5IYCH

Human core-pic in the initial transcribing state
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
150
structure length
150
Chain Sequence
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 19
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5iycH01
3J81i 3FHWA 2JA7H 3J80i 2CCZA 1XMQL 1NTGA 4KHPQ 1HZAA 4JCVE 1N36Q 1PH2A 3F2BA 1VQCA 3EBEA 4DR5L 3GTKH 2I5MX 1X55A 2WAQE 3F2DA 1VQOA 4AIMA 3F2CA 4JI7L 4JBWA 3PV0A 4B3RQ 2ZTEA 4C3IH 2K4KA 3NBHB 4DV2L 4K0KQ 2B3GA 1N34L 4QIWE 2RHQB 4PZ8A 3UDIA 1PYBA 1T9HA 1YHBA 2VQEQ 3BU2A 2ZJQA 3H0GG 1G51A 5C4XH 4IPDA 2I0QA 2BA0A 2GVBA 3GD7A 3GTLH 1CKNB 1E1TA 5IYBG 3CMEA 1UE7A 3I4MG 3MXNB 4GLVB 1N32Q 1HNZL 4LFBL 2K75A 1TWHH 1TXYA 3EIVA 1A63A 4POGA 1JT8A 4X66L 1B8AA 2WFWA 4WJ4A 1VQ9A 4LWCA 4NB3A 3KJPA 5M3FG 4XIGS 4GOPA 3PF4A 4RG1A 3CAMA 4ALPA 1VQHA 1YHQA 1HR0Q 2ZJPA 5JEAJ 3I2ZA 4LF5L 5BR8Q 2R7ZH 4A3DG 1N34Q 3CPWA 1KQSA 4GN4B 4DV0L 4IO9A 1QVFA 4JOIC 3KYHC 2NVTH 5M3FH 3HOVG 3CP0A 3GTJH 3HOYH 1N36L 5M5YH 2LXJA 1G291 1IBKL 3M85A 2E5LL 1VQPA 2VNUD 4QY7A 3ULLA 4BY7H 3I4OA 1I50H 4A3LH 2WP8J 3HOZH 4QJFA 4NXNL 3E0EA 2RF4A 1UEBA 3D0FA 2VW9A 2VQEL 2BH8A 1XNRQ 2IX1A 1ASZA 3RZOH 1LUZA 4A3JG 1X54A 1SRUA 4OONA 2EQSA 3JAMi 1VQ8A 1HR0W 2LSSA 1Y1WG 3ZJYC 1HR0L 4LF5Q 3TS0A 4PMWA 4BA2I 4A3LG 4GKJQ 4GKJL 2LXKA 2PMZE 4DAYB 4AQYL 1EIYB 2JEBI 3GTOH 2WB1G 2F4VQ 2OQKA 2JA8H 2NN6I 2RCNA 4C3HH 5FJ8G 3A5ZB 1YJ9A 2XGTA 1X6OA 2N8NA 2K14A 4YY3L 1XPRA 4JI5Q 2NN6G 2ZTCA 5C44G 2JA8G 2YV5A 4P74A 3W5OA 4DV7Q 1KXLA 2AWOA 4JI8Q 3H3VI 4KHZA 4NXNQ 3RLOA 4DUYL 3GTPH 2KCMA 4XTCS 2CFMA 1KAWA 3NEMA 3KF6B 2IHFA 2PI2E 3CD6A 1A8VA 4BBSG 3ERSX 1OTCA 4QL5A 5C3EH 4LF6L 3I4NG 4IFDI 3BZCA 3L7ZC 4JI7Q 4BY7G 4B3SQ 4JI4L 1Q12A 4B3SL 4LFCL 4JI4Q 4JI1Q 1YIJA 2QGQA 4DV5Q 5IP7G 4BBSH 3UDGA 3I4NH 4YWKA 1V1QA 1FGUA 5IYDG 5GAGC 1VQMA 1WOCA 1I6HH 1KHIA 1XJVA 1K83H 4POFA 1VQAA 3W1GA 4B3TL 5M3MH 2OTLA 3KDFA 2WAQG 2CWPA 3AQQA 4IJLA 1R9TH 1N8RC 4JI6Q 2R7ZG 3F1ZA 4NXML 2Z6KA 1B70B 4UP8A 4DUYQ 3S1QH 5JJKA 4TVAB 5C44H 4GKKQ 1IXRA 1VQKA 4FDBA 2BH2A 5IYCH 4KHPL 4OXPA 3W1BA 5FJ8H 5FLMH 4OO1G 3HFZB 4DR5Q 3CCLA 1NY4A 1MIUA 1M1KC 2VUMH 3TQYA 2ZJRA 3KF8B 4HJ8A 4OO1I 1Z47A 2N49A 4DV2Q 1PH6A 4LW1A 4KLKA 1I5FA 1LM0A 1WYDA 4JI8L 3JC66 4AYBG 1Y1WH 2NVXH 4LF4Q 2R92G 2IY5B 3AFQA 1XNRL 1NJIC 3T1YL 4HJ5A 5JEAG 3T1YQ 4A3IG 3PF5A 3I55A 1X65A 2IT1A 4UP7A 5GROA 1C7YA 1WI5A 4HIOA 2Q2IA 1VQEA 5IWAQ 4A3MH 1HNZQ 2D62A 4DK6C 4X64L 4JI3Q 2B63H 4JI6L 1Q1BA 1K8GA 2JEAI 4UP9A 5C3EG 2F52A 2UXBL 3HOYG 2QEXA 4DR4L 3A74A 3M9BA 4YY3Q 4A3FH 3U4ZA 3HOVH 5M5XH 3S1NH 1VCIA 4DV7L 3CCRA 2NZOA 1YBYA 5C0XJ 3AEVA 1WFQA 2UXCL 4A3GG 4P73A 3HOWH 1EQQA 4IFDJ 3PUYA 3FP9A 2EXDA 3J81c 2KENA 4ME3A 3CCEA 4A3FG 3G4SA 4OX9L 1E22A 4OWTB 1VQLA 3M4PA 4PZ6A 4DV3Q 3G71A 1X3FA 3CC4A 5J3BA 1AH9A 2VL6A 4LF4L 3DM3A 3ICEA 1L1OB 1EOVA 2GN5A 4YWMA 3U4VA 2JA6H 1N33Q 3G48A 2Y0SG 4A3JH 4GOPB 3STBC 1NMGA 3BJUA 1JJ2A 1EYGA 1K8AC 2Q2TA 4LF7L 4A3BH 5IWAL 1X3EA 2V1CC 1PH1A 2OQ0A 1JMCA 4JYAL 3CCQA 4P71A 4LFCQ 4JI1L 2A8VA 2UUCL 3PO3G 2UU9Q 1TWGH 1S40A 4JBKA 4X62Q 1VQGA 4L5RC 4BBRH 2Z6KC 3CCVA 4DR1L 1KIXA 4DR4Q 5IYCG 3E9HA 3PUZA 4GN5A 2JA7G 1HH2P 4X65Q 1PH5A 1C0AA 3E9IA 3S16H 1O7IA 2OCEA 2YYZA 1MJEA 3PIPA 2VZAA 1Y1VG 4R4TA 4B3ML 3S17H 3OW2A 4BY1H 3U50C 2OTJA 1EFWA 1EUJA 3H15A 2NVYH 1IBML 4UY8C 1FJGL 2KHJA 3HOUG 1Q81C 3HOZG 1Y14B 3KOJA 2B29A 4P72A 2CWAA 4C2MH 1YITA 2B63G 1HZ9A 1VQIA 3TREA 4OWWB 4R4CA 1K0RA 5GADC 4DR2L 4DR1Q 4P75A 3JAMc 4EX5A 3DLLA 1N33L 1XPUA 4Y52H 3H0GH 4R4OA 4BA1I 1PV4A 1VQNA 1IBLQ 4LF7Q 1K73C 1IBLL 2MNAA 1BBUA 2FXQA 5HGQA 2VQFQ 4IPCA 4LFAL 4NXMQ 5GAEC 2NZHA 5LMNW 2E2IH 3G6EA 1OXSC 2BA1A 4GLAC 4TQUS 4BXXH 4DNIA 1UWVA 1JJGA 3RNUA 4WJ3M 5IE8A 4HJ9A 4X65L 4DV3L 3GTGH 3A5UA 1SROA 3STBD 4JI0L 5DLQE 4JV5L 1OXUA 1QVCA 1VQDA 4GS3A 3HOXH 1QVGA 1KC8C 1PH9A 3M3YH 1SR3A 3TEHB 1XPOA 4QGUA 1HNWL 1C9OA 2R93H 1FL0A 1SN8A 3D31A 1IBMQ 2MO0A 1Z9FA 2AKWB 2VS1A 5IP9G 5C0XI 2YTYA 1PYSB 1VQBA 5IP7H 4X64Q 4YCWA 4DR7L 4A93G 2K5HA 4DV5L 4GN3B 1GVPA 3T1HL 2UU9L 2UXBQ 5JJLA 2R7FA 1QUQB 3J80c 2UUBQ 4BXXG 3J81j 2DGYA 3GO5A 4KI0A 4DR6L 4B3TQ 4R4QA 2JA5H 4A3GH 1Q7YC 2A19A 2UXCQ 3RN2A 2YTVA 4LFAQ 1HZCA 4JV5Q 1A0IA 4JYAQ 4GKKL 1J5EQ 3PUXA 2HIVA 1HJPA 3HKZG 1GM5A 1CKOA 1V43A 2JA5G 4LF9L 1CKMA 3BZKA 3I7FA 2ALYB 1HNXL 3B6YA 4LF8L 1A62A 1FJGQ 2K5VA 2ZM6Q 1EQRA 4GNXB 1YHAA 3J7ZC 4X6AH 1IYJB 1E1OA 2CQOA 1E7ZA 2MFIA 1KL9A 2MO1A 5IT9c 1YI2A 3RR5A 3KF6A 2KHIA 3CC7A 2Q2HA 4A75A 1BVSA 1IZ6A 3T1HQ 2ES2A 2OWOA 3PIOA 2I5LX 2RHSB 2HT1A 1E3PA 4C3JH 5LMNQ 3LGJA 1YVCA 1Q1EA 3CCJA 1I94Q 2R93G 3K7AH 3ULJA 3GTQH 2PNHA 3CXCA 1YJNA 1Q8KA 4L5SA 2AWNA 4LUVA 3UE0A 1OXXK 4IFDG 4HJAA 1PFSA 2N78A 2JK8A 4MNOA 4YWLA 1HZBA 1JE5A 2D0PA 4X62L 1XNQL 5FLMG 3UDFA 4IOCA 2UUBL 4LF8Q 3S15H 1GO3E 3KDFB 3S24A 1V9PA 4BBRG 4HIDA 2ZM6L 3PO2G 4DR6Q 2XTIA 1S72A 3Q8DA 4O0AA 1L1OC 4APVA 5JJIA 2JQOA 1B7YB 4GOPC 4B3MQ 4JI2Q 1XTDA 4A3DH 2R7DA 3M4OH 4R1JA 4A3BG 1I3QH 1YEZA 5E7NA 2JE6I 1Q86C 4H02A 1HNWQ 4HJ7A 1KD1C 3S14H 4IPHA 1VQ7A 4OX9Q 1MJCA 3HKSA 4JC0A 3CF5A 4LNQA 1H95A 1VQ5A 4JOIA 1KRTA 4JI0Q 1PH3A 3KLWA 3OTOL 3OTOQ 1PA6A 3PGZA 3TS2A 5C0XG 4DR2Q 2E2JH 2E8GA 3PUWA 4PG3A 3OYYA 3CCSA 1XMOL 1CSQA 4MTNA 1K3RA 4YHHQ 3RLFA 2VQFL 1YZ6A 1RL2A 4R4IA 3NELA 1M90C 5GQOA 1SE8A 2UUCQ 1U5KA 4JG2A 3K80C 4J15A 3VDYA 1U0LA 4NPSA 2JA9A 2K50A 2KBNA 1XMQQ 5LMUQ 1L1OA 4DR3L 1EWIA 3PO3H 3FKIG 1VQ4A 2ASBA 2L15A 4A93H 1OXTA 1KRSA 1CKNA 1P16A 4UPAA 3UE1A 2A1AA 1S3OA 2K52A 4DAMA 5C4JH 4DV4L 4DV4Q 4JI2L 2Y0SE 1AE3A 4HIMA 3EN2A 5M3MG 3GDEA 1LYLA 1X3GA 2UUAL 2HQLA 2UUAQ 4JBJA 5C4XG 1MKHA 1I94L 1HNXQ 1L2FA 3GTMH 3PSIA 2JA6G 3H3VH 3A0JA 1CSPA 4A3CH 1QUQA 1GD7A 5IY0A 1PH7A 1TWFH 3CW2C 3RZDH 3CMAA 3AYHB 1LTLA 3PCOB 3IRBA 2R92H 3M4QA 1N32L 3RN5A 3K8AA 3CPFA 4AQYQ 5M5WH 2HIXA 1XNQQ 2MQHA 4AYBE 1W3SA 3HKZE 5ELNA 3K7UC 3NENA 1BKBA 1PH8A 5H1SE 1UE6A 4QQBX 1JB7A 3PUVA 5LMUL 5HY6A 4JI5L 3UDXA 3J7A5 3K81C 1VQFA 1Y1VH 2IHEA 1WCMG 4IJHA 5BR8L 1NE3A 1VS0A 4YCUA 1PH4A 3ER0A 2UXDL 1P8LA 1J5EL 4A3KG 1SFOH 1FVIA 2N3SA 3L2PA 2Z0SA 4GLXA 4DR3Q 2YTXA 1NMFA 4L5QA 4OWXB 5AJ3L 5GAHC 1K9MC 3WWVA 2F3IA 1Q82C 3K0XA 2Q2UA 4B3RL 1X9NA 2E2HH 4A76A 1VQ6A 1GKHA 4LUZA 5ELOA 1EIFA 2KCTA 5IYBH 4DUZL 4A3CG 2WB1E 1QZHA 3M7NA 5IP9H 1UE1A 2ATWA 1OXVA 3CQZH 1UE5A 4A3IH 4BY1G 1TWCH 2I5HA 3HOXG 1E24A 2C35B 3CCMA 2YU9H 2D0OA 2IX0A 3KFUA 4DR7Q 3FKIH 5K36G 4IPGA 1RIPA 2VUMG 3RLNA 3AFPA 2PQAB 2PQAA 4DV0Q 3PO2H 4GNXC 1JJCB 4JBMA 3I56A 1ASYA 1L0WA 2ID0A 3U58A 2ZTDA 1XMOQ 1W2BA 4IOAA 1BBWA 1IBKQ 2E5LQ 4A3KH 4Y7NH 4YHHL 1SMXA 4EQ5A 4AH6A 1QZGA 4K0KL 1WCMH 2QA4A 2PI2A 2AMCB 3CCUA 4A3EG 1J6QA 2UXDQ 1DGSA 4DKAC 1VQJA 2H5XA 4DV6Q 4DV6L 4LF9Q 3S2DH 3F8TA 3S1MH 4RMFA 5IYDH 1Q46A 1N9WA 2EIFA 1SLJA 2AHOB 5AJ3Q 3HOWG 1NBWA 4L5TA 4LF6Q 1WJJA 3ULPA 1YNXA 4PZ7A 4DV1Q 4JI3L 4DV1L 2NVQH 1PHJA 3S1RH 2F4VL 1CUKA 1X56A 3TRZA 1D7QA 1G6PA 2GVAA 4A3MG 4HIKA 3I4MH 4DUZQ 4X66Q 3HOUH 2VY3A 3L0OA 5LMNL 1TWAH 5EAYA 3KJOA 2DUDA 3SGIA 3MEFA 1D8LA 1AE2A 3S2HH 3CC2A 2R6GA 5FLXc 2K5NA 4A4IA 4O2DA 4MZ9A 4A3EH 4DK3C 4DPGA 1PVOA 2CKZB 1IL2A 4LFBQ 1YJWA 2HHHQ 4GNXA 4LUOA 2HHHL 2JJQA 4YCVA
chains in the Genus database with same CATH superfamily
2E74C 1BDOA 3GP7A 2CCZA 1XMQL 1SYGA 4KHPQ 4FNFA 3VYTA 2L5TA 3R3OA 3F2CA 2NVQB 1JOQA 4B3RQ 1J9OA 3GV6A 2B3GA 4QIWE 1PYBA 1T9HA 4HAEA 2ZJQA 4JK1C 4KD4A 1EY7A 1G51A 5ELFA 2I0QA 1DD2A 3UI2A 1E1TA 5DEHA 3TP8A 3I4MG 1TT2A 4GLVB 4G7HC 2K05A 2K75A 4CDEC 2F0LA 4LMQD 1EYDA 1T5EA 1JT8A 2L12A 2HCIA 1VQ9A 3W3AA 3KJPA 5D65A 4EQPA 3T51B 3PF4A 1VQHA 3GTPB 2ZJPA 5JEAJ 5BN4A 5KYIA 3CPWA 1IHZA 3OMCA 4CJ0B 3R2TA 2FJ2A 5I2XA 5JJZA 4JOIC 5T1IA 4K5XA 3FDTA 3HOYH 1G291 2L1BA 2OXPA 1R4PB 3Q0AA 4IURA 3D8GA 2RF4A 3D0FA 2IX1A 2CVRA 3RZOH 1ASZA 1ET9A 3S14B 2F0TA 2Q8RE 2LS01 4RCNA 2LSSA 4FO2A 5FKAC 1XX8A 3VA5A 2LXKA 1EIYB 2WB1G 5ELBA 2OQKA 1BBXC 3G6JB 1SMYC 1CZWA 4N8FA 2CHBD 4YY3L 1I4RA 2ZTCA 2YV5A 2AWOA 2SNSA 1O7ZA 4XTCS 2PI2E 1CQFA 3L7ZC 3OOCA 4LFCL 1WCMB 4JI1Q 2QGQA 1D5MC 5CV5A 1H9SB 2PQEA 3I4NH 1AEXA 2B2WC 2JSOA 2CH4A 3I90A 1VQMA 1ILQA 5IYDG 2NVTB 1K83H 3KDFA 4CHTB 2WAQG 3AQQA 1R9TH 4HEDA 4JI6Q 2R7ZG 2F0OA 2Z6KA 4DUYQ 5JJKA 1HPCA 1IXRA 4A3FB 3HFZB 4I7ZC 4DR5Q 2SNMA 2XNAC 1X32A 1Z47A 4DV2Q 4KLKA 1I5FA 4RKLA 4AYBG 2C9OA 1NJIC 3T1YL 4C2MB 1YNJC 4RFBA 4L8JA 2R61A 3PF5A 2F0SA 1C7YA 1HFNA 1WI5A 1DYQA 4K8JA 4ZUJA 2B8GA 4FF3A 1CT1D 3CD6A 1B3AA 1VQEA 3FPPA 1PFBA 3E5SA 1ENAA 4A3BB 3C46A 5C3EG 2F52A 5A35A 2UXBL 4N9TA 3KBGA 1SNPA 2WKCA 5IGCA 1MHWC 2JA7B 5CBAE 1A2UA 3CCRA 1TY2A 3OWFA 1LTSD 4A3GG 4P73A 3K5MA 1EQQA 5FLXL 2IL8A 1CA5A 4DV3Q 4TRDA 4CDCC 1Z6HA 3CC4A 3Q23A 1ILPA 3HEJA 3QJYA 4LF4L 3DM3A 4YWMA 3GV3A 4RCOA 2JA6H 1S5BD 2ZXPA 2PZTA 4GOPB 1LTGD 1PTOC 3BJUA 1X3EA 1IL8A 4JYAL 4P71A 4LFCQ 4RAUC 3KLSX 1BCPB 1X3QA 3CCVA 2Z8LA 1KIXA 1BCPC 1ENFA 1T5XD 3D3RA 3E9IA 3S16H 2MP1A 5KYLA 2AQ1B 1O7IA 2IJ0A 2J4XA 2VZAA 3HS0C 4R4TA 4BBRB 4QMGA 4DNRB 5D3IB 1EUJA 2NVYH 1FJGL 1ICWA 4QUFA 1Q81C 3KOJA 2B29A 4P72A 4L63B 4A3DB 3MFGA 4KY7A 2A68D 1K0RA 4DR1Q 3OWEB 1RKNA 4PMBA 1N33L 3H0GH 4R4OA 1GUWA 1PV4A 1HUMA 1XXGA 2PMZB 4LF7Q 1FNVA 3G7LA 1SE4A 1QJOA 5C3WA 4LFAL 5GAEC 1SEBD 1ZYRC 2NZHA 2E2IH 2HCCA 1E2WA 1OXSC 4GLAC 4TQUS 4BXXH 4ZKCB 4ZKBB 3STBD 4JV5L 1QVCA 1Q90A 2RSOA 2KHSA 1BR9A 3GTMB 2E75C 1XPOA 2K03A 1K0SA 2VS1A 2AKWB 1F9PA 5IP9G 1VQBA 5E1FA 5IP7H 1LV9A 3RMHA 1QB5D 4C3IG 1PYWD 3MVVA 4GN3B 3A7LA 2UU9L 2JA8B 3J80c 2UUBQ 4BXXG 4KI0A 4DR6L 3QR8A 3IAYA 5KNBA 5J1ZA 1C48A 4LFAQ 1HZCA 4JYAQ 1A0IA 4KKSA 1GM5A 1LT5D 3HKZG 1V43A 3I7FA 5EKKA 1O7YA 3A7AB 2H1EA 3B6YA 2K5VA 2ZM6Q 3C2PA 5EKLA 2F0MA 2B2WA 3I72A 2MO1A 1E7ZA 2MFIA 3T56B 1YI2A 1M4VA 3CC7A 2I5LX 5C4ZA 2P5ZX 2A6EC 1HQRD 1K83B 1EEID 3NTIA 2A6HC 4ABNA 1YJNA 2FFKB 4YWLA 1HZBA 2RDHA 4BY1B 4IOCA 3TZDA 3J81E 3M3YB 1O80A 1V9PA 2PW7A 4BBRG 4HIDA 2ZM6L 4DR6Q 3PIO3 3SK8A 3Q8DA 3V2TA 3K5NA 4F87A 2ZXOA 1XTDA 4J8QA 4H02A 1HNWQ 4KHVA 1VQ7A 3CF5A 1YNJD 5IGBA 2EYPA 4Z9CB 1KRTA 3GTQB 4JI0Q 3M4OB 1QE6A 3FRPB 4DR2Q 2E2JH 3K58A 3NP8A 3TMEA 1K3RA 1LTTD 4GZYC 2VQFL 3U9SA 2EYHA 2TSSA 1DOKA 1SE8A 3VDYA 1U0LA 1BCPD 4ODGA 2Z1CA 2JA9A 1SSOA 3R8BA 2B2TC 2PYKA 3S2DB 5FOBB 3QIAA 1XYIA 3J80E 1STBA 2XWBB 1P16A 1EY0A 4DAMA 4JI2L 1IYUA 4DV4L 1ONLA 4FF2A 2Y0SE 3H6MA 1AE3A 4HIMA 2UUAQ 3URYA 1L2FA 3GTMH 1PRTB 3H3VH 5IY0A 1JICA 3RZDH 1LTLA 1N32L 3I73A 3K8AA 1SNDA 3CPFA 4AQYQ 1X3PA 4HCSA 4IALA 2F0HA 1VDZA 2GA4B 1UEAB 2WINB 2R92B 2NVYB 5HY6A 2A5HA 4DF7A 4WJWA 1VQFA 1BCPF 1Y1VH 1ESFA 1B53A 1WCMG 2CW0C 4YCUA 4WFN3 3NXWA 2DNEA 1P8LA 1FVIA 3HOYB 1PDQA 2Y0SB 3TSSA 1NMFA 4OWXB 5AJ3L 2QDLA 1PRTC 5GAHC 3I91A 3WWVA 1K9MC 2PW5A 1Q3LA 1BOSA 3GTOB 2E2HH 3KBXA 1GKHA 1GXDC 2K1BA 4A93B 4A3CG 1UUPA 2WB1E 1QZHA 3VR5A 1UE1A 3AB9A 1S5CD 1KNEA 4BY1G 2I5HA 1E24A 3CCMA 2D0OA 2KVMA 4Q5VA 5K36G 1RIPA 3OMGA 4DV0Q 2PQAA 4GNXC 1BO0A 5M5WB 4JBMA 1I6VC 1QNKA 4B9XA 1IBKQ 4Y7NH 1U4PA 5FO9B 4EQ5A 4AH6A 1AN8A 4HTHA 2PI2A 3D6WA 3CCUA 4DKAC 1VQJA 4MHEA 4DV6Q 5I2YA 4FXDA 3S1MH 2Q8TA 2EIFA 3BZDB 1RCVD 3A54A 5AJ3Q 5AFWA 1I50B 1NBWA 1WJJA 1JOOA 4PZ7A 4JI3L 4DV1L 1D7QA 1NSNS 2GVAA 3L0OA 5T1GA 4EGVA 4NKLA 3HOUB 3C1EA 2SDFA 1R9TB 4R8IA 2PO4A 2R6GA 1I4XA 1ZYRD 4EQNA 4DK3C 3SK6A 2CKZB 4FF1A 2HHHL 1TU2B 1DONA 2JJQA 1MD2D 4YCVA 3DXJC 4LAAA 2L0CA 3FHWA 1WD1A 1BXTA 3J80i 1NTGA 2B2YC 1N36Q 3F2BA 1X55A 4A3GB 5J39A 4JBWA 2ZTEA 4C3IH 2K4KA 3NBHB 3CHBD 4DA2A 5JVH3 1N34L 3T13A 1YHBA 2F0IA 3BU2A 3H0GG 4PMCA 1RTOA 4IPDA 2VXWA 1HNZL 3H91A 4IQZA 4OL7A 3HG9A 3S17B 4J6HA 5IODA 2WFWA 4WJ4A 4NB3A 2OEOA 5M3FG 1HHVA 1G2SA 5G3LD 3GQBA 3DHQA 4RG1A 1YHQA 1W6KA 4A3DG 3I2ZA 5BR8Q 3C3LA 1N34Q 1KQSA 1QVFA 2KEEA 4UDUC 2NVTH 1LO5D 5M3FH 3HOVG 2EY2A 3CP0A 3GTJH 3R93A 1MGSA 1IBKL 2VNUD 2F0VA 3K0YA 4QY7A 1KLUD 4ULLA 1EY6A 1I50H 1UEBA 2VQEL 1XNRQ 1EY8A 1LUZA 4A3JG 1X54A 4N9PA 1NAPA 1HR0L 4PMWA 4UHVA 5M5XB 4GKJQ 2PMZE 4DAYB 4AQYL 3GTOH 1SJED 1U9RA 4C3HH 5BN5A 3A5ZB 1YJ9A 2XGTA 4JI5Q 2N8NA 2NUCA 4RGTA 4FF4A 5C44G 2JA8G 5LHY1 3W5OA 1K28A 1SXTA 1KXLA 2I07B 4KHZA 4NXNQ 4DUYL 2R7ZB 4KY6A 1E2ZA 2CFMA 4HMIA 3NEMA 4OEMB 3M4YA 4ZRZA 1A8VA 4DK1A 4QL5A 3DEPA 4CKCA 4B3SQ 4JI4Q 1LABA 1YIJA 3HOXB 5IP7G 1IYVA 4CDDC 5GAGC 4RWSC 1WOCA 1XJVA 2HUGA 4POFA 1VQAA 4B3TL 2O5JC 5M3MH 1ENCA 1EQTA 4X3TA 4F88A 1N8RC 1B70B 4UP8A 1EU4A 5EBDA 1SYCA 3CCLA 1M1KC 2VUMH 2ZJRA 4HJ8A 4OO1I 5A2QL 2N49A 4XYOA 4OGQC 4AYBB 1CFMA 1PH6A 2NVXH 1RJTA 4HJ5A 1PLFA 3I55A 1X65A 2IT1A 5GROA 1JWUD 5IWAQ 4A3MH 2D62A 2QW7A 3BVMA 4JI3Q 1MBYA 1Q1BA 3KUPA 5KRUA 4DR4L 1DOMA 3M9BA 1STNA 3QG1A 3U4ZA 1V1PA 4DV7L 2CW0D 2NZOA 1YBYA 5C0XJ 3AEVA 1WFQA 4B08A 4H7BA 4IFDJ 3PUYA 1H9KA 1YNND 2BE5D 1STGA 3OW7A 2HD3A 3G4SA 4IUTA 3BVGA 2RDGA 3M4PA 4PZ6A 5EJWA 4A3JB 4IFDH 1X3FA 4CGYB 3IKJA 1B44D 1D2BA 2IW3A 3ICEA 1SNOA 1L1OB 3X3NA 3EVQA 4F8MA 3G48A 3MWYW 4C3JG 1EYGA 2Q2TA 1RD9D 2V1CC 3ERQA 1PH1A 2OQ0A 2N88A 2B2YA 2LY7A 1UAPA 3AMUA 3K5LA 1TWGH 1S40A 3OIQA 2R93B 4L5RC 1LTRD 2M00A 2BDOA 4DR1L 4DR4Q 5IYCG 4NP5A 1AW7A 1XWEA 3BDCA 1MJEA 3PIPA 3S17H 3OW2A 4BY1H 1SE2A 3PO2B 1EFWA 1IBML 2KHJA 1UNSA 3E3XA 1JE4A 1H9MA 3X3MA 5HURA 4P75A 3DLLA 1VQNA 1IBLQ 2A69D 3LNNA 1XTCD 1HCZA 1D1IA 1EQVA 5LMNW 2DY7A 3RNUA 4WJ3M 5IE8A 3A5UA 4TSSA 4JI0L 1QCBD 1D5XC 1VQDA 2PCFB 2QILA 4GS3A 1QVGA 1KC8C 3M3YH 1SR3A 3TEHB 4QGUA 1HNWL 1C9OA 4IZ8A 2R93H 3FVQA 3D31A 2VB2X 1IBMQ 2MUYA 5C0XI 4Y7NB 4ZK9B 2YTYA 5DM73 4C3IB 4RGMA 1WTQA 1JR0D 4KN4C 5KGUA 3S15B 1GHJA 3QO2A 5C5MA 4UAIA 1MI2A 4KKUA 3J81j 4B3TQ 1FNUA 1I3QB 3OPOA 3RN2A 3WOFA 1J5EQ 3PUXA 2HIVA 1HJPA 1Y1WB 2JA5G 4LF9L 2RKSA 3BZKA 1HNXL 2B2VC 4QIWB 2EYLA 4X6AH 1HRJA 4BS9A 1IYJB 3U9OA 1RHPA 2B2TA 1SYBA 1BVSA 1IZ6A 3PIOA 2RHSB 2X6LA 3CCJA 1O78A 3ULJA 1RDPD 3H0GB 4L5SA 1VMPA 5FLXE 1CHPD 1OXXK 2QKIC 4BBSB 1TIID 4IFDG 4HJAA 2N78A 2JK8A 1FR3A 1LT4D 2UUBL 3ZYYX 4LF8Q 5ISRA 3PO2G 5CV4A 4APVA 1ZKOA 5JJIA 1B7YB 4GOPC 2Z6BA 4B3MQ 5HGTA 1YEZA 3VA7A 2JE6I 4HJ7A 4IPHA 2JA6B 1MJCA 2IPKD 3NWSA 1PRTF 1JOKA 4JC0A 4JPBW 4KV6A 3KLWA 4DU9A 3OTOQ 4LK1C 5I9OA 5C0XG 1EYCA 1L0XB 1LACA 1I4QA 2ICIA 3PUWA 2EJGC 3HOWB 4PG3A 3OYYA 5I9PA 1CSQA 2ENBA 1ZXTA 1EYAA 4MTNA 4V190 1RL2A 4R4IA 1M90C 1JWSD 2WV6D 1U5KA 5CGKA 4LJZC 1JQYD 1TWAB 4NPSA 2EJFC 1XMQQ 4A3IB 5LMUQ 1L1OA 2F3WA 3PO3H 1S4ZA 4L6TB 2ASBA 4HMJA 2A1AA 1S3OA 2H4OA 3EN2A 5M3MG 1X3GA 2HQLA 1PMRA 1V1PB 4ZYSA 1I94L 1HNXQ 5M5YB 4MIUA 3PSIA 5A2QE 1I4PA 1GUOA 5E3FA 4K2KA 1TWFH 3FMCA 3CMAA 3M4QA 1PTOH 4DFAA 2HIXA 2MQHA 5ELNA 3CQZB 3NENA 1BKBA 3EJIA 4QQBX 3D6CA 5LMUL 2XVSA 3UDXA 3J7A5 3K81C 2I46A 1A3UA 1CHQD 2R3ZA 3I8ZA 1NE3A 1VS0A 4CDFC 3CKIB 3SXHA 5C4JB 2A6ED 4DR3Q 2F0DA 4KN7C 3FPUB 1STAA 1EOTA 2F3IA 3K0XA 1FD7D 4B3RL 2X6GA 5L37A 4A76A 1SJHD 4C56C 1EIFA 5IYBH 3DUZA 1TS3A 4OHJA 1UE5A 4A3IH 1TWCH 5EQ0A 1PTOB 3HOXG 2XWJB 1PZKD 4DGZA 3DM1A 5EKIA 4KMUC 3I4NB 2F0GA 1G6ZA 1JC7A 5J22A 2VUMG 2EY5A 5EBCA 1JJCB 1PZJD 3Q24A 1F77A 1L0WA 2ID0A 1WTWA 2XN9C 3MTSA 3KF8A 1AZQA 4U673 2E5LQ 4RGOS 3D4DA 4K0KL 2AMCB 5CMDA 1K8OA 2H5XA 4LF9Q 4DV6L 3NSWA 5IYDH 1Q46A 3NQTA 1SLJA 1STHA 2AHOB 4ZQ3A 3HOWG 3NK9A 5C4XB 3ULPA 1C4QA 2F4VL 3DEOA 4ILWA 3TRZA 1G6PA 4N8X1 2EDGA 3HOUH 2B2UC 2L9HA 2FMMA 3SGIA 3PMFA 4C3HB 3D4WA 4RHRA 5FLXc 4O2DA 1PVOA 1PZID 1YJWA 3J81i 4JCVE 4KJNA 5M3MB 1VQCA 3EBEA 2JP1A 2I5MX 2WAQE 3F2DA 4AIMA 4XQJA 4O1NA 4K0KQ 2WKDA 2RHQB 4PZ8A 5DM63 3S1RB 2K5DA 5C4XH 3K57A 3GD7A 3GTLH 1CKNB 3TP6A 3CMEA 1UE7A 1TXYA 3EIVA 1VMCA 2QDBA 1A63A 4POGA 4XT1B 1B8AA 2FMCA 2X69A 5IOCA 4XQNA 4HR7B 4XIGS 4GOPA 3J7YW 4HCEA 4ALPA 2AQ2B 2MHVA 1HR0Q 4LF5L 5IGEA 2R7ZH 2J0TD 2NZ1D 5FO8B 4GN4B 2QF7A 1EEFD 1GOZA 3LX0A 2K32A 3NUCA 1N36L 3GTGB 2LXJA 3ITPA 1V8QA 2E5LL 1TS2A 1KABA 1VQPA 1Y1VB 1PXUA 4BY7H 3I4OA 4RH6A 4A3LH 2WP8J 4NXNL 2JYOA 3KLSA 5CV8A 3QOLA 1SNQA 1SRUA 5CV9A 1JORA 2JN4A 1Y1WG 2JA5B 4K5WA 4LF5Q 3TS0A 4A3LG 4GKJL 2JEBI 2F4VQ 1EWCA 1ET6A 1EU3A 2NN6I 3BYTB 3AU7A 4I65A 1E0BA 1GUNA 1X6OA 1XPRA 2K14A 2NN6G 2XSCA 4K8IA 4P74A 4JI8Q 2PNRC 3RUZA 3H3VI 3RLOA 2EYOA 2JXMB 3K5OA 3K6OA 1F9SA 1KAWA 4BWGB 3KF6B 2IHFA 2EYMA 4KJOA 4BBSG 3ERSX 3I4NG 4LF6L 4IFDI 3BZCA 4OIKA 4JI7Q 4WORA 4BY7G 1PTOF 3FKIB 5I4DA 3HOZB 1I6HH 1KHIA 5CBEE 5JEAH 3MXNA 4IJLA 2CWPA 3F1ZA 2NBFA 2K01A 4NXML 5C44H 2E2JB 5EGTA 4FDBA 3OSOA 4KHPL 4OXPA 5C6AA 5FJ8H 3K7AB 5FLMH 5NUCA 3ND8A 1MIUA 2V4DA 5E4XA 3BS1A 3DWQA 1LM0A 1M8AA 1WYDA 3JC66 5FO7B 2R92G 2IY5B 3AFQA 1LT3D 4IUPA 5JVG3 2NYZD 3T1YQ 3WOEA 5IGDA 1KNAA 3J80L 3JAML 2Q2IA 2IWHA 4DK6C 4X64L 2B63H 1I4GA 3D4RA 2JEAI 5ELEA 4XT3B 4K14A 3A74A 4A3FH 3GTLB 3SE0A 2UXCL 3FP9A 2EXDA 2XIWA 2KENA 4A3FG 1B4OA 4OX9L 4OWTB 3G71A 1NNXA 5J3BA 1F9QA 3DWAA 3VYUA 1EOVA 1NCVA 2GN5A 2Y0SG 5G3LF 4A3JH 1NMGA 5TSSA 3ONAB 4M1UB 1JJ2A 4LF7L 2F0PA 4NW2A 1K8AC 1VF5C 5IWAL 1NUCA 2E2HB 5ELCA 2UUCL 1AP0A 3PO3G 2UU9Q 4JBKA 4X62Q 1VQGA 1QWYA 4BBRH 3N6RA 3TP5A 2G5DA 3PUZA 4GN5A 2JA7G 1HH2P 1PH5A 3IFTA 2F0QA 2D9UA 1JWMD 2YYZA 2A68C 2EYFA 3DMUA 2RA4A 3MC0B 1TVXA 5CORA 3H15A 3S16B 4FYDA 3HOZG 1Y14B 1LT6D 3NWTA 4PQXA 3P75A 1YITA 1HZ9A 3TREA 3F2UA 2B63B 3TDQA 4OWWB 1DM0B 5GADC 4Y52H 3KK7A 1HXYD 4EX5A 3JAMc 1XPUA 5JPNC 3BDOA 2MNAA 4IUVA 1BBUA 1WTHA 1H9RA 2VQFQ 4IPCA 3G6EA 1LTAD 2MPMA 5IIFA 3BDLA 4DNIA 1JJGA 1WTPA 5C4HA 4QCLA 4HJ9A 4DV3L 3A8JE 1EFID 1SROA 3MZ5A 5DLQE 2DJFC 3TN2A 3J81L 3CU7A 4RKBA 1NR2A 1F2MA 2BOSA 3MXPA 3HOXH 4S3SA 1PH9A 2MJ8A 2ZXRA 1ML0D 1FL0A 1SN8A 2NTTA 2MO0A 2ZT9C 1PYSB 1V1OA 1CTMA 4QF4A 3K59A 3MXGA 4YCWA 1H9SA 2K5HA 1Y8PB 3T1HL 1R4QB 2UXBQ 5JJLA 2KCNA 2R7FA 4EVOA 4CKEA 3J7AF 1CI3M 4A3GH 2A19A 2YTVA 1BF4A 2F3VA 1L0YB 2FINB 4LF8L 2B8FA 3R2IA 1A3VA 2A6HD 1EQRA 4GNXB 1E1OA 2CQOA 1KL9A 5IT9c 3RR5A 3T1HQ 5KNDA 4KK7A 2ES2A 2OWOA 3KLRA 5LMNQ 3LGJA 3P7JA 1Q1EA 2O4XA 3K7AH 3GTQH 1HFGA 1S5FD 1HA5A 1Q8KA 2F03A 4DAPA 3H94A 1PFSA 2D0PA 1JE5A 3VR4A 2NTSA 2NWGA 3UDFA 5FLMG 4RA8A 4DK0A 5DNFA 3T53B 2DNCA 4O0AA 1FYCA 1QG7A 1EL0A 4ID6A 4JI2Q 1Q8IA 4A3DH 2R7DA 4R1JA 1Q86C 1TWGB 1S5DD 2L55A 2VB3X 3S14H 3HKSA 4LNQA 1VQ5A 2EPBA 4U68A 2C5CA 1WD0A 1F2ZA 1B50A 1PH3A 1D1KA 3EQLC 2XRSD 3PGZA 3IL8A 3TS2A 4TKOB 2E2IB 4DXFA 2B39A 3CCSA 3HGBA 4XQQA 1D6EC 3RLFA 5EPLA 1BUVT 3NELA 2UUCQ 3TP7A 2K50A 2KBNA 5EPJA 3VR2A 3WDNA 2K6AA 1EWIA 3OHXC 3FKIG 4A93H 1KD1C 4DV4Q 2K52A 1EZ6A 1SYEA 3E0JA 4JBJA 4HSPA 1BNZA 1CSPA 1PH7A 2R92H 3AYHB 4WRDA 4NDXA 4IN3A 2B2UA 5M5WH 1XNQQ 1FGBD 4AYBE 3HKZE 3MEHA 1UE6A 3HKZB 2G9DA 3A55A 4B9WA 2VUMB 1SYDA 2BDNA 2WB1B 4IJHA 5CYUA 5BR8L 1PH4A 2UXDL 3BYYB 4O42A 4P2CB 1SFOH 3RZOB 2N3SA 4FP5D 2NN6H 1HQMC 2LFNA 5D3DA 2HDMA 1IKMA 1Q82C 1TQOA 1TS5A 1X9NA 1KTKA 1DZ1A 4KY5A 5ELOA 1VQ6A 3S1QB 4DUZL 2Z4IA 3VYSA 1Z7TA 1TWCB 3MXUA 5JPMC 1U4MA 1OO9B 3SK5A 1HTPA 3SHLA 2F0JA 2DJGC 2IX0A 3T4AC 4A3KB 3E6ZX 2KCCA 4FVMA 3RLNA 1HUNA 1B1ZA 1HA6A 2BCOA 3OIPA 3I56A 2MGSA 2ZTDA 5M3FB 1BBWA 4PV1C 4YHHL 1PFNA 4DAVA 1SMXA 1WCMH 1Y8NB 4A3EG 1DGSA 1WTXA 3S2DH 3F8TA 1MSHA 4RGNA 1N9WA 3PQIA 4JVZA 1A15A 1IW7D 2KA7A 1EY4A 4G4KA 1PHJA 4QUCA 5IGGA 1X56A 3HRZC 4KTAA 1WTOA 4A3MG 4HIKA 3I4MH 4X66Q 2VY3A 2F0WA 5LMNL 5JAVA 3KJOA 2EE1A 1D8LA 2KOLA 2K5NA 4A4IA 4MZ9A 2AUJD 1CA6A 2A69C 4LFBQ 2RVLA 4C1NI 4LUOA 4GNXA 4X3KA 2Z9HA 2YU9B 4DV0L 4IO9A 2JA7H 2PZWA 1HZAA 1PH2A 1YNNC 2BE5C 2QEJC 4DR5L 3GTKH 1SNMA 2KECA 1VQOA 4JI7L 2F0NA 2K33A 3PV0A 5JOBA 4DV2L 3UDIA 2VQEQ 5LL6S 2BA0A 2GVBA 1LTID 5IYBG 4IUNA 2G9HD 3MXNB 3I4MB 1N32Q 5COYA 4LFBL 1TWHH 3W2DA 2L11A 1A2TA 3SEBA 1JCKB 4X66L 1TWHB 2OF1A 4LWCA 3S1NB 4K6LA 2LMCB 5CR3A 5C44B 3CAMA 3PO3B 4MN3A 3KYHC 5K5PA 2LKVA 4NMZA 1D5ZC 5C3XA 5M5YH 1QILA 1WVLA 2XRQD 1TS4A 3M85A 4G7OC 3ULLA 2EZVA 3HOZH 4QJFA 2NVQH 3E0EA 2VW9A 2BH8A 2K28A 4R9WA 4IUQA 4OONA 2EQSA 5CC4A 3JAMi 4YIJA 1VQ8A 1HR0W 3ZJYC 1KAAA 4BA2I 1GHKA 1F9RA 3NTHA 3HZXA 2JA8H 2RCNA 5FJ8G 2NB0A 5D14A 3VR6A 4DV7Q 1O7LA 4X3SA 2O5IC 3BVZA 3GTPH 2KCMA 1DOLA 3HOVB 4A3MB 3Q22A 3RD4A 3I70A 2RDFA 2TMPA 1OTCA 5C3EH 2EYJA 4JI4L 1Q12A 4B3SL 1EIGA 3C1FA 4DV5Q 4CKBA 3UDGA 4C3JB 4BBSH 1TY0A 3NHHA 2Z4HA 1V1QA 4YWKA 1FGUA 4HSVA 3TZUA 5I6WA 4E6IA 3W1GA 3JAME 2OTLA 2J7ZA 3S2HB 4ZCKA 5CV7A 4H0LC 3S1QH 4TVAB 4GKKQ 1VQKA 2BH2A 1SFOB 5IYCH 2PPBC 3N52A 3W1BA 1J8IA 1TKWB 4OO1G 2EVBA 1DCZA 2EOTA 1NY4A 2F0KA 2IX3A 3P1HA 3TQYA 3KF8B 3MHBA 4LW1A 4JV5Q 3A8IE 4JI8L 1Y1WH 4LF4Q 1DJRD 1SE3A 2L4NA 1XNRL 2HQEA 5BN3A 5JEAG 1G91A 4A3IG 1GJXA 1KLGD 4UP7A 2RQXA 4V0BA 4HIOA 3V96A 1HNZQ 4JI6L 2A74C 4CJ2C 4H44C 1K8GA 1EY5A 4UP9A 3HOYG 2QEXA 1JB3A 4YY3Q 3S9WA 3LWUA 3HOVH 5M5XH 3S1NH 1VCIA 2WIIB 1EZ8A 1AFPA 1GUTA 5IT9L 3J81c 4ME3A 3CCEA 1VF7A 1RODA 2EY6A 3L3OC 1E22A 1VQLA 1RF2D 1EY9A 5C3EB 2D2CC 1AH9A 2VL6A 3U4VA 4DAYA 2SEBD 1B9NA 2RCFA 1N33Q 1A6XA 5DAUA 3STBC 3SDZA 4A3BH 4FXGC 2KUMA 1JMCA 1CM9A 1SDFA 3CCQA 4JI1L 2A8VA 3NBHA 5KEEA 2Z6KC 4DN4M 3SVMA 3E9HA 3I4LA 4X65Q 1RTNA 1C0AA 5KIXA 1BQQT 3QWNA 4C1NK 2OCEA 1SNCA 3P20A 4B3ML 1QOHA 1Y1VG 3U50C 2OTJA 2F0EA 1CK1A 2ICEC 4UY8C 2K04A 2N55A 3HOUG 1Y8OB 2OT2A 2CWAA 4C2MH 1STEA 4G57A 2B63G 1VQIA 1LTBD 2EY1A 5IT9E 1U4LA 4R4CA 4DR2L 4ZUIA 5E4WC 1QNUA 4BA1I 2Q8IB 1K73C 1IBLL 2FXQA 1SYFA 1KDAA 5HGQA 3LWEA 4NXMQ 5M9OA 2BA1A 3V05A 1EIHA 3NPPA 3S1MB 1UWVA 2WACA 4XYQA 4X65L 3GTGH 1B9MA 1PTOD 4XDXA 1OXUA 2D5DA 3BG3A 4RHSA 4BY7B 2KQ3A 2AQ3B 1Z9FA 1DXMA 5EPKA 4X64Q 1F2YA 4G7ZC 4A93G 4DR7L 4DV5L 1GVPA 4OIJA 1CQVA 1QUQB 2DGYA 3GO5A 2FHTA 4R4QA 3SK4A 2JA5H 1Q7YC 1NR4A 2UXCQ 4GKKL 1CKOA 4KKTA 4J1MA 1CKMA 2ALYB 1FJGQ 1A62A 2E2DC 3T16A 3MAQA 1E2VA 3SR1A 1YHAA 3J7ZC 1ESRA 5CV6A 4A3EB 5IGFA 2WAQB 1PRTD 4F7XA 3KF6A 2KHIA 3HOWH 2Q2HA 4A75A 3I3CA 2HT1A 1E3PA 4C3JH 3PIP3 1YVCA 1I94Q 2R93G 4CJ1B 4MTKA 2PNHA 1IKLA 4ZAIA 3CXCA 4ZLTF 1TR5A 2AWNA 4LUVA 3UE0A 5F2DA 1XNQL 4MNOA 4HN7A 4X62L 4OO1H 4CBVA 3S15H 1GO3E 3KDFB 3S24A 2AUKA 4K5VA 3GTJB 2O2LD 1U4RA 2XTIA 1S72A 1L1OC 3QB3A 2JQOA 2SOBA 3NQIA 3M4OH 4A3BG 1I3QH 1K8MA 5E7NA 3EROA 4R8NA 5LL6X 4OX9Q 3ND9A 4DXGA 1H95A 2CH4W 2M9VA 4JOIA 5C5LA 1IW7C 2KJXA 1C8CA 3OTOL 1PA6A 4OELB 3IFDA 4M8AA 4PNYA 3VR3A 2E8GA 1H9JA 4EQOA 1XMOL 4YHHQ 4ME5A 1YZ6A 3MA2B 4KD3A 5GQOA 3EA6A 4JG2A 3K80C 4J15A 1G8ZD 3GTKB 1STYA 4C3HG 4DR3L 5FK9C 5I6YA 5KNCA 5K36H 1VQ4A 2L15A 1OXTA 1KRSA 1CKNA 4UPAA 3UE1A 1KDBA 1MSGA 5C4JH 3RZDB 2F0FA 3CRLC 3GDEA 1LYLA 3O13A 1HTLD 2UUAL 1FNWA 1MKHA 3Q6SA 4I7AA 5C4XG 3EFXD 2JA6G 1I6HB 3A0JA 1W6JA 1PFMA 1QUQA 1GD7A 4A3CH 2RSNA 3CW2C 1B2TA 1CZGA 4IUUA 3PCOB 3IRBA 1Y69U 3RN5A 1EWHA 3FEWX 1W3SA 3K7UC 1SBBB 2EXZA 3A56A 5H1SE 1PH8A 1JB7A 2K5WA 3PUVA 1LLRD 3MFYA 1F2LA 1TWFB 4JI5L 5ELDA 1SMYD 2K5QA 2F1MA 1GUGA 4QB4A 2IHEA 3ER0A 3QOJA 1J5EL 4A3KG 4K2LA 1GUSA 1I4HA 3L2PA 2Z0SA 4GLXA 2DY8A 4DNTB 2KEDA 2YTXA 5C0XH 4L5QA 1AZPA 1B3QA 4FXKC 3NBIA 2Q2UA 4LUZA 2KCTA 3M7NA 4K6DA 5IP9H 2ATWA 1K3BC 1OXVA 3CQZH 4H13C 4X3UA 2QCPX 1A3TA 2C35B 2YU9H 3M7GA 1WTRA 3KFUA 4DR7Q 3FKIH 3VYRA 4IPGA 4JW0A 3AFPA 2PQAB 3PO2H 3HP3A 2A73B 2DN8A 1ASYA 2PZUA 3U58A 1XMOQ 1W2BA 3J7AV 4IOAA 2M2LA 4A3KH 2K7VA 1QZGA 2QA4A 1SAPA 3TBIB 1J6QA 2UXDQ 4XXEA 3H09A 4RMFA 2EJMA 1ZEQX 4L5TA 3NTKA 4LF6Q 1YNXA 2HDLA 4DV1Q 3S1RH 1CUKA 3H3VC 3DWPA 2F4IA 2RBMA 4DUZQ 1II3A 1TWAH 1ICFB 5EAYA 2E76C 1S5ED 2DUDA 2CQAA 2F0UA 3CRKC 3MEFA 3S2HH 1AE2A 3CC2A 4A3EH 3NE5B 4Q0FA 4DPGA 3A8KE 2B2VA 3L9AX 1IL2A 2HHHQ 2NVXB 1WTVA 1G2TA 1KDCA
chains in the Genus database with same CATH topology
3J81i 3FHWA 2JA7H 3J80i 2CCZA 1XMQL 1NTGA 4KHPQ 1HZAA 4JCVE 1N36Q 1PH2A 3F2BA 1VQCA 3EBEA 4DR5L 3GTKH 2I5MX 1X55A 2WAQE 3F2DA 1VQOA 4AIMA 3F2CA 4JI7L 4JBWA 3PV0A 4B3RQ 2ZTEA 4C3IH 2K4KA 3NBHB 4DV2L 4K0KQ 2B3GA 1N34L 4QIWE 2RHQB 4PZ8A 3UDIA 1PYBA 1T9HA 1YHBA 2VQEQ 3BU2A 2ZJQA 3H0GG 1G51A 5C4XH 4IPDA 2I0QA 2BA0A 2GVBA 3GD7A 3GTLH 1CKNB 1E1TA 5IYBG 3CMEA 1UE7A 3I4MG 3MXNB 4GLVB 1N32Q 1HNZL 4LFBL 2K75A 1TWHH 1TXYA 3EIVA 1A63A 4POGA 1JT8A 4X66L 1B8AA 2WFWA 4WJ4A 1VQ9A 4LWCA 4NB3A 3KJPA 5M3FG 4XIGS 4GOPA 3PF4A 4RG1A 3CAMA 4ALPA 1VQHA 1YHQA 1HR0Q 2ZJPA 5JEAJ 3I2ZA 4LF5L 5BR8Q 2R7ZH 4A3DG 1N34Q 3CPWA 1KQSA 4GN4B 4DV0L 4IO9A 1QVFA 4JOIC 3KYHC 2NVTH 5M3FH 3HOVG 3CP0A 3GTJH 3HOYH 1N36L 5M5YH 2LXJA 1G291 1IBKL 3M85A 2E5LL 1VQPA 2VNUD 4QY7A 3ULLA 4BY7H 3I4OA 1I50H 4A3LH 2WP8J 3HOZH 4QJFA 4NXNL 3E0EA 2RF4A 1UEBA 3D0FA 2VW9A 2VQEL 2BH8A 1XNRQ 2IX1A 1ASZA 3RZOH 1LUZA 4A3JG 1X54A 1SRUA 4OONA 2EQSA 3JAMi 1VQ8A 1HR0W 2LSSA 1Y1WG 3ZJYC 1HR0L 4LF5Q 3TS0A 4PMWA 4BA2I 4A3LG 4GKJQ 4GKJL 2LXKA 2PMZE 4DAYB 4AQYL 1EIYB 2JEBI 3GTOH 2WB1G 2F4VQ 2OQKA 2JA8H 2NN6I 2RCNA 4C3HH 5FJ8G 3A5ZB 1YJ9A 2XGTA 1X6OA 2N8NA 2K14A 4YY3L 1XPRA 4JI5Q 2NN6G 2ZTCA 5C44G 2JA8G 2YV5A 4P74A 3W5OA 4DV7Q 1KXLA 2AWOA 4JI8Q 3H3VI 4KHZA 4NXNQ 3RLOA 4DUYL 3GTPH 2KCMA 4XTCS 2CFMA 1KAWA 3NEMA 3KF6B 2IHFA 2PI2E 3CD6A 1A8VA 4BBSG 3ERSX 1OTCA 4QL5A 5C3EH 4LF6L 3I4NG 4IFDI 3BZCA 3L7ZC 4JI7Q 4BY7G 4B3SQ 4JI4L 1Q12A 4B3SL 4LFCL 4JI4Q 4JI1Q 1YIJA 2QGQA 4DV5Q 5IP7G 4BBSH 3UDGA 3I4NH 4YWKA 1V1QA 1FGUA 5IYDG 5GAGC 1VQMA 1WOCA 1I6HH 1KHIA 1XJVA 1K83H 4POFA 1VQAA 3W1GA 4B3TL 5M3MH 2OTLA 3KDFA 2WAQG 2CWPA 3AQQA 4IJLA 1R9TH 1N8RC 4JI6Q 2R7ZG 3F1ZA 4NXML 2Z6KA 1B70B 4UP8A 4DUYQ 3S1QH 5JJKA 4TVAB 5C44H 4GKKQ 1IXRA 1VQKA 4FDBA 2BH2A 5IYCH 4KHPL 4OXPA 3W1BA 5FJ8H 5FLMH 4OO1G 3HFZB 4DR5Q 3CCLA 1NY4A 1MIUA 1M1KC 2VUMH 3TQYA 2ZJRA 3KF8B 4HJ8A 4OO1I 1Z47A 2N49A 4DV2Q 1PH6A 4LW1A 4KLKA 1I5FA 1LM0A 1WYDA 4JI8L 3JC66 4AYBG 1Y1WH 2NVXH 4LF4Q 2R92G 2IY5B 3AFQA 1XNRL 1NJIC 3T1YL 4HJ5A 5JEAG 3T1YQ 4A3IG 3PF5A 3I55A 1X65A 2IT1A 4UP7A 5GROA 1C7YA 1WI5A 4HIOA 2Q2IA 1VQEA 5IWAQ 4A3MH 1HNZQ 2D62A 4DK6C 4X64L 4JI3Q 2B63H 4JI6L 1Q1BA 1K8GA 2JEAI 4UP9A 5C3EG 2F52A 2UXBL 3HOYG 2QEXA 4DR4L 3A74A 3M9BA 4YY3Q 4A3FH 3U4ZA 3HOVH 5M5XH 3S1NH 1VCIA 4DV7L 3CCRA 2NZOA 1YBYA 5C0XJ 3AEVA 1WFQA 2UXCL 4A3GG 4P73A 3HOWH 1EQQA 4IFDJ 3PUYA 3FP9A 2EXDA 3J81c 2KENA 4ME3A 3CCEA 4A3FG 3G4SA 4OX9L 1E22A 4OWTB 1VQLA 3M4PA 4PZ6A 4DV3Q 3G71A 1X3FA 3CC4A 5J3BA 1AH9A 2VL6A 4LF4L 3DM3A 3ICEA 1L1OB 1EOVA 2GN5A 4YWMA 3U4VA 2JA6H 1N33Q 3G48A 2Y0SG 4A3JH 4GOPB 3STBC 1NMGA 3BJUA 1JJ2A 1EYGA 1K8AC 2Q2TA 4LF7L 4A3BH 5IWAL 1X3EA 2V1CC 1PH1A 2OQ0A 1JMCA 4JYAL 3CCQA 4P71A 4LFCQ 4JI1L 2A8VA 2UUCL 3PO3G 2UU9Q 1TWGH 1S40A 4JBKA 4X62Q 1VQGA 4L5RC 4BBRH 2Z6KC 3CCVA 4DR1L 1KIXA 4DR4Q 5IYCG 3E9HA 3PUZA 4GN5A 2JA7G 1HH2P 4X65Q 1PH5A 1C0AA 3E9IA 3S16H 1O7IA 2OCEA 2YYZA 1MJEA 3PIPA 2VZAA 1Y1VG 4R4TA 4B3ML 3S17H 3OW2A 4BY1H 3U50C 2OTJA 1EFWA 1EUJA 3H15A 2NVYH 1IBML 4UY8C 1FJGL 2KHJA 3HOUG 1Q81C 3HOZG 1Y14B 3KOJA 2B29A 4P72A 2CWAA 4C2MH 1YITA 2B63G 1HZ9A 1VQIA 3TREA 4OWWB 4R4CA 1K0RA 5GADC 4DR2L 4DR1Q 4P75A 3JAMc 4EX5A 3DLLA 1N33L 1XPUA 4Y52H 3H0GH 4R4OA 4BA1I 1PV4A 1VQNA 1IBLQ 4LF7Q 1K73C 1IBLL 2MNAA 1BBUA 2FXQA 5HGQA 2VQFQ 4IPCA 4LFAL 4NXMQ 5GAEC 2NZHA 5LMNW 2E2IH 3G6EA 1OXSC 2BA1A 4GLAC 4TQUS 4BXXH 4DNIA 1UWVA 1JJGA 3RNUA 4WJ3M 5IE8A 4HJ9A 4X65L 4DV3L 3GTGH 3A5UA 1SROA 3STBD 4JI0L 5DLQE 4JV5L 1OXUA 1QVCA 1VQDA 4GS3A 3HOXH 1QVGA 1KC8C 1PH9A 3M3YH 1SR3A 3TEHB 1XPOA 4QGUA 1HNWL 1C9OA 2R93H 1FL0A 1SN8A 3D31A 1IBMQ 2MO0A 1Z9FA 2AKWB 2VS1A 5IP9G 5C0XI 2YTYA 1PYSB 1VQBA 5IP7H 4X64Q 4YCWA 4DR7L 4A93G 2K5HA 4DV5L 4GN3B 1GVPA 3T1HL 2UU9L 2UXBQ 5JJLA 2R7FA 1QUQB 3J80c 2UUBQ 4BXXG 3J81j 2DGYA 3GO5A 4KI0A 4DR6L 4B3TQ 4R4QA 2JA5H 4A3GH 1Q7YC 2A19A 2UXCQ 3RN2A 2YTVA 4LFAQ 1HZCA 4JV5Q 1A0IA 4JYAQ 4GKKL 1J5EQ 3PUXA 2HIVA 1HJPA 3HKZG 1GM5A 1CKOA 1V43A 2JA5G 4LF9L 1CKMA 3BZKA 3I7FA 2ALYB 1HNXL 3B6YA 4LF8L 1A62A 1FJGQ 2K5VA 2ZM6Q 1EQRA 4GNXB 1YHAA 3J7ZC 4X6AH 1IYJB 1E1OA 2CQOA 1E7ZA 2MFIA 1KL9A 2MO1A 5IT9c 1YI2A 3RR5A 3KF6A 2KHIA 3CC7A 2Q2HA 4A75A 1BVSA 1IZ6A 3T1HQ 2ES2A 2OWOA 3PIOA 2I5LX 2RHSB 2HT1A 1E3PA 4C3JH 5LMNQ 3LGJA 1YVCA 1Q1EA 3CCJA 1I94Q 2R93G 3K7AH 3ULJA 3GTQH 2PNHA 3CXCA 1YJNA 1Q8KA 4L5SA 2AWNA 4LUVA 3UE0A 1OXXK 4IFDG 4HJAA 1PFSA 2N78A 2JK8A 4MNOA 4YWLA 1HZBA 1JE5A 2D0PA 4X62L 1XNQL 5FLMG 3UDFA 4IOCA 2UUBL 4LF8Q 3S15H 1GO3E 3KDFB 3S24A 1V9PA 4BBRG 4HIDA 2ZM6L 3PO2G 4DR6Q 2XTIA 1S72A 3Q8DA 4O0AA 1L1OC 4APVA 5JJIA 2JQOA 1B7YB 4GOPC 4B3MQ 4JI2Q 1XTDA 4A3DH 2R7DA 3M4OH 4R1JA 4A3BG 1I3QH 1YEZA 5E7NA 2JE6I 1Q86C 4H02A 1HNWQ 4HJ7A 1KD1C 3S14H 4IPHA 1VQ7A 4OX9Q 1MJCA 3HKSA 4JC0A 3CF5A 4LNQA 1H95A 1VQ5A 4JOIA 1KRTA 4JI0Q 1PH3A 3KLWA 3OTOL 3OTOQ 1PA6A 3PGZA 3TS2A 5C0XG 4DR2Q 2E2JH 2E8GA 3PUWA 4PG3A 3OYYA 3CCSA 1XMOL 1CSQA 4MTNA 1K3RA 4YHHQ 3RLFA 2VQFL 1YZ6A 1RL2A 4R4IA 3NELA 1M90C 5GQOA 1SE8A 2UUCQ 1U5KA 4JG2A 3K80C 4J15A 3VDYA 1U0LA 4NPSA 2JA9A 2K50A 2KBNA 1XMQQ 5LMUQ 1L1OA 4DR3L 1EWIA 3PO3H 3FKIG 1VQ4A 2ASBA 2L15A 4A93H 1OXTA 1KRSA 1CKNA 1P16A 4UPAA 3UE1A 2A1AA 1S3OA 2K52A 4DAMA 5C4JH 4DV4L 4DV4Q 4JI2L 2Y0SE 1AE3A 4HIMA 3EN2A 5M3MG 3GDEA 1LYLA 1X3GA 2UUAL 2HQLA 2UUAQ 4JBJA 5C4XG 1MKHA 1I94L 1HNXQ 1L2FA 3GTMH 3PSIA 2JA6G 3H3VH 3A0JA 1CSPA 4A3CH 1QUQA 1GD7A 5IY0A 1PH7A 1TWFH 3CW2C 3RZDH 3CMAA 3AYHB 1LTLA 3PCOB 3IRBA 2R92H 3M4QA 1N32L 3RN5A 3K8AA 3CPFA 4AQYQ 5M5WH 2HIXA 1XNQQ 2MQHA 4AYBE 1W3SA 3HKZE 5ELNA 3K7UC 3NENA 1BKBA 1PH8A 5H1SE 1UE6A 4QQBX 1JB7A 3PUVA 5LMUL 5HY6A 4JI5L 3UDXA 3J7A5 3K81C 1VQFA 1Y1VH 2IHEA 1WCMG 4IJHA 5BR8L 1NE3A 1VS0A 4YCUA 1PH4A 3ER0A 2UXDL 1P8LA 1J5EL 4A3KG 1SFOH 1FVIA 2N3SA 3L2PA 2Z0SA 4GLXA 4DR3Q 2YTXA 1NMFA 4L5QA 4OWXB 5AJ3L 5GAHC 1K9MC 3WWVA 2F3IA 1Q82C 3K0XA 2Q2UA 4B3RL 1X9NA 2E2HH 4A76A 1VQ6A 1GKHA 4LUZA 5ELOA 1EIFA 2KCTA 5IYBH 4DUZL 4A3CG 2WB1E 1QZHA 3M7NA 5IP9H 1UE1A 2ATWA 1OXVA 3CQZH 1UE5A 4A3IH 4BY1G 1TWCH 2I5HA 3HOXG 1E24A 2C35B 3CCMA 2YU9H 2D0OA 2IX0A 3KFUA 4DR7Q 3FKIH 5K36G 4IPGA 1RIPA 2VUMG 3RLNA 3AFPA 2PQAB 2PQAA 4DV0Q 3PO2H 4GNXC 1JJCB 4JBMA 3I56A 1ASYA 1L0WA 2ID0A 3U58A 2ZTDA 1XMOQ 1W2BA 4IOAA 1BBWA 1IBKQ 2E5LQ 4A3KH 4Y7NH 4YHHL 1SMXA 4EQ5A 4AH6A 1QZGA 4K0KL 1WCMH 2QA4A 2PI2A 2AMCB 3CCUA 4A3EG 1J6QA 2UXDQ 1DGSA 4DKAC 1VQJA 2H5XA 4DV6Q 4DV6L 4LF9Q 3S2DH 3F8TA 3S1MH 4RMFA 5IYDH 1Q46A 1N9WA 2EIFA 1SLJA 2AHOB 5AJ3Q 3HOWG 1NBWA 4L5TA 4LF6Q 1WJJA 3ULPA 1YNXA 4PZ7A 4DV1Q 4JI3L 4DV1L 2NVQH 1PHJA 3S1RH 2F4VL 1CUKA 1X56A 3TRZA 1D7QA 1G6PA 2GVAA 4A3MG 4HIKA 3I4MH 4DUZQ 4X66Q 3HOUH 2VY3A 3L0OA 5LMNL 1TWAH 5EAYA 3KJOA 2DUDA 3SGIA 3MEFA 1D8LA 1AE2A 3S2HH 3CC2A 2R6GA 5FLXc 2K5NA 4A4IA 4O2DA 4MZ9A 4A3EH 4DK3C 4DPGA 1PVOA 2CKZB 1IL2A 4LFBQ 1YJWA 2HHHQ 4GNXA 4LUOA 2HHHL 2JJQA 4YCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 i;  3FHW A;  2JA7 H;  3J80 i;  2CCZ A;  1XMQ L;  1NTG A;  4KHP Q;  1HZA A;  4JCV E;  1N36 Q;  1PH2 A;  3F2B A;  1VQC A;  3EBE A;  4DR5 L;  3GTK H;  2I5M X;  1X55 A;  2WAQ E;  3F2D A;  1VQO A;  4AIM A;  3F2C A;  4JI7 L;  4JBW A;  3PV0 A;  4B3R Q;  2ZTE A;  4C3I H;  2K4K A;  3NBH B;  4DV2 L;  4K0K Q;  2B3G A;  1N34 L;  4QIW E;  2RHQ B;  4PZ8 A;  3UDI A;  1PYB A;  1T9H A;  1YHB A;  2VQE Q;  3BU2 A;  2ZJQ A;  3H0G G;  1G51 A;  5C4X H;  4IPD A;  2I0Q A;  2BA0 A;  2GVB A;  3GD7 A;  3GTL H;  1CKN B;  1E1T A;  5IYB G;  3CME A;  1UE7 A;  3I4M G;  3MXN B;  4GLV B;  1N32 Q;  1HNZ L;  4LFB L;  2K75 A;  1TWH H;  1TXY A;  3EIV A;  1A63 A;  4POG A;  1JT8 A;  4X66 L;  1B8A A;  2WFW A;  4WJ4 A;  1VQ9 A;  4LWC A;  4NB3 A;  3KJP A;  5M3F G;  4XIG S;  4GOP A;  3PF4 A;  4RG1 A;  3CAM A;  4ALP A;  1VQH A;  1YHQ A;  1HR0 Q;  2ZJP A;  5JEA J;  3I2Z A;  4LF5 L;  5BR8 Q;  2R7Z H;  4A3D G;  1N34 Q;  3CPW A;  1KQS A;  4GN4 B;  4DV0 L;  4IO9 A;  1QVF A;  4JOI C;  3KYH C;  2NVT H;  5M3F H;  3HOV G;  3CP0 A;  3GTJ H;  3HOY H;  1N36 L;  5M5Y H;  2LXJ A;  1G29 1;  1IBK L;  3M85 A;  2E5L L;  1VQP A;  2VNU D;  4QY7 A;  3ULL A;  4BY7 H;  3I4O A;  1I50 H;  4A3L H;  2WP8 J;  3HOZ H;  4QJF A;  4NXN L;  3E0E A;  2RF4 A;  1UEB A;  3D0F A;  2VW9 A;  2VQE L;  2BH8 A;  1XNR Q;  2IX1 A;  1ASZ A;  3RZO H;  1LUZ A;  4A3J G;  1X54 A;  1SRU A;  4OON A;  2EQS A;  3JAM i;  1VQ8 A;  1HR0 W;  2LSS A;  1Y1W G;  3ZJY C;  1HR0 L;  4LF5 Q;  3TS0 A;  4PMW A;  4BA2 I;  4A3L G;  4GKJ Q;  4GKJ L;  2LXK A;  2PMZ E;  4DAY B;  4AQY L;  1EIY B;  2JEB I;  3GTO H;  2WB1 G;  2F4V Q;  2OQK A;  2JA8 H;  2NN6 I;  2RCN A;  4C3H H;  5FJ8 G;  3A5Z B;  1YJ9 A;  2XGT A;  1X6O A;  2N8N A;  2K14 A;  4YY3 L;  1XPR A;  4JI5 Q;  2NN6 G;  2ZTC A;  5C44 G;  2JA8 G;  2YV5 A;  4P74 A;  3W5O A;  4DV7 Q;  1KXL A;  2AWO A;  4JI8 Q;  3H3V I;  4KHZ A;  4NXN Q;  3RLO A;  4DUY L;  3GTP H;  2KCM A;  4XTC S;  2CFM A;  1KAW A;  3NEM A;  3KF6 B;  2IHF A;  2PI2 E;  3CD6 A;  1A8V A;  4BBS G;  3ERS X;  1OTC A;  4QL5 A;  5C3E H;  4LF6 L;  3I4N G;  4IFD I;  3BZC A;  3L7Z C;  4JI7 Q;  4BY7 G;  4B3S Q;  4JI4 L;  1Q12 A;  4B3S L;  4LFC L;  4JI4 Q;  4JI1 Q;  1YIJ A;  2QGQ A;  4DV5 Q;  5IP7 G;  4BBS H;  3UDG A;  3I4N H;  4YWK A;  1V1Q A;  1FGU A;  5IYD G;  5GAG C;  1VQM A;  1WOC A;  1I6H H;  1KHI A;  1XJV A;  1K83 H;  4POF A;  1VQA A;  3W1G A;  4B3T L;  5M3M H;  2OTL A;  3KDF A;  2WAQ G;  2CWP A;  3AQQ A;  4IJL A;  1R9T H;  1N8R C;  4JI6 Q;  2R7Z G;  3F1Z A;  4NXM L;  2Z6K A;  1B70 B;  4UP8 A;  4DUY Q;  3S1Q H;  5JJK A;  4TVA B;  5C44 H;  4GKK Q;  1IXR A;  1VQK A;  4FDB A;  2BH2 A;  5IYC H;  4KHP L;  4OXP A;  3W1B A;  5FJ8 H;  5FLM H;  4OO1 G;  3HFZ B;  4DR5 Q;  3CCL A;  1NY4 A;  1MIU A;  1M1K C;  2VUM H;  3TQY A;  2ZJR A;  3KF8 B;  4HJ8 A;  4OO1 I;  1Z47 A;  2N49 A;  4DV2 Q;  1PH6 A;  4LW1 A;  4KLK A;  1I5F A;  1LM0 A;  1WYD A;  4JI8 L;  3JC6 6;  4AYB G;  1Y1W H;  2NVX H;  4LF4 Q;  2R92 G;  2IY5 B;  3AFQ A;  1XNR L;  1NJI C;  3T1Y L;  4HJ5 A;  5JEA G;  3T1Y Q;  4A3I G;  3PF5 A;  3I55 A;  1X65 A;  2IT1 A;  4UP7 A;  5GRO A;  1C7Y A;  1WI5 A;  4HIO A;  2Q2I A;  1VQE A;  5IWA Q;  4A3M H;  1HNZ Q;  2D62 A;  4DK6 C;  4X64 L;  4JI3 Q;  2B63 H;  4JI6 L;  1Q1B A;  1K8G A;  2JEA I;  4UP9 A;  5C3E G;  2F52 A;  2UXB L;  3HOY G;  2QEX A;  4DR4 L;  3A74 A;  3M9B A;  4YY3 Q;  4A3F H;  3U4Z A;  3HOV H;  5M5X H;  3S1N H;  1VCI A;  4DV7 L;  3CCR A;  2NZO A;  1YBY A;  5C0X J;  3AEV A;  1WFQ A;  2UXC L;  4A3G G;  4P73 A;  3HOW H;  1EQQ A;  4IFD J;  3PUY A;  3FP9 A;  2EXD A;  3J81 c;  2KEN A;  4ME3 A;  3CCE A;  4A3F G;  3G4S A;  4OX9 L;  1E22 A;  4OWT B;  1VQL A;  3M4P A;  4PZ6 A;  4DV3 Q;  3G71 A;  1X3F A;  3CC4 A;  5J3B A;  1AH9 A;  2VL6 A;  4LF4 L;  3DM3 A;  3ICE A;  1L1O B;  1EOV A;  2GN5 A;  4YWM A;  3U4V A;  2JA6 H;  1N33 Q;  3G48 A;  2Y0S G;  4A3J H;  4GOP B;  3STB C;  1NMG A;  3BJU A;  1JJ2 A;  1EYG A;  1K8A C;  2Q2T A;  4LF7 L;  4A3B H;  5IWA L;  1X3E A;  2V1C C;  1PH1 A;  2OQ0 A;  1JMC A;  4JYA L;  3CCQ A;  4P71 A;  4LFC Q;  4JI1 L;  2A8V A;  2UUC L;  3PO3 G;  2UU9 Q;  1TWG H;  1S40 A;  4JBK A;  4X62 Q;  1VQG A;  4L5R C;  4BBR H;  2Z6K C;  3CCV A;  4DR1 L;  1KIX A;  4DR4 Q;  5IYC G;  3E9H A;  3PUZ A;  4GN5 A;  2JA7 G;  1HH2 P;  4X65 Q;  1PH5 A;  1C0A A;  3E9I A;  3S16 H;  1O7I A;  2OCE A;  2YYZ A;  1MJE A;  3PIP A;  2VZA A;  1Y1V G;  4R4T A;  4B3M L;  3S17 H;  3OW2 A;  4BY1 H;  3U50 C;  2OTJ A;  1EFW A;  1EUJ A;  3H15 A;  2NVY H;  1IBM L;  4UY8 C;  1FJG L;  2KHJ A;  3HOU G;  1Q81 C;  3HOZ G;  1Y14 B;  3KOJ A;  2B29 A;  4P72 A;  2CWA A;  4C2M H;  1YIT A;  2B63 G;  1HZ9 A;  1VQI A;  3TRE A;  4OWW B;  4R4C A;  1K0R A;  5GAD C;  4DR2 L;  4DR1 Q;  4P75 A;  3JAM c;  4EX5 A;  3DLL A;  1N33 L;  1XPU A;  4Y52 H;  3H0G H;  4R4O A;  4BA1 I;  1PV4 A;  1VQN A;  1IBL Q;  4LF7 Q;  1K73 C;  1IBL L;  2MNA A;  1BBU A;  2FXQ A;  5HGQ A;  2VQF Q;  4IPC A;  4LFA L;  4NXM Q;  5GAE C;  2NZH A;  5LMN W;  2E2I H;  3G6E A;  1OXS C;  2BA1 A;  4GLA C;  4TQU S;  4BXX H;  4DNI A;  1UWV A;  1JJG A;  3RNU A;  4WJ3 M;  5IE8 A;  4HJ9 A;  4X65 L;  4DV3 L;  3GTG H;  3A5U A;  1SRO A;  3STB D;  4JI0 L;  5DLQ E;  4JV5 L;  1OXU A;  1QVC A;  1VQD A;  4GS3 A;  3HOX H;  1QVG A;  1KC8 C;  1PH9 A;  3M3Y H;  1SR3 A;  3TEH B;  1XPO A;  4QGU A;  1HNW L;  1C9O A;  2R93 H;  1FL0 A;  1SN8 A;  3D31 A;  1IBM Q;  2MO0 A;  1Z9F A;  2AKW B;  2VS1 A;  5IP9 G;  5C0X I;  2YTY A;  1PYS B;  1VQB A;  5IP7 H;  4X64 Q;  4YCW A;  4DR7 L;  4A93 G;  2K5H A;  4DV5 L;  4GN3 B;  1GVP A;  3T1H L;  2UU9 L;  2UXB Q;  5JJL A;  2R7F A;  1QUQ B;  3J80 c;  2UUB Q;  4BXX G;  3J81 j;  2DGY A;  3GO5 A;  4KI0 A;  4DR6 L;  4B3T Q;  4R4Q A;  2JA5 H;  4A3G H;  1Q7Y C;  2A19 A;  2UXC Q;  3RN2 A;  2YTV A;  4LFA Q;  1HZC A;  4JV5 Q;  1A0I A;  4JYA Q;  4GKK L;  1J5E Q;  3PUX A;  2HIV A;  1HJP A;  3HKZ G;  1GM5 A;  1CKO A;  1V43 A;  2JA5 G;  4LF9 L;  1CKM A;  3BZK A;  3I7F A;  2ALY B;  1HNX L;  3B6Y A;  4LF8 L;  1A62 A;  1FJG Q;  2K5V A;  2ZM6 Q;  1EQR A;  4GNX B;  1YHA A;  3J7Z C;  4X6A H;  1IYJ B;  1E1O A;  2CQO A;  1E7Z A;  2MFI A;  1KL9 A;  2MO1 A;  5IT9 c;  1YI2 A;  3RR5 A;  3KF6 A;  2KHI A;  3CC7 A;  2Q2H A;  4A75 A;  1BVS A;  1IZ6 A;  3T1H Q;  2ES2 A;  2OWO A;  3PIO A;  2I5L X;  2RHS B;  2HT1 A;  1E3P A;  4C3J H;  5LMN Q;  3LGJ A;  1YVC A;  1Q1E A;  3CCJ A;  1I94 Q;  2R93 G;  3K7A H;  3ULJ A;  3GTQ H;  2PNH A;  3CXC A;  1YJN A;  1Q8K A;  4L5S A;  2AWN A;  4LUV A;  3UE0 A;  1OXX K;  4IFD G;  4HJA A;  1PFS A;  2N78 A;  2JK8 A;  4MNO A;  4YWL A;  1HZB A;  1JE5 A;  2D0P A;  4X62 L;  1XNQ L;  5FLM G;  3UDF A;  4IOC A;  2UUB L;  4LF8 Q;  3S15 H;  1GO3 E;  3KDF B;  3S24 A;  1V9P A;  4BBR G;  4HID A;  2ZM6 L;  3PO2 G;  4DR6 Q;  2XTI A;  1S72 A;  3Q8D A;  4O0A A;  1L1O C;  4APV A;  5JJI A;  2JQO A;  1B7Y B;  4GOP C;  4B3M Q;  4JI2 Q;  1XTD A;  4A3D H;  2R7D A;  3M4O H;  4R1J A;  4A3B G;  1I3Q H;  1YEZ A;  5E7N A;  2JE6 I;  1Q86 C;  4H02 A;  1HNW Q;  4HJ7 A;  1KD1 C;  3S14 H;  4IPH A;  1VQ7 A;  4OX9 Q;  1MJC A;  3HKS A;  4JC0 A;  3CF5 A;  4LNQ A;  1H95 A;  1VQ5 A;  4JOI A;  1KRT A;  4JI0 Q;  1PH3 A;  3KLW A;  3OTO L;  3OTO Q;  1PA6 A;  3PGZ A;  3TS2 A;  5C0X G;  4DR2 Q;  2E2J H;  2E8G A;  3PUW A;  4PG3 A;  3OYY A;  3CCS A;  1XMO L;  1CSQ A;  4MTN A;  1K3R A;  4YHH Q;  3RLF A;  2VQF L;  1YZ6 A;  1RL2 A;  4R4I A;  3NEL A;  1M90 C;  5GQO A;  1SE8 A;  2UUC Q;  1U5K A;  4JG2 A;  3K80 C;  4J15 A;  3VDY A;  1U0L A;  4NPS A;  2JA9 A;  2K50 A;  2KBN A;  1XMQ Q;  5LMU Q;  1L1O A;  4DR3 L;  1EWI A;  3PO3 H;  3FKI G;  1VQ4 A;  2ASB A;  2L15 A;  4A93 H;  1OXT A;  1KRS A;  1CKN A;  1P16 A;  4UPA A;  3UE1 A;  2A1A A;  1S3O A;  2K52 A;  4DAM A;  5C4J H;  4DV4 L;  4DV4 Q;  4JI2 L;  2Y0S E;  1AE3 A;  4HIM A;  3EN2 A;  5M3M G;  3GDE A;  1LYL A;  1X3G A;  2UUA L;  2HQL A;  2UUA Q;  4JBJ A;  5C4X G;  1MKH A;  1I94 L;  1HNX Q;  1L2F A;  3GTM H;  3PSI A;  2JA6 G;  3H3V H;  3A0J A;  1CSP A;  4A3C H;  1QUQ A;  1GD7 A;  5IY0 A;  1PH7 A;  1TWF H;  3CW2 C;  3RZD H;  3CMA A;  3AYH B;  1LTL A;  3PCO B;  3IRB A;  2R92 H;  3M4Q A;  1N32 L;  3RN5 A;  3K8A A;  3CPF A;  4AQY Q;  5M5W H;  2HIX A;  1XNQ Q;  2MQH A;  4AYB E;  1W3S A;  3HKZ E;  5ELN A;  3K7U C;  3NEN A;  1BKB A;  1PH8 A;  5H1S E;  1UE6 A;  4QQB X;  1JB7 A;  3PUV A;  5LMU L;  5HY6 A;  4JI5 L;  3UDX A;  3J7A 5;  3K81 C;  1VQF A;  1Y1V H;  2IHE A;  1WCM G;  4IJH A;  5BR8 L;  1NE3 A;  1VS0 A;  4YCU A;  1PH4 A;  3ER0 A;  2UXD L;  1P8L A;  1J5E L;  4A3K G;  1SFO H;  1FVI A;  2N3S A;  3L2P A;  2Z0S A;  4GLX A;  4DR3 Q;  2YTX A;  1NMF A;  4L5Q A;  4OWX B;  5AJ3 L;  5GAH C;  1K9M C;  3WWV A;  2F3I A;  1Q82 C;  3K0X A;  2Q2U A;  4B3R L;  1X9N A;  2E2H H;  4A76 A;  1VQ6 A;  1GKH A;  4LUZ A;  5ELO A;  1EIF A;  2KCT A;  5IYB H;  4DUZ L;  4A3C G;  2WB1 E;  1QZH A;  3M7N A;  5IP9 H;  1UE1 A;  2ATW A;  1OXV A;  3CQZ H;  1UE5 A;  4A3I H;  4BY1 G;  1TWC H;  2I5H A;  3HOX G;  1E24 A;  2C35 B;  3CCM A;  2YU9 H;  2D0O A;  2IX0 A;  3KFU A;  4DR7 Q;  3FKI H;  5K36 G;  4IPG A;  1RIP A;  2VUM G;  3RLN A;  3AFP A;  2PQA B;  2PQA A;  4DV0 Q;  3PO2 H;  4GNX C;  1JJC B;  4JBM A;  3I56 A;  1ASY A;  1L0W A;  2ID0 A;  3U58 A;  2ZTD A;  1XMO Q;  1W2B A;  4IOA A;  1BBW A;  1IBK Q;  2E5L Q;  4A3K H;  4Y7N H;  4YHH L;  1SMX A;  4EQ5 A;  4AH6 A;  1QZG A;  4K0K L;  1WCM H;  2QA4 A;  2PI2 A;  2AMC B;  3CCU A;  4A3E G;  1J6Q A;  2UXD Q;  1DGS A;  4DKA C;  1VQJ A;  2H5X A;  4DV6 Q;  4DV6 L;  4LF9 Q;  3S2D H;  3F8T A;  3S1M H;  4RMF A;  5IYD H;  1Q46 A;  1N9W A;  2EIF A;  1SLJ A;  2AHO B;  5AJ3 Q;  3HOW G;  1NBW A;  4L5T A;  4LF6 Q;  1WJJ A;  3ULP A;  1YNX A;  4PZ7 A;  4DV1 Q;  4JI3 L;  4DV1 L;  2NVQ H;  1PHJ A;  3S1R H;  2F4V L;  1CUK A;  1X56 A;  3TRZ A;  1D7Q A;  1G6P A;  2GVA A;  4A3M G;  4HIK A;  3I4M H;  4DUZ Q;  4X66 Q;  3HOU H;  2VY3 A;  3L0O A;  5LMN L;  1TWA H;  5EAY A;  3KJO A;  2DUD A;  3SGI A;  3MEF A;  1D8L A;  1AE2 A;  3S2H H;  3CC2 A;  2R6G A;  5FLX c;  2K5N A;  4A4I A;  4O2D A;  4MZ9 A;  4A3E H;  4DK3 C;  4DPG A;  1PVO A;  2CKZ B;  1IL2 A;  4LFB Q;  1YJW A;  2HHH Q;  4GNX A;  4LUO A;  2HHH L;  2JJQ A;  4YCV A; 
#chains in the Genus database with same CATH topology
 2E74 C;  1BDO A;  3GP7 A;  2CCZ A;  1XMQ L;  1SYG A;  4KHP Q;  4FNF A;  3VYT A;  2L5T A;  3R3O A;  3F2C A;  2NVQ B;  1JOQ A;  4B3R Q;  1J9O A;  3GV6 A;  2B3G A;  4QIW E;  1PYB A;  1T9H A;  4HAE A;  2ZJQ A;  4JK1 C;  4KD4 A;  1EY7 A;  1G51 A;  5ELF A;  2I0Q A;  1DD2 A;  3UI2 A;  1E1T A;  5DEH A;  3TP8 A;  3I4M G;  1TT2 A;  4GLV B;  4G7H C;  2K05 A;  2K75 A;  4CDE C;  2F0L A;  4LMQ D;  1EYD A;  1T5E A;  1JT8 A;  2L12 A;  2HCI A;  1VQ9 A;  3W3A A;  3KJP A;  5D65 A;  4EQP A;  3T51 B;  3PF4 A;  1VQH A;  3GTP B;  2ZJP A;  5JEA J;  5BN4 A;  5KYI A;  3CPW A;  1IHZ A;  3OMC A;  4CJ0 B;  3R2T A;  2FJ2 A;  5I2X A;  5JJZ A;  4JOI C;  5T1I A;  4K5X A;  3FDT A;  3HOY H;  1G29 1;  2L1B A;  2OXP A;  1R4P B;  3Q0A A;  4IUR A;  3D8G A;  2RF4 A;  3D0F A;  2IX1 A;  2CVR A;  3RZO H;  1ASZ A;  1ET9 A;  3S14 B;  2F0T A;  2Q8R E;  2LS0 1;  4RCN A;  2LSS A;  4FO2 A;  5FKA C;  1XX8 A;  3VA5 A;  2LXK A;  1EIY B;  2WB1 G;  5ELB A;  2OQK A;  1BBX C;  3G6J B;  1SMY C;  1CZW A;  4N8F A;  2CHB D;  4YY3 L;  1I4R A;  2ZTC A;  2YV5 A;  2AWO A;  2SNS A;  1O7Z A;  4XTC S;  2PI2 E;  1CQF A;  3L7Z C;  3OOC A;  4LFC L;  1WCM B;  4JI1 Q;  2QGQ A;  1D5M C;  5CV5 A;  1H9S B;  2PQE A;  3I4N H;  1AEX A;  2B2W C;  2JSO A;  2CH4 A;  3I90 A;  1VQM A;  1ILQ A;  5IYD G;  2NVT B;  1K83 H;  3KDF A;  4CHT B;  2WAQ G;  3AQQ A;  1R9T H;  4HED A;  4JI6 Q;  2R7Z G;  2F0O A;  2Z6K A;  4DUY Q;  5JJK A;  1HPC A;  1IXR A;  4A3F B;  3HFZ B;  4I7Z C;  4DR5 Q;  2SNM A;  2XNA C;  1X32 A;  1Z47 A;  4DV2 Q;  4KLK A;  1I5F A;  4RKL A;  4AYB G;  2C9O A;  1NJI C;  3T1Y L;  4C2M B;  1YNJ C;  4RFB A;  4L8J A;  2R61 A;  3PF5 A;  2F0S A;  1C7Y A;  1HFN A;  1WI5 A;  1DYQ A;  4K8J A;  4ZUJ A;  2B8G A;  4FF3 A;  1CT1 D;  3CD6 A;  1B3A A;  1VQE A;  3FPP A;  1PFB A;  3E5S A;  1ENA A;  4A3B B;  3C46 A;  5C3E G;  2F52 A;  5A35 A;  2UXB L;  4N9T A;  3KBG A;  1SNP A;  2WKC A;  5IGC A;  1MHW C;  2JA7 B;  5CBA E;  1A2U A;  3CCR A;  1TY2 A;  3OWF A;  1LTS D;  4A3G G;  4P73 A;  3K5M A;  1EQQ A;  5FLX L;  2IL8 A;  1CA5 A;  4DV3 Q;  4TRD A;  4CDC C;  1Z6H A;  3CC4 A;  3Q23 A;  1ILP A;  3HEJ A;  3QJY A;  4LF4 L;  3DM3 A;  4YWM A;  3GV3 A;  4RCO A;  2JA6 H;  1S5B D;  2ZXP A;  2PZT A;  4GOP B;  1LTG D;  1PTO C;  3BJU A;  1X3E A;  1IL8 A;  4JYA L;  4P71 A;  4LFC Q;  4RAU C;  3KLS X;  1BCP B;  1X3Q A;  3CCV A;  2Z8L A;  1KIX A;  1BCP C;  1ENF A;  1T5X D;  3D3R A;  3E9I A;  3S16 H;  2MP1 A;  5KYL A;  2AQ1 B;  1O7I A;  2IJ0 A;  2J4X A;  2VZA A;  3HS0 C;  4R4T A;  4BBR B;  4QMG A;  4DNR B;  5D3I B;  1EUJ A;  2NVY H;  1FJG L;  1ICW A;  4QUF A;  1Q81 C;  3KOJ A;  2B29 A;  4P72 A;  4L63 B;  4A3D B;  3MFG A;  4KY7 A;  2A68 D;  1K0R A;  4DR1 Q;  3OWE B;  1RKN A;  4PMB A;  1N33 L;  3H0G H;  4R4O A;  1GUW A;  1PV4 A;  1HUM A;  1XXG A;  2PMZ B;  4LF7 Q;  1FNV A;  3G7L A;  1SE4 A;  1QJO A;  5C3W A;  4LFA L;  5GAE C;  1SEB D;  1ZYR C;  2NZH A;  2E2I H;  2HCC A;  1E2W A;  1OXS C;  4GLA C;  4TQU S;  4BXX H;  4ZKC B;  4ZKB B;  3STB D;  4JV5 L;  1QVC A;  1Q90 A;  2RSO A;  2KHS A;  1BR9 A;  3GTM B;  2E75 C;  1XPO A;  2K03 A;  1K0S A;  2VS1 A;  2AKW B;  1F9P A;  5IP9 G;  1VQB A;  5E1F A;  5IP7 H;  1LV9 A;  3RMH A;  1QB5 D;  4C3I G;  1PYW D;  3MVV A;  4GN3 B;  3A7L A;  2UU9 L;  2JA8 B;  3J80 c;  2UUB Q;  4BXX G;  4KI0 A;  4DR6 L;  3QR8 A;  3IAY A;  5KNB A;  5J1Z A;  1C48 A;  4LFA Q;  1HZC A;  4JYA Q;  1A0I A;  4KKS A;  1GM5 A;  1LT5 D;  3HKZ G;  1V43 A;  3I7F A;  5EKK A;  1O7Y A;  3A7A B;  2H1E A;  3B6Y A;  2K5V A;  2ZM6 Q;  3C2P A;  5EKL A;  2F0M A;  2B2W A;  3I72 A;  2MO1 A;  1E7Z A;  2MFI A;  3T56 B;  1YI2 A;  1M4V A;  3CC7 A;  2I5L X;  5C4Z A;  2P5Z X;  2A6E C;  1HQR D;  1K83 B;  1EEI D;  3NTI A;  2A6H C;  4ABN A;  1YJN A;  2FFK B;  4YWL A;  1HZB A;  2RDH A;  4BY1 B;  4IOC A;  3TZD A;  3J81 E;  3M3Y B;  1O80 A;  1V9P A;  2PW7 A;  4BBR G;  4HID A;  2ZM6 L;  4DR6 Q;  3PIO 3;  3SK8 A;  3Q8D A;  3V2T A;  3K5N A;  4F87 A;  2ZXO A;  1XTD A;  4J8Q A;  4H02 A;  1HNW Q;  4KHV A;  1VQ7 A;  3CF5 A;  1YNJ D;  5IGB A;  2EYP A;  4Z9C B;  1KRT A;  3GTQ B;  4JI0 Q;  3M4O B;  1QE6 A;  3FRP B;  4DR2 Q;  2E2J H;  3K58 A;  3NP8 A;  3TME A;  1K3R A;  1LTT D;  4GZY C;  2VQF L;  3U9S A;  2EYH A;  2TSS A;  1DOK A;  1SE8 A;  3VDY A;  1U0L A;  1BCP D;  4ODG A;  2Z1C A;  2JA9 A;  1SSO A;  3R8B A;  2B2T C;  2PYK A;  3S2D B;  5FOB B;  3QIA A;  1XYI A;  3J80 E;  1STB A;  2XWB B;  1P16 A;  1EY0 A;  4DAM A;  4JI2 L;  1IYU A;  4DV4 L;  1ONL A;  4FF2 A;  2Y0S E;  3H6M A;  1AE3 A;  4HIM A;  2UUA Q;  3URY A;  1L2F A;  3GTM H;  1PRT B;  3H3V H;  5IY0 A;  1JIC A;  3RZD H;  1LTL A;  1N32 L;  3I73 A;  3K8A A;  1SND A;  3CPF A;  4AQY Q;  1X3P A;  4HCS A;  4IAL A;  2F0H A;  1VDZ A;  2GA4 B;  1UEA B;  2WIN B;  2R92 B;  2NVY B;  5HY6 A;  2A5H A;  4DF7 A;  4WJW A;  1VQF A;  1BCP F;  1Y1V H;  1ESF A;  1B53 A;  1WCM G;  2CW0 C;  4YCU A;  4WFN 3;  3NXW A;  2DNE A;  1P8L A;  1FVI A;  3HOY B;  1PDQ A;  2Y0S B;  3TSS A;  1NMF A;  4OWX B;  5AJ3 L;  2QDL A;  1PRT C;  5GAH C;  3I91 A;  3WWV A;  1K9M C;  2PW5 A;  1Q3L A;  1BOS A;  3GTO B;  2E2H H;  3KBX A;  1GKH A;  1GXD C;  2K1B A;  4A93 B;  4A3C G;  1UUP A;  2WB1 E;  1QZH A;  3VR5 A;  1UE1 A;  3AB9 A;  1S5C D;  1KNE A;  4BY1 G;  2I5H A;  1E24 A;  3CCM A;  2D0O A;  2KVM A;  4Q5V A;  5K36 G;  1RIP A;  3OMG A;  4DV0 Q;  2PQA A;  4GNX C;  1BO0 A;  5M5W B;  4JBM A;  1I6V C;  1QNK A;  4B9X A;  1IBK Q;  4Y7N H;  1U4P A;  5FO9 B;  4EQ5 A;  4AH6 A;  1AN8 A;  4HTH A;  2PI2 A;  3D6W A;  3CCU A;  4DKA C;  1VQJ A;  4MHE A;  4DV6 Q;  5I2Y A;  4FXD A;  3S1M H;  2Q8T A;  2EIF A;  3BZD B;  1RCV D;  3A54 A;  5AJ3 Q;  5AFW A;  1I50 B;  1NBW A;  1WJJ A;  1JOO A;  4PZ7 A;  4JI3 L;  4DV1 L;  1D7Q A;  1NSN S;  2GVA A;  3L0O A;  5T1G A;  4EGV A;  4NKL A;  3HOU B;  3C1E A;  2SDF A;  1R9T B;  4R8I A;  2PO4 A;  2R6G A;  1I4X A;  1ZYR D;  4EQN A;  4DK3 C;  3SK6 A;  2CKZ B;  4FF1 A;  2HHH L;  1TU2 B;  1DON A;  2JJQ A;  1MD2 D;  4YCV A;  3DXJ C;  4LAA A;  2L0C A;  3FHW A;  1WD1 A;  1BXT A;  3J80 i;  1NTG A;  2B2Y C;  1N36 Q;  3F2B A;  1X55 A;  4A3G B;  5J39 A;  4JBW A;  2ZTE A;  4C3I H;  2K4K A;  3NBH B;  3CHB D;  4DA2 A;  5JVH 3;  1N34 L;  3T13 A;  1YHB A;  2F0I A;  3BU2 A;  3H0G G;  4PMC A;  1RTO A;  4IPD A;  2VXW A;  1HNZ L;  3H91 A;  4IQZ A;  4OL7 A;  3HG9 A;  3S17 B;  4J6H A;  5IOD A;  2WFW A;  4WJ4 A;  4NB3 A;  2OEO A;  5M3F G;  1HHV A;  1G2S A;  5G3L D;  3GQB A;  3DHQ A;  4RG1 A;  1YHQ A;  1W6K A;  4A3D G;  3I2Z A;  5BR8 Q;  3C3L A;  1N34 Q;  1KQS A;  1QVF A;  2KEE A;  4UDU C;  2NVT H;  1LO5 D;  5M3F H;  3HOV G;  2EY2 A;  3CP0 A;  3GTJ H;  3R93 A;  1MGS A;  1IBK L;  2VNU D;  2F0V A;  3K0Y A;  4QY7 A;  1KLU D;  4ULL A;  1EY6 A;  1I50 H;  1UEB A;  2VQE L;  1XNR Q;  1EY8 A;  1LUZ A;  4A3J G;  1X54 A;  4N9P A;  1NAP A;  1HR0 L;  4PMW A;  4UHV A;  5M5X B;  4GKJ Q;  2PMZ E;  4DAY B;  4AQY L;  3GTO H;  1SJE D;  1U9R A;  4C3H H;  5BN5 A;  3A5Z B;  1YJ9 A;  2XGT A;  4JI5 Q;  2N8N A;  2NUC A;  4RGT A;  4FF4 A;  5C44 G;  2JA8 G;  5LHY 1;  3W5O A;  1K28 A;  1SXT A;  1KXL A;  2I07 B;  4KHZ A;  4NXN Q;  4DUY L;  2R7Z B;  4KY6 A;  1E2Z A;  2CFM A;  4HMI A;  3NEM A;  4OEM B;  3M4Y A;  4ZRZ A;  1A8V A;  4DK1 A;  4QL5 A;  3DEP A;  4CKC A;  4B3S Q;  4JI4 Q;  1LAB A;  1YIJ A;  3HOX B;  5IP7 G;  1IYV A;  4CDD C;  5GAG C;  4RWS C;  1WOC A;  1XJV A;  2HUG A;  4POF A;  1VQA A;  4B3T L;  2O5J C;  5M3M H;  1ENC A;  1EQT A;  4X3T A;  4F88 A;  1N8R C;  1B70 B;  4UP8 A;  1EU4 A;  5EBD A;  1SYC A;  3CCL A;  1M1K C;  2VUM H;  2ZJR A;  4HJ8 A;  4OO1 I;  5A2Q L;  2N49 A;  4XYO A;  4OGQ C;  4AYB B;  1CFM A;  1PH6 A;  2NVX H;  1RJT A;  4HJ5 A;  1PLF A;  3I55 A;  1X65 A;  2IT1 A;  5GRO A;  1JWU D;  5IWA Q;  4A3M H;  2D62 A;  2QW7 A;  3BVM A;  4JI3 Q;  1MBY A;  1Q1B A;  3KUP A;  5KRU A;  4DR4 L;  1DOM A;  3M9B A;  1STN A;  3QG1 A;  3U4Z A;  1V1P A;  4DV7 L;  2CW0 D;  2NZO A;  1YBY A;  5C0X J;  3AEV A;  1WFQ A;  4B08 A;  4H7B A;  4IFD J;  3PUY A;  1H9K A;  1YNN D;  2BE5 D;  1STG A;  3OW7 A;  2HD3 A;  3G4S A;  4IUT A;  3BVG A;  2RDG A;  3M4P A;  4PZ6 A;  5EJW A;  4A3J B;  4IFD H;  1X3F A;  4CGY B;  3IKJ A;  1B44 D;  1D2B A;  2IW3 A;  3ICE A;  1SNO A;  1L1O B;  3X3N A;  3EVQ A;  4F8M A;  3G48 A;  3MWY W;  4C3J G;  1EYG A;  2Q2T A;  1RD9 D;  2V1C C;  3ERQ A;  1PH1 A;  2OQ0 A;  2N88 A;  2B2Y A;  2LY7 A;  1UAP A;  3AMU A;  3K5L A;  1TWG H;  1S40 A;  3OIQ A;  2R93 B;  4L5R C;  1LTR D;  2M00 A;  2BDO A;  4DR1 L;  4DR4 Q;  5IYC G;  4NP5 A;  1AW7 A;  1XWE A;  3BDC A;  1MJE A;  3PIP A;  3S17 H;  3OW2 A;  4BY1 H;  1SE2 A;  3PO2 B;  1EFW A;  1IBM L;  2KHJ A;  1UNS A;  3E3X A;  1JE4 A;  1H9M A;  3X3M A;  5HUR A;  4P75 A;  3DLL A;  1VQN A;  1IBL Q;  2A69 D;  3LNN A;  1XTC D;  1HCZ A;  1D1I A;  1EQV A;  5LMN W;  2DY7 A;  3RNU A;  4WJ3 M;  5IE8 A;  3A5U A;  4TSS A;  4JI0 L;  1QCB D;  1D5X C;  1VQD A;  2PCF B;  2QIL A;  4GS3 A;  1QVG A;  1KC8 C;  3M3Y H;  1SR3 A;  3TEH B;  4QGU A;  1HNW L;  1C9O A;  4IZ8 A;  2R93 H;  3FVQ A;  3D31 A;  2VB2 X;  1IBM Q;  2MUY A;  5C0X I;  4Y7N B;  4ZK9 B;  2YTY A;  5DM7 3;  4C3I B;  4RGM A;  1WTQ A;  1JR0 D;  4KN4 C;  5KGU A;  3S15 B;  1GHJ A;  3QO2 A;  5C5M A;  4UAI A;  1MI2 A;  4KKU A;  3J81 j;  4B3T Q;  1FNU A;  1I3Q B;  3OPO A;  3RN2 A;  3WOF A;  1J5E Q;  3PUX A;  2HIV A;  1HJP A;  1Y1W B;  2JA5 G;  4LF9 L;  2RKS A;  3BZK A;  1HNX L;  2B2V C;  4QIW B;  2EYL A;  4X6A H;  1HRJ A;  4BS9 A;  1IYJ B;  3U9O A;  1RHP A;  2B2T A;  1SYB A;  1BVS A;  1IZ6 A;  3PIO A;  2RHS B;  2X6L A;  3CCJ A;  1O78 A;  3ULJ A;  1RDP D;  3H0G B;  4L5S A;  1VMP A;  5FLX E;  1CHP D;  1OXX K;  2QKI C;  4BBS B;  1TII D;  4IFD G;  4HJA A;  2N78 A;  2JK8 A;  1FR3 A;  1LT4 D;  2UUB L;  3ZYY X;  4LF8 Q;  5ISR A;  3PO2 G;  5CV4 A;  4APV A;  1ZKO A;  5JJI A;  1B7Y B;  4GOP C;  2Z6B A;  4B3M Q;  5HGT A;  1YEZ A;  3VA7 A;  2JE6 I;  4HJ7 A;  4IPH A;  2JA6 B;  1MJC A;  2IPK D;  3NWS A;  1PRT F;  1JOK A;  4JC0 A;  4JPB W;  4KV6 A;  3KLW A;  4DU9 A;  3OTO Q;  4LK1 C;  5I9O A;  5C0X G;  1EYC A;  1L0X B;  1LAC A;  1I4Q A;  2ICI A;  3PUW A;  2EJG C;  3HOW B;  4PG3 A;  3OYY A;  5I9P A;  1CSQ A;  2ENB A;  1ZXT A;  1EYA A;  4MTN A;  4V19 0;  1RL2 A;  4R4I A;  1M90 C;  1JWS D;  2WV6 D;  1U5K A;  5CGK A;  4LJZ C;  1JQY D;  1TWA B;  4NPS A;  2EJF C;  1XMQ Q;  4A3I B;  5LMU Q;  1L1O A;  2F3W A;  3PO3 H;  1S4Z A;  4L6T B;  2ASB A;  4HMJ A;  2A1A A;  1S3O A;  2H4O A;  3EN2 A;  5M3M G;  1X3G A;  2HQL A;  1PMR A;  1V1P B;  4ZYS A;  1I94 L;  1HNX Q;  5M5Y B;  4MIU A;  3PSI A;  5A2Q E;  1I4P A;  1GUO A;  5E3F A;  4K2K A;  1TWF H;  3FMC A;  3CMA A;  3M4Q A;  1PTO H;  4DFA A;  2HIX A;  2MQH A;  5ELN A;  3CQZ B;  3NEN A;  1BKB A;  3EJI A;  4QQB X;  3D6C A;  5LMU L;  2XVS A;  3UDX A;  3J7A 5;  3K81 C;  2I46 A;  1A3U A;  1CHQ D;  2R3Z A;  3I8Z A;  1NE3 A;  1VS0 A;  4CDF C;  3CKI B;  3SXH A;  5C4J B;  2A6E D;  4DR3 Q;  2F0D A;  4KN7 C;  3FPU B;  1STA A;  1EOT A;  2F3I A;  3K0X A;  1FD7 D;  4B3R L;  2X6G A;  5L37 A;  4A76 A;  1SJH D;  4C56 C;  1EIF A;  5IYB H;  3DUZ A;  1TS3 A;  4OHJ A;  1UE5 A;  4A3I H;  1TWC H;  5EQ0 A;  1PTO B;  3HOX G;  2XWJ B;  1PZK D;  4DGZ A;  3DM1 A;  5EKI A;  4KMU C;  3I4N B;  2F0G A;  1G6Z A;  1JC7 A;  5J22 A;  2VUM G;  2EY5 A;  5EBC A;  1JJC B;  1PZJ D;  3Q24 A;  1F77 A;  1L0W A;  2ID0 A;  1WTW A;  2XN9 C;  3MTS A;  3KF8 A;  1AZQ A;  4U67 3;  2E5L Q;  4RGO S;  3D4D A;  4K0K L;  2AMC B;  5CMD A;  1K8O A;  2H5X A;  4LF9 Q;  4DV6 L;  3NSW A;  5IYD H;  1Q46 A;  3NQT A;  1SLJ A;  1STH A;  2AHO B;  4ZQ3 A;  3HOW G;  3NK9 A;  5C4X B;  3ULP A;  1C4Q A;  2F4V L;  3DEO A;  4ILW A;  3TRZ A;  1G6P A;  4N8X 1;  2EDG A;  3HOU H;  2B2U C;  2L9H A;  2FMM A;  3SGI A;  3PMF A;  4C3H B;  3D4W A;  4RHR A;  5FLX c;  4O2D A;  1PVO A;  1PZI D;  1YJW A;  3J81 i;  4JCV E;  4KJN A;  5M3M B;  1VQC A;  3EBE A;  2JP1 A;  2I5M X;  2WAQ E;  3F2D A;  4AIM A;  4XQJ A;  4O1N A;  4K0K Q;  2WKD A;  2RHQ B;  4PZ8 A;  5DM6 3;  3S1R B;  2K5D A;  5C4X H;  3K57 A;  3GD7 A;  3GTL H;  1CKN B;  3TP6 A;  3CME A;  1UE7 A;  1TXY A;  3EIV A;  1VMC A;  2QDB A;  1A63 A;  4POG A;  4XT1 B;  1B8A A;  2FMC A;  2X69 A;  5IOC A;  4XQN A;  4HR7 B;  4XIG S;  4GOP A;  3J7Y W;  4HCE A;  4ALP A;  2AQ2 B;  2MHV A;  1HR0 Q;  4LF5 L;  5IGE A;  2R7Z H;  2J0T D;  2NZ1 D;  5FO8 B;  4GN4 B;  2QF7 A;  1EEF D;  1GOZ A;  3LX0 A;  2K32 A;  3NUC A;  1N36 L;  3GTG B;  2LXJ A;  3ITP A;  1V8Q A;  2E5L L;  1TS2 A;  1KAB A;  1VQP A;  1Y1V B;  1PXU A;  4BY7 H;  3I4O A;  4RH6 A;  4A3L H;  2WP8 J;  4NXN L;  2JYO A;  3KLS A;  5CV8 A;  3QOL A;  1SNQ A;  1SRU A;  5CV9 A;  1JOR A;  2JN4 A;  1Y1W G;  2JA5 B;  4K5W A;  4LF5 Q;  3TS0 A;  4A3L G;  4GKJ L;  2JEB I;  2F4V Q;  1EWC A;  1ET6 A;  1EU3 A;  2NN6 I;  3BYT B;  3AU7 A;  4I65 A;  1E0B A;  1GUN A;  1X6O A;  1XPR A;  2K14 A;  2NN6 G;  2XSC A;  4K8I A;  4P74 A;  4JI8 Q;  2PNR C;  3RUZ A;  3H3V I;  3RLO A;  2EYO A;  2JXM B;  3K5O A;  3K6O A;  1F9S A;  1KAW A;  4BWG B;  3KF6 B;  2IHF A;  2EYM A;  4KJO A;  4BBS G;  3ERS X;  3I4N G;  4LF6 L;  4IFD I;  3BZC A;  4OIK A;  4JI7 Q;  4WOR A;  4BY7 G;  1PTO F;  3FKI B;  5I4D A;  3HOZ B;  1I6H H;  1KHI A;  5CBE E;  5JEA H;  3MXN A;  4IJL A;  2CWP A;  3F1Z A;  2NBF A;  2K01 A;  4NXM L;  5C44 H;  2E2J B;  5EGT A;  4FDB A;  3OSO A;  4KHP L;  4OXP A;  5C6A A;  5FJ8 H;  3K7A B;  5FLM H;  5NUC A;  3ND8 A;  1MIU A;  2V4D A;  5E4X A;  3BS1 A;  3DWQ A;  1LM0 A;  1M8A A;  1WYD A;  3JC6 6;  5FO7 B;  2R92 G;  2IY5 B;  3AFQ A;  1LT3 D;  4IUP A;  5JVG 3;  2NYZ D;  3T1Y Q;  3WOE A;  5IGD A;  1KNA A;  3J80 L;  3JAM L;  2Q2I A;  2IWH A;  4DK6 C;  4X64 L;  2B63 H;  1I4G A;  3D4R A;  2JEA I;  5ELE A;  4XT3 B;  4K14 A;  3A74 A;  4A3F H;  3GTL B;  3SE0 A;  2UXC L;  3FP9 A;  2EXD A;  2XIW A;  2KEN A;  4A3F G;  1B4O A;  4OX9 L;  4OWT B;  3G71 A;  1NNX A;  5J3B A;  1F9Q A;  3DWA A;  3VYU A;  1EOV A;  1NCV A;  2GN5 A;  2Y0S G;  5G3L F;  4A3J H;  1NMG A;  5TSS A;  3ONA B;  4M1U B;  1JJ2 A;  4LF7 L;  2F0P A;  4NW2 A;  1K8A C;  1VF5 C;  5IWA L;  1NUC A;  2E2H B;  5ELC A;  2UUC L;  1AP0 A;  3PO3 G;  2UU9 Q;  4JBK A;  4X62 Q;  1VQG A;  1QWY A;  4BBR H;  3N6R A;  3TP5 A;  2G5D A;  3PUZ A;  4GN5 A;  2JA7 G;  1HH2 P;  1PH5 A;  3IFT A;  2F0Q A;  2D9U A;  1JWM D;  2YYZ A;  2A68 C;  2EYF A;  3DMU A;  2RA4 A;  3MC0 B;  1TVX A;  5COR A;  3H15 A;  3S16 B;  4FYD A;  3HOZ G;  1Y14 B;  1LT6 D;  3NWT A;  4PQX A;  3P75 A;  1YIT A;  1HZ9 A;  3TRE A;  3F2U A;  2B63 B;  3TDQ A;  4OWW B;  1DM0 B;  5GAD C;  4Y52 H;  3KK7 A;  1HXY D;  4EX5 A;  3JAM c;  1XPU A;  5JPN C;  3BDO A;  2MNA A;  4IUV A;  1BBU A;  1WTH A;  1H9R A;  2VQF Q;  4IPC A;  3G6E A;  1LTA D;  2MPM A;  5IIF A;  3BDL A;  4DNI A;  1JJG A;  1WTP A;  5C4H A;  4QCL A;  4HJ9 A;  4DV3 L;  3A8J E;  1EFI D;  1SRO A;  3MZ5 A;  5DLQ E;  2DJF C;  3TN2 A;  3J81 L;  3CU7 A;  4RKB A;  1NR2 A;  1F2M A;  2BOS A;  3MXP A;  3HOX H;  4S3S A;  1PH9 A;  2MJ8 A;  2ZXR A;  1ML0 D;  1FL0 A;  1SN8 A;  2NTT A;  2MO0 A;  2ZT9 C;  1PYS B;  1V1O A;  1CTM A;  4QF4 A;  3K59 A;  3MXG A;  4YCW A;  1H9S A;  2K5H A;  1Y8P B;  3T1H L;  1R4Q B;  2UXB Q;  5JJL A;  2KCN A;  2R7F A;  4EVO A;  4CKE A;  3J7A F;  1CI3 M;  4A3G H;  2A19 A;  2YTV A;  1BF4 A;  2F3V A;  1L0Y B;  2FIN B;  4LF8 L;  2B8F A;  3R2I A;  1A3V A;  2A6H D;  1EQR A;  4GNX B;  1E1O A;  2CQO A;  1KL9 A;  5IT9 c;  3RR5 A;  3T1H Q;  5KND A;  4KK7 A;  2ES2 A;  2OWO A;  3KLR A;  5LMN Q;  3LGJ A;  3P7J A;  1Q1E A;  2O4X A;  3K7A H;  3GTQ H;  1HFG A;  1S5F D;  1HA5 A;  1Q8K A;  2F03 A;  4DAP A;  3H94 A;  1PFS A;  2D0P A;  1JE5 A;  3VR4 A;  2NTS A;  2NWG A;  3UDF A;  5FLM G;  4RA8 A;  4DK0 A;  5DNF A;  3T53 B;  2DNC A;  4O0A A;  1FYC A;  1QG7 A;  1EL0 A;  4ID6 A;  4JI2 Q;  1Q8I A;  4A3D H;  2R7D A;  4R1J A;  1Q86 C;  1TWG B;  1S5D D;  2L55 A;  2VB3 X;  3S14 H;  3HKS A;  4LNQ A;  1VQ5 A;  2EPB A;  4U68 A;  2C5C A;  1WD0 A;  1F2Z A;  1B50 A;  1PH3 A;  1D1K A;  3EQL C;  2XRS D;  3PGZ A;  3IL8 A;  3TS2 A;  4TKO B;  2E2I B;  4DXF A;  2B39 A;  3CCS A;  3HGB A;  4XQQ A;  1D6E C;  3RLF A;  5EPL A;  1BUV T;  3NEL A;  2UUC Q;  3TP7 A;  2K50 A;  2KBN A;  5EPJ A;  3VR2 A;  3WDN A;  2K6A A;  1EWI A;  3OHX C;  3FKI G;  4A93 H;  1KD1 C;  4DV4 Q;  2K52 A;  1EZ6 A;  1SYE A;  3E0J A;  4JBJ A;  4HSP A;  1BNZ A;  1CSP A;  1PH7 A;  2R92 H;  3AYH B;  4WRD A;  4NDX A;  4IN3 A;  2B2U A;  5M5W H;  1XNQ Q;  1FGB D;  4AYB E;  3HKZ E;  3MEH A;  1UE6 A;  3HKZ B;  2G9D A;  3A55 A;  4B9W A;  2VUM B;  1SYD A;  2BDN A;  2WB1 B;  4IJH A;  5CYU A;  5BR8 L;  1PH4 A;  2UXD L;  3BYY B;  4O42 A;  4P2C B;  1SFO H;  3RZO B;  2N3S A;  4FP5 D;  2NN6 H;  1HQM C;  2LFN A;  5D3D A;  2HDM A;  1IKM A;  1Q82 C;  1TQO A;  1TS5 A;  1X9N A;  1KTK A;  1DZ1 A;  4KY5 A;  5ELO A;  1VQ6 A;  3S1Q B;  4DUZ L;  2Z4I A;  3VYS A;  1Z7T A;  1TWC B;  3MXU A;  5JPM C;  1U4M A;  1OO9 B;  3SK5 A;  1HTP A;  3SHL A;  2F0J A;  2DJG C;  2IX0 A;  3T4A C;  4A3K B;  3E6Z X;  2KCC A;  4FVM A;  3RLN A;  1HUN A;  1B1Z A;  1HA6 A;  2BCO A;  3OIP A;  3I56 A;  2MGS A;  2ZTD A;  5M3F B;  1BBW A;  4PV1 C;  4YHH L;  1PFN A;  4DAV A;  1SMX A;  1WCM H;  1Y8N B;  4A3E G;  1DGS A;  1WTX A;  3S2D H;  3F8T A;  1MSH A;  4RGN A;  1N9W A;  3PQI A;  4JVZ A;  1A15 A;  1IW7 D;  2KA7 A;  1EY4 A;  4G4K A;  1PHJ A;  4QUC A;  5IGG A;  1X56 A;  3HRZ C;  4KTA A;  1WTO A;  4A3M G;  4HIK A;  3I4M H;  4X66 Q;  2VY3 A;  2F0W A;  5LMN L;  5JAV A;  3KJO A;  2EE1 A;  1D8L A;  2KOL A;  2K5N A;  4A4I A;  4MZ9 A;  2AUJ D;  1CA6 A;  2A69 C;  4LFB Q;  2RVL A;  4C1N I;  4LUO A;  4GNX A;  4X3K A;  2Z9H A;  2YU9 B;  4DV0 L;  4IO9 A;  2JA7 H;  2PZW A;  1HZA A;  1PH2 A;  1YNN C;  2BE5 C;  2QEJ C;  4DR5 L;  3GTK H;  1SNM A;  2KEC A;  1VQO A;  4JI7 L;  2F0N A;  2K33 A;  3PV0 A;  5JOB A;  4DV2 L;  3UDI A;  2VQE Q;  5LL6 S;  2BA0 A;  2GVB A;  1LTI D;  5IYB G;  4IUN A;  2G9H D;  3MXN B;  3I4M B;  1N32 Q;  5COY A;  4LFB L;  1TWH H;  3W2D A;  2L11 A;  1A2T A;  3SEB A;  1JCK B;  4X66 L;  1TWH B;  2OF1 A;  4LWC A;  3S1N B;  4K6L A;  2LMC B;  5CR3 A;  5C44 B;  3CAM A;  3PO3 B;  4MN3 A;  3KYH C;  5K5P A;  2LKV A;  4NMZ A;  1D5Z C;  5C3X A;  5M5Y H;  1QIL A;  1WVL A;  2XRQ D;  1TS4 A;  3M85 A;  4G7O C;  3ULL A;  2EZV A;  3HOZ H;  4QJF A;  2NVQ H;  3E0E A;  2VW9 A;  2BH8 A;  2K28 A;  4R9W A;  4IUQ A;  4OON A;  2EQS A;  5CC4 A;  3JAM i;  4YIJ A;  1VQ8 A;  1HR0 W;  3ZJY C;  1KAA A;  4BA2 I;  1GHK A;  1F9R A;  3NTH A;  3HZX A;  2JA8 H;  2RCN A;  5FJ8 G;  2NB0 A;  5D14 A;  3VR6 A;  4DV7 Q;  1O7L A;  4X3S A;  2O5I C;  3BVZ A;  3GTP H;  2KCM A;  1DOL A;  3HOV B;  4A3M B;  3Q22 A;  3RD4 A;  3I70 A;  2RDF A;  2TMP A;  1OTC A;  5C3E H;  2EYJ A;  4JI4 L;  1Q12 A;  4B3S L;  1EIG A;  3C1F A;  4DV5 Q;  4CKB A;  3UDG A;  4C3J B;  4BBS H;  1TY0 A;  3NHH A;  2Z4H A;  1V1Q A;  4YWK A;  1FGU A;  4HSV A;  3TZU A;  5I6W A;  4E6I A;  3W1G A;  3JAM E;  2OTL A;  2J7Z A;  3S2H B;  4ZCK A;  5CV7 A;  4H0L C;  3S1Q H;  4TVA B;  4GKK Q;  1VQK A;  2BH2 A;  1SFO B;  5IYC H;  2PPB C;  3N52 A;  3W1B A;  1J8I A;  1TKW B;  4OO1 G;  2EVB A;  1DCZ A;  2EOT A;  1NY4 A;  2F0K A;  2IX3 A;  3P1H A;  3TQY A;  3KF8 B;  3MHB A;  4LW1 A;  4JV5 Q;  3A8I E;  4JI8 L;  1Y1W H;  4LF4 Q;  1DJR D;  1SE3 A;  2L4N A;  1XNR L;  2HQE A;  5BN3 A;  5JEA G;  1G91 A;  4A3I G;  1GJX A;  1KLG D;  4UP7 A;  2RQX A;  4V0B A;  4HIO A;  3V96 A;  1HNZ Q;  4JI6 L;  2A74 C;  4CJ2 C;  4H44 C;  1K8G A;  1EY5 A;  4UP9 A;  3HOY G;  2QEX A;  1JB3 A;  4YY3 Q;  3S9W A;  3LWU A;  3HOV H;  5M5X H;  3S1N H;  1VCI A;  2WII B;  1EZ8 A;  1AFP A;  1GUT A;  5IT9 L;  3J81 c;  4ME3 A;  3CCE A;  1VF7 A;  1ROD A;  2EY6 A;  3L3O C;  1E22 A;  1VQL A;  1RF2 D;  1EY9 A;  5C3E B;  2D2C C;  1AH9 A;  2VL6 A;  3U4V A;  4DAY A;  2SEB D;  1B9N A;  2RCF A;  1N33 Q;  1A6X A;  5DAU A;  3STB C;  3SDZ A;  4A3B H;  4FXG C;  2KUM A;  1JMC A;  1CM9 A;  1SDF A;  3CCQ A;  4JI1 L;  2A8V A;  3NBH A;  5KEE A;  2Z6K C;  4DN4 M;  3SVM A;  3E9H A;  3I4L A;  4X65 Q;  1RTN A;  1C0A A;  5KIX A;  1BQQ T;  3QWN A;  4C1N K;  2OCE A;  1SNC A;  3P20 A;  4B3M L;  1QOH A;  1Y1V G;  3U50 C;  2OTJ A;  2F0E A;  1CK1 A;  2ICE C;  4UY8 C;  2K04 A;  2N55 A;  3HOU G;  1Y8O B;  2OT2 A;  2CWA A;  4C2M H;  1STE A;  4G57 A;  2B63 G;  1VQI A;  1LTB D;  2EY1 A;  5IT9 E;  1U4L A;  4R4C A;  4DR2 L;  4ZUI A;  5E4W C;  1QNU A;  4BA1 I;  2Q8I B;  1K73 C;  1IBL L;  2FXQ A;  1SYF A;  1KDA A;  5HGQ A;  3LWE A;  4NXM Q;  5M9O A;  2BA1 A;  3V05 A;  1EIH A;  3NPP A;  3S1M B;  1UWV A;  2WAC A;  4XYQ A;  4X65 L;  3GTG H;  1B9M A;  1PTO D;  4XDX A;  1OXU A;  2D5D A;  3BG3 A;  4RHS A;  4BY7 B;  2KQ3 A;  2AQ3 B;  1Z9F A;  1DXM A;  5EPK A;  4X64 Q;  1F2Y A;  4G7Z C;  4A93 G;  4DR7 L;  4DV5 L;  1GVP A;  4OIJ A;  1CQV A;  1QUQ B;  2DGY A;  3GO5 A;  2FHT A;  4R4Q A;  3SK4 A;  2JA5 H;  1Q7Y C;  1NR4 A;  2UXC Q;  4GKK L;  1CKO A;  4KKT A;  4J1M A;  1CKM A;  2ALY B;  1FJG Q;  1A62 A;  2E2D C;  3T16 A;  3MAQ A;  1E2V A;  3SR1 A;  1YHA A;  3J7Z C;  1ESR A;  5CV6 A;  4A3E B;  5IGF A;  2WAQ B;  1PRT D;  4F7X A;  3KF6 A;  2KHI A;  3HOW H;  2Q2H A;  4A75 A;  3I3C A;  2HT1 A;  1E3P A;  4C3J H;  3PIP 3;  1YVC A;  1I94 Q;  2R93 G;  4CJ1 B;  4MTK A;  2PNH A;  1IKL A;  4ZAI A;  3CXC A;  4ZLT F;  1TR5 A;  2AWN A;  4LUV A;  3UE0 A;  5F2D A;  1XNQ L;  4MNO A;  4HN7 A;  4X62 L;  4OO1 H;  4CBV A;  3S15 H;  1GO3 E;  3KDF B;  3S24 A;  2AUK A;  4K5V A;  3GTJ B;  2O2L D;  1U4R A;  2XTI A;  1S72 A;  1L1O C;  3QB3 A;  2JQO A;  2SOB A;  3NQI A;  3M4O H;  4A3B G;  1I3Q H;  1K8M A;  5E7N A;  3ERO A;  4R8N A;  5LL6 X;  4OX9 Q;  3ND9 A;  4DXG A;  1H95 A;  2CH4 W;  2M9V A;  4JOI A;  5C5L A;  1IW7 C;  2KJX A;  1C8C A;  3OTO L;  1PA6 A;  4OEL B;  3IFD A;  4M8A A;  4PNY A;  3VR3 A;  2E8G A;  1H9J A;  4EQO A;  1XMO L;  4YHH Q;  4ME5 A;  1YZ6 A;  3MA2 B;  4KD3 A;  5GQO A;  3EA6 A;  4JG2 A;  3K80 C;  4J15 A;  1G8Z D;  3GTK B;  1STY A;  4C3H G;  4DR3 L;  5FK9 C;  5I6Y A;  5KNC A;  5K36 H;  1VQ4 A;  2L15 A;  1OXT A;  1KRS A;  1CKN A;  4UPA A;  3UE1 A;  1KDB A;  1MSG A;  5C4J H;  3RZD B;  2F0F A;  3CRL C;  3GDE A;  1LYL A;  3O13 A;  1HTL D;  2UUA L;  1FNW A;  1MKH A;  3Q6S A;  4I7A A;  5C4X G;  3EFX D;  2JA6 G;  1I6H B;  3A0J A;  1W6J A;  1PFM A;  1QUQ A;  1GD7 A;  4A3C H;  2RSN A;  3CW2 C;  1B2T A;  1CZG A;  4IUU A;  3PCO B;  3IRB A;  1Y69 U;  3RN5 A;  1EWH A;  3FEW X;  1W3S A;  3K7U C;  1SBB B;  2EXZ A;  3A56 A;  5H1S E;  1PH8 A;  1JB7 A;  2K5W A;  3PUV A;  1LLR D;  3MFY A;  1F2L A;  1TWF B;  4JI5 L;  5ELD A;  1SMY D;  2K5Q A;  2F1M A;  1GUG A;  4QB4 A;  2IHE A;  3ER0 A;  3QOJ A;  1J5E L;  4A3K G;  4K2L A;  1GUS A;  1I4H A;  3L2P A;  2Z0S A;  4GLX A;  2DY8 A;  4DNT B;  2KED A;  2YTX A;  5C0X H;  4L5Q A;  1AZP A;  1B3Q A;  4FXK C;  3NBI A;  2Q2U A;  4LUZ A;  2KCT A;  3M7N A;  4K6D A;  5IP9 H;  2ATW A;  1K3B C;  1OXV A;  3CQZ H;  4H13 C;  4X3U A;  2QCP X;  1A3T A;  2C35 B;  2YU9 H;  3M7G A;  1WTR A;  3KFU A;  4DR7 Q;  3FKI H;  3VYR A;  4IPG A;  4JW0 A;  3AFP A;  2PQA B;  3PO2 H;  3HP3 A;  2A73 B;  2DN8 A;  1ASY A;  2PZU A;  3U58 A;  1XMO Q;  1W2B A;  3J7A V;  4IOA A;  2M2L A;  4A3K H;  2K7V A;  1QZG A;  2QA4 A;  1SAP A;  3TBI B;  1J6Q A;  2UXD Q;  4XXE A;  3H09 A;  4RMF A;  2EJM A;  1ZEQ X;  4L5T A;  3NTK A;  4LF6 Q;  1YNX A;  2HDL A;  4DV1 Q;  3S1R H;  1CUK A;  3H3V C;  3DWP A;  2F4I A;  2RBM A;  4DUZ Q;  1II3 A;  1TWA H;  1ICF B;  5EAY A;  2E76 C;  1S5E D;  2DUD A;  2CQA A;  2F0U A;  3CRK C;  3MEF A;  3S2H H;  1AE2 A;  3CC2 A;  4A3E H;  3NE5 B;  4Q0F A;  4DPG A;  3A8K E;  2B2V A;  3L9A X;  1IL2 A;  2HHH Q;  2NVX B;  1WTV A;  1G2T A;  1KDC A; 
#chains in the Genus database with same CATH homology
 3J81 i;  3FHW A;  2JA7 H;  3J80 i;  2CCZ A;  1XMQ L;  1NTG A;  4KHP Q;  1HZA A;  4JCV E;  1N36 Q;  1PH2 A;  3F2B A;  1VQC A;  3EBE A;  4DR5 L;  3GTK H;  2I5M X;  1X55 A;  2WAQ E;  3F2D A;  1VQO A;  4AIM A;  3F2C A;  4JI7 L;  4JBW A;  3PV0 A;  4B3R Q;  2ZTE A;  4C3I H;  2K4K A;  3NBH B;  4DV2 L;  4K0K Q;  2B3G A;  1N34 L;  4QIW E;  2RHQ B;  4PZ8 A;  3UDI A;  1PYB A;  1T9H A;  1YHB A;  2VQE Q;  3BU2 A;  2ZJQ A;  3H0G G;  1G51 A;  5C4X H;  4IPD A;  2I0Q A;  2BA0 A;  2GVB A;  3GD7 A;  3GTL H;  1CKN B;  1E1T A;  5IYB G;  3CME A;  1UE7 A;  3I4M G;  3MXN B;  4GLV B;  1N32 Q;  1HNZ L;  4LFB L;  2K75 A;  1TWH H;  1TXY A;  3EIV A;  1A63 A;  4POG A;  1JT8 A;  4X66 L;  1B8A A;  2WFW A;  4WJ4 A;  1VQ9 A;  4LWC A;  4NB3 A;  3KJP A;  5M3F G;  4XIG S;  4GOP A;  3PF4 A;  4RG1 A;  3CAM A;  4ALP A;  1VQH A;  1YHQ A;  1HR0 Q;  2ZJP A;  5JEA J;  3I2Z A;  4LF5 L;  5BR8 Q;  2R7Z H;  4A3D G;  1N34 Q;  3CPW A;  1KQS A;  4GN4 B;  4DV0 L;  4IO9 A;  1QVF A;  4JOI C;  3KYH C;  2NVT H;  5M3F H;  3HOV G;  3CP0 A;  3GTJ H;  3HOY H;  1N36 L;  5M5Y H;  2LXJ A;  1G29 1;  1IBK L;  3M85 A;  2E5L L;  1VQP A;  2VNU D;  4QY7 A;  3ULL A;  4BY7 H;  3I4O A;  1I50 H;  4A3L H;  2WP8 J;  3HOZ H;  4QJF A;  4NXN L;  3E0E A;  2RF4 A;  1UEB A;  3D0F A;  2VW9 A;  2VQE L;  2BH8 A;  1XNR Q;  2IX1 A;  1ASZ A;  3RZO H;  1LUZ A;  4A3J G;  1X54 A;  1SRU A;  4OON A;  2EQS A;  3JAM i;  1VQ8 A;  1HR0 W;  2LSS A;  1Y1W G;  3ZJY C;  1HR0 L;  4LF5 Q;  3TS0 A;  4PMW A;  4BA2 I;  4A3L G;  4GKJ Q;  4GKJ L;  2LXK A;  2PMZ E;  4DAY B;  4AQY L;  1EIY B;  2JEB I;  3GTO H;  2WB1 G;  2F4V Q;  2OQK A;  2JA8 H;  2NN6 I;  2RCN A;  4C3H H;  5FJ8 G;  3A5Z B;  1YJ9 A;  2XGT A;  1X6O A;  2N8N A;  2K14 A;  4YY3 L;  1XPR A;  4JI5 Q;  2NN6 G;  2ZTC A;  5C44 G;  2JA8 G;  2YV5 A;  4P74 A;  3W5O A;  4DV7 Q;  1KXL A;  2AWO A;  4JI8 Q;  3H3V I;  4KHZ A;  4NXN Q;  3RLO A;  4DUY L;  3GTP H;  2KCM A;  4XTC S;  2CFM A;  1KAW A;  3NEM A;  3KF6 B;  2IHF A;  2PI2 E;  3CD6 A;  1A8V A;  4BBS G;  3ERS X;  1OTC A;  4QL5 A;  5C3E H;  4LF6 L;  3I4N G;  4IFD I;  3BZC A;  3L7Z C;  4JI7 Q;  4BY7 G;  4B3S Q;  4JI4 L;  1Q12 A;  4B3S L;  4LFC L;  4JI4 Q;  4JI1 Q;  1YIJ A;  2QGQ A;  4DV5 Q;  5IP7 G;  4BBS H;  3UDG A;  3I4N H;  4YWK A;  1V1Q A;  1FGU A;  5IYD G;  5GAG C;  1VQM A;  1WOC A;  1I6H H;  1KHI A;  1XJV A;  1K83 H;  4POF A;  1VQA A;  3W1G A;  4B3T L;  5M3M H;  2OTL A;  3KDF A;  2WAQ G;  2CWP A;  3AQQ A;  4IJL A;  1R9T H;  1N8R C;  4JI6 Q;  2R7Z G;  3F1Z A;  4NXM L;  2Z6K A;  1B70 B;  4UP8 A;  4DUY Q;  3S1Q H;  5JJK A;  4TVA B;  5C44 H;  4GKK Q;  1IXR A;  1VQK A;  4FDB A;  2BH2 A;  5IYC H;  4KHP L;  4OXP A;  3W1B A;  5FJ8 H;  5FLM H;  4OO1 G;  3HFZ B;  4DR5 Q;  3CCL A;  1NY4 A;  1MIU A;  1M1K C;  2VUM H;  3TQY A;  2ZJR A;  3KF8 B;  4HJ8 A;  4OO1 I;  1Z47 A;  2N49 A;  4DV2 Q;  1PH6 A;  4LW1 A;  4KLK A;  1I5F A;  1LM0 A;  1WYD A;  4JI8 L;  3JC6 6;  4AYB G;  1Y1W H;  2NVX H;  4LF4 Q;  2R92 G;  2IY5 B;  3AFQ A;  1XNR L;  1NJI C;  3T1Y L;  4HJ5 A;  5JEA G;  3T1Y Q;  4A3I G;  3PF5 A;  3I55 A;  1X65 A;  2IT1 A;  4UP7 A;  5GRO A;  1C7Y A;  1WI5 A;  4HIO A;  2Q2I A;  1VQE A;  5IWA Q;  4A3M H;  1HNZ Q;  2D62 A;  4DK6 C;  4X64 L;  4JI3 Q;  2B63 H;  4JI6 L;  1Q1B A;  1K8G A;  2JEA I;  4UP9 A;  5C3E G;  2F52 A;  2UXB L;  3HOY G;  2QEX A;  4DR4 L;  3A74 A;  3M9B A;  4YY3 Q;  4A3F H;  3U4Z A;  3HOV H;  5M5X H;  3S1N H;  1VCI A;  4DV7 L;  3CCR A;  2NZO A;  1YBY A;  5C0X J;  3AEV A;  1WFQ A;  2UXC L;  4A3G G;  4P73 A;  3HOW H;  1EQQ A;  4IFD J;  3PUY A;  3FP9 A;  2EXD A;  3J81 c;  2KEN A;  4ME3 A;  3CCE A;  4A3F G;  3G4S A;  4OX9 L;  1E22 A;  4OWT B;  1VQL A;  3M4P A;  4PZ6 A;  4DV3 Q;  3G71 A;  1X3F A;  3CC4 A;  5J3B A;  1AH9 A;  2VL6 A;  4LF4 L;  3DM3 A;  3ICE A;  1L1O B;  1EOV A;  2GN5 A;  4YWM A;  3U4V A;  2JA6 H;  1N33 Q;  3G48 A;  2Y0S G;  4A3J H;  4GOP B;  3STB C;  1NMG A;  3BJU A;  1JJ2 A;  1EYG A;  1K8A C;  2Q2T A;  4LF7 L;  4A3B H;  5IWA L;  1X3E A;  2V1C C;  1PH1 A;  2OQ0 A;  1JMC A;  4JYA L;  3CCQ A;  4P71 A;  4LFC Q;  4JI1 L;  2A8V A;  2UUC L;  3PO3 G;  2UU9 Q;  1TWG H;  1S40 A;  4JBK A;  4X62 Q;  1VQG A;  4L5R C;  4BBR H;  2Z6K C;  3CCV A;  4DR1 L;  1KIX A;  4DR4 Q;  5IYC G;  3E9H A;  3PUZ A;  4GN5 A;  2JA7 G;  1HH2 P;  4X65 Q;  1PH5 A;  1C0A A;  3E9I A;  3S16 H;  1O7I A;  2OCE A;  2YYZ A;  1MJE A;  3PIP A;  2VZA A;  1Y1V G;  4R4T A;  4B3M L;  3S17 H;  3OW2 A;  4BY1 H;  3U50 C;  2OTJ A;  1EFW A;  1EUJ A;  3H15 A;  2NVY H;  1IBM L;  4UY8 C;  1FJG L;  2KHJ A;  3HOU G;  1Q81 C;  3HOZ G;  1Y14 B;  3KOJ A;  2B29 A;  4P72 A;  2CWA A;  4C2M H;  1YIT A;  2B63 G;  1HZ9 A;  1VQI A;  3TRE A;  4OWW B;  4R4C A;  1K0R A;  5GAD C;  4DR2 L;  4DR1 Q;  4P75 A;  3JAM c;  4EX5 A;  3DLL A;  1N33 L;  1XPU A;  4Y52 H;  3H0G H;  4R4O A;  4BA1 I;  1PV4 A;  1VQN A;  1IBL Q;  4LF7 Q;  1K73 C;  1IBL L;  2MNA A;  1BBU A;  2FXQ A;  5HGQ A;  2VQF Q;  4IPC A;  4LFA L;  4NXM Q;  5GAE C;  2NZH A;  5LMN W;  2E2I H;  3G6E A;  1OXS C;  2BA1 A;  4GLA C;  4TQU S;  4BXX H;  4DNI A;  1UWV A;  1JJG A;  3RNU A;  4WJ3 M;  5IE8 A;  4HJ9 A;  4X65 L;  4DV3 L;  3GTG H;  3A5U A;  1SRO A;  3STB D;  4JI0 L;  5DLQ E;  4JV5 L;  1OXU A;  1QVC A;  1VQD A;  4GS3 A;  3HOX H;  1QVG A;  1KC8 C;  1PH9 A;  3M3Y H;  1SR3 A;  3TEH B;  1XPO A;  4QGU A;  1HNW L;  1C9O A;  2R93 H;  1FL0 A;  1SN8 A;  3D31 A;  1IBM Q;  2MO0 A;  1Z9F A;  2AKW B;  2VS1 A;  5IP9 G;  5C0X I;  2YTY A;  1PYS B;  1VQB A;  5IP7 H;  4X64 Q;  4YCW A;  4DR7 L;  4A93 G;  2K5H A;  4DV5 L;  4GN3 B;  1GVP A;  3T1H L;  2UU9 L;  2UXB Q;  5JJL A;  2R7F A;  1QUQ B;  3J80 c;  2UUB Q;  4BXX G;  3J81 j;  2DGY A;  3GO5 A;  4KI0 A;  4DR6 L;  4B3T Q;  4R4Q A;  2JA5 H;  4A3G H;  1Q7Y C;  2A19 A;  2UXC Q;  3RN2 A;  2YTV A;  4LFA Q;  1HZC A;  4JV5 Q;  1A0I A;  4JYA Q;  4GKK L;  1J5E Q;  3PUX A;  2HIV A;  1HJP A;  3HKZ G;  1GM5 A;  1CKO A;  1V43 A;  2JA5 G;  4LF9 L;  1CKM A;  3BZK A;  3I7F A;  2ALY B;  1HNX L;  3B6Y A;  4LF8 L;  1A62 A;  1FJG Q;  2K5V A;  2ZM6 Q;  1EQR A;  4GNX B;  1YHA A;  3J7Z C;  4X6A H;  1IYJ B;  1E1O A;  2CQO A;  1E7Z A;  2MFI A;  1KL9 A;  2MO1 A;  5IT9 c;  1YI2 A;  3RR5 A;  3KF6 A;  2KHI A;  3CC7 A;  2Q2H A;  4A75 A;  1BVS A;  1IZ6 A;  3T1H Q;  2ES2 A;  2OWO A;  3PIO A;  2I5L X;  2RHS B;  2HT1 A;  1E3P A;  4C3J H;  5LMN Q;  3LGJ A;  1YVC A;  1Q1E A;  3CCJ A;  1I94 Q;  2R93 G;  3K7A H;  3ULJ A;  3GTQ H;  2PNH A;  3CXC A;  1YJN A;  1Q8K A;  4L5S A;  2AWN A;  4LUV A;  3UE0 A;  1OXX K;  4IFD G;  4HJA A;  1PFS A;  2N78 A;  2JK8 A;  4MNO A;  4YWL A;  1HZB A;  1JE5 A;  2D0P A;  4X62 L;  1XNQ L;  5FLM G;  3UDF A;  4IOC A;  2UUB L;  4LF8 Q;  3S15 H;  1GO3 E;  3KDF B;  3S24 A;  1V9P A;  4BBR G;  4HID A;  2ZM6 L;  3PO2 G;  4DR6 Q;  2XTI A;  1S72 A;  3Q8D A;  4O0A A;  1L1O C;  4APV A;  5JJI A;  2JQO A;  1B7Y B;  4GOP C;  4B3M Q;  4JI2 Q;  1XTD A;  4A3D H;  2R7D A;  3M4O H;  4R1J A;  4A3B G;  1I3Q H;  1YEZ A;  5E7N A;  2JE6 I;  1Q86 C;  4H02 A;  1HNW Q;  4HJ7 A;  1KD1 C;  3S14 H;  4IPH A;  1VQ7 A;  4OX9 Q;  1MJC A;  3HKS A;  4JC0 A;  3CF5 A;  4LNQ A;  1H95 A;  1VQ5 A;  4JOI A;  1KRT A;  4JI0 Q;  1PH3 A;  3KLW A;  3OTO L;  3OTO Q;  1PA6 A;  3PGZ A;  3TS2 A;  5C0X G;  4DR2 Q;  2E2J H;  2E8G A;  3PUW A;  4PG3 A;  3OYY A;  3CCS A;  1XMO L;  1CSQ A;  4MTN A;  1K3R A;  4YHH Q;  3RLF A;  2VQF L;  1YZ6 A;  1RL2 A;  4R4I A;  3NEL A;  1M90 C;  5GQO A;  1SE8 A;  2UUC Q;  1U5K A;  4JG2 A;  3K80 C;  4J15 A;  3VDY A;  1U0L A;  4NPS A;  2JA9 A;  2K50 A;  2KBN A;  1XMQ Q;  5LMU Q;  1L1O A;  4DR3 L;  1EWI A;  3PO3 H;  3FKI G;  1VQ4 A;  2ASB A;  2L15 A;  4A93 H;  1OXT A;  1KRS A;  1CKN A;  1P16 A;  4UPA A;  3UE1 A;  2A1A A;  1S3O A;  2K52 A;  4DAM A;  5C4J H;  4DV4 L;  4DV4 Q;  4JI2 L;  2Y0S E;  1AE3 A;  4HIM A;  3EN2 A;  5M3M G;  3GDE A;  1LYL A;  1X3G A;  2UUA L;  2HQL A;  2UUA Q;  4JBJ A;  5C4X G;  1MKH A;  1I94 L;  1HNX Q;  1L2F A;  3GTM H;  3PSI A;  2JA6 G;  3H3V H;  3A0J A;  1CSP A;  4A3C H;  1QUQ A;  1GD7 A;  5IY0 A;  1PH7 A;  1TWF H;  3CW2 C;  3RZD H;  3CMA A;  3AYH B;  1LTL A;  3PCO B;  3IRB A;  2R92 H;  3M4Q A;  1N32 L;  3RN5 A;  3K8A A;  3CPF A;  4AQY Q;  5M5W H;  2HIX A;  1XNQ Q;  2MQH A;  4AYB E;  1W3S A;  3HKZ E;  5ELN A;  3K7U C;  3NEN A;  1BKB A;  1PH8 A;  5H1S E;  1UE6 A;  4QQB X;  1JB7 A;  3PUV A;  5LMU L;  5HY6 A;  4JI5 L;  3UDX A;  3J7A 5;  3K81 C;  1VQF A;  1Y1V H;  2IHE A;  1WCM G;  4IJH A;  5BR8 L;  1NE3 A;  1VS0 A;  4YCU A;  1PH4 A;  3ER0 A;  2UXD L;  1P8L A;  1J5E L;  4A3K G;  1SFO H;  1FVI A;  2N3S A;  3L2P A;  2Z0S A;  4GLX A;  4DR3 Q;  2YTX A;  1NMF A;  4L5Q A;  4OWX B;  5AJ3 L;  5GAH C;  1K9M C;  3WWV A;  2F3I A;  1Q82 C;  3K0X A;  2Q2U A;  4B3R L;  1X9N A;  2E2H H;  4A76 A;  1VQ6 A;  1GKH A;  4LUZ A;  5ELO A;  1EIF A;  2KCT A;  5IYB H;  4DUZ L;  4A3C G;  2WB1 E;  1QZH A;  3M7N A;  5IP9 H;  1UE1 A;  2ATW A;  1OXV A;  3CQZ H;  1UE5 A;  4A3I H;  4BY1 G;  1TWC H;  2I5H A;  3HOX G;  1E24 A;  2C35 B;  3CCM A;  2YU9 H;  2D0O A;  2IX0 A;  3KFU A;  4DR7 Q;  3FKI H;  5K36 G;  4IPG A;  1RIP A;  2VUM G;  3RLN A;  3AFP A;  2PQA B;  2PQA A;  4DV0 Q;  3PO2 H;  4GNX C;  1JJC B;  4JBM A;  3I56 A;  1ASY A;  1L0W A;  2ID0 A;  3U58 A;  2ZTD A;  1XMO Q;  1W2B A;  4IOA A;  1BBW A;  1IBK Q;  2E5L Q;  4A3K H;  4Y7N H;  4YHH L;  1SMX A;  4EQ5 A;  4AH6 A;  1QZG A;  4K0K L;  1WCM H;  2QA4 A;  2PI2 A;  2AMC B;  3CCU A;  4A3E G;  1J6Q A;  2UXD Q;  1DGS A;  4DKA C;  1VQJ A;  2H5X A;  4DV6 Q;  4DV6 L;  4LF9 Q;  3S2D H;  3F8T A;  3S1M H;  4RMF A;  5IYD H;  1Q46 A;  1N9W A;  2EIF A;  1SLJ A;  2AHO B;  5AJ3 Q;  3HOW G;  1NBW A;  4L5T A;  4LF6 Q;  1WJJ A;  3ULP A;  1YNX A;  4PZ7 A;  4DV1 Q;  4JI3 L;  4DV1 L;  2NVQ H;  1PHJ A;  3S1R H;  2F4V L;  1CUK A;  1X56 A;  3TRZ A;  1D7Q A;  1G6P A;  2GVA A;  4A3M G;  4HIK A;  3I4M H;  4DUZ Q;  4X66 Q;  3HOU H;  2VY3 A;  3L0O A;  5LMN L;  1TWA H;  5EAY A;  3KJO A;  2DUD A;  3SGI A;  3MEF A;  1D8L A;  1AE2 A;  3S2H H;  3CC2 A;  2R6G A;  5FLX c;  2K5N A;  4A4I A;  4O2D A;  4MZ9 A;  4A3E H;  4DK3 C;  4DPG A;  1PVO A;  2CKZ B;  1IL2 A;  4LFB Q;  1YJW A;  2HHH Q;  4GNX A;  4LUO A;  2HHH L;  2JJQ A;  4YCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...