;  1PYB A;  4DR7 Q;  3I55 A;  3PGZ A;  5IT9 c;  3JAM i;  2KHJ A;  1EWI A;  3HOY H;  4JI3 Q;  1J6Q A;  5FJ8 H;  4P75 A;  4AYB E;  4C3H H;  1YIJ A;  2V1C C;  3T1H Q;  2N8N A;  1CKN B;  2VQF Q;  4BY7 G;  1FVI A;  2NZH A;  1N34 L;  2EXD A;  5M3F H;  2MFI A;  1QZH A;  3CC2 A;  3G4S A;  1X3E A;  5LMN Q;  1RIP A;  2WAQ G;  5GAH C;  3PO3 G;  2Y0S E;  1GM5 A;  4DV0 L;  4GNX C;  1G51 A;  2JA9 A;  1L1O C;  2IX0 A;  3PV0 A;  2UUA L;  3I4N H;  3PO2 G;  4HJ5 A;  4JV5 Q;  1X3F A;  2VZA A;  4IPH A;  2BA1 A;  2FXQ A;  4HIM A;  4IPC A;  2E2I H;  2D0P A;  4JI0 Q;  2PQA A;  1HZB A;  4DV2 L;  4A3G G;  2XGT A;  4LF7 Q;  3FP9 A;  3HFZ B;  4OWW B;  4B3S Q;  2L15 A;  3F2C A;  1ASZ A;  4RMF A;  4JI8 Q;  4BY7 H;  4DV5 Q;  4DPG A;  3STB C;  3PO3 H;  5AJ3 Q;  2QA4 A;  3RNU A;  4JI6 L;  1UE1 A;  2OCE A;  4RG1 A;  1X3G A;  3PIO A;  3PO2 H;  4BA2 I;  3ZJY C;  2HHH Q;  2N3S A;  4HJA A;  1SMX A;  5C4J H;  1KL9 A;  2Y0S G;  4A3G H;  2ASB A;  4C3I H;  1N36 Q;  2WP8 J;  2Q2H A;  4LFC Q;  2UUB Q;  4HJ7 A;  3D31 A;  5J3B A;  2RHS B;  3AQQ A;  4UY8 C;  5FLX c;  1SFO H;  3H3V I;  1NY4 A;  1IXR A;  1PYS B;  4WJ4 A;  4X62 L;  1VQ4 A;  4MNO A;  1CSQ A;  1EFW A;  4K0K L;  2IY5 B;  1E1O A;  4DKA C;  3K81 C;  4DV6 Q;  3PF5 A;  3STB D;  4DV7 Q;  2NVX H;  1A0I A;  2HIX A;  3JC6 6;  4YCU A;  1ASY A;  4IFD G;  1YEZ A;  3RN5 A;  4PZ7 A;  4JBW A;  1C9O A;  3I56 A;  1A8V A;  3T1Y Q;  3FHW A;  2KCM A;  1EIY B;  2K5N A;  4JOI C;  4GOP A;  4GLV B;  1K9M C;  3HOZ G;  3M7N A;  2F52 A;  1LTL A;  1VQI A;  1IBM Q;  3D0F A;  4JI5 Q;  2CWP A;  2PQA B;  2BH2 A;  1S40 A;  3I2Z A;  4AH6 A;  5M5X H;  3CCJ A;  1YJW A;  1XNQ Q;  1TWA H;  3KDF A;  4P73 A;  1WOC A;  3GD7 A;  5FLM G;  2E2J H;  5BR8 L;  3ERS X;  2IHF A;  4X64 L;  2ZJQ A;  3KF6 A;  1SE8 A;  3IRB A;  1JE5 A;  3J80 i;  1IBK L;  2YTV A;  3RR5 A;  3KJO A;  2JA8 G;  1K83 H;  3EIV A;  1NBW A;  2VQE L;  3HOX G;  1G29 1;  4QY7 A;  4LF6 Q;  2K5V A;  1X54 A;  2OQK A;  2UXD Q;  3HOZ H;  1LUZ A;  2JE6 I;  3K80 C;  3PUV A;  4FDB A;  4YCW A;  4MTN A;  4QJF A;  3G71 A;  4DR4 Q;  1E3P A;  3A5U A;  4DUY Q;  3U58 A;  2JEA I;  5GAG C;  5E7N A;  4DR5 Q;  4LF9 L;  3ER0 A;  4GN5 A;  1KD1 C;  1QZG A;  1N33 Q;  5FLM H;  2B29 A;  2JJQ A;  1XTD A;  2NN6 G;  1BKB A;  2Z6K C;  3E9I A;  3GDE A;  4UP8 A;  2R93 G;  2YV5 A;  1X56 A;  2KCT A;  2JA8 H;  4GKJ Q;  2BH8 A;  3EBE A;  1UE5 A;  2AWN A;  3S1M H;  3L7Z C;  3HOX H;  2UU9 L;  1VQ8 A;  2UXC Q;  3CCV A;  3OW2 A;  4DAM A;  1Z9F A;  1XNR Q;  3AEV A;  4DR3 Q;  3CQZ H;  2KBN A;  3UDI A;  3PUY A;  1KQS A;  4IO9 A;  1PH3 A;  1PH4 A;  1M90 C;  2UUC L;  4GOP B;  1UE6 A;  2Q2T A;  4B3T L;  2WAQ E;  3CC4 A;  2WB1 G;  4OON A;  3JAM c;  4JI4 L;  4A3D G;  2R93 H;  1OXT A;  1VQJ A;  4UP7 A;  2OWO A;  1HNW Q;  1VQK A;  3NBH B;  5EAY A;  4AIM A;  3KFU A;  1P16 A;  1RL2 A;  2YYZ A;  1C7Y A;  4DV0 Q;  4LF5 L;  3KDF B;  1JB7 A;  4DR1 Q;  2UUA Q;  4GKK L;  2JEB I;  2UXB Q;  1SRO A;  1KHI A;  5LMN W;  2MO1 A;  2K4K A;  3KF6 B;  4R4Q A;  4TVA B;  3BJU A;  5IWA L;  1K0R A;  2RF4 A;  4GN3 B;  3L0O A;  3WWV A;  4R4T A;  4DV2 Q;  2Q2I A;  1JT8 A;  1Y14 B;  1HNX L;  1FJG L;  4J15 A;  1FL0 A;  4O0A A;  4JC0 A;  2ATW A;  5C0X G;  2A8V A;  3U4Z A;  2GVA A;  4A3D H;  4LF4 L;  2R92 G;  2ZJP A;  2IT1 A;  4JI2 Q;  4JI6 Q;  1PA6 A;  1HR0 W;  4L5S A;  1NE3 A;  1YHA A;  1W3S A;  2C35 B;  2YTY A;  2PI2 A;  4A75 A;  2K50 A;  3CC7 A;  4DUZ Q;  3ULP A;  4NXN Q;  1MKH A;  1A62 A;  4LFA Q;  3ICE A;  1K73 C;  1Q46 A;  5HY6 A;  3S2D H;  1V1Q A;  5HGQ A;  1HZC A;  2PNH A;  2WFW A;  3HKZ G;  3W1G A;  3RN2 A;  3W5O A;  1DGS A;  1GVP A;  1XPO A;  3HKS A;  1EQQ A;  4LF8 L;  3M4O H;  4OX9 Q;  3F8T A;  1TWC H;  2ID0 A;  2R92 H;  1PFS A;  1KIX A;  1HR0 Q;  4JBM A;  2I0Q A;  5GAD C;  4KHP L;  4YWL A;  1QUQ A;  1OXU A;  4IJH A;  3RLO A;  3AFP A;  4DNI A;  4IPG A;  4DV3 Q;  4Y52 H;  2CFM A;  4OWT B;  2GVB A;  3I7F A;  1VS0 A;  3CPF A;  4KLK A;  1YJN A;  4X65 Q;  1JJC B;  1AE3 A;  4BY1 G;  1I94 L;  5C4X G;  1UE7 A;  1X65 A;  4DK6 C;  2XTI A;  2NVT H;  4TQU S;  1UEB A;  4JI7 Q;  2LXJ A;  3S16 H;  1BBW A;  1HNZ L;  1Y1V G;  2VL6 A;  3UDX A;  4A3K G;  4DR6 L;  1J5E L;  2EQS A;  4YHH L;  3GTQ H;  1CSP A;  1XPR A;  4ME3 A;  2VW9 A;  2AMC B;  2K5H A;  2NVY H;  3UDF A;  3CCM A;  3RZO H;  3M3Y H;  1VQN A;  1XPU A;  4DR7 L;  1OTC A;  4IPD A;  3UDG A;  1YJ9 A;  2CWA A;  5BR8 Q;  4C2M H;  3J81 j;  1PH1 A;  1PH7 A;  2E5L L;  1K3R A;  1XJV A;  1GO3 E;  5C4X H;  4X6A H;  4BY1 H; 
#chains in the Genus database with same CATH topology
 4HIK A;  1CA6 A;  4UAI A;  3OMC A;  1TS3 A;  1CQV A;  1SLJ A;  1V9P A;  3GTM H;  4OO1 I;  4X3S A;  5C5L A;  2VXW A;  4K2K A;  1DYQ A;  5LL6 X;  3EJI A;  4JI0 L;  1PFN A;  3A55 A;  4OEM B;  4L5T A;  2PW7 A;  5BN5 A;  4LF7 L;  1N9W A;  2HT1 A;  3S24 A;  3MC0 B;  2MP1 A;  4KD3 A;  4DV1 Q;  4KY5 A;  1DOK A;  4HMJ A;  1Q3L A;  2KQ3 A;  5H1S E;  2A68 C;  1VMC A;  2A1A A;  4K5V A;  1SRU A;  1S5F D;  1I5F A;  3M9B A;  5IYC G;  3BU2 A;  1A3V A;  4QL5 A;  4A3M H;  2HHH L;  1SND A;  3HOY B;  4K8I A;  4JI1 L;  4A3B H;  1MJE A;  3KLW A;  4WJW A;  1EYD A;  2B3G A;  4IN3 A;  2UUB L;  2MO0 A;  3M85 A;  3HEJ A;  1B53 A;  3I4N B;  5JPM C;  1VF7 A;  1EUJ A;  4RFB A;  3M4Y A;  3H15 A;  2E2D C;  1UWV A;  4DGZ A;  3M4Q A;  2A68 D;  5LMU L;  1STG A;  4BY7 B;  3HS0 C;  1Y8N B;  2D5D A;  3CCU A;  3BVZ A;  2K1B A;  4LF4 Q;  1PH2 A;  3MXN A;  3S1Q H;  2N88 A;  4A3E H;  1IBM L;  4F8M A;  1SNO A;  3GTL H;  5C4J B;  3Q23 A;  2LMC B;  5ELF A;  2RVL A;  1PH9 A;  2QGQ A;  3E9H A;  4K6L A;  2X6G A;  3ULL A;  2F0E A;  2HQE A;  3T16 A;  4CDC C;  1SFO B;  3EN2 A;  4LF6 L;  4PQX A;  1SN8 A;  4BY1 B;  1QVG A;  1I6H H;  4GLX A;  4R4I A;  4DUY L;  4LUZ A;  1I4R A;  2NVX B;  4A3J G;  1WCM G;  1AE2 A;  1BCP B;  2H5X A;  1P8L A;  5IE8 A;  1QCB D;  4K8J A;  1JIC A;  5C44 H;  2EJM A;  4DR6 Q;  2RCF A;  1CUK A;  1NJI C;  2HD3 A;  3FKI G;  4IOA A;  2BDO A;  4DN4 M;  4EVO A;  2MNA A;  4GNX B;  1TWA B;  4KJO A;  1GHJ A;  3PIP A;  4AQY L;  1XNR L;  4G57 A;  2E5L Q;  4A4I A;  1O7L A;  2L11 A;  1YZ6 A;  3E6Z X;  3HOV B;  1JMC A;  3HOZ B;  1L0Y B;  2UXB L;  3E0E A;  3TRE A;  3QR8 A;  3KLS X;  1I3Q H;  1NTG A;  4ZLT F;  2JA8 B;  4FF2 A;  1Q7Y C;  5KRU A;  1GUW A;  3W2D A;  4ZAI A;  3QJY A;  4JI2 L;  1B3Q A;  2F0N A;  4QIW E;  2VQF L;  1IBK Q;  4P2C B;  1PZI D;  4BBR B;  3F2D A;  1YNX A;  2AHO B;  1SJH D;  1X3Q A;  2J7Z A;  4B08 A;  1IYJ B;  1VQC A;  1WTV A;  1HUN A;  1H9K A;  4JI1 Q;  4ALP A;  5D14 A;  2SNM A;  4A3I H;  1BBX C;  1ET9 A;  2XWJ B;  3QOL A;  2FIN B;  2YU9 H;  5COR A;  4YWK A;  3KJP A;  1WTP A;  2TMP A;  4A93 H;  2F0Q A;  3BZC A;  2RHQ B;  2B2Y C;  3CCS A;  1RTN A;  1Y1W H;  1ZEQ X;  4QUF A;  2I5M X;  4DV3 L;  5GAE C;  5C3X A;  4P72 A;  1HZ9 A;  4OHJ A;  1AFP A;  3C1F A;  5LMU Q;  1GUT A;  2PI2 E;  4GLA C;  3J7Y W;  4JI7 L;  3J7A 5;  5IGG A;  4XQN A;  1QVC A;  2WII B;  4QF4 A;  1Q12 A;  3SVM A;  1KRS A;  4JI4 Q;  1X9N A;  2CQA A;  3KBG A;  1EY5 A;  1XX8 A;  1HPC A;  1M1K C;  4A3L H;  1F77 A;  3PQI A;  4NKL A;  3VYR A;  3M4O B;  1W2B A;  4DV7 L;  4N9P A;  1L1O A;  2R92 B;  1FJG Q;  1VQ6 A;  1WTR A;  1Q1E A;  1BQQ T;  1SNQ A;  3D3R A;  1CA5 A;  4YCV A;  3GV3 A;  1A2U A;  1Q81 C;  1EIF A;  4IOC A;  5IYD H;  2XRS D;  1SJE D;  3Q8D A;  5E4W C;  4LFB L;  2ENB A;  1IL8 A;  4JBK A;  2JA5 H;  2ZM6 L;  1DD2 A;  1H9J A;  1VQB A;  2KA7 A;  2NVY B;  4AQY Q;  2I5L X;  5JEA J;  4C2M B;  2A6H C;  2NTS A;  5IGE A;  4IUQ A;  2Q2U A;  3HOY G;  1PRT B;  5I6W A;  3GTM B;  1MGS A;  4IFD I;  3NBI A;  4XQJ A;  1K8G A;  3BVM A;  4PZ8 A;  3I4N G;  2M00 A;  5CV7 A;  4RH6 A;  4S3S A;  3W3A A;  5M5W H;  1VQ7 A;  3I55 A;  3PGZ A;  1R4P B;  2PCF B;  3HRZ C;  5JOB A;  4UDU C;  1ICF B;  1ESF A;  1EZ8 A;  2L9H A;  5FJ8 H;  4DA2 A;  2K5D A;  2VQF Q;  4BY7 G;  1N34 L;  5M3F H;  5GAH C;  4A3M B;  4ULL A;  2JSO A;  2UUA L;  4A3B B;  4ODG A;  2F0M A;  5IT9 L;  1B1Z A;  1EU4 A;  3IL8 A;  2FXQ A;  1EYA A;  2E2I H;  3WDN A;  1HZB A;  5EKI A;  3HFZ B;  4OWW B;  4B3S Q;  4RMF A;  4DV5 Q;  4QIW B;  3PO3 H;  4Q5V A;  2EE1 A;  4DAP A;  1FD7 D;  3R3O A;  1X3G A;  4RG1 A;  1IKL A;  1STB A;  2EJF C;  2F0T A;  1O78 A;  1SMX A;  4LMQ D;  3S1Q B;  4A3E B;  1EY7 A;  2ASB A;  4LFC Q;  3OMG A;  5I2Y A;  3GTL B;  5J3B A;  3H3V I;  4FF1 A;  1IXR A;  4X62 L;  4MNO A;  4DKA C;  2I46 A;  4DV6 Q;  1G2T A;  4DV7 Q;  3WOE A;  3E5S A;  4PZ7 A;  4JBW A;  3I56 A;  1I6H B;  3FHW A;  1EIY B;  2K5N A;  4JOI C;  4RA8 A;  3HOZ G;  1PZK D;  4KKS A;  1LTL A;  4M8A A;  1IHZ A;  3GQB A;  5C44 B;  4EGV A;  4AH6 A;  2ZXP A;  3MTS A;  5FLM G;  4H7B A;  3ERS X;  4X64 L;  2ZJQ A;  3KF6 A;  3IRB A;  1ENA A;  2JA8 G;  3QB3 A;  3RR5 A;  2EYF A;  1NBW A;  1IYV A;  1KLG D;  3H3V C;  2X69 A;  2K5V A;  3K80 C;  3PUV A;  4QJF A;  3G71 A;  3U58 A;  2JEA I;  1F9S A;  4DR5 Q;  4GN5 A;  1ZYR D;  3SK6 A;  1N33 Q;  3MFY A;  3I73 A;  2L5T A;  4UP8 A;  5T1G A;  2A6E D;  1BCP F;  3EBE A;  1UE5 A;  3S1M H;  3L7Z C;  2F0U A;  1HUM A;  1I3Q B;  3TP5 A;  3CCV A;  3OW2 A;  1JE4 A;  1EFI D;  2K01 A;  3CQZ H;  3PUY A;  5FO7 B;  5CV6 A;  2RKS A;  2WAQ E;  5CV4 A;  4B3T L;  1SYB A;  3JAM c;  5JAV A;  5A35 A;  2R93 H;  1OXT A;  1VQJ A;  1HNW Q;  3R2T A;  5EAY A;  1P16 A;  3TP6 A;  3KDF B;  2UUA Q;  2JEB I;  3DUZ A;  3OIP A;  5LMN W;  4A3I B;  2K4K A;  3OWE B;  1LAC A;  4GN3 B;  2IX3 A;  2YU9 B;  4A93 B;  1Y14 B;  1HNX L;  2A74 C;  3K0Y A;  1Y1W B;  3U9O A;  2EY6 A;  2A8V A;  4ZYS A;  3U4Z A;  2GVA A;  3LX0 A;  3SEB A;  2R92 G;  1JWM D;  1JOQ A;  1LTB D;  4F88 A;  2B2Y A;  1W3S A;  2C35 B;  4RCN A;  2PI2 A;  2PMZ B;  2EY1 A;  5KND A;  4A75 A;  2N55 A;  3CC7 A;  1HCZ A;  4CKE A;  1KTK A;  2EXZ A;  5FKA C;  4NXN Q;  1MKH A;  2R61 A;  1A62 A;  1I4X A;  1Q46 A;  5HGQ A;  2O4X A;  5A2Q L;  3X3M A;  5C0X H;  5COY A;  1TQO A;  2B2V C;  3F8T A;  1B2T A;  1PFS A;  1HR0 Q;  2QDL A;  2HCI A;  3RLO A;  1OXU A;  4DNI A;  1EY0 A;  2NWG A;  1U4L A;  1DCZ A;  2GVB A;  3CPF A;  4KLK A;  1F2Z A;  1TII D;  2XTI A;  2LXJ A;  1BBW A;  1PZJ D;  4MHE A;  2LFN A;  3A8J E;  2BCO A;  4YHH L;  2AMC B;  2Q8R E;  2K5H A;  4EQN A;  3M3Y H;  1XPU A;  3K6O A;  4BWG B;  1OTC A;  2L4N A;  2JA5 B;  1V1P B;  2DNC A;  5KYL A;  1GO3 E;  4BY1 H;  3MVV A;  4PNY A;  1CKM A;  2E74 C;  3WOF A;  3OW7 A;  3K7A H;  2VB3 X;  4CJ1 B;  3J80 c;  4DAY A;  3ONA B;  2XVS A;  3UE1 A;  1N32 L;  3I4L A;  1VQ9 A;  2ZXR A;  2F0P A;  4A3M G;  1WFQ A;  1VQE A;  3IFD A;  4NB3 A;  1JWS D;  1Z47 A;  5ELN A;  1K8A C;  4A3B G;  1LTA D;  3SE0 A;  1KDB A;  2C9O A;  2HIV A;  2IL8 A;  2KUM A;  1VQP A;  2ZTD A;  3DM3 A;  1Q1B A;  3I90 A;  5AJ3 L;  1ENC A;  3DLL A;  5KGU A;  5M5W B;  2PO4 A;  3CME A;  1TXY A;  2IW3 A;  1HH2 P;  4HR7 B;  2F0D A;  5DNF A;  3HOV H;  2WB1 E;  3S1R H;  2NUC A;  3FEW X;  2RSO A;  4HID A;  1E2V A;  5M3F B;  3M7G A;  4CJ0 B;  1VQG A;  1BO0 A;  3DXJ C;  1KXL A;  1RTO A;  3HG9 A;  4A3E G;  4XXE A;  2NTT A;  4YY3 Q;  3G7L A;  4KI0 A;  1Q8I A;  4J1M A;  1PRT F;  2E2I B;  2ES2 A;  2PNR C;  4B3R Q;  4ME5 A;  4RAU C;  1TWC B;  1VMP A;  3S15 H;  2KOL A;  5C5M A;  3TRZ A;  3LWU A;  4KK7 A;  4BBR H;  1B4O A;  2EVB A;  3B6Y A;  3PO3 B;  2WAQ B;  3FVQ A;  3MEH A;  3HGB A;  1NR4 A;  1K28 A;  1Y69 U;  1HJP A;  3J81 i;  1TR5 A;  1VQD A;  1YHQ A;  5C44 G;  4RGM A;  2JA7 H;  2Q8I B;  1JB3 A;  2Z9H A;  1A6X A;  2XN9 C;  4GOP C;  3GTP H;  1F9P A;  2KHI A;  3A74 A;  1SNM A;  4FXK C;  1EYG A;  3TS2 A;  2XWB B;  1KDC A;  1RDP D;  3N52 A;  4L6T B;  2BA0 A;  4DR4 L;  3CU7 A;  1EZ6 A;  2NYZ D;  1G91 A;  1SE3 A;  1V1O A;  1YI2 A;  1OXV A;  2K5Q A;  2QF7 A;  3IKJ A;  2CCZ A;  1BBU A;  2Y0S B;  4CKC A;  3PIP 3;  5IGC A;  1W6K A;  4YHH Q;  1PH5 A;  3NUC A;  4RKL A;  2L0C A;  2K7V A;  2Z0S A;  1VQO A;  1DZ1 A;  4OO1 H;  1LTS D;  5CV9 A;  2F03 A;  1PTO D;  1XYI A;  2UXC L;  4JOI A;  4JPB W;  2KHS A;  4QQB X;  4DR3 L;  3CD6 A;  4QCL A;  1C4Q A;  4B3M L;  1BXT A;  3DEO A;  4OWX B;  2L1B A;  4K0K Q;  1A15 A;  3MXN B;  3Q0A A;  1PVO A;  2LKV A;  4A3C H;  1VF5 C;  4NXM L;  4DR1 L;  4UP9 A;  2SNS A;  2ZXO A;  4DR2 L;  3CF5 A;  1N32 Q;  2RCN A;  4ILW A;  3L3O C;  4ZKC B;  1HZA A;  5JVH 3;  3DEP A;  3NEM A;  1TWG H;  3KF8 A;  1H95 A;  4A3I G;  2BE5 D;  2NBF A;  1L2F A;  1SYC A;  4A93 G;  4EQO A;  3S1M B;  2DGY A;  2A19 A;  2EJG C;  2TSS A;  1IW7 D;  4KV6 A;  1TWF H;  4YWM A;  3T1H L;  4A3F H;  1Y1W G;  2AQ2 B;  3KOJ A;  2VQE Q;  1YBY A;  3CQZ B;  3TP8 A;  4KY6 A;  4PMB A;  3OHX C;  1JJG A;  4LFA L;  1BF4 A;  1NMG A;  3T56 B;  4LF9 Q;  2R93 B;  5EGT A;  1Q82 C;  3SGI A;  1WTW A;  3J7A V;  3KBX A;  3EFX D;  1F9R A;  5L37 A;  2MHV A;  3SXH A;  4OX9 L;  3UE0 A;  4FXD A;  4C3J B;  3T13 A;  2KCC A;  1WJJ A;  2AKW B;  1G8Z D;  1H9R A;  4A3L G;  4OIK A;  3BDL A;  4X65 L;  1JJ2 A;  3M4P A;  4L5Q A;  3C2P A;  2WB1 B;  4HMI A;  3F2B A;  4R1J A;  1S3O A;  3V2T A;  5FLX L;  4JCV E;  2UUC Q;  2J4X A;  3DM1 A;  4DK3 C;  3S14 H;  1NAP A;  2NB0 A;  1OXS C;  5HGT A;  2PPB C;  3AFQ A;  1B9N A;  5IYD G;  1SE4 A;  1STN A;  2JA5 G;  5IYB H;  2B2U C;  1E22 A;  1VQH A;  3HOW H;  3GTG H;  3TEH B;  3FMC A;  5D3D A;  5IP7 H;  1PH8 A;  1PDQ A;  4NPS A;  4DNT B;  3F1Z A;  2OQ0 A;  3MA2 B;  4DXG A;  5BN3 A;  4IFD J;  1UEA B;  2D0O A;  4KN4 C;  4H0L C;  5BN4 A;  3V05 A;  2VNU D;  1WD0 A;  1AN8 A;  4DV4 L;  2Z1C A;  3M3Y B;  4ZK9 B;  1UUP A;  4LF8 Q;  4ZCK A;  1YVC A;  4X66 L;  2MUY A;  4JYA L;  1EY8 A;  4KJN A;  4B3M Q;  3GTJ H;  3A8I E;  4UHV A;  4GZY C;  2OF1 A;  4POG A;  2CKZ B;  1OXX K;  3K7A B;  5FJ8 G;  2EYJ A;  2HDL A;  4NXM Q;  1S5E D;  3K57 A;  5M3F G;  1HNZ Q;  1BVS A;  3RLN A;  2N49 A;  4DR2 Q;  4F7X A;  1I50 H;  3H94 A;  4GKJ L;  3NP8 A;  1O7Y A;  4IUR A;  3I91 A;  3I70 A;  1SAP A;  1L1O B;  3BS1 A;  5ELE A;  1PRT C;  1PYB A;  1RD9 D;  1CHQ D;  2LS0 1;  5IT9 c;  1STE A;  3JAM i;  2KHJ A;  1EWI A;  1YIJ A;  4AYB E;  2V1C C;  3T1H Q;  2N8N A;  1FVI A;  2MFI A;  4O42 A;  3G4S A;  2DNE A;  1Q90 A;  4N8F A;  2EYO A;  2WAQ G;  3PO3 G;  1KDA A;  2KJX A;  3S1R B;  4FYD A;  2O5I C;  4DV0 L;  1IKM A;  1G51 A;  1U4R A;  3PV0 A;  2IX0 A;  4XT1 B;  1X3F A;  4IPH A;  2VB2 X;  4NW2 A;  2F3W A;  2BA1 A;  4IPC A;  4JI0 Q;  4N8X 1;  2FMM A;  2XGT A;  4LF7 Q;  1SDF A;  2L15 A;  1ASZ A;  1HHV A;  3A56 A;  3R93 A;  4DPG A;  1S5D D;  3V96 A;  4JI6 L;  3S15 B;  4I7A A;  1ENF A;  1PYW D;  3A8K E;  3TSS A;  1UAP A;  3PIO A;  4BA2 I;  2HHH Q;  3VYU A;  4HJA A;  2Y0S G;  4C3I H;  2Q2H A;  2UUB Q;  2MJ8 A;  4G7O C;  3BDO A;  2JA7 B;  4WJ4 A;  1VQ4 A;  3VR5 A;  3GTP B;  2RSN A;  2H1E A;  1NSN S;  3VR6 A;  1DJR D;  1K3B C;  1A8V A;  4HTH A;  5IT9 E;  4GOP A;  4GLV B;  4CKB A;  3VR3 A;  1GUO A;  5C4H A;  4I7Z C;  1IBM Q;  4BS9 A;  2CWP A;  2BH2 A;  1SBB B;  3I2Z A;  3NBH A;  5CV5 A;  4DNR B;  3CCJ A;  4K2L A;  1X3P A;  2E2J H;  2IHF A;  1L0X B;  3D4W A;  4IFD H;  1JE5 A;  3J80 i;  1EWC A;  1K83 H;  1G29 1;  3ITP A;  4LF6 Q;  3EA6 A;  1X54 A;  4WFN 3;  4U68 A;  4FDB A;  4YCW A;  1B9M A;  4YIJ A;  1Z7T A;  3A5U A;  1F2M A;  1STY A;  4DUY Q;  5E7N A;  3ER0 A;  1TKW B;  4DFA A;  3GDE A;  1XTD A;  1BKB A;  1Y8P B;  4ZUJ A;  1FNV A;  2R93 G;  2FFK B;  2KCT A;  4GKJ Q;  3A54 A;  3O13 A;  1XWE A;  3AMU A;  2UU9 L;  1TWG B;  1VQ8 A;  4DAM A;  3OOC A;  1XNR Q;  1JOO A;  2HCC A;  2IPK D;  4IO9 A;  1PH4 A;  1M90 C;  1UE6 A;  1TWF B;  2JP1 A;  2KEE A;  1ET6 A;  3EQL C;  5KEE A;  4R8I A;  4A3F B;  2Q2T A;  2WB1 G;  2NN6 H;  5I6Y A;  4F87 A;  2OWO A;  4FP5 D;  3KFU A;  1RL2 A;  3SK8 A;  3VYT A;  4LF5 L;  4DV0 Q;  1SYD A;  1JB7 A;  2UXB Q;  1SRO A;  1KNE A;  3KF6 B;  4TVA B;  5C4Z A;  4ZRZ A;  5IWA L;  2RDG A;  1K0R A;  2RF4 A;  1EY6 A;  4R4T A;  2Q2I A;  1E0B A;  5CBE E;  5HUR A;  5C0X G;  4AYB B;  2A6H D;  4A3D H;  2DN8 A;  3K59 A;  1EIH A;  4JI2 Q;  4JI6 Q;  1HR0 W;  3HZX A;  2D9U A;  2AQ1 B;  3VA5 A;  3S14 B;  1YNN C;  3ICE A;  2CH4 A;  5HY6 A;  3AB9 A;  2PNH A;  1MBY A;  3W1G A;  3W5O A;  1DGS A;  1EQQ A;  1HA5 A;  1TWC H;  1AP0 A;  5KNB A;  2I0Q A;  2O2L D;  1QUQ A;  4DV3 Q;  4Y52 H;  3MXP A;  2CHB D;  3I7F A;  1YJN A;  1HFN A;  1AE3 A;  2PQE A;  4BY1 G;  1FYC A;  1UE7 A;  1X65 A;  2J0T D;  4L63 B;  3GTG B;  3HOW B;  4JI7 Q;  3S16 H;  5CBA E;  3BDC A;  1J5E L;  1LLR D;  2EQS A;  4G4K A;  2B2U A;  4NDX A;  1CSP A;  3NWS A;  2V4D A;  1WD1 A;  4X3T A;  3CCM A;  4X3U A;  3RZO H;  2Z8L A;  1E2W A;  3H09 A;  1WTO A;  1VQN A;  1STA A;  4DR7 L;  2B8F A;  3MWY W;  1RCV D;  1XJV A;  3MZ5 A;  5C4X H;  4X6A H;  1BDO A;  1O80 A;  1RJT A;  4LK1 C;  5E1F A;  4WOR A;  2KCN A;  1Y1V H;  4A3K H;  1HA6 A;  4KKT A;  2F4V L;  3GTJ B;  1B70 B;  5DM6 3;  5ISR A;  4JV5 L;  2F0S A;  3TS0 A;  5D3I B;  1SXT A;  3HOV G;  3AYH B;  2JXM B;  5A2Q E;  4Y7N H;  1F2Y A;  3ND9 A;  1LTR D;  2MQH A;  2N78 A;  2AUK A;  4LFB Q;  4HIO A;  1I50 B;  1L0W A;  2ZM6 Q;  5EKK A;  3CCE A;  2ZTC A;  2UU9 Q;  3Q22 A;  3K5N A;  2K5W A;  3CRK C;  3D4D A;  3NHH A;  1HXY D;  3VR4 A;  2D2C C;  2KEN A;  1ILP A;  5GQO A;  3P1H A;  4IUN A;  5JEA H;  4BBR G;  2EY5 A;  1N8R C;  4P71 A;  3K58 A;  3TBI B;  1HQR D;  3ERQ A;  2E2H H;  4POF A;  3S2D B;  2PZW A;  4IJL A;  4X3K A;  2PZU A;  2R7Z H;  2JQO A;  5C3E H;  1KRT A;  2JA7 G;  1T9H A;  1RHP A;  4XDX A;  4ABN A;  3T1Y L;  4DAY B;  4HN7 A;  4A76 A;  4PZ6 A;  3G48 A;  3J81 L;  1ML0 D;  1N34 Q;  1KAA A;  2L12 A;  1IL2 A;  3CAM A;  1XNQ L;  2OXP A;  3CCQ A;  5EQ0 A;  1NR2 A;  1Z6H A;  4I65 A;  5M9O A;  1CZW A;  4C3I B;  2IHE A;  2SEB D;  3K8A A;  1B7Y B;  4FXG C;  4C3J H;  4CBV A;  1O7Z A;  3FPP A;  1CHP D;  4OO1 G;  1I4H A;  2UXD L;  1S72 A;  5M5Y H;  1SNP A;  3R2I A;  4CDD C;  2VS1 A;  4GN4 B;  2P5Z X;  1DM0 B;  3N6R A;  2R7F A;  1PV4 A;  4A3C G;  1E1T A;  2OTJ A;  3S9W A;  1U0L A;  1VQA A;  2HUG A;  1NUC A;  2YTX A;  2E75 C;  3K0X A;  5GRO A;  2E2J B;  1F2L A;  1J9O A;  1T5X D;  1EQR A;  3KK7 A;  4X62 Q;  3U50 C;  3NTI A;  4JG2 A;  1K83 B;  4LUV A;  4HAE A;  2ZTE A;  2F4V Q;  2QEX A;  3OIQ A;  4A3F G;  4C1N K;  4HSV A;  2H4O A;  2G9D A;  4HJ9 A;  2PYK A;  3PF4 A;  2K6A A;  3HP3 A;  3CCL A;  2VUM H;  3OTO L;  3MFG A;  1X55 A;  5JJI A;  1HRJ A;  3RZD H;  1VCI A;  2A69 C;  2EOT A;  5FK9 C;  1RKN A;  1WTH A;  4OIJ A;  1TT2 A;  3MXU A;  4X64 Q;  1PTO H;  5M3M H;  2MGS A;  4JI3 L;  4NMZ A;  2KVM A;  4AYB G;  5LMN L;  3CMA A;  4DUZ L;  1D6E C;  2Z4H A;  3S2H H;  1MSH A;  2LSS A;  3VDY A;  2G9H D;  2A69 D;  1G2S A;  2DUD A;  4JI8 L;  2RDF A;  4JBJ A;  2EIF A;  3SR1 A;  1CTM A;  1WTQ A;  3ND8 A;  2B63 H;  2XIW A;  2XRQ D;  1BUV T;  1SNC A;  1TWH B;  2R3Z A;  5G3L F;  5LL6 S;  5IYB G;  5C0X I;  4A3D B;  4OGQ C;  5JJL A;  5LHY 1;  3HOW G;  4B3T Q;  1LTI D;  4R4C A;  1K8O A;  5IP7 G;  4MZ9 A;  2DY7 A;  1I6V C;  1JOR A;  2HDM A;  1X6O A;  3KF8 B;  2RBM A;  2ICI A;  5IGB A;  1G6P A;  4PMW A;  3TZU A;  2OT2 A;  2JA6 H;  1GD7 A;  1SEB D;  3I4O A;  2RA4 A;  1GUG A;  2R7D A;  1JQY D;  5IOD A;  3C3L A;  3Q24 A;  1HNX Q;  1E24 A;  3G6J B;  3CPW A;  3S17 H;  2WKD A;  3C1E A;  2LXK A;  1CKN A;  5K36 H;  3I4M H;  4JI5 L;  1CM9 A;  3S16 B;  3KYH C;  5DLQ E;  4KMU C;  4APV A;  1G6Z A;  1TVX A;  1QNK A;  3PUX A;  4DV1 L;  4CGY B;  1Q8K A;  3RZO B;  1U4P A;  3T4A C;  4KN7 C;  4PG3 A;  5FO9 B;  3H0G H;  1LTT D;  4J6H A;  1HFG A;  3P7J A;  5ELO A;  5FLX E;  5C4X B;  4CJ2 C;  2PZT A;  4KY7 A;  4XTC S;  5IP9 H;  1KLU D;  1CKO A;  4BXX H;  1Y1V B;  3PCO B;  4A3K B;  3HOU H;  2E76 C;  1D8L A;  4H02 A;  3UI2 A;  1JWU D;  3P75 A;  3VA7 A;  2QW7 A;  4P74 A;  2F0H A;  3GTO H;  3OTO Q;  2AWO A;  4Y7N B;  3K5O A;  1FR3 A;  5ELC A;  4BBS H;  1MI2 A;  3JAM L;  1R9T H;  1BCP C;  2ZT9 C;  4IAL A;  4JI3 Q;  1J6Q A;  2DJG C;  4C3H H;  1ROD A;  2F4I A;  1DXM A;  2NZH A;  5E3F A;  1ONL A;  1X3E A;  2QDB A;  4TKO B;  1RIP A;  5LMN Q;  4HSP A;  2AQ3 B;  2C5C A;  2F0I A;  4E6I A;  4R8N A;  1GM5 A;  4GNX C;  1L1O C;  2VZA A;  2CW0 C;  1TY2 A;  1PMR A;  2D0P A;  2PQA A;  1NCV A;  4DV2 L;  2LY7 A;  3PIO 3;  4C3I G;  5J1Z A;  2E2H B;  1XTC D;  1SSO A;  1BCP D;  5C6A A;  4JI8 Q;  3QIA A;  2R7Z B;  5AJ3 Q;  5C3E B;  3RNU A;  1MD2 D;  1UE1 A;  4HCS A;  3TN2 A;  3PO2 H;  1D5X C;  3ZJY C;  2N3S A;  2Q8T A;  4A3G H;  1K8M A;  1I4Q A;  5F2D A;  2WP8 J;  1AW7 A;  4HJ7 A;  1AZP A;  2F0G A;  2RHS B;  3AQQ A;  4FF4 A;  1NY4 A;  3GV6 A;  1PYS B;  5IGD A;  2WV6 D;  2IY5 B;  2AUJ D;  3T53 B;  2SOB A;  1UNS A;  1X32 A;  2FHT A;  1YEZ A;  3RN5 A;  4FF3 A;  4IFD G;  5M5Y B;  4PMC A;  3Q6S A;  4XYO A;  4M1U B;  4RGT A;  1K9M C;  3M7N A;  2F52 A;  3BG3 A;  4FVM A;  4JI5 Q;  3DWQ A;  1S40 A;  5M5X H;  1YJW A;  4DK0 A;  4P73 A;  1AEX A;  3J80 L;  3GD7 A;  4K5W A;  5IOC A;  5BR8 L;  2IJ0 A;  3NE5 B;  1SE8 A;  1IBK L;  3KJO A;  2EYL A;  2FJ2 A;  2OQK A;  5EPJ A;  3X3N A;  2JE6 I;  4DR4 Q;  1E3P A;  5EBC A;  1IYU A;  3MAQ A;  2B2V A;  1EIG A;  4MTK A;  2Z6K C;  2B29 A;  2JJQ A;  1MSG A;  2NN6 G;  2YV5 A;  3KLS A;  4EQP A;  4JVZ A;  1X56 A;  3DWP A;  2VUM B;  4FNF A;  3IFT A;  2AWN A;  1TS2 A;  3HOX H;  3RZD B;  1DOL A;  2UXC Q;  1H9S A;  3AEV A;  4DR3 Q;  4V19 0;  1KQS A;  1PTO B;  5M3M B;  2CH4 W;  2MPM A;  4GOP B;  5EJW A;  4C1N I;  3CC4 A;  4OON A;  4JI4 L;  4A3D G;  2NZ1 D;  1VQK A;  3NBH B;  1D7Q A;  2YYZ A;  1C7Y A;  5CC4 A;  4DR1 Q;  4GKK L;  3S2H B;  4IUV A;  3L9A X;  2MO1 A;  2XSC A;  4R4Q A;  4CDF C;  1HQM C;  2F0V A;  3L0O A;  5I9P A;  4DV2 Q;  1C8C A;  1FJG L;  4J15 A;  1FL0 A;  1EYC A;  4O0A A;  2ATW A;  1CI3 M;  2DJF C;  3I3C A;  5ELD A;  2ZJP A;  2IT1 A;  2B63 B;  1PA6 A;  4L5S A;  3EVQ A;  4LJZ C;  3QWN A;  4OEL B;  5G3L D;  2X6L A;  5EPL A;  2F0O A;  2I07 B;  3ULP A;  4LFA Q;  1A3T A;  1K73 C;  1PFM A;  3S2D H;  4QMG A;  2WFW A;  4Z9C B;  3NWT A;  3RN2 A;  1GVP A;  3HKS A;  1TS5 A;  4OX9 Q;  2ID0 A;  2O5J C;  1KIX A;  2JA6 B;  1PRT D;  4KHP L;  4YWL A;  4IJH A;  1QE6 A;  4K14 A;  1B50 A;  2BOS A;  1HTP A;  2CFM A;  2K28 A;  4ID6 A;  3BZD B;  4OWT B;  1M4V A;  3CHB D;  5C4X G;  1I94 L;  2B8G A;  1JR0 D;  4X65 Q;  3QO2 A;  2NVT H;  4TQU S;  3S17 B;  1Y1V G;  2VL6 A;  3UDX A;  4A3K G;  3GTQ H;  1XPR A;  3I4M B;  4ME3 A;  2VW9 A;  3UDF A;  1CQF A;  5KYI A;  1TU2 B;  1GJX A;  1GHK A;  3UDG A;  1YJ9 A;  5BR8 Q;  3J81 j;  1CK1 A;  5J39 A;  2BDN A;  1LT6 D;  2KEC A;  2EYP A;  5TSS A;  3ZYY X;  3H0G B;  4IUP A;  2DY8 A;  2ICE C;  4OXP A;  1GXD C;  3CW2 C;  3OPO A;  4NP5 A;  3S1N H;  3PUZ A;  3TQY A;  5I4D A;  3HOU B;  1W6J A;  3D6C A;  4XT3 B;  3TDQ A;  5JEA G;  4WJ3 M;  1YNJ C;  4J8Q A;  4B3S L;  3GTO B;  2RDH A;  1AZQ A;  4DV4 Q;  4GS3 A;  4DV5 L;  1QUQ B;  4BBS B;  5CMD A;  2B39 A;  4CDE C;  2K03 A;  3A7A B;  4G7Z C;  1R9T B;  4X66 Q;  4JYA Q;  2R7Z G;  1KAW A;  3E3X A;  5C3E G;  1A63 A;  1EY4 A;  4C3H B;  5IY0 A;  2F3V A;  4U67 3;  1YIT A;  1LT4 D;  1ICW A;  3RMH A;  2M2L A;  4LFC L;  1MHW C;  4QB4 A;  3RD4 A;  3NEL A;  5ELB A;  2K52 A;  4GKK Q;  1J8I A;  1YNJ D;  1IBL L;  3G6E A;  3J81 c;  1KNA A;  4DV6 L;  5IYC H;  4OL7 A;  4GNX A;  1JC7 A;  4BA1 I;  4C3J G;  1H9M A;  1U9R A;  3ULJ A;  2R6G A;  1NMF A;  3H91 A;  3W1B A;  5C3W A;  1M8A A;  1VQF A;  3PSI A;  4C56 C;  1CZG A;  4LW1 A;  1AH9 A;  1E7Z A;  3PO2 B;  4DU9 A;  3DHQ A;  2E8G A;  2ALY B;  2XNA C;  3SHL A;  4A3G B;  3HKZ E;  4L8J A;  2K05 A;  3C46 A;  5J22 A;  3GP7 A;  3OYY A;  1QVF A;  2CQO A;  3CCR A;  1DOM A;  3MXG A;  1TWH H;  4KHP Q;  3PUW A;  1R4Q B;  1SR3 A;  1D1I A;  2B2W C;  3LGJ A;  4DR5 L;  1I94 Q;  5I2X A;  3H3V H;  1N33 L;  1YHB A;  4EQ5 A;  4Q0F A;  1KC8 C;  4HED A;  1XMQ L;  3GTK H;  5JVG 3;  1PFB A;  3OSO A;  3U4V A;  3BVG A;  3TZD A;  3A7L A;  1B8A A;  1XMO L;  3QG1 A;  5M5X B;  2VUM G;  1MIU A;  2A5H A;  2RQX A;  3U9S A;  3J7Z C;  4A3J H;  1WCM H;  1WI5 A;  5EBD A;  3NK9 A;  3J81 E;  5IIF A;  1WTX A;  2I5H A;  5M3M G;  2NVQ H;  1HNW L;  4XYQ A;  3A0J A;  2PMZ E;  5DEH A;  3F2U A;  3FKI H;  2QIL A;  1EEI D;  4KHZ A;  2K75 A;  4IZ8 A;  4HJ8 A;  1U4M A;  4LNQ A;  5FO8 B;  1YNN D;  2GN5 A;  3K5M A;  5JJK A;  1QJO A;  1VQ5 A;  4H44 C;  4ZUI A;  4JK1 C;  2NN6 I;  4RHS A;  2EDG A;  1GKH A;  3HOX B;  3CP0 A;  2Z6K A;  3TP7 A;  1QWY A;  3NSW A;  4PV1 C;  3L2P A;  3DMU A;  4LUO A;  5CGK A;  1RF2 D;  1VQL A;  1QB5 D;  3RLF A;  1DON A;  1O7I A;  1A2T A;  2IX1 A;  2B63 G;  5C0X J;  1IZ6 A;  1LV9 A;  2JK8 A;  1B3A A;  4NXN L;  1LT3 D;  5DAU A;  4DAV A;  3T51 B;  4UPA A;  4O2D A;  1HR0 L;  1IBL Q;  4DF7 A;  2PW5 A;  2EPB A;  1TY0 A;  1V8Q A;  3AU7 A;  3D4R A;  2K33 A;  2NZO A;  3I72 A;  2JA6 G;  1XXG A;  1SMY C;  1SYE A;  1EU3 A;  1B44 D;  5IGF A;  1ZYR C;  1Y8O B;  3QOJ A;  2WKC A;  2B2T C;  1U5K A;  4JW0 A;  3GO5 A;  1N36 L;  5I9O A;  1BNZ A;  1PTO F;  4IUT A;  2A6E C;  1EOV A;  4B9X A;  1MJC A;  5K36 G;  4LF5 Q;  1LYL A;  3D8G A;  1Q86 C;  3I4M G;  2HQL A;  4R4O A;  1OO9 B;  1LM0 A;  1V43 A;  5AFW A;  5CR3 A;  4MIU A;  1T5E A;  2F0K A;  2F3I A;  5IWA Q;  2K14 A;  3VYS A;  4K6D A;  3P20 A;  1SMY D;  4LWC A;  3H0G G;  4EX5 A;  1WYD A;  1FGU A;  4XIG S;  3DWA A;  1JOK A;  1EQV A;  5IP9 G;  2L55 A;  2NVT B;  4BXX G;  3HOU G;  1D2B A;  1C0A A;  5FOB B;  3HKZ B;  1XMQ Q;  3GTQ B;  2Z4I A;  1I4G A;  3MEF A;  3MHB A;  3CXC A;  1PH6 A;  1XMO Q;  5KIX A;  3D6W A;  3NEN A;  3VR2 A;  2EY2 A;  3KLR A;  4KD4 A;  1VQM A;  4BBS G;  2JYO A;  3BZK A;  2OTL A;  4L5R C;  4DXF A;  1CT1 D;  5CV8 A;  3KUP A;  4RGN A;  1PHJ A;  3J7A F;  2D62 A;  2F0L A;  3K7U C;  4C3H G;  4QGU A;  1JCK B;  4ZQ3 A;  2IWH A;  4WRD A;  1GUS A;  5K5P A;  1SYF A;  3S1N B;  4YY3 L;  1D5Z C;  1J5E Q;  1II3 A;  3NXW A;  3ERO A;  3IAY A;  3NTK A;  1TS4 A;  2VY3 A;  3A5Z B;  4B3R L;  3SDZ A;  5T1I A;  4FO2 A;  2ZJR A;  4DR7 Q;  5EPK A;  4G7H C;  3HOY H;  1D5M C;  1PLF A;  4P75 A;  3NQT A;  1CKN B;  1WVL A;  2EXD A;  1QZH A;  3CC2 A;  1ZKO A;  1EWH A;  2Y0S E;  2JA9 A;  4JV5 Q;  3I4N H;  3PO2 G;  4HJ5 A;  2A73 B;  2G5D A;  5D65 A;  4HIM A;  2SDF A;  1QIL A;  1QG7 A;  4A3G G;  1SE2 A;  3FP9 A;  3URY A;  1FNW A;  3F2C A;  4BY7 H;  4V0B A;  4KTA A;  3STB C;  1BOS A;  2QA4 A;  4DK1 A;  3SK4 A;  2OCE A;  1ESR A;  3FPU B;  1VDZ A;  2Z6B A;  3K5L A;  5C4J H;  1KL9 A;  1NNX A;  3JAM E;  1N36 Q;  1K0S A;  1S5B D;  3D31 A;  1EQT A;  4UY8 C;  1QNU A;  5FLX c;  1SFO H;  1ZXT A;  1EFW A;  1CSQ A;  4K0K L;  1E1O A;  3PF5 A;  1QOH A;  3K81 C;  3STB D;  2NVX H;  1A0I A;  2HIX A;  3JC6 6;  4YCU A;  1ASY A;  2F0F A;  3I8Z A;  1C9O A;  3T1Y Q;  2KCM A;  2K32 A;  5NUC A;  1LO5 D;  4IQZ A;  1VQI A;  1HTL D;  3D0F A;  2PQA B;  2F0J A;  1C48 A;  1XNQ Q;  1TWA H;  2B2W A;  3KDF A;  2F1M A;  4ZKB B;  3GTK B;  1WOC A;  3BYY B;  3CRL C;  4QUC A;  1S5C D;  3RUZ A;  2YTV A;  3EIV A;  2VQE L;  3LWE A;  4QY7 A;  3HOX G;  4RHR A;  4A3J B;  1WCM B;  2QKI C;  2OEO A;  2UXD Q;  3FRP B;  1LUZ A;  3HOZ H;  5JPN C;  4MTN A;  2WAC A;  3LNN A;  5JJZ A;  2KED A;  1I4P A;  5GAG C;  4LF9 L;  4LAA A;  3NQI A;  1KD1 C;  2NVQ B;  1KAB A;  1QZG A;  5FLM H;  3FKI B;  3E9I A;  1EOT A;  1EY9 A;  4K5X A;  2K04 A;  3BYT B;  1BR9 A;  2JA8 H;  2EYM A;  2BH8 A;  2QEJ C;  1STH A;  3TME A;  2EZV A;  4KHV A;  5KNC A;  3SK5 A;  1Z9F A;  4MN3 A;  1CFM A;  5DM7 3;  4RKB A;  2KBN A;  3UDI A;  1A3U A;  2WIN B;  1PH3 A;  5E4X A;  2UUC L;  1ILQ A;  4HCE A;  2CVR A;  2GA4 B;  4UP7 A;  4AIM A;  3J80 E;  3FDT A;  1FGB D;  1KHI A;  1GOZ A;  1SYG A;  4RCO A;  1PTO C;  3BJU A;  3WWV A;  1GUN A;  1EL0 A;  1JT8 A;  2FMC A;  4JC0 A;  1V1P A;  4KKU A;  4H13 C;  3NPP A;  4TRD A;  4LF4 L;  1NE3 A;  1YHA A;  3OWF A;  2YTY A;  4RGO S;  2JN4 A;  2K50 A;  3R8B A;  4DUZ Q;  4XQQ A;  2QCP X;  1V1Q A;  2EYH A;  1EEF D;  3HKZ G;  1HZC A;  2BE5 C;  3E0J A;  1FNU A;  4B9W A;  1H9S B;  4LF8 L;  3M4O H;  1XPO A;  2F0W A;  2R92 H;  4JBM A;  5CYU A;  2B2T A;  3CKI B;  1IW7 C;  5GAD C;  3H6M A;  2M9V A;  3NTH A;  3AFP A;  4IPG A;  4TSS A;  4N9T A;  1S4Z A;  1VS0 A;  1JJC B;  4DK6 C;  4RWS C;  1PXU A;  1UEB A;  1LTG D;  4DR6 L;  1LAB A;  1HNZ L;  1F9Q A;  1LT5 D;  2NVY H;  2CW0 D;  3PMF A;  1E2Z A;  4R9W A;  4IUU A;  4CHT B;  1D1K A;  5EKL A;  4IPD A;  2E5L L;  2CWA A;  4C2M H;  1PH1 A;  1PH7 A;  1K3R A;  4O1N A; 
#chains in the Genus database with same CATH homology
 4HIK A;  1CKM A;  1Y1V H;  4A3K H;  3K7A H;  1SLJ A;  2F4V L;  4OXP A;  3J80 c;  1V9P A;  3GTM H;  4OO1 I;  1B70 B;  4JV5 L;  3CW2 C;  3TS0 A;  3UE1 A;  3S1N H;  3PUZ A;  1N32 L;  1VQ9 A;  3TQY A;  3HOV G;  2UXB L;  3AYH B;  4A3M G;  1WFQ A;  4Y7N H;  1VQE A;  4NB3 A;  5ELN A;  1K8A C;  1Z47 A;  4JI0 L;  4A3B G;  4L5T A;  2MQH A;  2N78 A;  5JEA G;  4LFB Q;  4WJ3 M;  4LF7 L;  2HIV A;  1N9W A;  2HT1 A;  3S24 A;  1VQP A;  4HIO A;  2ZTD A;  1L0W A;  4B3S L;  4DV1 Q;  2ZM6 Q;  3CCE A;  3DM3 A;  1Q1B A;  4GS3 A;  4DV4 Q;  4DV5 L;  1QUQ B;  2ZTC A;  2UU9 Q;  5AJ3 L;  5H1S E;  3DLL A;  3CME A;  1TXY A;  2A1A A;  1SRU A;  1HH2 P;  1I5F A;  3M9B A;  5IYC G;  4X66 Q;  3BU2 A;  2R7Z G;  4JYA Q;  1KAW A;  5C3E G;  3HOV H;  1A63 A;  4QL5 A;  2HHH L;  4A3M H;  2WB1 E;  3S1R H;  5IY0 A;  4JI1 L;  2KEN A;  4HID A;  5GQO A;  4A3B H;  1YIT A;  4BBR G;  1MJE A;  3KLW A;  1N8R C;  4LFC L;  1VQG A;  4P71 A;  2UUB L;  2B3G A;  3NEL A;  2MO0 A;  3M85 A;  2K52 A;  1KXL A;  4GKK Q;  4A3E G;  4YY3 Q;  2E2H H;  4KI0 A;  1IBL L;  4POF A;  1EUJ A;  3G6E A;  3J81 c;  4IJL A;  2ES2 A;  3H15 A;  4DV6 L;  5IYC H;  2R7Z H;  4B3R Q;  2JQO A;  1UWV A;  5C3E H;  3M4Q A;  1KRT A;  4GNX A;  2JA7 G;  3S15 H;  4BA1 I;  1T9H A;  5LMU L;  3TRZ A;  3T1Y L;  3ULJ A;  2R6G A;  4DAY B;  4BBR H;  3CCU A;  1NMF A;  3B6Y A;  3W1B A;  1VQF A;  4LF4 Q;  1PH2 A;  3PSI A;  4A76 A;  4PZ6 A;  4LW1 A;  3G48 A;  1N34 Q;  3S1Q H;  1E7Z A;  4A3E H;  1IBM L;  1AH9 A;  2E8G A;  1HJP A;  2ALY B;  3CAM A;  1IL2 A;  3CCQ A;  1XNQ L;  3GTL H;  3J81 i;  1VQD A;  1YHQ A;  5C44 G;  3HKZ E;  2JA7 H;  2IHE A;  3K8A A;  1B7Y B;  1PH9 A;  4C3J H;  2QGQ A;  3E9H A;  3OYY A;  4GOP C;  1QVF A;  3ULL A;  3GTP H;  2KHI A;  3A74 A;  2CQO A;  1EYG A;  4LF6 L;  3EN2 A;  3CCR A;  3TS2 A;  4OO1 G;  2UXD L;  1SN8 A;  1S72 A;  5M5Y H;  1TWH H;  2BA0 A;  1QVG A;  3PUW A;  4DR4 L;  4KHP Q;  4GLX A;  4R4I A;  1SR3 A;  1I6H H;  2VS1 A;  4GN4 B;  4LUZ A;  4DUY L;  3LGJ A;  4A3J G;  1YI2 A;  1OXV A;  1WCM G;  1AE2 A;  2H5X A;  4DR5 L;  1I94 Q;  1P8L A;  5IE8 A;  2CCZ A;  3H3V H;  1BBU A;  1N33 L;  1YHB A;  5C44 H;  4EQ5 A;  4DR6 Q;  2R7F A;  1PV4 A;  1KC8 C;  1NJI C;  1CUK A;  1XMQ L;  1E1T A;  3GTK H;  4A3C G;  4YHH Q;  1PH5 A;  2OTJ A;  3FKI G;  3U4V A;  4IOA A;  2Z0S A;  1VQO A;  1U0L A;  1B8A A;  1VQA A;  1XMO L;  2UXC L;  2MNA A;  4GNX B;  2YTX A;  2VUM G;  3K0X A;  1MIU A;  4JOI A;  5GRO A;  3PIP A;  4AQY L;  1XNR L;  3J7Z C;  2E5L Q;  4QQB X;  4DR3 L;  4A4I A;  3CD6 A;  4A3J H;  1WCM H;  4B3M L;  1WI5 A;  1EQR A;  1YZ6 A;  4OWX B;  3U50 C;  4X62 Q;  4K0K Q;  4JG2 A;  2I5H A;  4LUV A;  3MXN B;  1PVO A;  5M3M G;  2NVQ H;  2ZTE A;  1HNW L;  1JMC A;  2F4V Q;  2QEX A;  4A3C H;  3A0J A;  4A3F G;  2PMZ E;  3FKI H;  4NXM L;  4DR1 L;  4KHZ A;  4UP9 A;  2K75 A;  4HJ9 A;  3E0E A;  3TRE A;  3CF5 A;  4HJ8 A;  4DR2 L;  2RCN A;  3PF4 A;  3CCL A;  1N32 Q;  2VUM H;  3OTO L;  1X55 A;  1HZA A;  4LNQ A;  5JJI A;  2GN5 A;  5JJK A;  3RZD H;  1VCI A;  3NEM A;  1TWG H;  1VQ5 A;  1I3Q H;  1H95 A;  4A3I G;  1NTG A;  2NN6 I;  1L2F A;  1D7Q A;  4A93 G;  4X64 Q;  1GKH A;  1Q7Y C;  2DGY A;  2A19 A;  4JI3 L;  3CP0 A;  5M3M H;  4JI2 L;  2Z6K A;  1TWF H;  4YWM A;  3T1H L;  4QIW E;  4A3F H;  1Y1W G;  2VQF L;  1IBK Q;  3L2P A;  3KOJ A;  4LUO A;  1YBY A;  4AYB G;  2VQE Q;  1VQL A;  5LMN L;  3RLF A;  1O7I A;  3F2D A;  3CMA A;  2IX1 A;  1YNX A;  2AHO B;  2B63 G;  5C0X J;  1IZ6 A;  1IYJ B;  1VQC A;  4DUZ L;  4JI1 Q;  3S2H H;  4ALP A;  2JK8 A;  4NXN L;  1JJG A;  4LFA L;  2LSS A;  1NMG A;  4LF9 Q;  4A3I H;  1Q82 C;  3VDY A;  3SGI A;  4UPA A;  4YWK A;  3KJP A;  2YU9 H;  4A93 H;  3BZC A;  4OX9 L;  2RHQ B;  3UE0 A;  2DUD A;  4O2D A;  3CCS A;  1HR0 L;  1IBL Q;  1Y1W H;  4JI8 L;  1WJJ A;  2I5M X;  4DV3 L;  2AKW B;  5GAE C;  4JBJ A;  4P72 A;  2EIF A;  1HZ9 A;  4A3L G;  2NZO A;  2B63 H;  2JA6 G;  4X65 L;  1JJ2 A;  5LMU Q;  3M4P A;  4L5Q A;  2PI2 E;  4GLA C;  5IYB G;  4JI7 L;  5C0X I;  3J7A 5;  3F2B A;  4R1J A;  1S3O A;  1QVC A;  2UUC Q;  4JCV E;  5JJL A;  3HOW G;  1Q12 A;  4DK3 C;  4B3T Q;  3S14 H;  4R4C A;  1U5K A;  1KRS A;  5IP7 G;  1X9N A;  4JI4 Q;  3GO5 A;  1OXS C;  4MZ9 A;  1N36 L;  3AFQ A;  1EOV A;  1X6O A;  1MJC A;  3KF8 B;  5IYD G;  4LF5 Q;  5K36 G;  1LYL A;  1Q86 C;  3I4M G;  2HQL A;  4R4O A;  1G6P A;  1LM0 A;  1V43 A;  4PMW A;  1M1K C;  4A3L H;  2JA6 H;  1GD7 A;  2F3I A;  3I4O A;  5IWA Q;  2K14 A;  2R7D A;  2JA5 G;  5IYB H;  1W2B A;  4DV7 L;  1E22 A;  1L1O A;  1HNX Q;  1VQH A;  1FJG Q;  1VQ6 A;  1E24 A;  3HOW H;  1Q1E A;  3GTG H;  3CPW A;  3TEH B;  3S17 H;  4LWC A;  3H0G G;  5IP7 H;  1PH8 A;  4EX5 A;  1WYD A;  4YCV A;  2LXK A;  1FGU A;  4XIG S;  1Q81 C;  1EIF A;  4NPS A;  1CKN A;  3F1Z A;  4IOC A;  5IYD H;  5IP9 G;  3Q8D A;  3I4M H;  4JI5 L;  4LFB L;  3KYH C;  2OQ0 A;  5DLQ E;  3HOU G;  4BXX G;  4APV A;  4IFD J;  1C0A A;  2D0O A;  1XMQ Q;  4JBK A;  3PUX A;  2ZM6 L;  4DV1 L;  2JA5 H;  3MEF A;  2VNU D;  4DV4 L;  3CXC A;  1Q8K A;  1VQB A;  1PH6 A;  1XMO Q;  3NEN A;  4PG3 A;  4LF8 Q;  3H0G H;  2I5L X;  4AQY Q;  5JEA J;  1YVC A;  4X66 L;  1VQM A;  4JYA L;  4BBS G;  5ELO A;  3BZK A;  2OTL A;  4B3M Q;  3GTJ H;  4XTC S;  5IP9 H;  4L5R C;  1CKO A;  4POG A;  2CKZ B;  1PHJ A;  1OXX K;  2D62 A;  3PCO B;  2Q2U A;  3HOU H;  4BXX H;  3HOY G;  3K7U C;  5FJ8 G;  4QGU A;  4IFD I;  1D8L A;  4NXM Q;  5M3F G;  4H02 A;  1HNZ Q;  4YY3 L;  1BVS A;  3RLN A;  2N49 A;  4DR2 Q;  1J5E Q;  4P74 A;  1K8G A;  1I50 H;  3GTO H;  3OTO Q;  4GKJ L;  2AWO A;  4PZ8 A;  2VY3 A;  3A5Z B;  3I4N G;  4BBS H;  4B3R L;  1L1O B;  5M5W H;  1R9T H;  2ZJR A;  1VQ7 A;  1PYB A;  4DR7 Q;  3I55 A;  3PGZ A;  5IT9 c;  3JAM i;  2KHJ A;  1EWI A;  3HOY H;  4JI3 Q;  1J6Q A;  5FJ8 H;  4P75 A;  4AYB E;  4C3H H;  1YIJ A;  2V1C C;  3T1H Q;  2N8N A;  1CKN B;  2VQF Q;  4BY7 G;  1FVI A;  2NZH A;  1N34 L;  2EXD A;  5M3F H;  2MFI A;  1QZH A;  3CC2 A;  3G4S A;  1X3E A;  5LMN Q;  1RIP A;  2WAQ G;  5GAH C;  3PO3 G;  2Y0S E;  1GM5 A;  4DV0 L;  4GNX C;  1G51 A;  2JA9 A;  1L1O C;  2IX0 A;  3PV0 A;  2UUA L;  3I4N H;  3PO2 G;  4HJ5 A;  4JV5 Q;  1X3F A;  2VZA A;  4IPH A;  2BA1 A;  2FXQ A;  4HIM A;  4IPC A;  2E2I H;  2D0P A;  4JI0 Q;  2PQA A;  1HZB A;  4DV2 L;  4A3G G;  2XGT A;  4LF7 Q;  3FP9 A;  3HFZ B;  4OWW B;  4B3S Q;  2L15 A;  3F2C A;  1ASZ A;  4RMF A;  4JI8 Q;  4BY7 H;  4DV5 Q;  4DPG A;  3STB C;  3PO3 H;  5AJ3 Q;  2QA4 A;  3RNU A;  4JI6 L;  1UE1 A;  2OCE A;  4RG1 A;  1X3G A;  3PIO A;  3PO2 H;  4BA2 I;  3ZJY C;  2HHH Q;  2N3S A;  4HJA A;  1SMX A;  5C4J H;  1KL9 A;  2Y0S G;  4A3G H;  2ASB A;  4C3I H;  1N36 Q;  2WP8 J;  2Q2H A;  4LFC Q;  2UUB Q;  4HJ7 A;  3D31 A;  5J3B A;  2RHS B;  3AQQ A;  4UY8 C;  5FLX c;  1SFO H;  3H3V I;  1NY4 A;  1IXR A;  1PYS B;  4WJ4 A;  4X62 L;  1VQ4 A;  4MNO A;  1CSQ A;  1EFW A;  4K0K L;  2IY5 B;  1E1O A;  4DKA C;  3K81 C;  4DV6 Q;  3PF5 A;  3STB D;  4DV7 Q;  2NVX H;  1A0I A;  2HIX A;  3JC6 6;  4YCU A;  1ASY A;  4IFD G;  1YEZ A;  3RN5 A;  4PZ7 A;  4JBW A;  1C9O A;  3I56 A;  1A8V A;  3T1Y Q;  3FHW A;  2KCM A;  1EIY B;  2K5N A;  4JOI C;  4GOP A;  4GLV B;  1K9M C;  3HOZ G;  3M7N A;  2F52 A;  1LTL A;  1VQI A;  1IBM Q;  3D0F A;  4JI5 Q;  2CWP A;  2PQA B;  2BH2 A;  1S40 A;  3I2Z A;  4AH6 A;  5M5X H;  3CCJ A;  1YJW A;  1XNQ Q;  1TWA H;  3KDF A;  4P73 A;  1WOC A;  3GD7 A;  5FLM G;  2E2J H;  5BR8 L;  3ERS X;  2IHF A;  4X64 L;  2ZJQ A;  3KF6 A;  1SE8 A;  3IRB A;  1JE5 A;  3J80 i;  1IBK L;  2YTV A;  3RR5 A;  3KJO A;  2JA8 G;  1K83 H;  3EIV A;  1NBW A;  2VQE L;  3HOX G;  1G29 1;  4QY7 A;  4LF6 Q;  2K5V A;  1X54 A;  2OQK A;  2UXD Q;  3HOZ H;  1LUZ A;  2JE6 I;  3K80 C;  3PUV A;  4FDB A;  4YCW A;  4MTN A;  4QJF A;  3G71 A;  4DR4 Q;  1E3P A;  3A5U A;  4DUY Q;  3U58 A;  2JEA I;  5GAG C;  5E7N A;  4DR5 Q;  4LF9 L;  3ER0 A;  4GN5 A;  1KD1 C;  1QZG A;  1N33 Q;  5FLM H;  2B29 A;  2JJQ A;  1XTD A;  2NN6 G;  1BKB A;  2Z6K C;  3E9I A;  3GDE A;  4UP8 A;  2R93 G;  2YV5 A;  1X56 A;  2KCT A;  2JA8 H;  4GKJ Q;  2BH8 A;  3EBE A;  1UE5 A;  2AWN A;  3S1M H;  3L7Z C;  3HOX H;  2UU9 L;  1VQ8 A;  2UXC Q;  3CCV A;  3OW2 A;  4DAM A;  1Z9F A;  1XNR Q;  3AEV A;  4DR3 Q;  3CQZ H;  2KBN A;  3UDI A;  3PUY A;  1KQS A;  4IO9 A;  1PH3 A;  1PH4 A;  1M90 C;  2UUC L;  4GOP B;  1UE6 A;  2Q2T A;  4B3T L;  2WAQ E;  3CC4 A;  2WB1 G;  4OON A;  3JAM c;  4JI4 L;  4A3D G;  2R93 H;  1OXT A;  1VQJ A;  4UP7 A;  2OWO A;  1HNW Q;  1VQK A;  3NBH B;  5EAY A;  4AIM A;  3KFU A;  1P16 A;  1RL2 A;  2YYZ A;  1C7Y A;  4DV0 Q;  4LF5 L;  3KDF B;  1JB7 A;  4DR1 Q;  2UUA Q;  4GKK L;  2JEB I;  2UXB Q;  1SRO A;  1KHI A;  5LMN W;  2MO1 A;  2K4K A;  3KF6 B;  4R4Q A;  4TVA B;  3BJU A;  5IWA L;  1K0R A;  2RF4 A;  4GN3 B;  3L0O A;  3WWV A;  4R4T A;  4DV2 Q;  2Q2I A;  1JT8 A;  1Y14 B;  1HNX L;  1FJG L;  4J15 A;  1FL0 A;  4O0A A;  4JC0 A;  2ATW A;  5C0X G;  2A8V A;  3U4Z A;  2GVA A;  4A3D H;  4LF4 L;  2R92 G;  2ZJP A;  2IT1 A;  4JI2 Q;  4JI6 Q;  1PA6 A;  1HR0 W;  4L5S A;  1NE3 A;  1YHA A;  1W3S A;  2C35 B;  2YTY A;  2PI2 A;  4A75 A;  2K50 A;  3CC7 A;  4DUZ Q;  3ULP A;  4NXN Q;  1MKH A;  1A62 A;  4LFA Q;  3ICE A;  1K73 C;  1Q46 A;  5HY6 A;  3S2D H;  1V1Q A;  5HGQ A;  1HZC A;  2PNH A;  2WFW A;  3HKZ G;  3W1G A;  3RN2 A;  3W5O A;  1DGS A;  1GVP A;  1XPO A;  3HKS A;  1EQQ A;  4LF8 L;  3M4O H;  4OX9 Q;  3F8T A;  1TWC H;  2ID0 A;  2R92 H;  1PFS A;  1KIX A;  1HR0 Q;  4JBM A;  2I0Q A;  5GAD C;  4KHP L;  4YWL A;  1QUQ A;  1OXU A;  4IJH A;  3RLO A;  3AFP A;  4DNI A;  4IPG A;  4DV3 Q;  4Y52 H;  2CFM A;  4OWT B;  2GVB A;  3I7F A;  1VS0 A;  3CPF A;  4KLK A;  1YJN A;  4X65 Q;  1JJC B;  1AE3 A;  4BY1 G;  1I94 L;  5C4X G;  1UE7 A;  1X65 A;  4DK6 C;  2XTI A;  2NVT H;  4TQU S;  1UEB A;  4JI7 Q;  2LXJ A;  3S16 H;  1BBW A;  1HNZ L;  1Y1V G;  2VL6 A;  3UDX A;  4A3K G;  4DR6 L;  1J5E L;  2EQS A;  4YHH L;  3GTQ H;  1CSP A;  1XPR A;  4ME3 A;  2VW9 A;  2AMC B;  2K5H A;  2NVY H;  3UDF A;  3CCM A;  3RZO H;  3M3Y H;  1VQN A;  1XPU A;  4DR7 L;  1OTC A;  4IPD A;  3UDG A;  1YJ9 A;  2CWA A;  5BR8 Q;  4C2M H;  3J81 j;  1PH1 A;  1PH7 A;  2E5L L;  1K3R A;  1XJV A;  1GO3 E;  5C4X H;  4X6A H;  4BY1 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...