5IYCH

Human core-pic in the initial transcribing state
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
150
structure length
150
Chain Sequence
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 19
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5iycH01
3CCEA 4POFA 1Y1VG 1B7YB 2JA9A 1EUJA 3NEMA 4P74A 3UE1A 2DGYA 1KIXA 1I3QH 4DR5L 4NXNL 4UPAA 4DKAC 1QZHA 2JA7G 1I5FA 2OQKA 3GTOH 1E3PA 2NZHA 2K4KA 1SN8A 1OXUA 4QL5A 3KDFA 3OTOQ 3G6EA 1HR0L 1X3FA 1VQKA 2B63H 2RHQB 5H1SE 4PG3A 3T1HQ 3HOXH 1VQIA 3B6YA 4X64Q 2Z0SA 1PH1A 1Q1BA 2WP8J 3S1RH 2UU9L 4JI2L 4A3DG 1Q46A 2CWAA 3CPFA 2UXCQ 1C7YA 1TXYA 4EX5A 5HY6A 2OTLA 4LFBL 3HOUH 2VS1A 2YTXA 4Y52H 3A5ZB 3ULPA 1PH7A 1VQFA 4R4TA 1Q86C 3FKIH 1L2FA 3D31A 3WWVA 2K52A 3CPWA 4GNXA 1PA6A 4KHPL 3I55A 2I5HA 1HNWQ 4X65L 5AJ3L 3BU2A 5FLXc 4B3SL 4YWMA 2IT1A 2IX1A 2KHJA 2D0PA 2OWOA 1SE8A 2PQAB 4X66L 2BA0A 3PGZA 3KFUA 1AE2A 4YY3L 4DV3L 4B3TL 1HNXQ 3AYHB 5EAYA 1VQ8A 1Y1VH 3L7ZC 4QQBX 1K73C 1MKHA 1CKNA 4DAMA 5JEAJ 1A0IA 1SLJA 3MXNB 2OQ0A 3GO5A 1PH8A 1XNRL 4LF4L 1GVPA 3HFZB 5IP9G 4DR6Q 3MEFA 5LMUQ 2HQLA 3CCJA 4A3IH 3CCQA 2ZM6Q 2UUAQ 1JB7A 4JBKA 2R93H 3HKZE 2JQOA 4JBJA 2JE6I 5IYCH 1XMQQ 3JAMi 3GTPH 4IOCA 3M4QA 2KHIA 4BY7H 3CMAA 2LXJA 4JI1L 1JJGA 3UDIA 5C0XJ 3CCUA 1TWFH 1YBYA 2Q2HA 1PH4A 1DGSA 1K0RA 3DM3A 2CFMA 5DLQE 4LFAQ 4A3KG 2D0OA 1VQLA 2Q2UA 2AHOB 5J3BA 2ZTCA 1YHAA 3E9HA 3HOWH 3F8TA 4L5SA 3TS2A 4GNXB 4B3RQ 1VQCA 1OXTA 2PI2E 4R4CA 2PNHA 3J7A5 1N36L 1YHBA 2VQEQ 2GVBA 2JA7H 1BVSA 4UY8C 2K50A 3K80C 1M1KC 1V9PA 1SR3A 4JI3L 3KF6B 3F2DA 4AH6A 3G48A 3CD6A 1L1OC 2UUCL 3J81j 4LF9L 5LMNL 4BY1G 5BR8L 1QZGA 4YWKA 4BBSH 5HGQA 1UE6A 2K5HA 5IP7G 2MFIA 3I4NH 1LTLA 2N3SA 1HZBA 1YNXA 2E2JH 3STBC 3KDFB 1EQRA 1LYLA 5GROA 3RLFA 5IP7H 4GN5A 2WAQE 4OXPA 5GQOA 1HR0W 4P71A 3F1ZA 3K7AH 5IYCG 2C35B 1T9HA 2F3IA 4OONA 1KQSA 2ZTDA 4LF6Q 2A8VA 1GO3E 1WYDA 1CKMA 1BBWA 1FL0A 2CQOA 2NN6I 4DV7Q 3HOZG 2UXDL 4PZ7A 1YVCA 1N32L 1WFQA 4YCVA 3CCSA 2MNAA 3T1YQ 1NJIC 2QGQA 1C9OA 5C44G 4L5RC 4OX9L 4A3JG 1N33Q 3PUYA 3CF5A 5JJLA 2EXDA 1KHIA 1TWHH 1YJWA 3M4PA 4AQYQ 2FXQA 2F4VL 1K8GA 3HOWG 4NXML 2VY3A 3PSIA 4LFCQ 4B3MQ 2BH2A 1NBWA 3BZCA 3ULLA 4EQ5A 2Z6KA 4JI6Q 4JI4L 1AH9A 4Y7NH 4IPCA 4DUYQ 3S14H 1S72A 4BY1H 1IZ6A 2WAQG 3CCLA 5ELNA 4IJHA 1VQ4A 4K0KQ 1W3SA 3J7ZC 4X6AH 1G51A 4LF5L 1P16A 1HR0Q 2B63G 1UEBA 3M9BA 4YWLA 3H3VH 3FHWA 4YHHL 2R92G 2UU9Q 3CC4A 3AQQA 3PIOA 4J15A 2YU9H 2HHHL 1VQJA 2N8NA 4APVA 1CUKA 2BA1A 4GN3B 1XNQL 4O0AA 1N34Q 4GN4B 5M3FH 3RZDH 1S3OA 4XTCS 3OW2A 4IOAA 3SGIA 1Z47A 1B70B 4DV2Q 5AJ3Q 4JYAQ 3GTGH 4DPGA 3I56A 2WFWA 2HT1A 1L1OA 2I5MX 2AWNA 1JT8A 3H0GH 1VQMA 1AE3A 2JA6G 1U0LA 3A0JA 1KRSA 4A3DH 1EIFA 4A3CG 1YJ9A 2V1CC 5IWAQ 3S1MH 4A93G 4HJAA 1NTGA 5C4XH 3CC7A 4DR6L 4A3IG 4X62L 3S24A 2XGTA 4IPGA 2JA5H 2BH8A 1XPRA 1LUZA 4OWXB 4LF7L 3OTOL 1IBLQ 1KXLA 4JI0L 4A3GH 1Q81C 5C4JH 3GTMH 1QVFA 3TQYA 3T1HL 2IX0A 2KCMA 2R7FA 1MJEA 4LFAL 1TWGH 4DV6Q 3KF6A 4HJ7A 1M90C 2HIXA 2UUBQ 2L15A 4C3IH 1OTCA 1K3RA 4GKKQ 2K14A 5FLMH 3HOYH 1W2BA 5IT9c 4KHPQ 2KCTA 3CCRA 1GM5A 1HNWL 4X65Q 3PO3H 5IYDH 1XMOL 4DV4Q 1VQHA 1S40A 1SMXA 5C3EH 4X66Q 1N8RC 1NE3A 2YTVA 4BBRH 1TWAH 3VDYA 1HNXL 4LW1A 3F2BA 4HJ8A 2R6GA 2YYZA 4GOPC 2VNUD 1X3EA 4JG2A 3M4OH 4ALPA 1WCMH 1E1TA 4KLKA 4LF9Q 3PUZA 5C0XG 1J6QA 2VUMG 4LF4Q 1EWIA 3H3VI 5LMUL 1VQAA 3Q8DA 1VQ6A 3U50C 4C3JH 1NY4A 4BA1I 4BA2I 4AIMA 3KJPA 4JI8L 5ELOA 1XMQL 4JV5L 1K83H 1YI2A 1EQQA 2NN6G 3F2CA 5M3MG 4JBMA 2PMZE 1K9MC 1EIYB 4IFDG 3D0FA 2PQAA 3K0XA 4DV5L 3EN2A 3AFPA 2D62A 4TVAB 1VQDA 2Q2IA 3EIVA 4TQUS 3W5OA 5M3MH 4DR2L 3S16H 3TREA 5IYBH 1YIJA 2E5LQ 4DV0L 4JI7Q 4A3KH 1N32Q 1H95A 3T1YL 2VUMH 3CC2A 1N33L 3RLOA 3CMEA 3W1BA 1I94Q 2GN5A 1VS0A 4NB3A 2JEBI 5JJKA 4FDBA 4LUOA 4O2DA 4NXMQ 3HOVH 1V1QA 2MO1A 4QY7A 1VQ5A 3HOUG 4B3RL 3PO3G 3RN2A 3UDXA 3UDGA 4HJ9A 4BBRG 1A63A 1VQOA 4AYBG 1E7ZA 5IE8A 2K5NA 4IFDJ 1JJ2A 4JI4Q 3GTJH 4DR1Q 2E2IH 3J80c 4JI3Q 3RN5A 4BXXH 4DUYL 2R7DA 4R1JA 2UUCQ 1JJCB 1CKNB 2LXKA 5BR8Q 3I4OA 4OO1I 4OWWB 3PCOB 2CCZA 2OCEA 1YJNA 1IBKQ 1NMGA 3TS0A 4RMFA 1ASZA 1FJGL 2N49A 4UP8A 5M3FG 2NZOA 1UE5A 3PUVA 2HHHQ 3RNUA 1Q8KA 4P72A 1PVOA 2K75A 4A3FH 3OYYA 1BKBA 4GOPB 1P8LA 3ERSX 3G4SA 1J5EL 1HNZQ 1VQEA 1Q1EA 1WJJA 1X3GA 2RF4A 1A8VA 3K7UC 3ER0A 3NBHB 4MZ9A 3KJOA 3DLLA 4DV2L 3I4MH 2CWPA 4DR3Q 1E24A 5IP9H 4AQYL 1X6OA 2VQFQ 1Q82C 2F4VQ 1HZ9A 4A4IA 4GLAC 4LFCL 4OWTB 4JOIC 4GKJQ 1FVIA 4A3CH 2KENA 4DUZQ 5JJIA 2AKWB 5IWAL 4DV1Q 1PH3A 1QUQB 1G291 1YZ6A 3CAMA 3PO2H 4PZ8A 4X62Q 3K8AA 3J81i 4C3HH 1X55A 5GAEC 4BXXG 4UP9A 3GDEA 2I5LX 4A76A 3GD7A 4DR7Q 1X56A 4IJLA 1QVGA 1IBLL 2EQSA 4LUZA 1MJCA 4JI0Q 4A3GG 4A3EH 2E2HH 4L5QA 4DAYB 1O7IA 1XPUA 4KI0A 5JEAG 4P73A 3U58A 3KF8B 4LF8Q 2JJQA 3CP0A 1XPOA 2JK8A 2YTYA 4R4IA 3JAMc 2ALYB 4DR5Q 3I7FA 1E1OA 3CXCA 3M7NA 4ME3A 3L0OA 1VQNA 1Y1WH 1PH2A 4GKKL 1QUQA 5GAGC 5LMNW 5FLMG 1PV4A 4GLXA 2RCNA 2ES2A 2LSSA 5GAHC 2RHSB 4IFDI 1I6HH 1XTDA 3L2PA 5M5YH 3GTLH 4JC0A 1X65A 4QGUA 2ZTEA 3I2ZA 4JOIA 1WOCA 2ID0A 3HKZG 3NELA 1XMOQ 2E8GA 2GVAA 2Y0SE 3PUXA 4JI5Q 2UXCL 2YV5A 3W1GA 4HIDA 1JMCA 4GS3A 3ULJA 4QIWE 2H5XA 2MO0A 1VQPA 1CSQA 2WB1G 4DR4L 1E22A 4YCWA 1NMFA 2MQHA 4RG1A 4HIMA 1YEZA 1KL9A 1N9WA 4WJ4A 3PF5A 4DK6C 1Y1WG 1IBML 3PV0A 1Q7YC 4JYAL 2JA5G 3HOZH 1UWVA 4JV5Q 5K36G 4DNIA 3E0EA 4B3TQ 4LF7Q 2QEXA 3I4MG 5C3EG 3K81C 1OXVA 4A93H 4DV5Q 2B29A 4POGA 2JA8G 1QVCA 1VCIA 4DR2Q 2VW9A 3HOVG 4JI7L 1OXSC 1YITA 2E5LL 3I4NG 3CW2C 1BBUA 3U4ZA 4DV6L 2Q2TA 4GOPA 4NXNQ 2UUBL 3CCVA 1I94L 4A3BG 4YCUA 3PF4A 3M3YH 3A74A 1HZAA 5GADC 3PO2G 4A3FG 1GKHA 3U4VA 3NENA 4HIOA 2I0QA 3GTQH 3TRZA 3S2HH 1V43A 3BJUA 4X64L 4HIKA 4DV4L 4JI2Q 2R7ZH 3S1QH 1HZCA 3CCMA 4GLVB 1VQBA 4LFBQ 4A3JH 1UE1A 4DR1L 1IYJB 4C2MH 2DUDA 2Y0SG 1VQGA 1X54A 2PI2A 2ZJQA 3BZKA 2VL6A 3IRBA 1CSPA 4A3MG 4LNQA 1N36Q 5M5WH 2VQEL 4B3SQ 1KC8C 3KOJA 1Q12A 4PMWA 2NVYH 1KRTA 4JI8Q 1XJVA 5E7NA 1U5KA 2AWOA 2NVTH 3FP9A 3CQZH 4YY3Q 4DV3Q 4IPHA 4GNXC 4UP7A 3PIPA 1EYGA 1RL2A 1FGUA 1YHQA 1XNRQ 1HH2P 4XIGS 1X9NA 2JA6H 1Y14B 2OTJA 2HIVA 2EIFA 3HOXG 4DV0Q 1HNZL 1EFWA 4WJ3M 3JC66 1MIUA 2VZAA 2ZM6L 2IHEA 4NPSA 1PHJA 2UUAL 3S15H 2R93G 2WB1E 3STBD 3HKSA 1ASYA 1SFOH 4DR3L 1CKOA 3TEHB 2VQFL 2XTIA 1IL2A 1GD7A 1I50H 1PYSB 1VQ9A 4JI1Q 4A75A 4GKJL 4PZ6A 2K5VA 2UXDQ 4P75A 3GTKH 3EBEA 2UXBL 3KLWA 3LGJA 4IO9A 1A62A 2N78A 3UE0A 4OX9Q 4AYBE 2Z6KC 4LWCA 5C0XI 2R92H 2B3GA 4JCVE 1PH5A 1L1OB 2JA8H 1R9TH 3PUWA 3S17H 4BBSG 4R4OA 4H02A 3KYHC 3J81c 4DR7L 1VQ7A 1D8LA 2AMCB 4B3ML 2IY5B 4A3MH 1IBKL 1FJGQ 1RIPA 4IPDA 2NVXH 1G6PA 3RR5A 4JI6L 1WI5A 1PFSA 1UE7A 2F52A 1PYBA 3AFQA 5IYDG 2QA4A 3AEVA 3E9IA 3ICEA 2R7ZG 5C44H 3S1NH 4K0KL 5LMNQ 4MTNA 2CKZB 4LF5Q 1J5EQ 5M5XH 4JBWA 2ATWA 2JEAI 1WCMG 1SRUA 4MNOA 4QJFA 3ZJYC 4YHHQ 4LUVA 2ZJPA 3G71A 5C4XG 1EOVA 1K8AC 1TWCH 3RLNA 1KAWA 4A3BH 4JI5L 4A3LH 1OXXK 4LF6L 3FKIG 4DV7L 2ZJRA 1D7QA 1XNQQ 4DUZL 1N34L 4DR4Q 4OO1G 3A5UA 1SROA 3RZOH 1HJPA 4DV1L 2A1AA 4L5TA 4HJ5A 1PH6A 3UDFA 4DK3C 4BY7G 5FJ8G 1LM0A 4KHZA 5IY0A 2UXBQ 1KD1C 3H15A 2ASBA 1IBMQ 1JE5A 1Z9FA 1L0WA 5FJ8H 5IYBG 1B8AA 2IHFA 3J80i 3H0GG 2A19A 4A3LG 1IXRA 4R4QA 3M85A 1PH9A 3S2DH 4A3EG 2NVQH 1C0AA 3HOYG 2KBNA 4LF8L
chains in the Genus database with same CATH superfamily
1Y1VG 1KNEA 5JPMC 4A3JB 3UE1A 1AFPA 4C3JG 5CBEE 3NK9A 5ELBA 4R8IA 2HUGA 4UPAA 3S1QB 2JA7G 1I5FA 2OQKA 1EIGA 3IL8A 3GTOH 1B9MA 4QL5A 3KDFA 2R93B 4C2MB 3MFYA 1SYBA 5H1SE 3C1EA 3T1HQ 3HOXH 4X64Q 2KEEA 1PH1A 2UXCQ 4EQPA 1TXYA 3OOCA 1LTAD 4LFBL 3HOUH 2YTXA 1VQFA 4R4TA 3FKIH 2K52A 1ICWA 5FLXc 1IYUA 1RKNA 2OWOA 4X66L 2BA0A 3KFUA 5G3LD 1AE2A 4YY3L 4DV3L 5KRUA 1HNXQ 2WV6D 2BDNA 4CDEC 3L7ZC 1MKHA 1F2ZA 4LF4L 1JOKA 2B2WC 3MEFA 4WRDA 4CBVA 3QWNA 2R93H 3W3AA 2JE6I 5IYCH 2B63B 1PLFA 3JAMi 1SE3A 4IOCA 3J80L 1PTOF 3CMAA 1G8ZD 2LXJA 4MIUA 3KLSA 5C0XJ 5C5MA 1LTID 2CFMA 1VQLA 3ND9A 2Z4HA 5J3BA 1TU2B 2F0DA 3E9HA 2EYJA 4RGOS 4GNXB 4B3RQ 1VQCA 1F9RA 1OXTA 4R4CA 5I9PA 4G7OC 3QG1A 1BVSA 2D2CC 5C4JB 4ZCKA 2SOBA 3F2DA 3I4LA 3NBHA 4TSSA 3G48A 1DJRD 2UUCL 2GA4B 5LMNL 1HPCA 1NNXA 4CDDC 2FFKB 3CRKC 3CQZB 4BBSH 1UE6A 4A93G 2Z4IA 2DNEA 4KV6A 5IP7G 3DWPA 3RLFA 5BN4A 1GHJA 2M00A 2KCCA 3GV6A 4M1UB 1GJXA 4P71A 1QOHA 2NWGA 4OONA 1KQSA 2ZTDA 1GO3E 4DV7Q 1BBWA 3HOZG 2YU9B 2EY1A 2F3VA 4PZ7A 5EQ0A 1N32L 1WFQA 1F77A 2QGQA 5C44G 4OX9L 5M3FB 3PUYA 3RZDB 1KHIA 2FHTA 4KY5A 2VY3A 5M3MB 3ERQA 1JWUD 1YNJC 1F2LA 5EKIA 1KAAA 3VR4A 5I4DA 1WTQA 4DGZA 2IPKD 2Z6KA 5DAUA 1SNMA 1PTOB 4Y7NH 1AH9A 3BDOA 4OGQC 2E75C 1S72A 2WAQG 1DXMA 1DYQA 4IJHA 5ELNA 4K0KQ 1W3SA 3J7ZC 1FYCA 4CGYB 4YWLA 3IKJA 3FHWA 4J15A 2YU9H 2O2LD 3A8IE 3E5SA 2QEJC 3OMCA 4IOAA 4Z9CB 1KLGD 5AJ3Q 4BS9A 3MA2B 2B2WA 3MXGA 3GTGH 1U4LA 1L1OA 2K1BA 3GTKB 3L9AX 3H0GH 2QKIC 3A0JA 2V1CC 3X3NA 1NTGA 4FO2A 1QB5D 5LHY1 5JVH3 2XGTA 4IPGA 2BH8A 2F0QA 3T51B 5C4XB 2RKSA 1X32A 3OTOL 3S15B 1U4MA 4A3GH 1SFOB 5JPNC 3GTMH 1MJEA 3A54A 2PZTA 3OHXC 1IYVA 4JW0A 2BE5D 1E2VA 1K3RA 1SYDA 5FLMH 1W2BA 3CCRA 4C3IB 1FGBD 5FOBB 4X66Q 2PPBC 2BE5C 2OXPA 3VDYA 1EEFD 3PO3B 5D14A 2R6GA 1X3EA 4ALPA 3U9OA 2EDGA 4LF9Q 2OF1A 1J6QA 2VUMG 4LF4Q 3H3VI 5LMUL 1VQAA 3Q8DA 3U50C 1NY4A 4AIMA 1HCZA 2KEDA 2OT2A 4RCNA 4JVZA 1W6JA 4UDUC 4A3EB 1C8CA 2PMZE 3D0FA 4DV5L 1VQDA 2Q2IA 2K03A 3EIVA 4TQUS 4DR2L 1HA6A 1N33L 3FDTA 1VS0A 4FDBA 1EWCA 1CTMA 1SNPA 4NXMQ 2MO1A 4B3RL 2ZXOA 1MSHA 5D65A 3SK4A 4X3SA 4HJ9A 1STNA 5IE8A 2K5NA 1H9RA 1JJ2A 3GTJH 1QWYA 4DR1Q 1JICA 2B39A 4XQJA 5EPKA 4R1JA 1JJCB 4L8JA 4OO1I 4OWWB 2CW0D 2CCZA 1YJNA 4XT3B 1ASZA 3GTQB 3R2TA 5C44B 3S1NB 4A3FB 1KDCA 3RNUA 2QDLA 4FF4A 1A3UA 2K75A 1BKBA 4GOPB 4PQXA 3ERSX 3K7AB 4A3DB 1HQMC 1SSOA 3NBHB 3KJOA 3K7UC 1S5BD 1T5XD 3NQIA 2CWPA 4DR3Q 1IW7D 2VQFQ 1HZ9A 1SXTA 1AN8A 4KK7A 2NVTB 1NR4A 5JEAH 3VYTA 2KENA 5JJIA 2F0EA 2AKWB 1QJOA 1KTKA 3J81L 1PH3A 1Z6HA 4PZ8A 3J81i 3EQLC 4C3HH 1DM0B 3NTHA 4UP9A 2I5LX 3GDEA 3IFDA 1X3PA 3GD7A 4EQOA 1AEXA 1X56A 4IJLA 2EPBA 4IN3A 2EQSA 4LUZA 3NBIA 1IBLL 3WOFA 4K8JA 3M7GA 4DAYB 2E2HH 1XPUA 4KI0A 2KQ3A 2K32A 3KF8B 2YTYA 3JAMc 4A3KB 4ME3A 2JSOA 4V0BA 1Y1WH 1VQNA 1QUQA 2RCNA 1SYCA 4FYDA 3L2PA 3R93A 1X65A 2ZXPA 1WOCA 2ID0A 2E8GA 2UXCL 5LL6X 4GS3A 1SAPA 5KGUA 1AZQA 2B2TC 3OMGA 1LT6D 4OELB 4F7XA 5IGDA 1EYDA 3S9WA 1TT2A 1IBML 4RKLA 1Q7YC 4WORA 4JV5Q 3E0EA 2NVYB 5C3EG 2K04A 2K33A 1PTOH 4POGA 1QVCA 3HOVG 1NR2A 3CW2C 3JAME 1BBUA 5I6YA 1I94L 2IL8A 3D6CA 5DM63 3VA5A 2F0KA 3H3VC 3KBGA 4YCUA 3O13A 2RCFA 5GADC 3PO2G 1H9SA 3GTQH 3I91A 3BJUA 3MTSA 1I3QB 5D3IB 2Q8RE 2PMZB 4GLVB 5IODA 2KECA 4LFBQ 3HOYB 1PFNA 3IRBA 1CSPA 1NAPA 5T1GA 5FLXL 1PZKD 1N36Q 1LTSD 4B3SQ 3HZXA 1S4ZA 2A6HC 2NVYH 4BBSB 1SNQA 5J22A 1XJVA 1BOSA 1NUCA 3QR8A 3S1RB 2MJ8A 1WTXA 3PIPA 2NVXB 1MBYA 1EYGA 3V2TA 1TR5A 1HH2P 1MSGA 1Y14B 4QUCA 2EIFA 1TKWB 1I6HB 2PQEA 1ESRA 3GTLB 3KUPA 4NPSA 3S15H 2R93G 2WB1E 3J80E 2KUMA 2BOSA 3TEHB 2VQFL 3GTMB 1IL2A 2JN4A 1I50H 2TSSA 4GKJL 4PZ6A 2G5DA 2UXDQ 4FXDA 4P75A 1BCPD 3GTKH 5J1ZA 1B44D 2R3ZA 4MHEA 1JWMD 2SDFA 2L5TA 5C0XI 3PUWA 5M5WB 2K5WA 3RMHA 1XXGA 3KYHC 4K6LA 2AMCB 3DEOA 1IBKL 1S5CD 1FJGQ 4YIJA 4IPDA 2NVXH 3RR5A 2A68D 1U9RA 1VF7A 4JI6L 2F52A 4A3MB 5CYUA 4IFDH 5LMNQ 1R4PB 1DONA 4IUVA 4K2KA 2ATWA 2H4OA 2JEAI 2DJFC 2ICIA 2F0HA 4LUVA 2ZJPA 2RA4A 3G71A 1K8AC 1D6EC 1EZ8A 1XNQQ 4UAIA 1N34L 1IL8A 1HJPA 1PH6A 3MVVA 1LM0A 5IY0A 1KD1C 1B4OA 5FJ8H 1S5DD 3D4RA 2IHFA 1A15A 4HAEA 3H0GG 1Y69U 2O5IC 1PH9A 3S2DH 1C0AA 4NMZA 3HOYG 5EPLA 1SMYC 4P74A 4NXNL 4DKAC 4XQNA 3P7JA 1F9SA 1J9OA 1XX8A 4KJOA 3OTOQ 4I7ZC 1HR0L 4PG3A 3GTOB 2WINB 4ZUJA 2Z0SA 3S1RH 1FR3A 4G7HC 4A3DG 1Q46A 2OTLA 3CKIB 4Y52H 4OO1H 1ENCA 5CORA 1PH7A 5C3EB 1ENFA 1L2FA 3BYYB 2RSOA 4HCEA 5I9OA 3EA6A 1IW7C 4KJNA 4X65L 4YWMA 2IX1A 3LWUA 4IUUA 5I2XA 3C2PA 4C3HG 4BWGB 1HHVA 3OWEB 1V1PA 1W6KA 5EAYA 1VQ8A 1Y1VH 4QQBX 1K73C 3OW7A 1A0IA 1SYFA 1XNRL 1PH8A 4C3HB 1LTTD 3HFZB 5IP9G 4DR6Q 2EOTA 4J1MA 3CCQA 1F9PA 2ZM6Q 3HOZB 4KD3A 1XMQQ 1CQFA 1STAA 3K58A 1BR9A 3M4QA 2AQ3B 3UDIA 1PH4A 4LFAQ 2D0OA 2EY5A 3F8TA 3K0YA 1LABA 4GZYC 4F88A 1IKMA 4QF4A 3S2HB 4XDXA 2PI2E 3VR6A 5CV6A 2K50A 1H9SB 5K36H 1SR3A 3OSOA 5G3LF 2CH4A 3K5MA 4YWKA 5HGQA 1BUVT 1LTLA 1EQRA 2A69C 5GQOA 4OXPA 1O80A 2JA6B 1WTOA 2C35B 3TDQA 2NVQB 1GUTA 1SJHD 5F2DA 2JXMB 1CKMA 1FL0A 2CQOA 3D4DA 2NN6I 2UXDL 1O7ZA 2QCPX 3A7AB 4C3JB 2F4VL 2K6AA 1DZ1A 1Z7TA 1K8GA 3HOWG 5IGFA 2BH2A 1HUMA 1O7YA 1NBWA 2R92B 3ULLA 4EQ5A 4JI6Q 4JI4L 2AQ2B 5AFWA 2CQAA 1AZPA 3TBIB 1CQVA 1G51A 1P16A 5KNDA 3QIAA 2UU9Q 1TWFB 3AQQA 1OO9B 1S5ED 4DXGA 5CV9A 1VQJA 1SYEA 1STBA 5FLXE 1XNQL 4O0AA 5FKAC 3Q6SA 4GN4B 1O78A 1S3OA 2WB1B 5M3FH 4XTCS 3RZDH 3SGIA 4DV2Q 2F1MA 3TP7A 4DPGA 1STGA 1BXTA 2IW3A 2DY7A 3FMCA 4RAUC 1VQMA 1EIHA 1U0LA 2Z9HA 1KRSA 1EIFA 4ZQ3A 1FD7D 3N6RA 1I4RA 1LT3D 4OIJA 3CC7A 5ELDA 4DU9A 5C5LA 3DWAA 2F0TA 4OWXB 4LJZC 1IBLQ 3HOWB 1KXLA 4JI0L 1AP0A 5C4JH 4V190 3T1HL 2IX0A 2R7FA 3AU7A 1SJED 1TWGH 5CC4A 3OWFA 2JYOA 1I4XA 1TWHB 1EOTA 2K14A 1C48A 3HOYH 3HKZB 4X65Q 1LTBD 2SNMA 1IKLA 3CU7A 5IYDH 1S40A 1Q8IA 2JP1A 4RKBA 1N8RC 1NE3A 2YTVA 4BBRH 1TS4A 2H1EA 1UNSA 1HNXL 4LW1A 1TQOA 4HJ8A 1EY0A 1JQYD 1PZJD 2XNAC 2VNUD 3K5OA 1WCMH 2PO4A 3NWTA 3PUZA 5C0XG 1K83B 1VQ6A 4C3JH 4BA1I 2K7VA 2PW5A 4JI8L 1XMQL 2B2VC 4CJ2C 1L0YB 3F2CA 3AFPA 5M3MH 4ZKCB 3BYTB 4JI7Q 1N32Q 4DV0L 4A3KH 4RH6A 1H95A 4H13C 2VUMH 3CMEA 1A3TA 1Y8PB 3W1BA 1AW7A 5JJKA 2QILA 1DOKA 1UEAB 1D1KA 1PTOC 1E7ZA 4IFDJ 4JI4Q 4BXXH 1V1PB 3RN5A 4CDCC 4FF3A 3W2DA 3VYSA 4R9WA 3PCOB 2A69D 4LMQD 1K28A 1NMGA 2FMMA 1QILA 5A2QE 5EGTA 1UE5A 2MUYA 3SEBA 4I7AA 4P72A 1GUWA 2J4XA 1PVOA 5CBAE 2HQEA 4A3FH 3OYYA 1WTVA 1KABA 1X3GA 4JYAL 1K0SA 3R2IA 1E24A 3KBXA 3WOEA 1X6OA 5IP9H 4AQYL 5DEHA 4A3GB 4GLAC 3SK8A 1TY0A 4GKJQ 1FVIA 2ZXRA 3P1HA 4DFAA 4DUZQ 4C1NI 5IWAL 1TWGB 2RDHA 3D4WA 5CV8A 5KYIA 3NUCA 1LTGD 1NCVA 1X55A 4BXXG 1JOOA 3AB9A 3L3OC 5DM73 1WTRA 1O7IA 4MTKA 4P73A 3HG9A 3H94A 5T1IA 2JK8A 2VXWA 1XYIA 2ALYB 4DR5Q 2L4NA 2WAQB 1PH2A 1F2MA 5GAGC 5FLMG 1PV4A 4IFDI 5GAHC 2RHSB 1XTDA 1YNND 2CHBD 3GTLH 5ELEA 4UHVA 4QGUA 1EY6A 4JK1C 3HKZG 3FKIB 4G4KA 2NTTA 4ZKBB 2B2UA 2Y0SE 3PUXA 1STYA 2YV5A 3MXNA 2MO0A 2E2IB 1EEID 2E76C 1SYGA 1EYCA 1E22A 4YCWA 1NMFA 2J0TD 4RG1A 5C0XH 1YEZA 1E2WA 3HOZH 3SK6A 5NUCA 4DNIA 4KTAA 5I6WA 3NWSA 2JA8G 2K05A 1VCIA 5E1FA 4K2LA 2VW9A 4JI7L 1SMYD 2Q2TA 4NXNQ 3A7LA 4A3BG 3E6ZX 1M4VA 4RGTA 4HR7B 1HZAA 1GKHA 4RWSC 3U4VA 2I0QA 1UAPA 1F9QA 1V43A 2A6EC 4DV4L 4JI2Q 2R7ZH 3D3RA 1HZCA 3S1QH 1CT1D 3OIQA 4E6IA 1VQBA 1Q90A 1IHZA 1UE1A 4DR1L 1IYJB 1GUNA 1VQGA 1X54A 4FNFA 2VB2X 3BZKA 4LNQA 1V1OA 4RHSA 4A3MG 3H09A 4PMWA 4JI8Q 1U5KA 2NVTH 3FP9A 3DUZA 1G2TA 4UP7A 3K6OA 3NTKA 1B3AA 2EYLA 1XNRQ 2F0WA 2HIVA 1EFWA 1LTRD 1TVXA 3F2UA 3JC66 2VZAA 2ZM6L 1PHJA 1EU3A 4FVMA 5ELFA 1I4QA 1PYSB 4A75A 2K5VA 2K01A 1G6ZA 3KLWA 3LGJA 5KYLA 4K5WA 2N78A 3X3MA 4AYBE 3MXPA 1QE6A 4KKTA 1I4GA 1PH5A 3S17H 4L6TB 1R9TH 4BBSG 1D8LA 1QNUA 4B3ML 4DAVA 4A93B 3MHBA 1RIPA 2EJMA 2XRQD 4K6DA 1RF2D 1PFSA 1UE7A 3AFQA 1PYBA 2EZVA 4X3UA 1UUPA 1TS2A 4K0KL 1B3QA 5EPJA 3BDCA 4MNOA 4QJFA 1FNWA 2C5CA 4CKBA 1EY5A 3P75A 1TWCH 1GHKA 4AYBB 1OXXK 2RQXA 3RZOB 1JC7A 1ZEQX 3QOLA 2CH4W 2ZJRA 3SE0A 4A3BB 2A1AA 4HJ5A 3UDFA 4RCOA 4KHZA 2ASBA 3H15A 1JE5A 1Z9FA 3NPPA 5IYBG 5IT9L 3H6MA 1B8AA 1PRTC 4Q0FA 3M85A 2XWJB 4QCLA 2KBNA 3BZDB 3CCEA 4POFA 2JA9A 1EUJA 2KHSA 2DGYA 1KIXA 3TP5A 5EJWA 1E3PA 2K4KA 1SN8A 1OXUA 2VUMB 1PRTF 1X3FA 2N88A 5CGKA 2UU9L 1Q1BA 4JI2L 2CWAA 3FEWX 4EX5A 5HY6A 2VS1A 2V4DA 2PZUA 1Q86C 3CPWA 2EE1A 3D31A 3DXJC 3I55A 1XTCD 5AJ3L 3BU2A 1BQQT 5EKKA 2IT1A 2KHJA 2D0PA 5IGCA 1EQVA 2PQAB 2E2DC 2XVSA 4B3TL 3GP7A 1ZKOA 2A73B 2MGSA 3NTIA 3K59A 1CKNA 4DAMA 3MXNB 1SLJA 5ELCA 2OQ0A 3GO5A 1CA6A 5LMUQ 2HQLA 4A3IH 2X6GA 1JB7A 4JBJA 2JQOA 1FNUA 3BS1A 2KHIA 4BY7H 4HMIA 1JJGA 3CCUA 2NUCA 1TWFH 3VYRA 1NSNS 2UXBQ 5K36G 5DLQE 2AHOB 1WVLA 4L5SA 3TS2A 1QG7A 3A56A 3PQIA 2ENBA 2FMCA 2GVBA 4IUQA 2JA7H 3K5LA 2A5HA 4UY8C 1TWCB 4FF1A 3QB3A 5M5XB 1STHA 1V9PA 3A8JE 1Q3LA 1RDPD 2DY8A 2DNCA 4AH6A 4A3IB 5BR8L 2F0SA 1TIID 3CRLC 1HTPA 1HZBA 1YNXA 2RDGA 3STBC 4DAPA 2E2JH 5GROA 4BY7B 1QNKA 4GN5A 2WAQE 5M9OA 3F1ZA 5IYCG 1T9HA 2F3IA 1WYDA 3TZDA 4LAAA 1D5ZC 2XWBB 4YCVA 1YNNC 2MNAA 3CCSA 3T1YQ 1NJIC 1C9OA 1WTHA 1BNZA 4L5RC 1ZYRC 2EXDA 1ESFA 4NXML 3D8GA 1G2SA 4H7BA 4HSVA 3PSIA 2L11A 4TKOB 1BF4A 4LFCQ 3R8BA 2EJGC 2PCFB 4DUYQ 4U673 4BY1H 3CCLA 4H0LC 1VQ4A 2LMCB 2SNSA 1UEBA 3M9BA 4XXEA 4YHHL 2R92G 3CC4A 1MI2A 4G7ZC 2HHHL 1EZ6A 4QB4A 1EL0A 4KY6A 1B1ZA 4APVA 1CUKA 2BA1A 1ET6A 3HGBA 5IOCA 4DA2A 1JE4A 1Z47A 4ZUIA 1B70B 1Y1VB 4JYAQ 1RJTA 1BCPC 1ENAA 2LFNA 4PNYA 2EJFC 2I5MX 3G7LA 1AE3A 2NB0A 4A3CG 3BVZA 1YJ9A 5IWAQ 2JA8B 1PMRA 2E74C 4X62L 3S24A 3Q0AA 1PTOD 3I4MB 2JA5H 1F2YA 2EYMA 3MWYW 2KA7A 3Q23A 1LUZA 5CV5A 4LF7L 2X69A 4KY7A 1Q81C 4K8IA 4ILWA 4LFAL 3IAYA 4DV6Q 3KF6A 3BDLA 2L15A 1OTCA 5HGTA 4GKKQ 5IT9c 1S5FD 2WKDA 5J39A 3HOVB 4DV4Q 1SMXA 5C3EH 4U68A 1TWAH 3SXHA 1SE2A 4Y7NB 3F2BA 2DJGC 2YYZA 4GOPC 4KLKA 1E1TA 1XWEA 2JA5B 2LY7A 3KLSX 4MN3A 3VR2A 3VYUA 2M9VA 4RGNA 3KJPA 3I90A 4RFBA 3E0JA 1K83H 2NN6G 4EQNA 4IFDG 1EIYB 2PQAA 3K0XA 3EN2A 1BBXC 1HFNA 3MAQA 3TREA 1YIJA 1ICFB 1J8IA 3VA7A 1I94Q 3J7AF 2LS01 3GTGB 2GN5A 4NB3A 1YNJD 1DOLA 4O2DA 2QDBA 5I2YA 1VQ5A 3HOUG 3RN2A 3I70A 1TWAB 3R3OA 1VQOA 1G91A 3V96A 2NN6H 4JI3Q 4C1NK 4KN4C 2R7DA 3TN2A 1CKNB 5BR8Q 2I07B 3SHLA 2L9HA 2OCEA 1IBKQ 1WD1A 4UP8A 5M3FG 2NZOA 3PUVA 3A55A 2HHHQ 2B8FA 1EQTA 1D2BA 1LV9A 2MPMA 4FXGC 4B9XA 1MGSA 4N8X1 1J5EL 1LACA 4B9WA 1HNZQ 1VQEA 1Q1EA 3DLLA 4DV2L 3I4MH 3ER0A 1VMCA 2Z8LA 1JOQA 4A4IA 3H91A 1T5EA 3OPOA 4FXKC 4OWTB 4LFCL 4ZLTF 4JOIC 4A3CH 4IZ8A 3S2DB 4DV1Q 1QUQB 4NKLA 1VDZA 3MFGA 4KMUC 4IUPA 1L0XB 3K8AA 1ET9A 4DK1A 5GAEC 3J7AV 3HEJA 4DR7Q 3FRPB 3SDZA 2J7ZA 1QVGA 3WDNA 4JI0Q 4A3GG 4L5QA 5ISRA 1HQRD 2F0LA 3CP0A 1I4PA 2A6ED 3M7NA 4DNTB 3SVMA 4GKKL 1DD2A 1KNAA 2LSSA 4H44C 1I6HH 4JC0A 1PFMA 2ZTEA 3I2ZA 4JOIA 4XQQA 1XMOQ 4P2CB 1RCVD 2F0OA 4HMJA 2GVAA 4JI5Q 3MZ5A 3W1GA 2B2UC 1JMCA 4KN7C 3GTJB 1VQPA 1CSQA 2F0JA 1VMPA 2WB1G 4ABNA 4CKCA 1KDAA 4HIMA 4O1NA 1EY7A 4HCSA 4DK6C 4WJ4A 1EYAA 2JA5G 1CI3M 1UWVA 3I4NB 5FO7B 2MP1A 3K81C 1OXVA 4A93H 4DV5Q 3D6WA 1I4HA 1YITA 3I4NG 3U4ZA 4DV6L 2UUBL 3CCVA 2O5JC 1JB3A 1GOZA 2NYZD 4EGVA 1PXUA 2AUKA 3PF4A 1HUNA 1RTOA 3FVQA 4A3FG 1ZXTA 3NENA 2Y0SB 4N9PA 2EY2A 3S2HH 1CHQD 2EVBA 3HS0C 4X64L 4HIKA 4N9TA 1RD9D 3CCMA 1GXDC 4CKEA 3K57A 4C2MH 2Y0SG 2PI2A 2Q8IB 2G9HD 3HOXB 3QJYA 4ZYSA 2B2YC 1JWSD 3KOJA 1B9NA 1Q12A 1KRTA 1U4RA 4OIKA 3CQZH 5A2QL 4IPHA 1H9KA 1RL2A 1X9NA 2JA6H 4X3TA 4WJ3M 2NZ1D 3EROA 1HNZL 1MIUA 2IHEA 1ASYA 2B2VA 2F0MA 4DR3L 1CKOA 5E4WC 2PW7A 4HTHA 5IGBA 1E2ZA 4JI1Q 3AMUA 2VB3X 3EFXD 5IGEA 2EY6A 1A62A 3P20A 1EY8A 4OX9Q 2Z6KC 2FINB 4LWCA 4JCVE 2JA8H 2IX3A 4ME5A 4R4OA 4H02A 1QCBD 3NSWA 3J81c 1VQ7A 1PRTB 3PIO3 2RDFA 1G6PA 4ZK9B 1WI5A 5IYDG 2L1BA 3AEVA 2F0FA 1CZGA 3ICEA 4F8MA 5C44H 3S1NH 4MTNA 2O4XA 3M3YB 1J5EQ 2KOLA 4JBWA 1WCMG 1SBBB 3ZJYC 4YHHQ 1JR0D 1EOVA 2F03A 4JI5L 4A3LH 1TS3A 5JAVA 2HCCA 4J6HA 2X6LA 4DUZL 4OO1G 4DR4Q 3GV3A 1SROA 4DAYA 3RZOH 3HOUB 4L5TA 4DK3C 4BY7G 2ZT9C 3T4AC 5C3XA 5JOBA 4OEMB 1IBMQ 2MHVA 2AQ1B 4CHTB 4A3LG 5FO9B 1FNVA 4LF8L 4ID6A 1LT5D 1B7YB 3NEMA 1CK1A 2NTSA 1I3QH 4DR5L 4KD4A 5EKLA 1QZHA 2NZHA 3Q22A 1E0BA 1VQKA 2B63H 2RHQB 1B53A 3GTPB 1VQIA 3B6YA 2WP8J 5EBCA 3CPFA 1C7YA 1GUSA 3A5ZB 3ULPA 1PRTD 3WWVA 4GNXA 1PA6A 4KHPL 2F0IA 3A8KE 2I5HA 5LL6S 1HNWQ 4B3SL 3LWEA 3PIP3 1SE8A 1WCMB 3PGZA 2B2TA 3AYHB 5JEAJ 2HDLA 3K5NA 1H9MA 1GVPA 4KKUA 2RBMA 3CCJA 2UUAQ 4JBKA 3HKZE 2F4IA 3GTPH 1DOMA 2F0PA 4JI1L 1EY4A 3DWQA 5EBDA 2Q2HA 1YBYA 2A68C 4IURA 2KVMA 1DGSA 1K0RA 3C1FA 3DM3A 2Q2UA 4A3KG 4FP5D 2ZTCA 1YHAA 5E4XA 3HOWH 5M5YB 5E3FA 4Q5VA 3DEPA 3HRZC 3N52A 3J7A5 2PNHA 1N36L 1YHBA 2VQEQ 3LNNA 4HEDA 4PMBA 2EXZA 3K80C 4OL7A 4XYQA 1M1KC 4JI3L 1K8MA 3KF6B 4DF7A 3MXUA 3CD6A 1L1OC 1I6VC 4I65A 3J81j 4LF9L 4BY1G 1QZGA 2K5HA 3I4NH 2MFIA 2N3SA 4BBRB 1II3A 3KDFB 2IWHA 1LYLA 3BVGA 5IP7H 1KDBA 4B08A 2HDMA 1HR0W 4L63B 3K7AH 2RVLA 2E2JB 4LF6Q 2A8VA 2F0GA 2XSCA 1YVCA 5CMDA 1Y8NB 2B8GA 4X3KA 1N33Q 5JJLA 4A3JG 2AUJD 3CF5A 1STEA 1YJWA 1TWHH 4FF2A 3M4PA 4AQYQ 2FXQA 3I3CA 4B3MQ 1B2TA 4WFN3 3H0GB 3BZCA 2PZWA 1BDOA 4K14A 4IPCA 3S14H 1IZ6A 4DXFA 4X6AH 5C3WA 4LF5L 1HR0Q 1GUGA 2B63G 2HD3A 3H3VH 2L0CA 4QMGA 4IQZA 3PIOA 5C4ZA 1WD0A 1SNOA 1BCPF 1SNCA 2N8NA 4PMCA 4IALA 4GN3B 5CR3A 1SDFA 4K5VA 2QW7A 1N34Q 3FPUB 2WIIB 2F0UA 3OW2A 4CDFC 1RTNA 3I56A 2WFWA 2HT1A 4TRDA 1CZWA 2AWNA 1JT8A 3DHQA 3NQTA 2JA6G 4A3DH 1EY9A 3S1MH 5KEEA 1EWHA 5IT9E 3S14B 4IUTA 4HJAA 1X3QA 5C4XH 4DR6L 4A3IG 3NP8A 3UI2A 1XPRA 4EVOA 2JA7B 3I72A 3EJIA 1QVFA 3TQYA 1CHPD 2EYHA 2KCMA 4ZAIA 1H9JA 2KCNA 4HJ7A 1M90C 2HIXA 2UUBQ 3PO2B 4R8NA 4C3IH 4KHPQ 5A35A 3T53B 2KCTA 1PYWD 4NW2A 3J7YW 1GM5A 1HNWL 1RHPA 3M4YA 5K5PA 3PO3H 2M2LA 5L37A 1XMOL 1VQHA 2C9OA 1R4QB 3URYA 5FO8B 4S3SA 2K5QA 2EYFA 4RHRA 1CM9A 4JG2A 3M4OH 1U4PA 1Y1WB 4M8AA 5TSSA 1EWIA 1BCPB 5KNCA 4BA2I 2RSNA 4ULLA 5ELOA 2PNRC 4JV5L 2L55A 3DM1A 1YI2A 1EQQA 1KLUD 4JBMA 5M3MG 3OIPA 1K9MC 4IO9A 2D62A 2F0NA 4TVAB 3W5OA 2XN9C 3S16H 5IYBH 2E5LQ 3T1YL 2CVRA 2IJ0A 3CC2A 3RLOA 1WTWA 2JEBI 4KHVA 4LUOA 1HFGA 3HOVH 1M8AA 1V1QA 4QY7A 3PO3G 1LT4D 1SEBD 4BY1B 3UDXA 3UDGA 1HRJA 2BDOA 4BBRG 1A63A 1ONLA 3U9SA 4AYBG 5KIXA 2E2IH 5HURA 3J80c 4DUYL 2F0VA 2F3WA 3I8ZA 3ZYYX 3TMEA 1SE4A 4G57A 4PV1C 2D9UA 3FPPA 2UUCQ 2LXKA 3I4OA 1PDQA 3TP6A 3SR1A 2WACA 3TS0A 1A3VA 4RMFA 1FJGL 2N49A 1Q8KA 3GQBA 1EFID 1K3BC 3T56B 3S16B 2P5ZX 3ITPA 1P8LA 2EYPA 3G4SA 1Y8OB 1WJJA 2NBFA 3G6EA 2RF4A 1A8VA 4MZ9A 2DN8A 1D5XC 2OEOA 2F4VQ 1Q82C 4RGMA 3JAML 1MD2D 1A6XA 1JORA 5JVG3 2A74C 4ZRZA 2SEBD 1PFBA 2KJXA 1G291 1YZ6A 3CAMA 3VR5A 3C46A 3PO2H 1D1IA 2A6HD 4X62Q 4QIWB 2I46A 3T16A 1V8QA 2BCOA 2K5DA 4A76A 2Z6BA 1MJCA 4A3EH 3V05A 5JEAG 5CV7A 4XYOA 3U58A 4LF8Q 2JJQA 1XPOA 2B2YA 3KK7A 1A2UA 1CFMA 4R4IA 5BN3A 4QUFA 3I7FA 1E1OA 3SK5A 4CJ0B 3CXCA 3L0OA 2HCIA 2XIWA 2ES2A 5LMNW 4J8QA 4GLXA 2L12A 1WTPA 5M5YH 3LX0A 3NELA 3RUZA 3BVMA 4HIDA 3ULJA 4QIWE 2H5XA 4DR4L 2MQHA 4CJ1B 2Z1CA 1KL9A 1N9WA 1VF5C 3PF5A 4DN4M 5CV4A 1Y1WG 3PV0A 1R9TB 3MC0B 1JCKB 3IFTA 4B3TQ 4LF7Q 2QEXA 3I4MG 1TS5A 2B29A 1HA5A 5C6AA 4DR2Q 5DNFA 4LK1C 2WKCA 1OXSC 1MHWC 2TMPA 2E5LL 4GOPA 4DNRB 3BG3A 3EVQA 3J81E 3M3YH 3A74A 4OHJA 2G9DA 4HIOA 3TRZA 3PMFA 1EU4A 2QF7A 5JJZA 1HXYD 4A3JH 3NHHA 2DUDA 4NDXA 1HTLD 2LKVA 2ZJQA 2VL6A 1GUOA 3ND8A 5M5WH 2VQEL 1RODA 3QOJA 5D3DA 1KC8C 2E2HB 1O7LA 5E7NA 2AWOA 4K5XA 4YY3Q 3I73A 4DV3Q 1K8OA 3G6JB 4DK0A 4GNXC 2ICEC 1FGUA 1YHQA 4XIGS 1TY2A 2OTJA 3HOXG 4DV0Q 4HN7A 3QO2A 2UUAL 1I50B 3MEHA 2XRSD 3STBD 3HKSA 1DCZA 4ODGA 1SFOH 2XTIA 1GD7A 3ONAB 3TZUA 1VQ9A 4XT1B 4HSPA 4JPBW 5COYA 3KF8A 3EBEA 5FK9C 2UXBL 2K28A 3UE0A 3HP3A 1ILQA 1BO0A 2D5DA 5BN5A 2R92H 2B3GA 4F87A 1L1OB 2CW0C 2FJ2A 4DR7L 2IY5B 1ZYRD 3S17B 4A3MH 2PYKA 3NE5B 1B50A 2QA4A 3E3XA 5IGGA 3TSSA 2N55A 3E9IA 3C3LA 3Q24A 2R7ZG 3VR3A 2R61A 2CKZB 4LF5Q 4KKSA 5M5XH 1LO5D 4RA8A 1SRUA 5C4XG 2R7ZB 1C4QA 3NXWA 1KAWA 3RLNA 3TP8A 2EYOA 3T13A 4A3BH 4LF6L 3FKIG 4DV7L 1D7QA 5KNBA 1LLRD 3A5UA 1ILPA 1ML0D 1A2TA 4DV1L 1D5MC 5C4HA 2Q8TA 1SNDA 5FJ8G 3S1MB 3M4OB 3RD4A 3KLRA 1L0WA 1PZID 3CHBD 3DMUA 4N8FA 3J80i 4WJWA 4NP5A 2A19A 4C56C 1CA5A 1IXRA 4R4QA 4C3IG 4IUNA 4O42A 5IIFA 4A3EG 2NVQH
chains in the Genus database with same CATH topology
3CCEA 4POFA 1Y1VG 1B7YB 2JA9A 1EUJA 3NEMA 4P74A 3UE1A 2DGYA 1KIXA 1I3QH 4DR5L 4NXNL 4UPAA 4DKAC 1QZHA 2JA7G 1I5FA 2OQKA 3GTOH 1E3PA 2NZHA 2K4KA 1SN8A 1OXUA 4QL5A 3KDFA 3OTOQ 3G6EA 1HR0L 1X3FA 1VQKA 2B63H 2RHQB 5H1SE 4PG3A 3T1HQ 3HOXH 1VQIA 3B6YA 4X64Q 2Z0SA 1PH1A 1Q1BA 2WP8J 3S1RH 2UU9L 4JI2L 4A3DG 1Q46A 2CWAA 3CPFA 2UXCQ 1C7YA 1TXYA 4EX5A 5HY6A 2OTLA 4LFBL 3HOUH 2VS1A 2YTXA 4Y52H 3A5ZB 3ULPA 1PH7A 1VQFA 4R4TA 1Q86C 3FKIH 1L2FA 3D31A 3WWVA 2K52A 3CPWA 4GNXA 1PA6A 4KHPL 3I55A 2I5HA 1HNWQ 4X65L 5AJ3L 3BU2A 5FLXc 4B3SL 4YWMA 2IT1A 2IX1A 2KHJA 2D0PA 2OWOA 1SE8A 2PQAB 4X66L 2BA0A 3PGZA 3KFUA 1AE2A 4YY3L 4DV3L 4B3TL 1HNXQ 3AYHB 5EAYA 1VQ8A 1Y1VH 3L7ZC 4QQBX 1K73C 1MKHA 1CKNA 4DAMA 5JEAJ 1A0IA 1SLJA 3MXNB 2OQ0A 3GO5A 1PH8A 1XNRL 4LF4L 1GVPA 3HFZB 5IP9G 4DR6Q 3MEFA 5LMUQ 2HQLA 3CCJA 4A3IH 3CCQA 2ZM6Q 2UUAQ 1JB7A 4JBKA 2R93H 3HKZE 2JQOA 4JBJA 2JE6I 5IYCH 1XMQQ 3JAMi 3GTPH 4IOCA 3M4QA 2KHIA 4BY7H 3CMAA 2LXJA 4JI1L 1JJGA 3UDIA 5C0XJ 3CCUA 1TWFH 1YBYA 2Q2HA 1PH4A 1DGSA 1K0RA 3DM3A 2CFMA 5DLQE 4LFAQ 4A3KG 2D0OA 1VQLA 2Q2UA 2AHOB 5J3BA 2ZTCA 1YHAA 3E9HA 3HOWH 3F8TA 4L5SA 3TS2A 4GNXB 4B3RQ 1VQCA 1OXTA 2PI2E 4R4CA 2PNHA 3J7A5 1N36L 1YHBA 2VQEQ 2GVBA 2JA7H 1BVSA 4UY8C 2K50A 3K80C 1M1KC 1V9PA 1SR3A 4JI3L 3KF6B 3F2DA 4AH6A 3G48A 3CD6A 1L1OC 2UUCL 3J81j 4LF9L 5LMNL 4BY1G 5BR8L 1QZGA 4YWKA 4BBSH 5HGQA 1UE6A 2K5HA 5IP7G 2MFIA 3I4NH 1LTLA 2N3SA 1HZBA 1YNXA 2E2JH 3STBC 3KDFB 1EQRA 1LYLA 5GROA 3RLFA 5IP7H 4GN5A 2WAQE 4OXPA 5GQOA 1HR0W 4P71A 3F1ZA 3K7AH 5IYCG 2C35B 1T9HA 2F3IA 4OONA 1KQSA 2ZTDA 4LF6Q 2A8VA 1GO3E 1WYDA 1CKMA 1BBWA 1FL0A 2CQOA 2NN6I 4DV7Q 3HOZG 2UXDL 4PZ7A 1YVCA 1N32L 1WFQA 4YCVA 3CCSA 2MNAA 3T1YQ 1NJIC 2QGQA 1C9OA 5C44G 4L5RC 4OX9L 4A3JG 1N33Q 3PUYA 3CF5A 5JJLA 2EXDA 1KHIA 1TWHH 1YJWA 3M4PA 4AQYQ 2FXQA 2F4VL 1K8GA 3HOWG 4NXML 2VY3A 3PSIA 4LFCQ 4B3MQ 2BH2A 1NBWA 3BZCA 3ULLA 4EQ5A 2Z6KA 4JI6Q 4JI4L 1AH9A 4Y7NH 4IPCA 4DUYQ 3S14H 1S72A 4BY1H 1IZ6A 2WAQG 3CCLA 5ELNA 4IJHA 1VQ4A 4K0KQ 1W3SA 3J7ZC 4X6AH 1G51A 4LF5L 1P16A 1HR0Q 2B63G 1UEBA 3M9BA 4YWLA 3H3VH 3FHWA 4YHHL 2R92G 2UU9Q 3CC4A 3AQQA 3PIOA 4J15A 2YU9H 2HHHL 1VQJA 2N8NA 4APVA 1CUKA 2BA1A 4GN3B 1XNQL 4O0AA 1N34Q 4GN4B 5M3FH 3RZDH 1S3OA 4XTCS 3OW2A 4IOAA 3SGIA 1Z47A 1B70B 4DV2Q 5AJ3Q 4JYAQ 3GTGH 4DPGA 3I56A 2WFWA 2HT1A 1L1OA 2I5MX 2AWNA 1JT8A 3H0GH 1VQMA 1AE3A 2JA6G 1U0LA 3A0JA 1KRSA 4A3DH 1EIFA 4A3CG 1YJ9A 2V1CC 5IWAQ 3S1MH 4A93G 4HJAA 1NTGA 5C4XH 3CC7A 4DR6L 4A3IG 4X62L 3S24A 2XGTA 4IPGA 2JA5H 2BH8A 1XPRA 1LUZA 4OWXB 4LF7L 3OTOL 1IBLQ 1KXLA 4JI0L 4A3GH 1Q81C 5C4JH 3GTMH 1QVFA 3TQYA 3T1HL 2IX0A 2KCMA 2R7FA 1MJEA 4LFAL 1TWGH 4DV6Q 3KF6A 4HJ7A 1M90C 2HIXA 2UUBQ 2L15A 4C3IH 1OTCA 1K3RA 4GKKQ 2K14A 5FLMH 3HOYH 1W2BA 5IT9c 4KHPQ 2KCTA 3CCRA 1GM5A 1HNWL 4X65Q 3PO3H 5IYDH 1XMOL 4DV4Q 1VQHA 1S40A 1SMXA 5C3EH 4X66Q 1N8RC 1NE3A 2YTVA 4BBRH 1TWAH 3VDYA 1HNXL 4LW1A 3F2BA 4HJ8A 2R6GA 2YYZA 4GOPC 2VNUD 1X3EA 4JG2A 3M4OH 4ALPA 1WCMH 1E1TA 4KLKA 4LF9Q 3PUZA 5C0XG 1J6QA 2VUMG 4LF4Q 1EWIA 3H3VI 5LMUL 1VQAA 3Q8DA 1VQ6A 3U50C 4C3JH 1NY4A 4BA1I 4BA2I 4AIMA 3KJPA 4JI8L 5ELOA 1XMQL 4JV5L 1K83H 1YI2A 1EQQA 2NN6G 3F2CA 5M3MG 4JBMA 2PMZE 1K9MC 1EIYB 4IFDG 3D0FA 2PQAA 3K0XA 4DV5L 3EN2A 3AFPA 2D62A 4TVAB 1VQDA 2Q2IA 3EIVA 4TQUS 3W5OA 5M3MH 4DR2L 3S16H 3TREA 5IYBH 1YIJA 2E5LQ 4DV0L 4JI7Q 4A3KH 1N32Q 1H95A 3T1YL 2VUMH 3CC2A 1N33L 3RLOA 3CMEA 3W1BA 1I94Q 2GN5A 1VS0A 4NB3A 2JEBI 5JJKA 4FDBA 4LUOA 4O2DA 4NXMQ 3HOVH 1V1QA 2MO1A 4QY7A 1VQ5A 3HOUG 4B3RL 3PO3G 3RN2A 3UDXA 3UDGA 4HJ9A 4BBRG 1A63A 1VQOA 4AYBG 1E7ZA 5IE8A 2K5NA 4IFDJ 1JJ2A 4JI4Q 3GTJH 4DR1Q 2E2IH 3J80c 4JI3Q 3RN5A 4BXXH 4DUYL 2R7DA 4R1JA 2UUCQ 1JJCB 1CKNB 2LXKA 5BR8Q 3I4OA 4OO1I 4OWWB 3PCOB 2CCZA 2OCEA 1YJNA 1IBKQ 1NMGA 3TS0A 4RMFA 1ASZA 1FJGL 2N49A 4UP8A 5M3FG 2NZOA 1UE5A 3PUVA 2HHHQ 3RNUA 1Q8KA 4P72A 1PVOA 2K75A 4A3FH 3OYYA 1BKBA 4GOPB 1P8LA 3ERSX 3G4SA 1J5EL 1HNZQ 1VQEA 1Q1EA 1WJJA 1X3GA 2RF4A 1A8VA 3K7UC 3ER0A 3NBHB 4MZ9A 3KJOA 3DLLA 4DV2L 3I4MH 2CWPA 4DR3Q 1E24A 5IP9H 4AQYL 1X6OA 2VQFQ 1Q82C 2F4VQ 1HZ9A 4A4IA 4GLAC 4LFCL 4OWTB 4JOIC 4GKJQ 1FVIA 4A3CH 2KENA 4DUZQ 5JJIA 2AKWB 5IWAL 4DV1Q 1PH3A 1QUQB 1G291 1YZ6A 3CAMA 3PO2H 4PZ8A 4X62Q 3K8AA 3J81i 4C3HH 1X55A 5GAEC 4BXXG 4UP9A 3GDEA 2I5LX 4A76A 3GD7A 4DR7Q 1X56A 4IJLA 1QVGA 1IBLL 2EQSA 4LUZA 1MJCA 4JI0Q 4A3GG 4A3EH 2E2HH 4L5QA 4DAYB 1O7IA 1XPUA 4KI0A 5JEAG 4P73A 3U58A 3KF8B 4LF8Q 2JJQA 3CP0A 1XPOA 2JK8A 2YTYA 4R4IA 3JAMc 2ALYB 4DR5Q 3I7FA 1E1OA 3CXCA 3M7NA 4ME3A 3L0OA 1VQNA 1Y1WH 1PH2A 4GKKL 1QUQA 5GAGC 5LMNW 5FLMG 1PV4A 4GLXA 2RCNA 2ES2A 2LSSA 5GAHC 2RHSB 4IFDI 1I6HH 1XTDA 3L2PA 5M5YH 3GTLH 4JC0A 1X65A 4QGUA 2ZTEA 3I2ZA 4JOIA 1WOCA 2ID0A 3HKZG 3NELA 1XMOQ 2E8GA 2GVAA 2Y0SE 3PUXA 4JI5Q 2UXCL 2YV5A 3W1GA 4HIDA 1JMCA 4GS3A 3ULJA 4QIWE 2H5XA 2MO0A 1VQPA 1CSQA 2WB1G 4DR4L 1E22A 4YCWA 1NMFA 2MQHA 4RG1A 4HIMA 1YEZA 1KL9A 1N9WA 4WJ4A 3PF5A 4DK6C 1Y1WG 1IBML 3PV0A 1Q7YC 4JYAL 2JA5G 3HOZH 1UWVA 4JV5Q 5K36G 4DNIA 3E0EA 4B3TQ 4LF7Q 2QEXA 3I4MG 5C3EG 3K81C 1OXVA 4A93H 4DV5Q 2B29A 4POGA 2JA8G 1QVCA 1VCIA 4DR2Q 2VW9A 3HOVG 4JI7L 1OXSC 1YITA 2E5LL 3I4NG 3CW2C 1BBUA 3U4ZA 4DV6L 2Q2TA 4GOPA 4NXNQ 2UUBL 3CCVA 1I94L 4A3BG 4YCUA 3PF4A 3M3YH 3A74A 1HZAA 5GADC 3PO2G 4A3FG 1GKHA 3U4VA 3NENA 4HIOA 2I0QA 3GTQH 3TRZA 3S2HH 1V43A 3BJUA 4X64L 4HIKA 4DV4L 4JI2Q 2R7ZH 3S1QH 1HZCA 3CCMA 4GLVB 1VQBA 4LFBQ 4A3JH 1UE1A 4DR1L 1IYJB 4C2MH 2DUDA 2Y0SG 1VQGA 1X54A 2PI2A 2ZJQA 3BZKA 2VL6A 3IRBA 1CSPA 4A3MG 4LNQA 1N36Q 5M5WH 2VQEL 4B3SQ 1KC8C 3KOJA 1Q12A 4PMWA 2NVYH 1KRTA 4JI8Q 1XJVA 5E7NA 1U5KA 2AWOA 2NVTH 3FP9A 3CQZH 4YY3Q 4DV3Q 4IPHA 4GNXC 4UP7A 3PIPA 1EYGA 1RL2A 1FGUA 1YHQA 1XNRQ 1HH2P 4XIGS 1X9NA 2JA6H 1Y14B 2OTJA 2HIVA 2EIFA 3HOXG 4DV0Q 1HNZL 1EFWA 4WJ3M 3JC66 1MIUA 2VZAA 2ZM6L 2IHEA 4NPSA 1PHJA 2UUAL 3S15H 2R93G 2WB1E 3STBD 3HKSA 1ASYA 1SFOH 4DR3L 1CKOA 3TEHB 2VQFL 2XTIA 1IL2A 1GD7A 1I50H 1PYSB 1VQ9A 4JI1Q 4A75A 4GKJL 4PZ6A 2K5VA 2UXDQ 4P75A 3GTKH 3EBEA 2UXBL 3KLWA 3LGJA 4IO9A 1A62A 2N78A 3UE0A 4OX9Q 4AYBE 2Z6KC 4LWCA 5C0XI 2R92H 2B3GA 4JCVE 1PH5A 1L1OB 2JA8H 1R9TH 3PUWA 3S17H 4BBSG 4R4OA 4H02A 3KYHC 3J81c 4DR7L 1VQ7A 1D8LA 2AMCB 4B3ML 2IY5B 4A3MH 1IBKL 1FJGQ 1RIPA 4IPDA 2NVXH 1G6PA 3RR5A 4JI6L 1WI5A 1PFSA 1UE7A 2F52A 1PYBA 3AFQA 5IYDG 2QA4A 3AEVA 3E9IA 3ICEA 2R7ZG 5C44H 3S1NH 4K0KL 5LMNQ 4MTNA 2CKZB 4LF5Q 1J5EQ 5M5XH 4JBWA 2ATWA 2JEAI 1WCMG 1SRUA 4MNOA 4QJFA 3ZJYC 4YHHQ 4LUVA 2ZJPA 3G71A 5C4XG 1EOVA 1K8AC 1TWCH 3RLNA 1KAWA 4A3BH 4JI5L 4A3LH 1OXXK 4LF6L 3FKIG 4DV7L 2ZJRA 1D7QA 1XNQQ 4DUZL 1N34L 4DR4Q 4OO1G 3A5UA 1SROA 3RZOH 1HJPA 4DV1L 2A1AA 4L5TA 4HJ5A 1PH6A 3UDFA 4DK3C 4BY7G 5FJ8G 1LM0A 4KHZA 5IY0A 2UXBQ 1KD1C 3H15A 2ASBA 1IBMQ 1JE5A 1Z9FA 1L0WA 5FJ8H 5IYBG 1B8AA 2IHFA 3J80i 3H0GG 2A19A 4A3LG 1IXRA 4R4QA 3M85A 1PH9A 3S2DH 4A3EG 2NVQH 1C0AA 3HOYG 2KBNA 4LF8L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCE A;  4POF A;  1Y1V G;  1B7Y B;  2JA9 A;  1EUJ A;  3NEM A;  4P74 A;  3UE1 A;  2DGY A;  1KIX A;  1I3Q H;  4DR5 L;  4NXN L;  4UPA A;  4DKA C;  1QZH A;  2JA7 G;  1I5F A;  2OQK A;  3GTO H;  1E3P A;  2NZH A;  2K4K A;  1SN8 A;  1OXU A;  4QL5 A;  3KDF A;  3OTO Q;  3G6E A;  1HR0 L;  1X3F A;  1VQK A;  2B63 H;  2RHQ B;  5H1S E;  4PG3 A;  3T1H Q;  3HOX H;  1VQI A;  3B6Y A;  4X64 Q;  2Z0S A;  1PH1 A;  1Q1B A;  2WP8 J;  3S1R H;  2UU9 L;  4JI2 L;  4A3D G;  1Q46 A;  2CWA A;  3CPF A;  2UXC Q;  1C7Y A;  1TXY A;  4EX5 A;  5HY6 A;  2OTL A;  4LFB L;  3HOU H;  2VS1 A;  2YTX A;  4Y52 H;  3A5Z B;  3ULP A;  1PH7 A;  1VQF A;  4R4T A;  1Q86 C;  3FKI H;  1L2F A;  3D31 A;  3WWV A;  2K52 A;  3CPW A;  4GNX A;  1PA6 A;  4KHP L;  3I55 A;  2I5H A;  1HNW Q;  4X65 L;  5AJ3 L;  3BU2 A;  5FLX c;  4B3S L;  4YWM A;  2IT1 A;  2IX1 A;  2KHJ A;  2D0P A;  2OWO A;  1SE8 A;  2PQA B;  4X66 L;  2BA0 A;  3PGZ A;  3KFU A;  1AE2 A;  4YY3 L;  4DV3 L;  4B3T L;  1HNX Q;  3AYH B;  5EAY A;  1VQ8 A;  1Y1V H;  3L7Z C;  4QQB X;  1K73 C;  1MKH A;  1CKN A;  4DAM A;  5JEA J;  1A0I A;  1SLJ A;  3MXN B;  2OQ0 A;  3GO5 A;  1PH8 A;  1XNR L;  4LF4 L;  1GVP A;  3HFZ B;  5IP9 G;  4DR6 Q;  3MEF A;  5LMU Q;  2HQL A;  3CCJ A;  4A3I H;  3CCQ A;  2ZM6 Q;  2UUA Q;  1JB7 A;  4JBK A;  2R93 H;  3HKZ E;  2JQO A;  4JBJ A;  2JE6 I;  5IYC H;  1XMQ Q;  3JAM i;  3GTP H;  4IOC A;  3M4Q A;  2KHI A;  4BY7 H;  3CMA A;  2LXJ A;  4JI1 L;  1JJG A;  3UDI A;  5C0X J;  3CCU A;  1TWF H;  1YBY A;  2Q2H A;  1PH4 A;  1DGS A;  1K0R A;  3DM3 A;  2CFM A;  5DLQ E;  4LFA Q;  4A3K G;  2D0O A;  1VQL A;  2Q2U A;  2AHO B;  5J3B A;  2ZTC A;  1YHA A;  3E9H A;  3HOW H;  3F8T A;  4L5S A;  3TS2 A;  4GNX B;  4B3R Q;  1VQC A;  1OXT A;  2PI2 E;  4R4C A;  2PNH A;  3J7A 5;  1N36 L;  1YHB A;  2VQE Q;  2GVB A;  2JA7 H;  1BVS A;  4UY8 C;  2K50 A;  3K80 C;  1M1K C;  1V9P A;  1SR3 A;  4JI3 L;  3KF6 B;  3F2D A;  4AH6 A;  3G48 A;  3CD6 A;  1L1O C;  2UUC L;  3J81 j;  4LF9 L;  5LMN L;  4BY1 G;  5BR8 L;  1QZG A;  4YWK A;  4BBS H;  5HGQ A;  1UE6 A;  2K5H A;  5IP7 G;  2MFI A;  3I4N H;  1LTL A;  2N3S A;  1HZB A;  1YNX A;  2E2J H;  3STB C;  3KDF B;  1EQR A;  1LYL A;  5GRO A;  3RLF A;  5IP7 H;  4GN5 A;  2WAQ E;  4OXP A;  5GQO A;  1HR0 W;  4P71 A;  3F1Z A;  3K7A H;  5IYC G;  2C35 B;  1T9H A;  2F3I A;  4OON A;  1KQS A;  2ZTD A;  4LF6 Q;  2A8V A;  1GO3 E;  1WYD A;  1CKM A;  1BBW A;  1FL0 A;  2CQO A;  2NN6 I;  4DV7 Q;  3HOZ G;  2UXD L;  4PZ7 A;  1YVC A;  1N32 L;  1WFQ A;  4YCV A;  3CCS A;  2MNA A;  3T1Y Q;  1NJI C;  2QGQ A;  1C9O A;  5C44 G;  4L5R C;  4OX9 L;  4A3J G;  1N33 Q;  3PUY A;  3CF5 A;  5JJL A;  2EXD A;  1KHI A;  1TWH H;  1YJW A;  3M4P A;  4AQY Q;  2FXQ A;  2F4V L;  1K8G A;  3HOW G;  4NXM L;  2VY3 A;  3PSI A;  4LFC Q;  4B3M Q;  2BH2 A;  1NBW A;  3BZC A;  3ULL A;  4EQ5 A;  2Z6K A;  4JI6 Q;  4JI4 L;  1AH9 A;  4Y7N H;  4IPC A;  4DUY Q;  3S14 H;  1S72 A;  4BY1 H;  1IZ6 A;  2WAQ G;  3CCL A;  5ELN A;  4IJH A;  1VQ4 A;  4K0K Q;  1W3S A;  3J7Z C;  4X6A H;  1G51 A;  4LF5 L;  1P16 A;  1HR0 Q;  2B63 G;  1UEB A;  3M9B A;  4YWL A;  3H3V H;  3FHW A;  4YHH L;  2R92 G;  2UU9 Q;  3CC4 A;  3AQQ A;  3PIO A;  4J15 A;  2YU9 H;  2HHH L;  1VQJ A;  2N8N A;  4APV A;  1CUK A;  2BA1 A;  4GN3 B;  1XNQ L;  4O0A A;  1N34 Q;  4GN4 B;  5M3F H;  3RZD H;  1S3O A;  4XTC S;  3OW2 A;  4IOA A;  3SGI A;  1Z47 A;  1B70 B;  4DV2 Q;  5AJ3 Q;  4JYA Q;  3GTG H;  4DPG A;  3I56 A;  2WFW A;  2HT1 A;  1L1O A;  2I5M X;  2AWN A;  1JT8 A;  3H0G H;  1VQM A;  1AE3 A;  2JA6 G;  1U0L A;  3A0J A;  1KRS A;  4A3D H;  1EIF A;  4A3C G;  1YJ9 A;  2V1C C;  5IWA Q;  3S1M H;  4A93 G;  4HJA A;  1NTG A;  5C4X H;  3CC7 A;  4DR6 L;  4A3I G;  4X62 L;  3S24 A;  2XGT A;  4IPG A;  2JA5 H;  2BH8 A;  1XPR A;  1LUZ A;  4OWX B;  4LF7 L;  3OTO L;  1IBL Q;  1KXL A;  4JI0 L;  4A3G H;  1Q81 C;  5C4J H;  3GTM H;  1QVF A;  3TQY A;  3T1H L;  2IX0 A;  2KCM A;  2R7F A;  1MJE A;  4LFA L;  1TWG H;  4DV6 Q;  3KF6 A;  4HJ7 A;  1M90 C;  2HIX A;  2UUB Q;  2L15 A;  4C3I H;  1OTC A;  1K3R A;  4GKK Q;  2K14 A;  5FLM H;  3HOY H;  1W2B A;  5IT9 c;  4KHP Q;  2KCT A;  3CCR A;  1GM5 A;  1HNW L;  4X65 Q;  3PO3 H;  5IYD H;  1XMO L;  4DV4 Q;  1VQH A;  1S40 A;  1SMX A;  5C3E H;  4X66 Q;  1N8R C;  1NE3 A;  2YTV A;  4BBR H;  1TWA H;  3VDY A;  1HNX L;  4LW1 A;  3F2B A;  4HJ8 A;  2R6G A;  2YYZ A;  4GOP C;  2VNU D;  1X3E A;  4JG2 A;  3M4O H;  4ALP A;  1WCM H;  1E1T A;  4KLK A;  4LF9 Q;  3PUZ A;  5C0X G;  1J6Q A;  2VUM G;  4LF4 Q;  1EWI A;  3H3V I;  5LMU L;  1VQA A;  3Q8D A;  1VQ6 A;  3U50 C;  4C3J H;  1NY4 A;  4BA1 I;  4BA2 I;  4AIM A;  3KJP A;  4JI8 L;  5ELO A;  1XMQ L;  4JV5 L;  1K83 H;  1YI2 A;  1EQQ A;  2NN6 G;  3F2C A;  5M3M G;  4JBM A;  2PMZ E;  1K9M C;  1EIY B;  4IFD G;  3D0F A;  2PQA A;  3K0X A;  4DV5 L;  3EN2 A;  3AFP A;  2D62 A;  4TVA B;  1VQD A;  2Q2I A;  3EIV A;  4TQU S;  3W5O A;  5M3M H;  4DR2 L;  3S16 H;  3TRE A;  5IYB H;  1YIJ A;  2E5L Q;  4DV0 L;  4JI7 Q;  4A3K H;  1N32 Q;  1H95 A;  3T1Y L;  2VUM H;  3CC2 A;  1N33 L;  3RLO A;  3CME A;  3W1B A;  1I94 Q;  2GN5 A;  1VS0 A;  4NB3 A;  2JEB I;  5JJK A;  4FDB A;  4LUO A;  4O2D A;  4NXM Q;  3HOV H;  1V1Q A;  2MO1 A;  4QY7 A;  1VQ5 A;  3HOU G;  4B3R L;  3PO3 G;  3RN2 A;  3UDX A;  3UDG A;  4HJ9 A;  4BBR G;  1A63 A;  1VQO A;  4AYB G;  1E7Z A;  5IE8 A;  2K5N A;  4IFD J;  1JJ2 A;  4JI4 Q;  3GTJ H;  4DR1 Q;  2E2I H;  3J80 c;  4JI3 Q;  3RN5 A;  4BXX H;  4DUY L;  2R7D A;  4R1J A;  2UUC Q;  1JJC B;  1CKN B;  2LXK A;  5BR8 Q;  3I4O A;  4OO1 I;  4OWW B;  3PCO B;  2CCZ A;  2OCE A;  1YJN A;  1IBK Q;  1NMG A;  3TS0 A;  4RMF A;  1ASZ A;  1FJG L;  2N49 A;  4UP8 A;  5M3F G;  2NZO A;  1UE5 A;  3PUV A;  2HHH Q;  3RNU A;  1Q8K A;  4P72 A;  1PVO A;  2K75 A;  4A3F H;  3OYY A;  1BKB A;  4GOP B;  1P8L A;  3ERS X;  3G4S A;  1J5E L;  1HNZ Q;  1VQE A;  1Q1E A;  1WJJ A;  1X3G A;  2RF4 A;  1A8V A;  3K7U C;  3ER0 A;  3NBH B;  4MZ9 A;  3KJO A;  3DLL A;  4DV2 L;  3I4M H;  2CWP A;  4DR3 Q;  1E24 A;  5IP9 H;  4AQY L;  1X6O A;  2VQF Q;  1Q82 C;  2F4V Q;  1HZ9 A;  4A4I A;  4GLA C;  4LFC L;  4OWT B;  4JOI C;  4GKJ Q;  1FVI A;  4A3C H;  2KEN A;  4DUZ Q;  5JJI A;  2AKW B;  5IWA L;  4DV1 Q;  1PH3 A;  1QUQ B;  1G29 1;  1YZ6 A;  3CAM A;  3PO2 H;  4PZ8 A;  4X62 Q;  3K8A A;  3J81 i;  4C3H H;  1X55 A;  5GAE C;  4BXX G;  4UP9 A;  3GDE A;  2I5L X;  4A76 A;  3GD7 A;  4DR7 Q;  1X56 A;  4IJL A;  1QVG A;  1IBL L;  2EQS A;  4LUZ A;  1MJC A;  4JI0 Q;  4A3G G;  4A3E H;  2E2H H;  4L5Q A;  4DAY B;  1O7I A;  1XPU A;  4KI0 A;  5JEA G;  4P73 A;  3U58 A;  3KF8 B;  4LF8 Q;  2JJQ A;  3CP0 A;  1XPO A;  2JK8 A;  2YTY A;  4R4I A;  3JAM c;  2ALY B;  4DR5 Q;  3I7F A;  1E1O A;  3CXC A;  3M7N A;  4ME3 A;  3L0O A;  1VQN A;  1Y1W H;  1PH2 A;  4GKK L;  1QUQ A;  5GAG C;  5LMN W;  5FLM G;  1PV4 A;  4GLX A;  2RCN A;  2ES2 A;  2LSS A;  5GAH C;  2RHS B;  4IFD I;  1I6H H;  1XTD A;  3L2P A;  5M5Y H;  3GTL H;  4JC0 A;  1X65 A;  4QGU A;  2ZTE A;  3I2Z A;  4JOI A;  1WOC A;  2ID0 A;  3HKZ G;  3NEL A;  1XMO Q;  2E8G A;  2GVA A;  2Y0S E;  3PUX A;  4JI5 Q;  2UXC L;  2YV5 A;  3W1G A;  4HID A;  1JMC A;  4GS3 A;  3ULJ A;  4QIW E;  2H5X A;  2MO0 A;  1VQP A;  1CSQ A;  2WB1 G;  4DR4 L;  1E22 A;  4YCW A;  1NMF A;  2MQH A;  4RG1 A;  4HIM A;  1YEZ A;  1KL9 A;  1N9W A;  4WJ4 A;  3PF5 A;  4DK6 C;  1Y1W G;  1IBM L;  3PV0 A;  1Q7Y C;  4JYA L;  2JA5 G;  3HOZ H;  1UWV A;  4JV5 Q;  5K36 G;  4DNI A;  3E0E A;  4B3T Q;  4LF7 Q;  2QEX A;  3I4M G;  5C3E G;  3K81 C;  1OXV A;  4A93 H;  4DV5 Q;  2B29 A;  4POG A;  2JA8 G;  1QVC A;  1VCI A;  4DR2 Q;  2VW9 A;  3HOV G;  4JI7 L;  1OXS C;  1YIT A;  2E5L L;  3I4N G;  3CW2 C;  1BBU A;  3U4Z A;  4DV6 L;  2Q2T A;  4GOP A;  4NXN Q;  2UUB L;  3CCV A;  1I94 L;  4A3B G;  4YCU A;  3PF4 A;  3M3Y H;  3A74 A;  1HZA A;  5GAD C;  3PO2 G;  4A3F G;  1GKH A;  3U4V A;  3NEN A;  4HIO A;  2I0Q A;  3GTQ H;  3TRZ A;  3S2H H;  1V43 A;  3BJU A;  4X64 L;  4HIK A;  4DV4 L;  4JI2 Q;  2R7Z H;  3S1Q H;  1HZC A;  3CCM A;  4GLV B;  1VQB A;  4LFB Q;  4A3J H;  1UE1 A;  4DR1 L;  1IYJ B;  4C2M H;  2DUD A;  2Y0S G;  1VQG A;  1X54 A;  2PI2 A;  2ZJQ A;  3BZK A;  2VL6 A;  3IRB A;  1CSP A;  4A3M G;  4LNQ A;  1N36 Q;  5M5W H;  2VQE L;  4B3S Q;  1KC8 C;  3KOJ A;  1Q12 A;  4PMW A;  2NVY H;  1KRT A;  4JI8 Q;  1XJV A;  5E7N A;  1U5K A;  2AWO A;  2NVT H;  3FP9 A;  3CQZ H;  4YY3 Q;  4DV3 Q;  4IPH A;  4GNX C;  4UP7 A;  3PIP A;  1EYG A;  1RL2 A;  1FGU A;  1YHQ A;  1XNR Q;  1HH2 P;  4XIG S;  1X9N A;  2JA6 H;  1Y14 B;  2OTJ A;  2HIV A;  2EIF A;  3HOX G;  4DV0 Q;  1HNZ L;  1EFW A;  4WJ3 M;  3JC6 6;  1MIU A;  2VZA A;  2ZM6 L;  2IHE A;  4NPS A;  1PHJ A;  2UUA L;  3S15 H;  2R93 G;  2WB1 E;  3STB D;  3HKS A;  1ASY A;  1SFO H;  4DR3 L;  1CKO A;  3TEH B;  2VQF L;  2XTI A;  1IL2 A;  1GD7 A;  1I50 H;  1PYS B;  1VQ9 A;  4JI1 Q;  4A75 A;  4GKJ L;  4PZ6 A;  2K5V A;  2UXD Q;  4P75 A;  3GTK H;  3EBE A;  2UXB L;  3KLW A;  3LGJ A;  4IO9 A;  1A62 A;  2N78 A;  3UE0 A;  4OX9 Q;  4AYB E;  2Z6K C;  4LWC A;  5C0X I;  2R92 H;  2B3G A;  4JCV E;  1PH5 A;  1L1O B;  2JA8 H;  1R9T H;  3PUW A;  3S17 H;  4BBS G;  4R4O A;  4H02 A;  3KYH C;  3J81 c;  4DR7 L;  1VQ7 A;  1D8L A;  2AMC B;  4B3M L;  2IY5 B;  4A3M H;  1IBK L;  1FJG Q;  1RIP A;  4IPD A;  2NVX H;  1G6P A;  3RR5 A;  4JI6 L;  1WI5 A;  1PFS A;  1UE7 A;  2F52 A;  1PYB A;  3AFQ A;  5IYD G;  2QA4 A;  3AEV A;  3E9I A;  3ICE A;  2R7Z G;  5C44 H;  3S1N H;  4K0K L;  5LMN Q;  4MTN A;  2CKZ B;  4LF5 Q;  1J5E Q;  5M5X H;  4JBW A;  2ATW A;  2JEA I;  1WCM G;  1SRU A;  4MNO A;  4QJF A;  3ZJY C;  4YHH Q;  4LUV A;  2ZJP A;  3G71 A;  5C4X G;  1EOV A;  1K8A C;  1TWC H;  3RLN A;  1KAW A;  4A3B H;  4JI5 L;  4A3L H;  1OXX K;  4LF6 L;  3FKI G;  4DV7 L;  2ZJR A;  1D7Q A;  1XNQ Q;  4DUZ L;  1N34 L;  4DR4 Q;  4OO1 G;  3A5U A;  1SRO A;  3RZO H;  1HJP A;  4DV1 L;  2A1A A;  4L5T A;  4HJ5 A;  1PH6 A;  3UDF A;  4DK3 C;  4BY7 G;  5FJ8 G;  1LM0 A;  4KHZ A;  5IY0 A;  2UXB Q;  1KD1 C;  3H15 A;  2ASB A;  1IBM Q;  1JE5 A;  1Z9F A;  1L0W A;  5FJ8 H;  5IYB G;  1B8A A;  2IHF A;  3J80 i;  3H0G G;  2A19 A;  4A3L G;  1IXR A;  4R4Q A;  3M85 A;  1PH9 A;  3S2D H;  4A3E G;  2NVQ H;  1C0A A;  3HOY G;  2KBN A;  4LF8 L; 
#chains in the Genus database with same CATH topology
 1Y1V G;  1KNE A;  5JPM C;  4A3J B;  3UE1 A;  1AFP A;  4C3J G;  5CBE E;  3NK9 A;  5ELB A;  4R8I A;  2HUG A;  4UPA A;  3S1Q B;  2JA7 G;  1I5F A;  2OQK A;  1EIG A;  3IL8 A;  3GTO H;  1B9M A;  4QL5 A;  3KDF A;  2R93 B;  4C2M B;  3MFY A;  1SYB A;  5H1S E;  3C1E A;  3T1H Q;  3HOX H;  4X64 Q;  2KEE A;  1PH1 A;  2UXC Q;  4EQP A;  1TXY A;  3OOC A;  1LTA D;  4LFB L;  3HOU H;  2YTX A;  1VQF A;  4R4T A;  3FKI H;  2K52 A;  1ICW A;  5FLX c;  1IYU A;  1RKN A;  2OWO A;  4X66 L;  2BA0 A;  3KFU A;  5G3L D;  1AE2 A;  4YY3 L;  4DV3 L;  5KRU A;  1HNX Q;  2WV6 D;  2BDN A;  4CDE C;  3L7Z C;  1MKH A;  1F2Z A;  4LF4 L;  1JOK A;  2B2W C;  3MEF A;  4WRD A;  4CBV A;  3QWN A;  2R93 H;  3W3A A;  2JE6 I;  5IYC H;  2B63 B;  1PLF A;  3JAM i;  1SE3 A;  4IOC A;  3J80 L;  1PTO F;  3CMA A;  1G8Z D;  2LXJ A;  4MIU A;  3KLS A;  5C0X J;  5C5M A;  1LTI D;  2CFM A;  1VQL A;  3ND9 A;  2Z4H A;  5J3B A;  1TU2 B;  2F0D A;  3E9H A;  2EYJ A;  4RGO S;  4GNX B;  4B3R Q;  1VQC A;  1F9R A;  1OXT A;  4R4C A;  5I9P A;  4G7O C;  3QG1 A;  1BVS A;  2D2C C;  5C4J B;  4ZCK A;  2SOB A;  3F2D A;  3I4L A;  3NBH A;  4TSS A;  3G48 A;  1DJR D;  2UUC L;  2GA4 B;  5LMN L;  1HPC A;  1NNX A;  4CDD C;  2FFK B;  3CRK C;  3CQZ B;  4BBS H;  1UE6 A;  4A93 G;  2Z4I A;  2DNE A;  4KV6 A;  5IP7 G;  3DWP A;  3RLF A;  5BN4 A;  1GHJ A;  2M00 A;  2KCC A;  3GV6 A;  4M1U B;  1GJX A;  4P71 A;  1QOH A;  2NWG A;  4OON A;  1KQS A;  2ZTD A;  1GO3 E;  4DV7 Q;  1BBW A;  3HOZ G;  2YU9 B;  2EY1 A;  2F3V A;  4PZ7 A;  5EQ0 A;  1N32 L;  1WFQ A;  1F77 A;  2QGQ A;  5C44 G;  4OX9 L;  5M3F B;  3PUY A;  3RZD B;  1KHI A;  2FHT A;  4KY5 A;  2VY3 A;  5M3M B;  3ERQ A;  1JWU D;  1YNJ C;  1F2L A;  5EKI A;  1KAA A;  3VR4 A;  5I4D A;  1WTQ A;  4DGZ A;  2IPK D;  2Z6K A;  5DAU A;  1SNM A;  1PTO B;  4Y7N H;  1AH9 A;  3BDO A;  4OGQ C;  2E75 C;  1S72 A;  2WAQ G;  1DXM A;  1DYQ A;  4IJH A;  5ELN A;  4K0K Q;  1W3S A;  3J7Z C;  1FYC A;  4CGY B;  4YWL A;  3IKJ A;  3FHW A;  4J15 A;  2YU9 H;  2O2L D;  3A8I E;  3E5S A;  2QEJ C;  3OMC A;  4IOA A;  4Z9C B;  1KLG D;  5AJ3 Q;  4BS9 A;  3MA2 B;  2B2W A;  3MXG A;  3GTG H;  1U4L A;  1L1O A;  2K1B A;  3GTK B;  3L9A X;  3H0G H;  2QKI C;  3A0J A;  2V1C C;  3X3N A;  1NTG A;  4FO2 A;  1QB5 D;  5LHY 1;  5JVH 3;  2XGT A;  4IPG A;  2BH8 A;  2F0Q A;  3T51 B;  5C4X B;  2RKS A;  1X32 A;  3OTO L;  3S15 B;  1U4M A;  4A3G H;  1SFO B;  5JPN C;  3GTM H;  1MJE A;  3A54 A;  2PZT A;  3OHX C;  1IYV A;  4JW0 A;  2BE5 D;  1E2V A;  1K3R A;  1SYD A;  5FLM H;  1W2B A;  3CCR A;  4C3I B;  1FGB D;  5FOB B;  4X66 Q;  2PPB C;  2BE5 C;  2OXP A;  3VDY A;  1EEF D;  3PO3 B;  5D14 A;  2R6G A;  1X3E A;  4ALP A;  3U9O A;  2EDG A;  4LF9 Q;  2OF1 A;  1J6Q A;  2VUM G;  4LF4 Q;  3H3V I;  5LMU L;  1VQA A;  3Q8D A;  3U50 C;  1NY4 A;  4AIM A;  1HCZ A;  2KED A;  2OT2 A;  4RCN A;  4JVZ A;  1W6J A;  4UDU C;  4A3E B;  1C8C A;  2PMZ E;  3D0F A;  4DV5 L;  1VQD A;  2Q2I A;  2K03 A;  3EIV A;  4TQU S;  4DR2 L;  1HA6 A;  1N33 L;  3FDT A;  1VS0 A;  4FDB A;  1EWC A;  1CTM A;  1SNP A;  4NXM Q;  2MO1 A;  4B3R L;  2ZXO A;  1MSH A;  5D65 A;  3SK4 A;  4X3S A;  4HJ9 A;  1STN A;  5IE8 A;  2K5N A;  1H9R A;  1JJ2 A;  3GTJ H;  1QWY A;  4DR1 Q;  1JIC A;  2B39 A;  4XQJ A;  5EPK A;  4R1J A;  1JJC B;  4L8J A;  4OO1 I;  4OWW B;  2CW0 D;  2CCZ A;  1YJN A;  4XT3 B;  1ASZ A;  3GTQ B;  3R2T A;  5C44 B;  3S1N B;  4A3F B;  1KDC A;  3RNU A;  2QDL A;  4FF4 A;  1A3U A;  2K75 A;  1BKB A;  4GOP B;  4PQX A;  3ERS X;  3K7A B;  4A3D B;  1HQM C;  1SSO A;  3NBH B;  3KJO A;  3K7U C;  1S5B D;  1T5X D;  3NQI A;  2CWP A;  4DR3 Q;  1IW7 D;  2VQF Q;  1HZ9 A;  1SXT A;  1AN8 A;  4KK7 A;  2NVT B;  1NR4 A;  5JEA H;  3VYT A;  2KEN A;  5JJI A;  2F0E A;  2AKW B;  1QJO A;  1KTK A;  3J81 L;  1PH3 A;  1Z6H A;  4PZ8 A;  3J81 i;  3EQL C;  4C3H H;  1DM0 B;  3NTH A;  4UP9 A;  2I5L X;  3GDE A;  3IFD A;  1X3P A;  3GD7 A;  4EQO A;  1AEX A;  1X56 A;  4IJL A;  2EPB A;  4IN3 A;  2EQS A;  4LUZ A;  3NBI A;  1IBL L;  3WOF A;  4K8J A;  3M7G A;  4DAY B;  2E2H H;  1XPU A;  4KI0 A;  2KQ3 A;  2K32 A;  3KF8 B;  2YTY A;  3JAM c;  4A3K B;  4ME3 A;  2JSO A;  4V0B A;  1Y1W H;  1VQN A;  1QUQ A;  2RCN A;  1SYC A;  4FYD A;  3L2P A;  3R93 A;  1X65 A;  2ZXP A;  1WOC A;  2ID0 A;  2E8G A;  2UXC L;  5LL6 X;  4GS3 A;  1SAP A;  5KGU A;  1AZQ A;  2B2T C;  3OMG A;  1LT6 D;  4OEL B;  4F7X A;  5IGD A;  1EYD A;  3S9W A;  1TT2 A;  1IBM L;  4RKL A;  1Q7Y C;  4WOR A;  4JV5 Q;  3E0E A;  2NVY B;  5C3E G;  2K04 A;  2K33 A;  1PTO H;  4POG A;  1QVC A;  3HOV G;  1NR2 A;  3CW2 C;  3JAM E;  1BBU A;  5I6Y A;  1I94 L;  2IL8 A;  3D6C A;  5DM6 3;  3VA5 A;  2F0K A;  3H3V C;  3KBG A;  4YCU A;  3O13 A;  2RCF A;  5GAD C;  3PO2 G;  1H9S A;  3GTQ H;  3I91 A;  3BJU A;  3MTS A;  1I3Q B;  5D3I B;  2Q8R E;  2PMZ B;  4GLV B;  5IOD A;  2KEC A;  4LFB Q;  3HOY B;  1PFN A;  3IRB A;  1CSP A;  1NAP A;  5T1G A;  5FLX L;  1PZK D;  1N36 Q;  1LTS D;  4B3S Q;  3HZX A;  1S4Z A;  2A6H C;  2NVY H;  4BBS B;  1SNQ A;  5J22 A;  1XJV A;  1BOS A;  1NUC A;  3QR8 A;  3S1R B;  2MJ8 A;  1WTX A;  3PIP A;  2NVX B;  1MBY A;  1EYG A;  3V2T A;  1TR5 A;  1HH2 P;  1MSG A;  1Y14 B;  4QUC A;  2EIF A;  1TKW B;  1I6H B;  2PQE A;  1ESR A;  3GTL B;  3KUP A;  4NPS A;  3S15 H;  2R93 G;  2WB1 E;  3J80 E;  2KUM A;  2BOS A;  3TEH B;  2VQF L;  3GTM B;  1IL2 A;  2JN4 A;  1I50 H;  2TSS A;  4GKJ L;  4PZ6 A;  2G5D A;  2UXD Q;  4FXD A;  4P75 A;  1BCP D;  3GTK H;  5J1Z A;  1B44 D;  2R3Z A;  4MHE A;  1JWM D;  2SDF A;  2L5T A;  5C0X I;  3PUW A;  5M5W B;  2K5W A;  3RMH A;  1XXG A;  3KYH C;  4K6L A;  2AMC B;  3DEO A;  1IBK L;  1S5C D;  1FJG Q;  4YIJ A;  4IPD A;  2NVX H;  3RR5 A;  2A68 D;  1U9R A;  1VF7 A;  4JI6 L;  2F52 A;  4A3M B;  5CYU A;  4IFD H;  5LMN Q;  1R4P B;  1DON A;  4IUV A;  4K2K A;  2ATW A;  2H4O A;  2JEA I;  2DJF C;  2ICI A;  2F0H A;  4LUV A;  2ZJP A;  2RA4 A;  3G71 A;  1K8A C;  1D6E C;  1EZ8 A;  1XNQ Q;  4UAI A;  1N34 L;  1IL8 A;  1HJP A;  1PH6 A;  3MVV A;  1LM0 A;  5IY0 A;  1KD1 C;  1B4O A;  5FJ8 H;  1S5D D;  3D4R A;  2IHF A;  1A15 A;  4HAE A;  3H0G G;  1Y69 U;  2O5I C;  1PH9 A;  3S2D H;  1C0A A;  4NMZ A;  3HOY G;  5EPL A;  1SMY C;  4P74 A;  4NXN L;  4DKA C;  4XQN A;  3P7J A;  1F9S A;  1J9O A;  1XX8 A;  4KJO A;  3OTO Q;  4I7Z C;  1HR0 L;  4PG3 A;  3GTO B;  2WIN B;  4ZUJ A;  2Z0S A;  3S1R H;  1FR3 A;  4G7H C;  4A3D G;  1Q46 A;  2OTL A;  3CKI B;  4Y52 H;  4OO1 H;  1ENC A;  5COR A;  1PH7 A;  5C3E B;  1ENF A;  1L2F A;  3BYY B;  2RSO A;  4HCE A;  5I9O A;  3EA6 A;  1IW7 C;  4KJN A;  4X65 L;  4YWM A;  2IX1 A;  3LWU A;  4IUU A;  5I2X A;  3C2P A;  4C3H G;  4BWG B;  1HHV A;  3OWE B;  1V1P A;  1W6K A;  5EAY A;  1VQ8 A;  1Y1V H;  4QQB X;  1K73 C;  3OW7 A;  1A0I A;  1SYF A;  1XNR L;  1PH8 A;  4C3H B;  1LTT D;  3HFZ B;  5IP9 G;  4DR6 Q;  2EOT A;  4J1M A;  3CCQ A;  1F9P A;  2ZM6 Q;  3HOZ B;  4KD3 A;  1XMQ Q;  1CQF A;  1STA A;  3K58 A;  1BR9 A;  3M4Q A;  2AQ3 B;  3UDI A;  1PH4 A;  4LFA Q;  2D0O A;  2EY5 A;  3F8T A;  3K0Y A;  1LAB A;  4GZY C;  4F88 A;  1IKM A;  4QF4 A;  3S2H B;  4XDX A;  2PI2 E;  3VR6 A;  5CV6 A;  2K50 A;  1H9S B;  5K36 H;  1SR3 A;  3OSO A;  5G3L F;  2CH4 A;  3K5M A;  4YWK A;  5HGQ A;  1BUV T;  1LTL A;  1EQR A;  2A69 C;  5GQO A;  4OXP A;  1O80 A;  2JA6 B;  1WTO A;  2C35 B;  3TDQ A;  2NVQ B;  1GUT A;  1SJH D;  5F2D A;  2JXM B;  1CKM A;  1FL0 A;  2CQO A;  3D4D A;  2NN6 I;  2UXD L;  1O7Z A;  2QCP X;  3A7A B;  4C3J B;  2F4V L;  2K6A A;  1DZ1 A;  1Z7T A;  1K8G A;  3HOW G;  5IGF A;  2BH2 A;  1HUM A;  1O7Y A;  1NBW A;  2R92 B;  3ULL A;  4EQ5 A;  4JI6 Q;  4JI4 L;  2AQ2 B;  5AFW A;  2CQA A;  1AZP A;  3TBI B;  1CQV A;  1G51 A;  1P16 A;  5KND A;  3QIA A;  2UU9 Q;  1TWF B;  3AQQ A;  1OO9 B;  1S5E D;  4DXG A;  5CV9 A;  1VQJ A;  1SYE A;  1STB A;  5FLX E;  1XNQ L;  4O0A A;  5FKA C;  3Q6S A;  4GN4 B;  1O78 A;  1S3O A;  2WB1 B;  5M3F H;  4XTC S;  3RZD H;  3SGI A;  4DV2 Q;  2F1M A;  3TP7 A;  4DPG A;  1STG A;  1BXT A;  2IW3 A;  2DY7 A;  3FMC A;  4RAU C;  1VQM A;  1EIH A;  1U0L A;  2Z9H A;  1KRS A;  1EIF A;  4ZQ3 A;  1FD7 D;  3N6R A;  1I4R A;  1LT3 D;  4OIJ A;  3CC7 A;  5ELD A;  4DU9 A;  5C5L A;  3DWA A;  2F0T A;  4OWX B;  4LJZ C;  1IBL Q;  3HOW B;  1KXL A;  4JI0 L;  1AP0 A;  5C4J H;  4V19 0;  3T1H L;  2IX0 A;  2R7F A;  3AU7 A;  1SJE D;  1TWG H;  5CC4 A;  3OWF A;  2JYO A;  1I4X A;  1TWH B;  1EOT A;  2K14 A;  1C48 A;  3HOY H;  3HKZ B;  4X65 Q;  1LTB D;  2SNM A;  1IKL A;  3CU7 A;  5IYD H;  1S40 A;  1Q8I A;  2JP1 A;  4RKB A;  1N8R C;  1NE3 A;  2YTV A;  4BBR H;  1TS4 A;  2H1E A;  1UNS A;  1HNX L;  4LW1 A;  1TQO A;  4HJ8 A;  1EY0 A;  1JQY D;  1PZJ D;  2XNA C;  2VNU D;  3K5O A;  1WCM H;  2PO4 A;  3NWT A;  3PUZ A;  5C0X G;  1K83 B;  1VQ6 A;  4C3J H;  4BA1 I;  2K7V A;  2PW5 A;  4JI8 L;  1XMQ L;  2B2V C;  4CJ2 C;  1L0Y B;  3F2C A;  3AFP A;  5M3M H;  4ZKC B;  3BYT B;  4JI7 Q;  1N32 Q;  4DV0 L;  4A3K H;  4RH6 A;  1H95 A;  4H13 C;  2VUM H;  3CME A;  1A3T A;  1Y8P B;  3W1B A;  1AW7 A;  5JJK A;  2QIL A;  1DOK A;  1UEA B;  1D1K A;  1PTO C;  1E7Z A;  4IFD J;  4JI4 Q;  4BXX H;  1V1P B;  3RN5 A;  4CDC C;  4FF3 A;  3W2D A;  3VYS A;  4R9W A;  3PCO B;  2A69 D;  4LMQ D;  1K28 A;  1NMG A;  2FMM A;  1QIL A;  5A2Q E;  5EGT A;  1UE5 A;  2MUY A;  3SEB A;  4I7A A;  4P72 A;  1GUW A;  2J4X A;  1PVO A;  5CBA E;  2HQE A;  4A3F H;  3OYY A;  1WTV A;  1KAB A;  1X3G A;  4JYA L;  1K0S A;  3R2I A;  1E24 A;  3KBX A;  3WOE A;  1X6O A;  5IP9 H;  4AQY L;  5DEH A;  4A3G B;  4GLA C;  3SK8 A;  1TY0 A;  4GKJ Q;  1FVI A;  2ZXR A;  3P1H A;  4DFA A;  4DUZ Q;  4C1N I;  5IWA L;  1TWG B;  2RDH A;  3D4W A;  5CV8 A;  5KYI A;  3NUC A;  1LTG D;  1NCV A;  1X55 A;  4BXX G;  1JOO A;  3AB9 A;  3L3O C;  5DM7 3;  1WTR A;  1O7I A;  4MTK A;  4P73 A;  3HG9 A;  3H94 A;  5T1I A;  2JK8 A;  2VXW A;  1XYI A;  2ALY B;  4DR5 Q;  2L4N A;  2WAQ B;  1PH2 A;  1F2M A;  5GAG C;  5FLM G;  1PV4 A;  4IFD I;  5GAH C;  2RHS B;  1XTD A;  1YNN D;  2CHB D;  3GTL H;  5ELE A;  4UHV A;  4QGU A;  1EY6 A;  4JK1 C;  3HKZ G;  3FKI B;  4G4K A;  2NTT A;  4ZKB B;  2B2U A;  2Y0S E;  3PUX A;  1STY A;  2YV5 A;  3MXN A;  2MO0 A;  2E2I B;  1EEI D;  2E76 C;  1SYG A;  1EYC A;  1E22 A;  4YCW A;  1NMF A;  2J0T D;  4RG1 A;  5C0X H;  1YEZ A;  1E2W A;  3HOZ H;  3SK6 A;  5NUC A;  4DNI A;  4KTA A;  5I6W A;  3NWS A;  2JA8 G;  2K05 A;  1VCI A;  5E1F A;  4K2L A;  2VW9 A;  4JI7 L;  1SMY D;  2Q2T A;  4NXN Q;  3A7L A;  4A3B G;  3E6Z X;  1M4V A;  4RGT A;  4HR7 B;  1HZA A;  1GKH A;  4RWS C;  3U4V A;  2I0Q A;  1UAP A;  1F9Q A;  1V43 A;  2A6E C;  4DV4 L;  4JI2 Q;  2R7Z H;  3D3R A;  1HZC A;  3S1Q H;  1CT1 D;  3OIQ A;  4E6I A;  1VQB A;  1Q90 A;  1IHZ A;  1UE1 A;  4DR1 L;  1IYJ B;  1GUN A;  1VQG A;  1X54 A;  4FNF A;  2VB2 X;  3BZK A;  4LNQ A;  1V1O A;  4RHS A;  4A3M G;  3H09 A;  4PMW A;  4JI8 Q;  1U5K A;  2NVT H;  3FP9 A;  3DUZ A;  1G2T A;  4UP7 A;  3K6O A;  3NTK A;  1B3A A;  2EYL A;  1XNR Q;  2F0W A;  2HIV A;  1EFW A;  1LTR D;  1TVX A;  3F2U A;  3JC6 6;  2VZA A;  2ZM6 L;  1PHJ A;  1EU3 A;  4FVM A;  5ELF A;  1I4Q A;  1PYS B;  4A75 A;  2K5V A;  2K01 A;  1G6Z A;  3KLW A;  3LGJ A;  5KYL A;  4K5W A;  2N78 A;  3X3M A;  4AYB E;  3MXP A;  1QE6 A;  4KKT A;  1I4G A;  1PH5 A;  3S17 H;  4L6T B;  1R9T H;  4BBS G;  1D8L A;  1QNU A;  4B3M L;  4DAV A;  4A93 B;  3MHB A;  1RIP A;  2EJM A;  2XRQ D;  4K6D A;  1RF2 D;  1PFS A;  1UE7 A;  3AFQ A;  1PYB A;  2EZV A;  4X3U A;  1UUP A;  1TS2 A;  4K0K L;  1B3Q A;  5EPJ A;  3BDC A;  4MNO A;  4QJF A;  1FNW A;  2C5C A;  4CKB A;  1EY5 A;  3P75 A;  1TWC H;  1GHK A;  4AYB B;  1OXX K;  2RQX A;  3RZO B;  1JC7 A;  1ZEQ X;  3QOL A;  2CH4 W;  2ZJR A;  3SE0 A;  4A3B B;  2A1A A;  4HJ5 A;  3UDF A;  4RCO A;  4KHZ A;  2ASB A;  3H15 A;  1JE5 A;  1Z9F A;  3NPP A;  5IYB G;  5IT9 L;  3H6M A;  1B8A A;  1PRT C;  4Q0F A;  3M85 A;  2XWJ B;  4QCL A;  2KBN A;  3BZD B;  3CCE A;  4POF A;  2JA9 A;  1EUJ A;  2KHS A;  2DGY A;  1KIX A;  3TP5 A;  5EJW A;  1E3P A;  2K4K A;  1SN8 A;  1OXU A;  2VUM B;  1PRT F;  1X3F A;  2N88 A;  5CGK A;  2UU9 L;  1Q1B A;  4JI2 L;  2CWA A;  3FEW X;  4EX5 A;  5HY6 A;  2VS1 A;  2V4D A;  2PZU A;  1Q86 C;  3CPW A;  2EE1 A;  3D31 A;  3DXJ C;  3I55 A;  1XTC D;  5AJ3 L;  3BU2 A;  1BQQ T;  5EKK A;  2IT1 A;  2KHJ A;  2D0P A;  5IGC A;  1EQV A;  2PQA B;  2E2D C;  2XVS A;  4B3T L;  3GP7 A;  1ZKO A;  2A73 B;  2MGS A;  3NTI A;  3K59 A;  1CKN A;  4DAM A;  3MXN B;  1SLJ A;  5ELC A;  2OQ0 A;  3GO5 A;  1CA6 A;  5LMU Q;  2HQL A;  4A3I H;  2X6G A;  1JB7 A;  4JBJ A;  2JQO A;  1FNU A;  3BS1 A;  2KHI A;  4BY7 H;  4HMI A;  1JJG A;  3CCU A;  2NUC A;  1TWF H;  3VYR A;  1NSN S;  2UXB Q;  5K36 G;  5DLQ E;  2AHO B;  1WVL A;  4L5S A;  3TS2 A;  1QG7 A;  3A56 A;  3PQI A;  2ENB A;  2FMC A;  2GVB A;  4IUQ A;  2JA7 H;  3K5L A;  2A5H A;  4UY8 C;  1TWC B;  4FF1 A;  3QB3 A;  5M5X B;  1STH A;  1V9P A;  3A8J E;  1Q3L A;  1RDP D;  2DY8 A;  2DNC A;  4AH6 A;  4A3I B;  5BR8 L;  2F0S A;  1TII D;  3CRL C;  1HTP A;  1HZB A;  1YNX A;  2RDG A;  3STB C;  4DAP A;  2E2J H;  5GRO A;  4BY7 B;  1QNK A;  4GN5 A;  2WAQ E;  5M9O A;  3F1Z A;  5IYC G;  1T9H A;  2F3I A;  1WYD A;  3TZD A;  4LAA A;  1D5Z C;  2XWB B;  4YCV A;  1YNN C;  2MNA A;  3CCS A;  3T1Y Q;  1NJI C;  1C9O A;  1WTH A;  1BNZ A;  4L5R C;  1ZYR C;  2EXD A;  1ESF A;  4NXM L;  3D8G A;  1G2S A;  4H7B A;  4HSV A;  3PSI A;  2L11 A;  4TKO B;  1BF4 A;  4LFC Q;  3R8B A;  2EJG C;  2PCF B;  4DUY Q;  4U67 3;  4BY1 H;  3CCL A;  4H0L C;  1VQ4 A;  2LMC B;  2SNS A;  1UEB A;  3M9B A;  4XXE A;  4YHH L;  2R92 G;  3CC4 A;  1MI2 A;  4G7Z C;  2HHH L;  1EZ6 A;  4QB4 A;  1EL0 A;  4KY6 A;  1B1Z A;  4APV A;  1CUK A;  2BA1 A;  1ET6 A;  3HGB A;  5IOC A;  4DA2 A;  1JE4 A;  1Z47 A;  4ZUI A;  1B70 B;  1Y1V B;  4JYA Q;  1RJT A;  1BCP C;  1ENA A;  2LFN A;  4PNY A;  2EJF C;  2I5M X;  3G7L A;  1AE3 A;  2NB0 A;  4A3C G;  3BVZ A;  1YJ9 A;  5IWA Q;  2JA8 B;  1PMR A;  2E74 C;  4X62 L;  3S24 A;  3Q0A A;  1PTO D;  3I4M B;  2JA5 H;  1F2Y A;  2EYM A;  3MWY W;  2KA7 A;  3Q23 A;  1LUZ A;  5CV5 A;  4LF7 L;  2X69 A;  4KY7 A;  1Q81 C;  4K8I A;  4ILW A;  4LFA L;  3IAY A;  4DV6 Q;  3KF6 A;  3BDL A;  2L15 A;  1OTC A;  5HGT A;  4GKK Q;  5IT9 c;  1S5F D;  2WKD A;  5J39 A;  3HOV B;  4DV4 Q;  1SMX A;  5C3E H;  4U68 A;  1TWA H;  3SXH A;  1SE2 A;  4Y7N B;  3F2B A;  2DJG C;  2YYZ A;  4GOP C;  4KLK A;  1E1T A;  1XWE A;  2JA5 B;  2LY7 A;  3KLS X;  4MN3 A;  3VR2 A;  3VYU A;  2M9V A;  4RGN A;  3KJP A;  3I90 A;  4RFB A;  3E0J A;  1K83 H;  2NN6 G;  4EQN A;  4IFD G;  1EIY B;  2PQA A;  3K0X A;  3EN2 A;  1BBX C;  1HFN A;  3MAQ A;  3TRE A;  1YIJ A;  1ICF B;  1J8I A;  3VA7 A;  1I94 Q;  3J7A F;  2LS0 1;  3GTG B;  2GN5 A;  4NB3 A;  1YNJ D;  1DOL A;  4O2D A;  2QDB A;  5I2Y A;  1VQ5 A;  3HOU G;  3RN2 A;  3I70 A;  1TWA B;  3R3O A;  1VQO A;  1G91 A;  3V96 A;  2NN6 H;  4JI3 Q;  4C1N K;  4KN4 C;  2R7D A;  3TN2 A;  1CKN B;  5BR8 Q;  2I07 B;  3SHL A;  2L9H A;  2OCE A;  1IBK Q;  1WD1 A;  4UP8 A;  5M3F G;  2NZO A;  3PUV A;  3A55 A;  2HHH Q;  2B8F A;  1EQT A;  1D2B A;  1LV9 A;  2MPM A;  4FXG C;  4B9X A;  1MGS A;  4N8X 1;  1J5E L;  1LAC A;  4B9W A;  1HNZ Q;  1VQE A;  1Q1E A;  3DLL A;  4DV2 L;  3I4M H;  3ER0 A;  1VMC A;  2Z8L A;  1JOQ A;  4A4I A;  3H91 A;  1T5E A;  3OPO A;  4FXK C;  4OWT B;  4LFC L;  4ZLT F;  4JOI C;  4A3C H;  4IZ8 A;  3S2D B;  4DV1 Q;  1QUQ B;  4NKL A;  1VDZ A;  3MFG A;  4KMU C;  4IUP A;  1L0X B;  3K8A A;  1ET9 A;  4DK1 A;  5GAE C;  3J7A V;  3HEJ A;  4DR7 Q;  3FRP B;  3SDZ A;  2J7Z A;  1QVG A;  3WDN A;  4JI0 Q;  4A3G G;  4L5Q A;  5ISR A;  1HQR D;  2F0L A;  3CP0 A;  1I4P A;  2A6E D;  3M7N A;  4DNT B;  3SVM A;  4GKK L;  1DD2 A;  1KNA A;  2LSS A;  4H44 C;  1I6H H;  4JC0 A;  1PFM A;  2ZTE A;  3I2Z A;  4JOI A;  4XQQ A;  1XMO Q;  4P2C B;  1RCV D;  2F0O A;  4HMJ A;  2GVA A;  4JI5 Q;  3MZ5 A;  3W1G A;  2B2U C;  1JMC A;  4KN7 C;  3GTJ B;  1VQP A;  1CSQ A;  2F0J A;  1VMP A;  2WB1 G;  4ABN A;  4CKC A;  1KDA A;  4HIM A;  4O1N A;  1EY7 A;  4HCS A;  4DK6 C;  4WJ4 A;  1EYA A;  2JA5 G;  1CI3 M;  1UWV A;  3I4N B;  5FO7 B;  2MP1 A;  3K81 C;  1OXV A;  4A93 H;  4DV5 Q;  3D6W A;  1I4H A;  1YIT A;  3I4N G;  3U4Z A;  4DV6 L;  2UUB L;  3CCV A;  2O5J C;  1JB3 A;  1GOZ A;  2NYZ D;  4EGV A;  1PXU A;  2AUK A;  3PF4 A;  1HUN A;  1RTO A;  3FVQ A;  4A3F G;  1ZXT A;  3NEN A;  2Y0S B;  4N9P A;  2EY2 A;  3S2H H;  1CHQ D;  2EVB A;  3HS0 C;  4X64 L;  4HIK A;  4N9T A;  1RD9 D;  3CCM A;  1GXD C;  4CKE A;  3K57 A;  4C2M H;  2Y0S G;  2PI2 A;  2Q8I B;  2G9H D;  3HOX B;  3QJY A;  4ZYS A;  2B2Y C;  1JWS D;  3KOJ A;  1B9N A;  1Q12 A;  1KRT A;  1U4R A;  4OIK A;  3CQZ H;  5A2Q L;  4IPH A;  1H9K A;  1RL2 A;  1X9N A;  2JA6 H;  4X3T A;  4WJ3 M;  2NZ1 D;  3ERO A;  1HNZ L;  1MIU A;  2IHE A;  1ASY A;  2B2V A;  2F0M A;  4DR3 L;  1CKO A;  5E4W C;  2PW7 A;  4HTH A;  5IGB A;  1E2Z A;  4JI1 Q;  3AMU A;  2VB3 X;  3EFX D;  5IGE A;  2EY6 A;  1A62 A;  3P20 A;  1EY8 A;  4OX9 Q;  2Z6K C;  2FIN B;  4LWC A;  4JCV E;  2JA8 H;  2IX3 A;  4ME5 A;  4R4O A;  4H02 A;  1QCB D;  3NSW A;  3J81 c;  1VQ7 A;  1PRT B;  3PIO 3;  2RDF A;  1G6P A;  4ZK9 B;  1WI5 A;  5IYD G;  2L1B A;  3AEV A;  2F0F A;  1CZG A;  3ICE A;  4F8M A;  5C44 H;  3S1N H;  4MTN A;  2O4X A;  3M3Y B;  1J5E Q;  2KOL A;  4JBW A;  1WCM G;  1SBB B;  3ZJY C;  4YHH Q;  1JR0 D;  1EOV A;  2F03 A;  4JI5 L;  4A3L H;  1TS3 A;  5JAV A;  2HCC A;  4J6H A;  2X6L A;  4DUZ L;  4OO1 G;  4DR4 Q;  3GV3 A;  1SRO A;  4DAY A;  3RZO H;  3HOU B;  4L5T A;  4DK3 C;  4BY7 G;  2ZT9 C;  3T4A C;  5C3X A;  5JOB A;  4OEM B;  1IBM Q;  2MHV A;  2AQ1 B;  4CHT B;  4A3L G;  5FO9 B;  1FNV A;  4LF8 L;  4ID6 A;  1LT5 D;  1B7Y B;  3NEM A;  1CK1 A;  2NTS A;  1I3Q H;  4DR5 L;  4KD4 A;  5EKL A;  1QZH A;  2NZH A;  3Q22 A;  1E0B A;  1VQK A;  2B63 H;  2RHQ B;  1B53 A;  3GTP B;  1VQI A;  3B6Y A;  2WP8 J;  5EBC A;  3CPF A;  1C7Y A;  1GUS A;  3A5Z B;  3ULP A;  1PRT D;  3WWV A;  4GNX A;  1PA6 A;  4KHP L;  2F0I A;  3A8K E;  2I5H A;  5LL6 S;  1HNW Q;  4B3S L;  3LWE A;  3PIP 3;  1SE8 A;  1WCM B;  3PGZ A;  2B2T A;  3AYH B;  5JEA J;  2HDL A;  3K5N A;  1H9M A;  1GVP A;  4KKU A;  2RBM A;  3CCJ A;  2UUA Q;  4JBK A;  3HKZ E;  2F4I A;  3GTP H;  1DOM A;  2F0P A;  4JI1 L;  1EY4 A;  3DWQ A;  5EBD A;  2Q2H A;  1YBY A;  2A68 C;  4IUR A;  2KVM A;  1DGS A;  1K0R A;  3C1F A;  3DM3 A;  2Q2U A;  4A3K G;  4FP5 D;  2ZTC A;  1YHA A;  5E4X A;  3HOW H;  5M5Y B;  5E3F A;  4Q5V A;  3DEP A;  3HRZ C;  3N52 A;  3J7A 5;  2PNH A;  1N36 L;  1YHB A;  2VQE Q;  3LNN A;  4HED A;  4PMB A;  2EXZ A;  3K80 C;  4OL7 A;  4XYQ A;  1M1K C;  4JI3 L;  1K8M A;  3KF6 B;  4DF7 A;  3MXU A;  3CD6 A;  1L1O C;  1I6V C;  4I65 A;  3J81 j;  4LF9 L;  4BY1 G;  1QZG A;  2K5H A;  3I4N H;  2MFI A;  2N3S A;  4BBR B;  1II3 A;  3KDF B;  2IWH A;  1LYL A;  3BVG A;  5IP7 H;  1KDB A;  4B08 A;  2HDM A;  1HR0 W;  4L63 B;  3K7A H;  2RVL A;  2E2J B;  4LF6 Q;  2A8V A;  2F0G A;  2XSC A;  1YVC A;  5CMD A;  1Y8N B;  2B8G A;  4X3K A;  1N33 Q;  5JJL A;  4A3J G;  2AUJ D;  3CF5 A;  1STE A;  1YJW A;  1TWH H;  4FF2 A;  3M4P A;  4AQY Q;  2FXQ A;  3I3C A;  4B3M Q;  1B2T A;  4WFN 3;  3H0G B;  3BZC A;  2PZW A;  1BDO A;  4K14 A;  4IPC A;  3S14 H;  1IZ6 A;  4DXF A;  4X6A H;  5C3W A;  4LF5 L;  1HR0 Q;  1GUG A;  2B63 G;  2HD3 A;  3H3V H;  2L0C A;  4QMG A;  4IQZ A;  3PIO A;  5C4Z A;  1WD0 A;  1SNO A;  1BCP F;  1SNC A;  2N8N A;  4PMC A;  4IAL A;  4GN3 B;  5CR3 A;  1SDF A;  4K5V A;  2QW7 A;  1N34 Q;  3FPU B;  2WII B;  2F0U A;  3OW2 A;  4CDF C;  1RTN A;  3I56 A;  2WFW A;  2HT1 A;  4TRD A;  1CZW A;  2AWN A;  1JT8 A;  3DHQ A;  3NQT A;  2JA6 G;  4A3D H;  1EY9 A;  3S1M H;  5KEE A;  1EWH A;  5IT9 E;  3S14 B;  4IUT A;  4HJA A;  1X3Q A;  5C4X H;  4DR6 L;  4A3I G;  3NP8 A;  3UI2 A;  1XPR A;  4EVO A;  2JA7 B;  3I72 A;  3EJI A;  1QVF A;  3TQY A;  1CHP D;  2EYH A;  2KCM A;  4ZAI A;  1H9J A;  2KCN A;  4HJ7 A;  1M90 C;  2HIX A;  2UUB Q;  3PO2 B;  4R8N A;  4C3I H;  4KHP Q;  5A35 A;  3T53 B;  2KCT A;  1PYW D;  4NW2 A;  3J7Y W;  1GM5 A;  1HNW L;  1RHP A;  3M4Y A;  5K5P A;  3PO3 H;  2M2L A;  5L37 A;  1XMO L;  1VQH A;  2C9O A;  1R4Q B;  3URY A;  5FO8 B;  4S3S A;  2K5Q A;  2EYF A;  4RHR A;  1CM9 A;  4JG2 A;  3M4O H;  1U4P A;  1Y1W B;  4M8A A;  5TSS A;  1EWI A;  1BCP B;  5KNC A;  4BA2 I;  2RSN A;  4ULL A;  5ELO A;  2PNR C;  4JV5 L;  2L55 A;  3DM1 A;  1YI2 A;  1EQQ A;  1KLU D;  4JBM A;  5M3M G;  3OIP A;  1K9M C;  4IO9 A;  2D62 A;  2F0N A;  4TVA B;  3W5O A;  2XN9 C;  3S16 H;  5IYB H;  2E5L Q;  3T1Y L;  2CVR A;  2IJ0 A;  3CC2 A;  3RLO A;  1WTW A;  2JEB I;  4KHV A;  4LUO A;  1HFG A;  3HOV H;  1M8A A;  1V1Q A;  4QY7 A;  3PO3 G;  1LT4 D;  1SEB D;  4BY1 B;  3UDX A;  3UDG A;  1HRJ A;  2BDO A;  4BBR G;  1A63 A;  1ONL A;  3U9S A;  4AYB G;  5KIX A;  2E2I H;  5HUR A;  3J80 c;  4DUY L;  2F0V A;  2F3W A;  3I8Z A;  3ZYY X;  3TME A;  1SE4 A;  4G57 A;  4PV1 C;  2D9U A;  3FPP A;  2UUC Q;  2LXK A;  3I4O A;  1PDQ A;  3TP6 A;  3SR1 A;  2WAC A;  3TS0 A;  1A3V A;  4RMF A;  1FJG L;  2N49 A;  1Q8K A;  3GQB A;  1EFI D;  1K3B C;  3T56 B;  3S16 B;  2P5Z X;  3ITP A;  1P8L A;  2EYP A;  3G4S A;  1Y8O B;  1WJJ A;  2NBF A;  3G6E A;  2RF4 A;  1A8V A;  4MZ9 A;  2DN8 A;  1D5X C;  2OEO A;  2F4V Q;  1Q82 C;  4RGM A;  3JAM L;  1MD2 D;  1A6X A;  1JOR A;  5JVG 3;  2A74 C;  4ZRZ A;  2SEB D;  1PFB A;  2KJX A;  1G29 1;  1YZ6 A;  3CAM A;  3VR5 A;  3C46 A;  3PO2 H;  1D1I A;  2A6H D;  4X62 Q;  4QIW B;  2I46 A;  3T16 A;  1V8Q A;  2BCO A;  2K5D A;  4A76 A;  2Z6B A;  1MJC A;  4A3E H;  3V05 A;  5JEA G;  5CV7 A;  4XYO A;  3U58 A;  4LF8 Q;  2JJQ A;  1XPO A;  2B2Y A;  3KK7 A;  1A2U A;  1CFM A;  4R4I A;  5BN3 A;  4QUF A;  3I7F A;  1E1O A;  3SK5 A;  4CJ0 B;  3CXC A;  3L0O A;  2HCI A;  2XIW A;  2ES2 A;  5LMN W;  4J8Q A;  4GLX A;  2L12 A;  1WTP A;  5M5Y H;  3LX0 A;  3NEL A;  3RUZ A;  3BVM A;  4HID A;  3ULJ A;  4QIW E;  2H5X A;  4DR4 L;  2MQH A;  4CJ1 B;  2Z1C A;  1KL9 A;  1N9W A;  1VF5 C;  3PF5 A;  4DN4 M;  5CV4 A;  1Y1W G;  3PV0 A;  1R9T B;  3MC0 B;  1JCK B;  3IFT A;  4B3T Q;  4LF7 Q;  2QEX A;  3I4M G;  1TS5 A;  2B29 A;  1HA5 A;  5C6A A;  4DR2 Q;  5DNF A;  4LK1 C;  2WKC A;  1OXS C;  1MHW C;  2TMP A;  2E5L L;  4GOP A;  4DNR B;  3BG3 A;  3EVQ A;  3J81 E;  3M3Y H;  3A74 A;  4OHJ A;  2G9D A;  4HIO A;  3TRZ A;  3PMF A;  1EU4 A;  2QF7 A;  5JJZ A;  1HXY D;  4A3J H;  3NHH A;  2DUD A;  4NDX A;  1HTL D;  2LKV A;  2ZJQ A;  2VL6 A;  1GUO A;  3ND8 A;  5M5W H;  2VQE L;  1ROD A;  3QOJ A;  5D3D A;  1KC8 C;  2E2H B;  1O7L A;  5E7N A;  2AWO A;  4K5X A;  4YY3 Q;  3I73 A;  4DV3 Q;  1K8O A;  3G6J B;  4DK0 A;  4GNX C;  2ICE C;  1FGU A;  1YHQ A;  4XIG S;  1TY2 A;  2OTJ A;  3HOX G;  4DV0 Q;  4HN7 A;  3QO2 A;  2UUA L;  1I50 B;  3MEH A;  2XRS D;  3STB D;  3HKS A;  1DCZ A;  4ODG A;  1SFO H;  2XTI A;  1GD7 A;  3ONA B;  3TZU A;  1VQ9 A;  4XT1 B;  4HSP A;  4JPB W;  5COY A;  3KF8 A;  3EBE A;  5FK9 C;  2UXB L;  2K28 A;  3UE0 A;  3HP3 A;  1ILQ A;  1BO0 A;  2D5D A;  5BN5 A;  2R92 H;  2B3G A;  4F87 A;  1L1O B;  2CW0 C;  2FJ2 A;  4DR7 L;  2IY5 B;  1ZYR D;  3S17 B;  4A3M H;  2PYK A;  3NE5 B;  1B50 A;  2QA4 A;  3E3X A;  5IGG A;  3TSS A;  2N55 A;  3E9I A;  3C3L A;  3Q24 A;  2R7Z G;  3VR3 A;  2R61 A;  2CKZ B;  4LF5 Q;  4KKS A;  5M5X H;  1LO5 D;  4RA8 A;  1SRU A;  5C4X G;  2R7Z B;  1C4Q A;  3NXW A;  1KAW A;  3RLN A;  3TP8 A;  2EYO A;  3T13 A;  4A3B H;  4LF6 L;  3FKI G;  4DV7 L;  1D7Q A;  5KNB A;  1LLR D;  3A5U A;  1ILP A;  1ML0 D;  1A2T A;  4DV1 L;  1D5M C;  5C4H A;  2Q8T A;  1SND A;  5FJ8 G;  3S1M B;  3M4O B;  3RD4 A;  3KLR A;  1L0W A;  1PZI D;  3CHB D;  3DMU A;  4N8F A;  3J80 i;  4WJW A;  4NP5 A;  2A19 A;  4C56 C;  1CA5 A;  1IXR A;  4R4Q A;  4C3I G;  4IUN A;  4O42 A;  5IIF A;  4A3E G;  2NVQ H; 
#chains in the Genus database with same CATH homology
 3CCE A;  4POF A;  1Y1V G;  1B7Y B;  2JA9 A;  1EUJ A;  3NEM A;  4P74 A;  3UE1 A;  2DGY A;  1KIX A;  1I3Q H;  4DR5 L;  4NXN L;  4UPA A;  4DKA C;  1QZH A;  2JA7 G;  1I5F A;  2OQK A;  3GTO H;  1E3P A;  2NZH A;  2K4K A;  1SN8 A;  1OXU A;  4QL5 A;  3KDF A;  3OTO Q;  3G6E A;  1HR0 L;  1X3F A;  1VQK A;  2B63 H;  2RHQ B;  5H1S E;  4PG3 A;  3T1H Q;  3HOX H;  1VQI A;  3B6Y A;  4X64 Q;  2Z0S A;  1PH1 A;  1Q1B A;  2WP8 J;  3S1R H;  2UU9 L;  4JI2 L;  4A3D G;  1Q46 A;  2CWA A;  3CPF A;  2UXC Q;  1C7Y A;  1TXY A;  4EX5 A;  5HY6 A;  2OTL A;  4LFB L;  3HOU H;  2VS1 A;  2YTX A;  4Y52 H;  3A5Z B;  3ULP A;  1PH7 A;  1VQF A;  4R4T A;  1Q86 C;  3FKI H;  1L2F A;  3D31 A;  3WWV A;  2K52 A;  3CPW A;  4GNX A;  1PA6 A;  4KHP L;  3I55 A;  2I5H A;  1HNW Q;  4X65 L;  5AJ3 L;  3BU2 A;  5FLX c;  4B3S L;  4YWM A;  2IT1 A;  2IX1 A;  2KHJ A;  2D0P A;  2OWO A;  1SE8 A;  2PQA B;  4X66 L;  2BA0 A;  3PGZ A;  3KFU A;  1AE2 A;  4YY3 L;  4DV3 L;  4B3T L;  1HNX Q;  3AYH B;  5EAY A;  1VQ8 A;  1Y1V H;  3L7Z C;  4QQB X;  1K73 C;  1MKH A;  1CKN A;  4DAM A;  5JEA J;  1A0I A;  1SLJ A;  3MXN B;  2OQ0 A;  3GO5 A;  1PH8 A;  1XNR L;  4LF4 L;  1GVP A;  3HFZ B;  5IP9 G;  4DR6 Q;  3MEF A;  5LMU Q;  2HQL A;  3CCJ A;  4A3I H;  3CCQ A;  2ZM6 Q;  2UUA Q;  1JB7 A;  4JBK A;  2R93 H;  3HKZ E;  2JQO A;  4JBJ A;  2JE6 I;  5IYC H;  1XMQ Q;  3JAM i;  3GTP H;  4IOC A;  3M4Q A;  2KHI A;  4BY7 H;  3CMA A;  2LXJ A;  4JI1 L;  1JJG A;  3UDI A;  5C0X J;  3CCU A;  1TWF H;  1YBY A;  2Q2H A;  1PH4 A;  1DGS A;  1K0R A;  3DM3 A;  2CFM A;  5DLQ E;  4LFA Q;  4A3K G;  2D0O A;  1VQL A;  2Q2U A;  2AHO B;  5J3B A;  2ZTC A;  1YHA A;  3E9H A;  3HOW H;  3F8T A;  4L5S A;  3TS2 A;  4GNX B;  4B3R Q;  1VQC A;  1OXT A;  2PI2 E;  4R4C A;  2PNH A;  3J7A 5;  1N36 L;  1YHB A;  2VQE Q;  2GVB A;  2JA7 H;  1BVS A;  4UY8 C;  2K50 A;  3K80 C;  1M1K C;  1V9P A;  1SR3 A;  4JI3 L;  3KF6 B;  3F2D A;  4AH6 A;  3G48 A;  3CD6 A;  1L1O C;  2UUC L;  3J81 j;  4LF9 L;  5LMN L;  4BY1 G;  5BR8 L;  1QZG A;  4YWK A;  4BBS H;  5HGQ A;  1UE6 A;  2K5H A;  5IP7 G;  2MFI A;  3I4N H;  1LTL A;  2N3S A;  1HZB A;  1YNX A;  2E2J H;  3STB C;  3KDF B;  1EQR A;  1LYL A;  5GRO A;  3RLF A;  5IP7 H;  4GN5 A;  2WAQ E;  4OXP A;  5GQO A;  1HR0 W;  4P71 A;  3F1Z A;  3K7A H;  5IYC G;  2C35 B;  1T9H A;  2F3I A;  4OON A;  1KQS A;  2ZTD A;  4LF6 Q;  2A8V A;  1GO3 E;  1WYD A;  1CKM A;  1BBW A;  1FL0 A;  2CQO A;  2NN6 I;  4DV7 Q;  3HOZ G;  2UXD L;  4PZ7 A;  1YVC A;  1N32 L;  1WFQ A;  4YCV A;  3CCS A;  2MNA A;  3T1Y Q;  1NJI C;  2QGQ A;  1C9O A;  5C44 G;  4L5R C;  4OX9 L;  4A3J G;  1N33 Q;  3PUY A;  3CF5 A;  5JJL A;  2EXD A;  1KHI A;  1TWH H;  1YJW A;  3M4P A;  4AQY Q;  2FXQ A;  2F4V L;  1K8G A;  3HOW G;  4NXM L;  2VY3 A;  3PSI A;  4LFC Q;  4B3M Q;  2BH2 A;  1NBW A;  3BZC A;  3ULL A;  4EQ5 A;  2Z6K A;  4JI6 Q;  4JI4 L;  1AH9 A;  4Y7N H;  4IPC A;  4DUY Q;  3S14 H;  1S72 A;  4BY1 H;  1IZ6 A;  2WAQ G;  3CCL A;  5ELN A;  4IJH A;  1VQ4 A;  4K0K Q;  1W3S A;  3J7Z C;  4X6A H;  1G51 A;  4LF5 L;  1P16 A;  1HR0 Q;  2B63 G;  1UEB A;  3M9B A;  4YWL A;  3H3V H;  3FHW A;  4YHH L;  2R92 G;  2UU9 Q;  3CC4 A;  3AQQ A;  3PIO A;  4J15 A;  2YU9 H;  2HHH L;  1VQJ A;  2N8N A;  4APV A;  1CUK A;  2BA1 A;  4GN3 B;  1XNQ L;  4O0A A;  1N34 Q;  4GN4 B;  5M3F H;  3RZD H;  1S3O A;  4XTC S;  3OW2 A;  4IOA A;  3SGI A;  1Z47 A;  1B70 B;  4DV2 Q;  5AJ3 Q;  4JYA Q;  3GTG H;  4DPG A;  3I56 A;  2WFW A;  2HT1 A;  1L1O A;  2I5M X;  2AWN A;  1JT8 A;  3H0G H;  1VQM A;  1AE3 A;  2JA6 G;  1U0L A;  3A0J A;  1KRS A;  4A3D H;  1EIF A;  4A3C G;  1YJ9 A;  2V1C C;  5IWA Q;  3S1M H;  4A93 G;  4HJA A;  1NTG A;  5C4X H;  3CC7 A;  4DR6 L;  4A3I G;  4X62 L;  3S24 A;  2XGT A;  4IPG A;  2JA5 H;  2BH8 A;  1XPR A;  1LUZ A;  4OWX B;  4LF7 L;  3OTO L;  1IBL Q;  1KXL A;  4JI0 L;  4A3G H;  1Q81 C;  5C4J H;  3GTM H;  1QVF A;  3TQY A;  3T1H L;  2IX0 A;  2KCM A;  2R7F A;  1MJE A;  4LFA L;  1TWG H;  4DV6 Q;  3KF6 A;  4HJ7 A;  1M90 C;  2HIX A;  2UUB Q;  2L15 A;  4C3I H;  1OTC A;  1K3R A;  4GKK Q;  2K14 A;  5FLM H;  3HOY H;  1W2B A;  5IT9 c;  4KHP Q;  2KCT A;  3CCR A;  1GM5 A;  1HNW L;  4X65 Q;  3PO3 H;  5IYD H;  1XMO L;  4DV4 Q;  1VQH A;  1S40 A;  1SMX A;  5C3E H;  4X66 Q;  1N8R C;  1NE3 A;  2YTV A;  4BBR H;  1TWA H;  3VDY A;  1HNX L;  4LW1 A;  3F2B A;  4HJ8 A;  2R6G A;  2YYZ A;  4GOP C;  2VNU D;  1X3E A;  4JG2 A;  3M4O H;  4ALP A;  1WCM H;  1E1T A;  4KLK A;  4LF9 Q;  3PUZ A;  5C0X G;  1J6Q A;  2VUM G;  4LF4 Q;  1EWI A;  3H3V I;  5LMU L;  1VQA A;  3Q8D A;  1VQ6 A;  3U50 C;  4C3J H;  1NY4 A;  4BA1 I;  4BA2 I;  4AIM A;  3KJP A;  4JI8 L;  5ELO A;  1XMQ L;  4JV5 L;  1K83 H;  1YI2 A;  1EQQ A;  2NN6 G;  3F2C A;  5M3M G;  4JBM A;  2PMZ E;  1K9M C;  1EIY B;  4IFD G;  3D0F A;  2PQA A;  3K0X A;  4DV5 L;  3EN2 A;  3AFP A;  2D62 A;  4TVA B;  1VQD A;  2Q2I A;  3EIV A;  4TQU S;  3W5O A;  5M3M H;  4DR2 L;  3S16 H;  3TRE A;  5IYB H;  1YIJ A;  2E5L Q;  4DV0 L;  4JI7 Q;  4A3K H;  1N32 Q;  1H95 A;  3T1Y L;  2VUM H;  3CC2 A;  1N33 L;  3RLO A;  3CME A;  3W1B A;  1I94 Q;  2GN5 A;  1VS0 A;  4NB3 A;  2JEB I;  5JJK A;  4FDB A;  4LUO A;  4O2D A;  4NXM Q;  3HOV H;  1V1Q A;  2MO1 A;  4QY7 A;  1VQ5 A;  3HOU G;  4B3R L;  3PO3 G;  3RN2 A;  3UDX A;  3UDG A;  4HJ9 A;  4BBR G;  1A63 A;  1VQO A;  4AYB G;  1E7Z A;  5IE8 A;  2K5N A;  4IFD J;  1JJ2 A;  4JI4 Q;  3GTJ H;  4DR1 Q;  2E2I H;  3J80 c;  4JI3 Q;  3RN5 A;  4BXX H;  4DUY L;  2R7D A;  4R1J A;  2UUC Q;  1JJC B;  1CKN B;  2LXK A;  5BR8 Q;  3I4O A;  4OO1 I;  4OWW B;  3PCO B;  2CCZ A;  2OCE A;  1YJN A;  1IBK Q;  1NMG A;  3TS0 A;  4RMF A;  1ASZ A;  1FJG L;  2N49 A;  4UP8 A;  5M3F G;  2NZO A;  1UE5 A;  3PUV A;  2HHH Q;  3RNU A;  1Q8K A;  4P72 A;  1PVO A;  2K75 A;  4A3F H;  3OYY A;  1BKB A;  4GOP B;  1P8L A;  3ERS X;  3G4S A;  1J5E L;  1HNZ Q;  1VQE A;  1Q1E A;  1WJJ A;  1X3G A;  2RF4 A;  1A8V A;  3K7U C;  3ER0 A;  3NBH B;  4MZ9 A;  3KJO A;  3DLL A;  4DV2 L;  3I4M H;  2CWP A;  4DR3 Q;  1E24 A;  5IP9 H;  4AQY L;  1X6O A;  2VQF Q;  1Q82 C;  2F4V Q;  1HZ9 A;  4A4I A;  4GLA C;  4LFC L;  4OWT B;  4JOI C;  4GKJ Q;  1FVI A;  4A3C H;  2KEN A;  4DUZ Q;  5JJI A;  2AKW B;  5IWA L;  4DV1 Q;  1PH3 A;  1QUQ B;  1G29 1;  1YZ6 A;  3CAM A;  3PO2 H;  4PZ8 A;  4X62 Q;  3K8A A;  3J81 i;  4C3H H;  1X55 A;  5GAE C;  4BXX G;  4UP9 A;  3GDE A;  2I5L X;  4A76 A;  3GD7 A;  4DR7 Q;  1X56 A;  4IJL A;  1QVG A;  1IBL L;  2EQS A;  4LUZ A;  1MJC A;  4JI0 Q;  4A3G G;  4A3E H;  2E2H H;  4L5Q A;  4DAY B;  1O7I A;  1XPU A;  4KI0 A;  5JEA G;  4P73 A;  3U58 A;  3KF8 B;  4LF8 Q;  2JJQ A;  3CP0 A;  1XPO A;  2JK8 A;  2YTY A;  4R4I A;  3JAM c;  2ALY B;  4DR5 Q;  3I7F A;  1E1O A;  3CXC A;  3M7N A;  4ME3 A;  3L0O A;  1VQN A;  1Y1W H;  1PH2 A;  4GKK L;  1QUQ A;  5GAG C;  5LMN W;  5FLM G;  1PV4 A;  4GLX A;  2RCN A;  2ES2 A;  2LSS A;  5GAH C;  2RHS B;  4IFD I;  1I6H H;  1XTD A;  3L2P A;  5M5Y H;  3GTL H;  4JC0 A;  1X65 A;  4QGU A;  2ZTE A;  3I2Z A;  4JOI A;  1WOC A;  2ID0 A;  3HKZ G;  3NEL A;  1XMO Q;  2E8G A;  2GVA A;  2Y0S E;  3PUX A;  4JI5 Q;  2UXC L;  2YV5 A;  3W1G A;  4HID A;  1JMC A;  4GS3 A;  3ULJ A;  4QIW E;  2H5X A;  2MO0 A;  1VQP A;  1CSQ A;  2WB1 G;  4DR4 L;  1E22 A;  4YCW A;  1NMF A;  2MQH A;  4RG1 A;  4HIM A;  1YEZ A;  1KL9 A;  1N9W A;  4WJ4 A;  3PF5 A;  4DK6 C;  1Y1W G;  1IBM L;  3PV0 A;  1Q7Y C;  4JYA L;  2JA5 G;  3HOZ H;  1UWV A;  4JV5 Q;  5K36 G;  4DNI A;  3E0E A;  4B3T Q;  4LF7 Q;  2QEX A;  3I4M G;  5C3E G;  3K81 C;  1OXV A;  4A93 H;  4DV5 Q;  2B29 A;  4POG A;  2JA8 G;  1QVC A;  1VCI A;  4DR2 Q;  2VW9 A;  3HOV G;  4JI7 L;  1OXS C;  1YIT A;  2E5L L;  3I4N G;  3CW2 C;  1BBU A;  3U4Z A;  4DV6 L;  2Q2T A;  4GOP A;  4NXN Q;  2UUB L;  3CCV A;  1I94 L;  4A3B G;  4YCU A;  3PF4 A;  3M3Y H;  3A74 A;  1HZA A;  5GAD C;  3PO2 G;  4A3F G;  1GKH A;  3U4V A;  3NEN A;  4HIO A;  2I0Q A;  3GTQ H;  3TRZ A;  3S2H H;  1V43 A;  3BJU A;  4X64 L;  4HIK A;  4DV4 L;  4JI2 Q;  2R7Z H;  3S1Q H;  1HZC A;  3CCM A;  4GLV B;  1VQB A;  4LFB Q;  4A3J H;  1UE1 A;  4DR1 L;  1IYJ B;  4C2M H;  2DUD A;  2Y0S G;  1VQG A;  1X54 A;  2PI2 A;  2ZJQ A;  3BZK A;  2VL6 A;  3IRB A;  1CSP A;  4A3M G;  4LNQ A;  1N36 Q;  5M5W H;  2VQE L;  4B3S Q;  1KC8 C;  3KOJ A;  1Q12 A;  4PMW A;  2NVY H;  1KRT A;  4JI8 Q;  1XJV A;  5E7N A;  1U5K A;  2AWO A;  2NVT H;  3FP9 A;  3CQZ H;  4YY3 Q;  4DV3 Q;  4IPH A;  4GNX C;  4UP7 A;  3PIP A;  1EYG A;  1RL2 A;  1FGU A;  1YHQ A;  1XNR Q;  1HH2 P;  4XIG S;  1X9N A;  2JA6 H;  1Y14 B;  2OTJ A;  2HIV A;  2EIF A;  3HOX G;  4DV0 Q;  1HNZ L;  1EFW A;  4WJ3 M;  3JC6 6;  1MIU A;  2VZA A;  2ZM6 L;  2IHE A;  4NPS A;  1PHJ A;  2UUA L;  3S15 H;  2R93 G;  2WB1 E;  3STB D;  3HKS A;  1ASY A;  1SFO H;  4DR3 L;  1CKO A;  3TEH B;  2VQF L;  2XTI A;  1IL2 A;  1GD7 A;  1I50 H;  1PYS B;  1VQ9 A;  4JI1 Q;  4A75 A;  4GKJ L;  4PZ6 A;  2K5V A;  2UXD Q;  4P75 A;  3GTK H;  3EBE A;  2UXB L;  3KLW A;  3LGJ A;  4IO9 A;  1A62 A;  2N78 A;  3UE0 A;  4OX9 Q;  4AYB E;  2Z6K C;  4LWC A;  5C0X I;  2R92 H;  2B3G A;  4JCV E;  1PH5 A;  1L1O B;  2JA8 H;  1R9T H;  3PUW A;  3S17 H;  4BBS G;  4R4O A;  4H02 A;  3KYH C;  3J81 c;  4DR7 L;  1VQ7 A;  1D8L A;  2AMC B;  4B3M L;  2IY5 B;  4A3M H;  1IBK L;  1FJG Q;  1RIP A;  4IPD A;  2NVX H;  1G6P A;  3RR5 A;  4JI6 L;  1WI5 A;  1PFS A;  1UE7 A;  2F52 A;  1PYB A;  3AFQ A;  5IYD G;  2QA4 A;  3AEV A;  3E9I A;  3ICE A;  2R7Z G;  5C44 H;  3S1N H;  4K0K L;  5LMN Q;  4MTN A;  2CKZ B;  4LF5 Q;  1J5E Q;  5M5X H;  4JBW A;  2ATW A;  2JEA I;  1WCM G;  1SRU A;  4MNO A;  4QJF A;  3ZJY C;  4YHH Q;  4LUV A;  2ZJP A;  3G71 A;  5C4X G;  1EOV A;  1K8A C;  1TWC H;  3RLN A;  1KAW A;  4A3B H;  4JI5 L;  4A3L H;  1OXX K;  4LF6 L;  3FKI G;  4DV7 L;  2ZJR A;  1D7Q A;  1XNQ Q;  4DUZ L;  1N34 L;  4DR4 Q;  4OO1 G;  3A5U A;  1SRO A;  3RZO H;  1HJP A;  4DV1 L;  2A1A A;  4L5T A;  4HJ5 A;  1PH6 A;  3UDF A;  4DK3 C;  4BY7 G;  5FJ8 G;  1LM0 A;  4KHZ A;  5IY0 A;  2UXB Q;  1KD1 C;  3H15 A;  2ASB A;  1IBM Q;  1JE5 A;  1Z9F A;  1L0W A;  5FJ8 H;  5IYB G;  1B8A A;  2IHF A;  3J80 i;  3H0G G;  2A19 A;  4A3L G;  1IXR A;  4R4Q A;  3M85 A;  1PH9 A;  3S2D H;  4A3E G;  2NVQ H;  1C0A A;  3HOY G;  2KBN A;  4LF8 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...