5IYCH

Human core-pic in the initial transcribing state
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
150
structure length
150
Chain Sequence
b'MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna
total genus 19
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5iycH01
4A3LH 2K14A 3CPFA 4A3BG 4IJLA 3ULLA 1V1QA 1X3FA 2AHOB 4DR4L 3DM3A 2JA9A 2B29A 1QUQA 3F1ZA 3OTOQ 2VQEL 2ZJRA 2ES2A 2NZHA 4MNOA 4UP9A 4DR3L 1VQ8A 1CSPA 3GTPH 2ZTEA 4EQ5A 5M3MG 1RL2A 1PHJA 3I7FA 5ELNA 4DUZL 1X3EA 4DV7L 2ZJPA 4JI4L 3LGJA 4JV5Q 4OO1I 2D62A 2ALYB 4LW1A 1HJPA 1PH5A 5IP9G 3W1GA 1KRSA 2PQAB 3U4VA 1PH1A 4X6AH 3ER0A 1JE5A 1YHBA 1GM5A 1I94Q 2IY5B 2JA5G 4IFDG 3CMEA 4A93G 2B3GA 2K50A 1VCIA 3CCUA 4DV0L 2Y0SE 1QZHA 3FHWA 1VQOA 4KHZA 4MZ9A 4DR2L 2YTYA 5C44G 4C3HH 4R4TA 4DAYB 3CCSA 1NJIC 3I4MG 2VQFQ 4LWCA 4UPAA 4HJ9A 1FJGL 3TRZA 4X64L 1C0AA 4HJ8A 1KHIA 1UEBA 2YV5A 1JJGA 4DV3L 4IOAA 4JI8Q 4IPCA 1J5EQ 2E2JH 1PYSB 1K8GA 1YITA 5J3BA 1E1OA 2UUCL 5M3FH 3GTGH 3HOVG 1HNXL 2JE6I 1A63A 2MQHA 2WFWA 2F4VQ 2CFMA 1VQHA 3KF6A 1J6QA 4X65L 1D7QA 3W5OA 4DR5L 4X62L 2VS1A 3M4PA 1MKHA 3PUVA 4BY1G 4JI3L 4A3DH 1X55A 4DUYL 4AQYQ 4JI2L 4GKKQ 4A3CH 4Y7NH 3IRBA 1WFQA 1Y1VG 2LSSA 2RHQB 2PQAA 1UE5A 1V43A 2HIVA 1Y1WH 4NB3A 4DV6L 1K73C 3H0GG 3JAMi 3J81c 2R7DA 3HKZG 3STBC 1V9PA 4C3IH 2FXQA 1UE6A 1AE2A 2Q2TA 1CUKA 1L1OC 4NXNQ 1XNRQ 2JA8H 1XMQQ 5IYDG 3T1YQ 4BBRG 2K4KA 4R4QA 4LF6Q 1K83H 1VQPA 2RHSB 2YTXA 3EBEA 4GNXC 1PH4A 2CWPA 2OTLA 2KCTA 4B3SL 1VS0A 4BY7H 1G6PA 3UE1A 1YNXA 1P16A 1A62A 2AMCB 3PUZA 4P74A 3S1NH 3L0OA 3M9BA 4OO1G 3Q8DA 5FLMG 1I3QH 2VQFL 4DPGA 2F3IA 2C35B 4QY7A 1HZBA 2DUDA 2OCEA 3HOUH 2ASBA 2E8GA 1YJNA 3G48A 1QZGA 2I5LX 3PCOB 1SLJA 3JC66 1AE3A 2R7ZH 1CKNB 1OXUA 1D8LA 1KXLA 3PGZA 3S2HH 1WCMH 4A3IH 4B3RL 1J5EL 3HOZG 1YI2A 1QUQB 4PZ6A 4KLKA 1ASZA 4HJ7A 3PV0A 3S15H 2JA6H 3SGIA 5K36G 3PSIA 2UXDQ 1TXYA 5JEAG 4LNQA 1K3RA 5JJIA 4JI1Q 3S1RH 1WOCA 2ZM6L 4AYBE 4DNIA 4B3TQ 3J80i 1JMCA 2R92H 2PI2A 3EIVA 2RCNA 1UE1A 1GD7A 1L2FA 2D0PA 5GADC 2ZTCA 4AQYL 1B7YB 2NVQH 2CCZA 2NZOA 4B3MQ 4JI6L 3RLFA 1SMXA 4J15A 3OW2A 1XMOL 2GVAA 2E5LQ 4R4IA 1Q82C 2ATWA 1Z47A 3RN2A 1N36Q 2IHFA 1TWHH 3PF5A 2VUMG 3S1MH 4LF4L 1N32Q 4A3BH 3UDGA 5FJ8H 3GTLH 3F2BA 4A75A 1IBKL 5IYBH 2WAQG 4L5TA 4NXNL 3PUXA 4AH6A 4DV5Q 4TQUS 5BR8Q 2PMZE 4A4IA 4GKJL 3FKIG 4K0KL 3K8AA 1P8LA 4X66Q 4JOIC 3NELA 1YBYA 5C3EH 3HOXH 1PH6A 1KC8C 1QVCA 2WAQE 4QIWE 5LMUL 3D31A 4OXPA 3F8TA 1ASYA 1VQGA 4JYAQ 1CKNA 3ULPA 4JG2A 1HR0L 4DV4L 2I0QA 2IHEA 4NXMQ 3KF6B 4OONA 4JBMA 1T9HA 4GLAC 2Q2IA 4BA1I 3B6YA 5IYCG 2OWOA 1I6HH 4JI0L 1NBWA 1JJCB 2RF4A 5C4XH 1VQNA 4LF5Q 4A3EH 2Q2HA 3GTMH 3J81i 2CKZB 4A3KH 1IZ6A 2Y0SG 5E7NA 4LUOA 4PZ7A 1Q81C 2JA7H 1JJ2A 3UDFA 3J7ZC 4IPHA 2XTIA 2A8VA 2B63H 3A5ZB 1VQKA 4YCVA 4JBWA 3PO2G 2UXCQ 1Q8KA 3S16H 3J80c 2KBNA 4JI1L 3RR5A 4A3GG 4JI7Q 1VQDA 2PI2E 4B3TL 2R6GA 1HNZL 1IYJB 1E24A 4QJFA 3T1HL 2Z0SA 3CQZH 2UUAQ 1TWFH 4GN3B 4A3MH 4BA2I 2VL6A 4B3ML 2HIXA 3BZKA 1W2BA 2E5LL 4BBSG 1L0WA 4GOPC 5C0XI 1M90C 2DGYA 1Y1VH 1YVCA 1VQBA 3U4ZA 1N36L 5H1SE 1VQJA 2N78A 3HOWH 1VQ6A 2UXBQ 5GAHC 4QGUA 4IOCA 2N8NA 1XPRA 4A3LG 3NEMA 2XGTA 2Z6KA 3NBHB 4LUZA 3RLOA 1E1TA 5JEAJ 5BR8L 1VQ9A 3RZOH 1I5FA 1PFSA 3CF5A 1G291 2VZAA 3GTQH 4X66L 2UUBL 2R93H 4YWKA 4OWXB 5C0XJ 3ICEA 3AQQA 4IPGA 3CCQA 1PH2A 1X56A 1IBMQ 1HNWL 1XJVA 1S72A 1DGSA 1NMGA 1K8AC 1B70B 3CCJA 1CKMA 2KHJA 1U0LA 1JB7A 3OTOL 1N33Q 4FDBA 4DR7Q 1KAWA 4R4OA 3I4OA 3G71A 4KHPQ 5C4JH 4JBKA 4YWLA 4LF8Q 2WP8J 5IP7H 2JQOA 1QVFA 4DV1Q 2HT1A 4JV5L 3E9HA 3M7NA 3M3YH 5GQOA 3PF4A 4DV2Q 2YYZA 2K5VA 2HQLA 4O0AA 2OTJA 5FLXc 3PO3H 3S2DH 1I94L 3J81j 2UXCL 2I5MX 1FGUA 1S3OA 4A3JH 4LFCQ 1KL9A 3DLLA 1SRUA 4HJ5A 1EUJA 4P73A 1X9NA 3MXNB 1SROA 1NY4A 3KOJA 3CMAA 3F2DA 2YU9H 4QQBX 3I2ZA 4GS3A 3GO5A 3I4NH 2VW9A 3KDFB 3KF8B 5M3FG 5IWAQ 4UP7A 2QA4A 3CCVA 4PZ8A 4A3FH 2OQ0A 5IE8A 3K7AH 4BXXH 5LMNW 4JI8L 4YY3Q 1Q1EA 5LMNQ 2L15A 4AYBG 1PV4A 2UXBL 1U5KA 4A3DG 3CPWA 3RLNA 4A3CG 2E2HH 3GD7A 3HOYH 5GAGC 2F4VL 4MTNA 1PA6A 1YHAA 1SE8A 4ME3A 1X3GA 5C0XG 1Y1WG 1PH3A 2UU9Q 2GVBA 4DR4Q 4NPSA 1EOVA 1MJCA 3STBD 4P72A 1IBML 4LF9Q 3M4OH 4P75A 4GKKL 4DAMA 5HY6A 1IBLQ 1EYGA 1EWIA 2GN5A 2WB1G 2JA8G 3W1BA 3TS0A 1SN8A 2I5HA 4DV7Q 4JI4Q 3KLWA 1R9TH 1N33L 1QVGA 4BY7G 4DK3C 3H3VH 2CQOA 1A8VA 1HH2P 1VQLA 1VQCA 2A1AA 5M5WH 5IYCH 4KHPL 3GDEA 1WYDA 2K5NA 2WB1E 4JC0A 5M5XH 4LF8L 1XNQQ 3HKSA 5M3MH 4LF7Q 4DV0Q 1XNRL 3J7A5 1XMQL 3T1YL 4DR2Q 1MIUA 2QEXA 3WWVA 4LF6L 1KRTA 1N8RC 3KDFA 1N34Q 3HOUG 3ERSX 5IP9H 2BH8A 3HFZB 3TREA 3KJOA 2F52A 3K0XA 3AYHB 5ELOA 1YHQA 1VQ5A 1E3PA 4IO9A 3S1QH 2N3SA 4LFCL 3VDYA 2JA5H 2R7ZG 3S14H 4A93H 1EQQA 2MNAA 1WCMG 4A3IG 1K0RA 4JI5Q 1PYBA 3ULJA 3CAMA 5HGQA 2JEBI 4DV3Q 3KYHC 1EFWA 1XPUA 5C44H 1Z9FA 2JA6G 2LXKA 1G51A 1N9WA 2BA1A 1PH9A 3I4MH 1WI5A 3G4SA 1LM0A 2UUCQ 3PIPA 4C2MH 1HNXQ 1PH8A 3CD6A 3F2CA 3M85A 3FP9A 2R92G 1RIPA 1YJ9A 4WJ3M 3BU2A 1YIJA 1VQ7A 5IT9c 2IT1A 2MO1A 2VNUD 4JBJA 3CCMA 4XTCS 2LXJA 2UXDL 1OTCA 4JI3Q 2PNHA 4DUYQ 1VQMA 4JI2Q 2KENA 3HOVH 1L1OA 2JK8A 2ZTDA 3K81C 2H5XA 2JEAI 1C9OA 2K52A 3RN5A 4POGA 2UU9L 4KI0A 4GNXA 1PVOA 3AFPA 4DV6Q 3TS2A 1X54A 2AKWB 4LF9L 4IPDA 1TWCH 3UDIA 5FJ8G 1NMFA 1IBLL 4RG1A 3L7ZC 5IYBG 4UY8C 3GTKH 3A5UA 4BY1H 1SFOH 1OXVA 1XTDA 4YHHQ 2NVTH 2AWNA 3CP0A 3TEHB 4APVA 3I55A 5C3EG 1NE3A 3HOXG 4B3SQ 1HZCA 4OX9Q 4DR1Q 1N32L 4JCVE 3H0GH 3CXCA 4GN4B 4RMFA 4LF7L 3RZDH 1XNQL 4HIKA 4DV5L 1GKHA 1E22A 3PUYA 2IX1A 1VQIA 5IYDH 1N34L 3A74A 4BBRH 4LFBQ 1VQEA 1YEZA 5C4XG 2EXDA 4A3EG 5DLQE 4Y52H 4HIOA 4JYAL 1GO3E 1YZ6A 2ZJQA 4OWWB 1IL2A 4A3KG 3NENA 2JA7G 2CWAA 3MEFA 4JI5L 1SR3A 4NXML 1O7IA 2B63G 4B3RQ 3I56A 4IJHA 5FLMH 1X65A 5IY0A 1M1KC 4LF5L 1KIXA 4A76A 5AJ3Q 1X6OA 4O2DA 2KCMA 4L5QA 2JJQA 2OQKA 1UE7A 2MO0A 2ZM6Q 1NTGA 2D0OA 1K9MC 3H15A 1JT8A 4QL5A 3HOZH 2AWOA 4A3MG 3GTOH 4DR6Q 2HHHQ 1W3SA 2NVYH 1KD1C 1CSQA 5GAEC 2VY3A 1OXSC 1OXXK 4PMWA 4JI6Q 4JI7L 3CC2A 1H95A 3GTJH 4GOPB 5GROA 1XMOQ 1Q86C 2E2IH 3HOWG 3CCEA 1CKOA 1LUZA 1AH9A 4JOIA 1BBWA 2ID0A 2K5HA 2QGQA 1Q1BA 4R4CA 3CCRA 1BBUA 2NN6I 2UUAL 4LF4Q 3E0EA 3UE0A 4DKAC 4YHHL 1IBKQ 3CW2C 4GLVB 1LYLA 2R7FA 3D0FA 4L5RC 5EAYA 3H3VI 4LFAQ 2R93G 4GKJQ 1XPOA 4TVAB 3HKZE 4OX9L 1HZ9A 3EN2A 4DR1L 2NVXH 3CCLA 1EQRA 2VUMH 1I50H 2EIFA 3CC4A 5LMUQ 1PH7A 1OXTA 1UWVA 1HR0W 1HR0Q 4AIMA 4DV4Q 4POFA 4LFBL 3M4QA 1YJWA 1Y14B 1WJJA 3FKIH 4OWTB 2VQEQ 4C3JH 4JI0Q 3BZCA 4ALPA 4DR3Q 4IFDI 5IP7G 4H02A 3E9IA 4DUZQ 2Z6KC 1KQSA 4EX5A 3G6EA 1L1OB 4PG3A 4YWMA 3OYYA 4P71A 3UDXA 1HZAA 3PUWA 4DR7L 2MFIA 3PO3G 4XIGS 2BA0A 4GNXB 4HJAA 5JJKA 1BVSA 1A0IA 3CC7A 4A3JG 5AJ3L 4DV1L 4YCUA 4HIMA 1MJEA 4IFDJ 3KJPA 2Q2UA 2KHIA 3A0JA 3AFQA 4DV2L 4GOPA 2V1CC 4UP8A 2BH2A 3I4NG 1HNZQ 3S17H 5JJLA 2YTVA 1GVPA 3T1HQ 1VQAA 2IX0A 3K7UC 2HHHL 4DR6L 1FJGQ 4X64Q 3RNUA 3PO2H 4A3FG 4DK6C 3S24A 1IXRA 3AEVA 4BXXG 3JAMc 1C7YA 4A3GH 4L5SA 2N49A 3K80C 2A19A 1Q7YC 1FL0A 1FVIA 3BJUA 5IWAL 1VQ4A 4WJ4A 3HOYG 3PIOA 1TWGH 2EQSA 1BKBA 2K75A 4R1JA 1VQFA 1EIFA 1TWAH 1S40A 4HIDA 4YCWA 4LFAL 3ZJYC 3L2PA 4YY3L 5M5YH 4BBSH 5LMNL 3KFUA 4K0KQ 4X65Q 1LTLA 3U50C 1Q46A 3U58A 2UUBQ 4DR5Q 4X62Q 4GN5A 3TQYA 1E7ZA 1Q12A 1HNWQ 1EIYB 4GLXA 2NN6G 4LUVA 1B8AA
chains in the Genus database with same CATH superfamily
3DWAA 3CPFA 4DU9A 2AHOB 2MJ8A 4DR4L 1JOKA 2VQEL 4UP9A 1MSGA 2Q8TA 1C8CA 5M3MG 2B39A 2NVYB 4DUZL 1D1KA 4OO1I 1LACA 2F0JA 3GTJB 2PQAB 4ULLA 2L12A 4NW2A 2B2UC 5ELEA 2L5TA 1MD2D 1I94Q 5E4WC 4C3IB 4R8IA 2PCFB 5EGTA 2DNCA 1VQOA 2F0WA 4KHZA 1M8AA 1EEFD 1HA5A 4R4TA 3CCSA 1NJIC 1UEAB 4HJ9A 4UPAA 3QOLA 1HFGA 1XX8A 1B3AA 4HSVA 2FMMA 2OXPA 4OIKA 4IURA 1NR4A 4DV3L 5IIFA 4JI8Q 4IPCA 1PYSB 3TP7A 3R2IA 5M3FH 2ZXRA 5EBCA 1MSHA 1VQHA 5EPKA 1J6QA 1WCMB 4RGMA 3W5OA 4KY6A 2I07B 2VS1A 3M4PA 3O13A 4X62L 4L6TB 3E6ZX 4A3DH 4DUYL 1WFQA 2LSSA 3A7LA 2Y0SB 5C0XH 1Y1WH 1K73C 3JAMi 1UUPA 2QILA 1F9SA 2AUKA 1XNRQ 3NSWA 2JA8H 3T1YQ 1I4QA 1A15A 1K83H 1I4GA 4HCEA 3EBEA 1PH4A 4K0KQ 2XWBB 3KBGA 1EL0A 2HD3A 1TWGB 1YNXA 1A62A 1F2LA 1TWAB 4P74A 3L0OA 4OO1G 1DM0B 2XRQD 5M5YB 4BBSB 3Q8DA 3CRKC 1GJXA 2C35B 2DUDA 1BCPB 1YJNA 1GHKA 3S9WA 1SYDA 1CKNB 1STGA 1KXLA 4A3IH 1YI2A 4K14A 1QUQB 2B2TC 4RKBA 3GTPB 4P2CB 3PSIA 2B2VC 4LNQA 2R92H 1JMCA 3EIVA 1GD7A 2D0PA 5GADC 1LTAD 4RGTA 1U4PA 3OW2A 2EYHA 1XMOL 1EY8A 4R4IA 4CHTB 4C3HB 4HEDA 3OMCA 2IHFA 1TWHH 4FVMA 3PQIA 4LF4L 2K6AA 2DNEA 3UDGA 4A3BH 1NSNS 4QUFA 2SNSA 2F0QA 2L11A 2JXMB 1A2UA 3PUXA 2HCCA 1SDFA 4DV5Q 4FP5D 4GKJL 2EE1A 2E2JB 1KDCA 4X66Q 3NELA 2QDBA 3EQLC 4U68A 3GTGB 2Z1CA 3ULPA 4JG2A 2QKIC 3Q6SA 5A2QL 2KHSA 3KF6B 4JBMA 2OWOA 2E76C 1TY0A 5KNCA 1EYAA 3GTMH 2RCFA 2M00A 5JVG3 4FF3A 4LUOA 1JJ2A 3UDFA 3OIQA 3RUZA 1XTCD 5C4JB 2UXCQ 1Q8KA 3TP8A 2PPBC 4JI7Q 1W6JA 4IN3A 1IYJB 3DEPA 2AUJD 4QJFA 2WINB 3T1HL 2PMZB 1F2YA 4BA2I 4A3MH 5CR3A 2HIXA 3ONAB 3BZKA 2R3ZA 4QIWB 4X3TA 1YVCA 1I3QB 3U4ZA 1VQ6A 1D5ZC 2PYKA 3AU7A 1IL8A 1AEXA 4QGUA 2N8NA 1PTOD 3NEMA 3RLOA 2ENBA 4LUZA 1SNMA 1E1TA 1VQ9A 3K7AB 1I5FA 2D9UA 1SNQA 3CF5A 4OWXB 1GHJA 1GXDC 4KJOA 2F0MA 4UDUC 1KDAA 1PFMA 1AFPA 1B70B 1CKMA 3S1RB 2KHJA 1U0LA 1JB7A 2LMCB 1N33Q 4DR7Q 1KAWA 3SXHA 3G6JB 2RQXA 4LF8Q 4EVOA 1QVFA 4DV1Q 4CJ0B 2HQLA 1MI2A 1I94L 3S1MB 3Q22A 4K5VA 4GZYC 1CHQD 4P73A 1NY4A 1EOTA 2CH4W 1LT3D 2J7ZA 5C3EB 4UP7A 3BDOA 3NPPA 4ZK9B 4K8IA 4PZ8A 2EY5A 3TBIB 4DGZA 3R93A 5JVH3 4JI8L 4YY3Q 2Z4HA 1LLRD 4DAPA 4AYBG 1PV4A 2F0PA 2QCPX 3CPWA 1IHZA 4MIUA 1U4LA 4NKLA 4A3EB 2F0GA 4I7ZC 4X3UA 3MFGA 1SE8A 2JA7B 1KNAA 3I70A 3MWYW 2UU9Q 5CMDA 2XRSD 3J80L 2EY1A 1DD2A 5HY6A 3BVMA 2QW7A 3TS0A 4JI4Q 5C4HA 1LTBD 4DA2A 3LX0A 1F2MA 1BUVT 2CQOA 2D2CC 2KUMA 5ISRA 1VQCA 2A1AA 2XWJB 1VQLA 1J8IA 5M3MH 3IL8A 4DV0Q 1XNRL 3T1YL 1VF7A 3WWVA 1LTRD 2L0CA 1SE4A 3HOUG 3ERSX 2BH8A 4KN4C 3KJOA 3AYHB 4IO9A 3HKZB 2N3SA 5I6WA 3VDYA 3S14H 5F2DA 3LWUA 5CV8A 1EQQA 3RD4A 1X3PA 1XPUA 3A56A 4FXGC 2BDOA 2JA6G 3PIP3 3AB9A 3BYYB 2BA1A 1WI5A 1LM0A 1RJTA 1QG7A 2XIWA 3HP3A 1EEID 1YJ9A 1AZQA 2IT1A 2MO1A 1EWHA 4XTCS 4KKSA 4JI3Q 2KENA 4DK0A 2PQEA 1L1OA 2JK8A 3K81C 3P20A 3RN5A 2FMCA 3OWEB 3MXGA 4I7AA 3HGBA 3Q24A 4GNXA 1EY9A 4DV6Q 3S2DB 1Y8OB 2H1EA 3HEJA 3UI2A 4RG1A 3L7ZC 2C9OA 2D5DA 1OXVA 3ND9A 2NVTH 3ND8A 1RTNA 1B53A 3I4NB 3HOXG 1HZCA 2FINB 1LTID 3RZDH 2IWHA 4DV5L 4TSSA 1E22A 4RHSA 1AZPA 2Z6BA 1N34L 1YEZA 3K0YA 3J7AF 3CRLC 2IJ0A 4OGQC 1W6KA 1WD0A 1YZ6A 4OWWB 1IL2A 1PXUA 5HURA 2A69C 4V190 1LT4D 4JK1C 2B63G 4OO1H 3KUPA 3I56A 2FJ2A 4IJHA 1BCPC 3M4OB 1KIXA 4OEMB 2N88A 2OQKA 5IOCA 4LAAA 2ZM6Q 1BXTA 2D0OA 2GA4B 1K9MC 2OF1A 5M5WB 1F9RA 2O4XA 3VR6A 3GTOH 4DR6Q 4HMJA 1CSQA 3OPOA 3NBIA 4PMWA 4TRDA 4JI7L 5A2QE 2DJFC 2PZTA 4GOPB 3HOWG 1X32A 4KKUA 1AH9A 4C1NK 3V96A 2K5HA 3CCRA 1Q1BA 2WKDA 2NN6I 1CQVA 4NDXA 5M9OA 2R7FA 1KLUD 3D0FA 4L5RC 3H3VI 1XPOA 1HZ9A 4DR1L 1E0BA 1EQRA 4ZCKA 3CC4A 1JWSD 4QB4A 3LNNA 2C5CA 1HR0Q 4AIMA 2CVRA 4POFA 5AFWA 4LFBL 4F88A 1YJWA 2VQEQ 1IW7D 4KY5A 3VA5A 1V1PB 4H02A 4DUZQ 3G6EA 4P71A 5CV5A 4DR7L 2MFIA 1QJOA 1BBXC 1I6VC 4XIGS 2BA0A 5JJKA 1J9OA 4A3JG 2B8GA 3GTKB 5AJ3L 1SNDA 4DV1L 1HQMC 4BY1B 3SK6A 3A0JA 3I91A 1VMPA 1B1ZA 2CQAA 3K7UC 3H0GB 1FR3A 4A3FG 3AEVA 1IXRA 3OWFA 1C7YA 1MBYA 3KK7A 4L8JA 1PDQA 2N49A 3FPUB 1NUCA 1RF2D 2CW0D 3MA2B 1FL0A 4WJ4A 1CT1D 1DYQA 5EKIA 4OHJA 3M4YA 4Z9CB 3NQIA 1HCZA 3R8BA 4YY3L 1UAPA 2ZXOA 1JQYD 2UUBQ 3U58A 4RA8A 4X62Q 4RCOA 1GUOA 3GV3A 1Q12A 4CDEC 3DM1A 4GLXA 2NN6G 2JP1A 1D1IA 4J8QA 4IJLA 3DM3A 2ICIA 3HS0C 5KIXA 2ZJRA 1EQTA 3HOZB 1STNA 1EY7A 2KCNA 1BO0A 1PHJA 3NWSA 1X3EA 4JI4L 4EQOA 4JV5Q 4LW1A 1DXMA 2E2IB 2IPKD 1KRSA 3E3XA 3U4VA 1Y1WB 1JE5A 1YHBA 4N8X1 2JA5G 3CMEA 1NAPA 1PTOF 3VR5A 2B3GA 4DV0L 2JA8B 2YTYA 5C44G 1AP0A 3ITPA 2PW5A 2F0KA 4QF4A 1FJGL 2VUMB 1I50B 4K5WA 1C0AA 1S5FD 2QDLA 5CBEE 5D14A 2MHVA 5TSSA 1LT6D 3D4RA 1YITA 5J3BA 4XXEA 3TN2A 3VYRA 5IGFA 3GV6A 1A63A 1FNUA 4ZRZA 3SK5A 1D7QA 3PUVA 4JI3L 1EYDA 1SNOA 1X55A 2A68D 5E3FA 2WACA 1KDBA 2RHQB 2NYZD 1TKWB 1QB5D 4QUCA 3S17B 1R4QB 4DV6L 1IKMA 3J81c 1V8QA 3T56B 2K33A 3STBC 3HG9A 2HCIA 2WIIB 3PO2B 1PMRA 3J81E 5I6YA 1SMYD 1XMQQ 4KJNA 4A3GB 4BBRG 1T5EA 3KBXA 4IUVA 2OTLA 2RHSB 2YTXA 1GOZA 2KCTA 1VS0A 1TWHB 1G6PA 3CKIB 3RMHA 3EVQA 3I73A 1ZYRD 1WTVA 3PUZA 3S1NH 2RKSA 4ZQ3A 5EQ0A 2VQFL 3C3LA 3HOUH 2SDFA 2E8GA 1QZGA 1WVLA 3D3RA 5IGDA 1OXUA 1J5EL 3QB3A 4PZ6A 1ESFA 3PV0A 2JA6H 1X3QA 1TXYA 3FMCA 4ZUIA 5JJIA 3NXWA 2ZM6L 4AYBE 3NHHA 1LT5D 1LV9A 3DWQA 1L2FA 2KEDA 5LL6X 4AQYL 3H6MA 1B7YB 1RTOA 2NVQH 2CCZA 5E1FA 4J15A 3OOCA 3GTLH 1AW7A 1MHWC 3F2BA 4A75A 4XQNA 2XNAC 1SYGA 4AH6A 3SK4A 1G2SA 4TQUS 2X6LA 4A4IA 1QWYA 3K8AA 4XT1B 1P8LA 4JOIC 1YBYA 3FVQA 3HOXH 2R61A 1KC8C 1QVCA 2WAQE 3S15H 5CGKA 1QE6A 3D31A 3F8TA 2MPMA 1VQGA 4OXPA 1EWCA 5ELDA 5KYLA 3DUZA 1HR0L 2I0QA 1SYBA 5I2YA 4OONA 1I6HH 4CDFC 1NBWA 1JJCB 2RF4A 1VQNA 3MVVA 2SNMA 2PZWA 4LF5Q 3C1EA 2Q2HA 5I9OA 4Y7NB 2CKZB 2Y0SG 1QNKA 4C56C 2XTIA 4ZAIA 2B63H 3A8KE 3S16H 2KBNA 4JI1L 5L37A 2EYMA 4IUTA 1E24A 4KV6A 4BY7B 2Z0SA 3CQZH 2UUAQ 2F0DA 3G7LA 2VL6A 4MN3A 1W2BA 4OL7A 2E5LL 4BBSG 2B2WC 4GOPC 2DGYA 1Y1VH 1I4RA 3HOWH 5GAHC 2XGTA 2R7ZB 5BR8L 1SJHD 5D65A 3RZOH 3S2HB 1PFSA 3GTQH 1G291 1GUNA 2UUBL 4YWKA 4IPGA 1PH2A 1XJVA 2FHTA 1NMGA 1D2BA 2L1BA 4FDBA 2RDFA 3JAML 1TQOA 3VYSA 4JV5L 3E9HA 5GQOA 4C3HG 2A73B 2B2YA 3PF4A 2YYZA 2K5VA 3VR2A 1BNZA 5HGTA 2F0UA 2OTJA 4CGYB 4O1NA 1STEA 1S3OA 4A3JH 1GUWA 5KNDA 3DLLA 4HJ5A 1EUJA 4RGNA 1STHA 3MXNB 3KOJA 2YU9H 4QQBX 4GS3A 3I2ZA 3GO5A 3KLSA 4PNYA 1BCPF 1RD9D 5IWAQ 3NBHA 3W2DA 1WTQA 4B9XA 1EIGA 1PTOH 1DJRD 2VB2X 4A3FH 1TVXA 5K5PA 2WKCA 2RDHA 2UXBL 1U5KA 5A35A 5C4XB 5GAGC 5I2XA 4A3KB 5JJZA 4JW0A 1SJED 1CQFA 5CV6A 4P72A 1IBML 2GN5A 2PW7A 1F9QA 2NN6H 3W1BA 4DV7Q 5DM63 1E2VA 3H3VH 3IKJA 1ET6A 2WB1E 5M5XH 3HKSA 1SSOA 4G7ZC 1XMQL 1N8RC 1N34Q 3KF8A 3TREA 2E74C 1YHQA 1SE2A 1E3PA 1EY4A 3S1QH 4LFCL 2JA5H 1HUMA 4CDDC 4DAVA 1K0RA 3H91A 5HGQA 2JEBI 2R93B 5C44H 1Z9FA 2RBMA 2CH4A 2LXKA 3NTIA 5C3WA 5DAUA 3G4SA 2UUCQ 3PIPA 1HNXQ 1KAAA 3F2CA 1Z7TA 2RSOA 4KN7C 1VQ7A 4H7BA 2A6HC 2EYOA 4JBJA 1HPCA 5IGBA 5FO8B 2PNHA 2EVBA 2AQ1B 3M3YB 2K52A 1PVOA 3AFPA 3TS2A 3PO3B 3K6OA 1X54A 2AKWB 4LF9L 4IPDA 1TWCH 5FJ8G 2A5HA 1IBLL 3GTOB 5IYBG 3A5UA 1SFOH 3SHLA 2AWNA 4EQPA 5IODA 1ZEQX 3EROA 5C3EG 4B3SQ 1E2ZA 4DR1Q 1EFID 3C46A 4RMFA 1XNQL 4CBVA 4IUQA 3EJIA 4UAIA 1HA6A 4G4KA 3A74A 3GQBA 4BBRH 4LFBQ 1KNEA 4A3EG 3X3MA 4Y52H 4ZKBB 3HOYB 2K03A 1QILA 3NENA 2JA7G 2EJMA 4JI5L 1SR3A 1O7IA 2Q8RE 1M4VA 1HTPA 3K5MA 3TZDA 5IY0A 5EJWA 4LF5L 3QG1A 5AJ3Q 4FF1A 1JCKB 2KCMA 4L5QA 1R9TB 1UE7A 2H4OA 1K3BC 2JYOA 2AWOA 2NVYH 4PMCA 4JI6Q 1H95A 1I4PA 3GTJH 1Q86C 5J39A 5G3LD 1LUZA 1UNSA 2ID0A 4R4CA 2UUAL 1BBUA 3QWNA 1IBKQ 5IGCA 4KY7A 1LYLA 5CYUA 4TVAB 5LHY1 3K59A 3I4MB 4C2MB 1HR0W 5IT9L 5EPLA 2LKVA 4HMIA 1G2TA 1B50A 4XYOA 1FNVA 4JI0Q 5CBAE 4ALPA 1HXYD 5IP7G 2MP1A 1KQSA 3HOVB 2DJGC 4PG3A 1HZAA 3PUWA 1RKNA 1BVSA 4HTHA 1A0IA 1A3TA 4YCUA 1MJEA 4ZUJA 4IFDJ 2Q2UA 1YNJC 2KHIA 3AFQA 2BH2A 4UP8A 3I4NG 1HNZQ 1FNWA 1BR9A 3FEWX 3VR4A 2HHHL 1FJGQ 1WTHA 1VDZA 1O80A 4RCNA 3BG3A 3JAMc 4L5SA 5CV9A 5IWAL 1VQ4A 4F87A 1NCVA 1TWGH 2EQSA 1BKBA 2F0OA 2K75A 1H9JA 4R1JA 1TWAH 1S40A 2E2DC 4HIDA 4LFAL 5M5YH 4BBSH 1EY0A 3KFUA 2KECA 1LTLA 3U50C 1ILQA 4GN5A 1EIYB 1LTTD 2K14A 5FLXL 4FXDA 2BE5C 1X3FA 3OTOQ 2ES2A 1WD1A 1QUQA 1I4XA 3F1ZA 4RKLA 2NZHA 3GTPH 1VQ8A 1SBBB 1Y8PB 2ZTEA 2IL8A 4RFBA 2E75C 2I46A 4DV7L 2ZJPA 3LGJA 2D62A 2ALYB 1B44D 2X69A 3I90A 1HJPA 3A54A 5IP9G 2K32A 1PRTC 3W1GA 4X6AH 1PH1A 3ER0A 4OELB 4A93G 1IYVA 2K50A 1QZHA 3CCUA 2Y0SE 3FHWA 4MZ9A 1Q90A 1B4OA 2G9HD 4C3HH 2VQFQ 4LWCA 2NVXB 1G6ZA 3L9AX 3TRZA 4X64L 4HJ8A 2YV5A 2WAQB 4KD4A 4IOAA 5COYA 1J5EQ 2E2JH 3VYUA 3FKIB 1K8GA 4C3JB 3C2PA 4ZKCB 2UUCL 2O2LD 3GTGH 1HNXL 2JE6I 2MQHA 2B8FA 2CFMA 3KF6A 1QCBD 5IGGA 1DOKA 1QNUA 2JA6B 3L3OC 4BY1G 1I4HA 2KCCA 4AQYQ 3HRZC 3TP6A 4K8JA 3TZUA 3ERQA 1Y1VG 4FNFA 5CV7A 4PQXA 1STAA 1YNND 4NB3A 5JOBA 3H0GG 2R7DA 1AE2A 4K6DA 2Q2TA 2NVQB 1CUKA 1L1OC 2HDLA 1EY5A 4DAYA 1CI3M 4CJ1B 5IYDG 4R4QA 1VQPA 4B3SL 1F77A 4GNXC 2RSNA 5C3XA 2PZUA 3UE1A 2A69D 1DZ1A 2AMCB 1CFMA 2F0VA 5FLMG 1I3QH 2EOTA 4DPGA 2F3IA 1BCPD 4QY7A 4F7XA 3G48A 4DFAA 4L63B 1BQQT 1KLGD 1SLJA 1AE3A 1D8LA 4XQQA 3HOZG 2EZVA 4KLKA 1ASZA 4HJ7A 5JEAG 2X6GA 4JI1Q 4QCLA 1B9NA 5I4DA 3S1RH 2A6EC 4DNIA 3N52A 2Z9HA 4R8NA 1ONLA 1UE1A 5ELFA 1R4PB 4JI6L 3RLFA 3SEBA 2E5LQ 4FYDA 2ATWA 3RN2A 3PF5A 2LS01 2VUMG 3S1MH 1N32Q 5FJ8H 1IBKL 2F0IA 5IYBH 1HHVA 1H9KA 4NXNL 4L5TA 5BR8Q 2PMZE 4KHVA 1O7LA 3P1HA 2BCOA 1CHPD 5C3EH 4QIWE 5M3FB 4JYAQ 1ASYA 2J4XA 1CA6A 2K1BA 1BOSA 1WTXA 1LO5D 4NXMQ 1T9HA 4GLAC 2Q2IA 4HCSA 4BA1I 1WTRA 4JI0L 1CA5A 2LFNA 2JSOA 4A3DB 3V05A 4A3EH 2TSSA 3HZXA 4KD3A 4CJ2C 2JA7H 1Q81C 1PZJD 3J7ZC 1DCZA 3A5ZB 3KLRA 1VQKA 3PO2G 4JBWA 2KEEA 4XT3B 4HR7B 3J80c 3A55A 2WB1B 4A3GG 1VQDA 5ELBA 4B3TL 2R6GA 2K7VA 3NE5B 5E4XA 1HNZL 1CM9A 1K83B 3PMFA 3J80E 3CHBD 1TWFH 4B3ML 1L0WA 1A3UA 1M90C 1TT2A 1N36L 4FO2A 1VQJA 2N78A 3OIPA 5H1SE 2UXBQ 4IOCA 1JC7A 4A3LG 2Z6KA 3NBHB 1Y69U 1ICWA 1Q3LA 5JEAJ 3MC0B 4IUNA 4A3IB 2VZAA 3H09A 5C0XJ 4ILWA 3ICEA 1IBMQ 1X56A 3D8GA 1B9MA 3MFYA 1DGSA 1U4RA 4E6IA 5BN5A 1K8AC 4FF4A 1JE4A 5D3DA 3OTOL 5IGEA 2R92B 5G3LF 3I4OA 4S3SA 4JBKA 4YWLA 2IW3A 2WP8J 5IP7H 2JQOA 3NQTA 3M7NA 5C5MA 3TDQA 2EYFA 1SYFA 2BOSA 4O0AA 4H44C 5FLXc 3S2DH 4A3BB 3K58A 1RODA 4LFCQ 1KL9A 2SEBD 1SRUA 1D5MC 1SROA 2XN9C 3F2DA 5EKKA 2VW9A 3I4NH 3KF8B 1DOLA 2ICEC 2QA4A 3CCVA 2EYJA 5LMNQ 3T4AC 4A3CG 3RLNA 2E2HH 1E2WA 3GD7A 3QR8A 3GTMB 4MTNA 1F2ZA 1SYEA 4FXKC 4ME3A 1X3GA 3QOJA 1PH3A 1K28A 4NPSA 1EOVA 4C3IG 1MJCA 2B2UA 3STBD 2K01A 1L0YB 4LF9Q 3M4OH 4DAMA 1IBLQ 1EYGA 1EWIA 1B3QA 3KLWA 4BY7G 4DK3C 1A8VA 5IYCH 2O5IC 5M5WH 3SR1A 4KHPL 3GDEA 4A3MB 2PNRC 5FOBB 1XNQQ 3J7A5 2Q8IB 4DR2Q 1EYCA 1SE3A 4EGVA 1KRTA 4R9WA 3KDFA 3FDTA 5IP9H 4G57A 1FYCA 3HFZB 1VQ5A 2F52A 1FGBD 3EFXD 5ELOA 5C4ZA 2R7ZG 4A93H 1NR2A 2MNAA 1WCMG 3MXPA 2A74C 4JI5Q 1PYBA 1EFWA 1HUNA 4HN7A 1ESRA 2F0HA 3T53B 5JAVA 1RIPA 4K2KA 3BU2A 3X3NA 1RCVD 1V1PA 2LXJA 3M7GA 1OTCA 1VQMA 4JI2Q 2JEAI 4YIJA 2J0TD 1F9PA 3UDIA 1CK1A 3V2TA 3GTKH 4UY8C 4BY1H 2JN4A 2HUGA 3P7JA 3CP0A 3TEHB 4APVA 3QJYA 3I55A 1ZXTA 3J7YW 1NE3A 3A7AB 2MUYA 1N32L 3H0GH 3DHQA 4LF7L 2DY7A 4HIKA 1GKHA 4CKCA 1C48A 3PUYA 1IKLA 1VQIA 4O42A 5KRUA 2F03A 5IYDH 5DNFA 1VQEA 2B2TA 3SK8A 5C4XG 2OT2A 2EXDA 4WJWA 5DLQE 4HIOA 4DNRB 4NP5A 2B2VA 1JB3A 2ZJQA 4JYAL 4A3KG 4HAEA 3T13A 4NXML 1PRTF 1GUTA 4B3RQ 3NK9A 1PRTB 5FLMH 1U4MA 2K5DA 1NNXA 4KTAA 4O2DA 4LJZC 2JJQA 3FRPB 2MO0A 1TS2A 1JT8A 4QL5A 3HOZH 5C5LA 3I8ZA 2HHHQ 1W3SA 2PO4A 5GAEC 4H13C 1HFNA 5M3MB 1OXXK 5JEAH 3CC2A 4XDXA 5GROA 2E2IH 3CCEA 1CKOA 4N9PA 3MXUA 5FO7B 2QGQA 3E0EA 3S14B 4YHHL 4IZ8A 4GLVB 1GUSA 5EAYA 2R93G 4LFAQ 1H9SA 1AN8A 1G91A 3T51B 4OX9L 3NTHA 4N9TA 3QO2A 2OEOA 2VUMH 1I50H 2EIFA 3EA6A 4PMBA 5LMUQ 1PH7A 3A8IE 1OXTA 2L55A 4DV4Q 2DN8A 2P5ZX 3M4QA 1Y14B 2Z4IA 3BZCA 3AMUA 4IFDI 4XYQA 4EX5A 3OHXC 1L1OB 3DEOA 4YWMA 3UDXA 3MTSA 3K5NA 2EYPA 3PO3G 4GNXB 4HJAA 1BF4A 3SVMA 1S5ED 3A8JE 4HIMA 3VA7A 3KJPA 2NVTB 3K57A 1O7ZA 2VXWA 5JJLA 3S17H 3BVGA 1OO9B 2TMPA 4RAUC 2IX0A 3BS1A 4X64Q 3PO2H 3RZDB 4DK6C 3S24A 4BXXG 3MHBA 2B2YC 5KGUA 4A3GH 3K80C 5T1GA 2A19A 4MHEA 3PIO3 1Q7YC 1FVIA 3HOYG 2F0TA 1VQFA 4YCWA 4RGOS 4CKBA 5LMNL 4J6HA 5EPJA 1PLFA 1Q46A 3TQYA 3P75A 5JPNC 1HNWQ 1TR5A 1VF5C 1LTGD 4V0BA 1ICFB 1B8AA 4A3LH 1PTOC 4JVZA 3ULLA 1V1QA 3MAQA 3J7AV 4ME5A 2JA9A 2B29A 4MNOA 4ZYSA 2EDGA 4DR3L 1CSPA 4EQ5A 3SE0A 1RL2A 3I7FA 5ELNA 3WDNA 4MTKA 4BWGB 1PH5A 4RWSC 1GM5A 1SNPA 2IY5B 4IFDG 1VCIA 1S5CD 2M9VA 3WOFA 4DR2L 1TIID 3LWEA 2K05A 4DAYB 3H3VC 3I4MG 2O5JC 2KA7A 1II3A 1XYIA 1ET9A 3Q0AA 1WTPA 1KHIA 1PFNA 1UEBA 2KOLA 1JJGA 2A6HD 3D4DA 4DK1A 2F0EA 2L9HA 1E1OA 3FPPA 3HOVG 1CZGA 2WFWA 1SNCA 2F4VQ 4X65L 1CZWA 2L4NA 4DR5L 1MKHA 3SDZA 2WV6D 4GKKQ 4A3CH 4JI2L 4Y7NH 3IRBA 2EY6A 1LABA 1B2TA 2PQAA 1UE5A 1V43A 2HIVA 3HKZG 1V9PA 4C3IH 2FXQA 1UE6A 1JR0D 4NXNQ 2K4KA 4N8FA 3BVZA 4LF6Q 3TMEA 4BY7H 2CWPA 1TS4A 3CU7A 3H94A 2F1MA 3GP7A 1P16A 2F0NA 3M9BA 1HQRD 2F3VA 1HZBA 2OCEA 3OW7A 1JORA 2ASBA 5KYIA 2I5LX 3PCOB 2NTSA 4I65A 3JC66 2R7ZH 3PGZA 1LTSD 1WCMH 3S2HH 4B3RL 4IQZA 1JOOA 4ZLTF 1V1OA 5K36G 4B08A 3SGIA 3VR3A 2UXDQ 4H0LC 4DNTB 1QOHA 1K3RA 3N6RA 1ENCA 4LK1C 3Q23A 1WOCA 4B3TQ 2F0SA 3J80i 2V4DA 2PI2A 4X3SA 2RCNA 2ZTCA 2NZOA 4B3MQ 5JPMC 1SMXA 2GVAA 1EZ8A 4ID6A 1Q82C 5NUCA 1Z47A 3OMGA 2EY2A 4XQJA 1N36Q 3JAME 1TWFB 2K5QA 2WAQG 3MXNA 3W3AA 3FKIG 4K0KL 4C3JG 3BZDB 1SXTA 4DXGA 1PH6A 1L0XB 4M8AA 5LMUL 5EKLA 1T5XD 4KK7A 1CKNA 1S4ZA 2HDMA 4DV4L 2IHEA 5DM73 5IYCG 1XXGA 3B6YA 3OSOA 4AYBB 1Z6HA 5C4XH 1C4QA 5FO9B 1ML0D 1YNJD 3J81i 3IFDA 1IZ6A 5E7NA 3J81L 2RVLA 4PZ7A 4Q5VA 4A3KH 4IPHA 2A8VA 5I9PA 4YCVA 1VMCA 5D3IB 1DONA 3NWTA 4CDCC 1JOQA 3RR5A 2PI2E 1K8MA 1EQVA 3U9SA 4GN3B 3R2TA 1O78A 5BN4A 3MZ5A 2F0LA 3I72A 3S1NB 5C0XI 1EIHA 1VQBA 1YNNC 3HOUB 2F0FA 4KKTA 1STBA 1XPRA 3DXJC 2BE5D 2R93H 4X66L 1STYA 2KQ3A 2NB0A 4M1UB 3AQQA 2N55A 3CCQA 1HNWL 3R3OA 2E2HB 1S72A 2NUCA 1JWMD 3CCJA 1PRTD 4DXFA 4R4OA 2SOBA 3G71A 1IW7C 1EY6A 3BDLA 5C4JH 3MEHA 2Z8LA 4KHPQ 4FF2A 2HT1A 1ILPA 3M3YH 4WRDA 4DV2Q 2VB3X 5CV4A 1U9RA 4EQNA 4J1MA 5J1ZA 3PO3H 3E5SA 3J81j 2UXCL 2I5MX 5T1IA 1FGUA 3GTLB 3U9OA 1Y8NB 2KVMA 5LL6S 1X9NA 3CMAA 1Q8IA 1XWEA 1EU4A 4WFN3 2DY8A 3KDFB 1SAPA 5M3FG 3HOXB 3NP8A 3S15B 2RA4A 1A6XA 4A93B 2QF7A 2OQ0A 5IE8A 3K7AH 4BXXH 5LMNW 5ELCA 1Q1EA 1RHPA 2L15A 3D4WA 1I6HB 2RDGA 4QMGA 2CW0C 4A3DG 4LMQD 2NTTA 3HOYH 2F4VL 1RDPD 1PA6A 1DOMA 1YHAA 1S5BD 5C0XG 1Y1WG 3K5LA 2EYLA 2GVBA 4DR4Q 1ZKOA 3VYTA 4ODGA 2B63B 4P75A 4GKKL 4IUPA 2WB1G 3S16B 2JA8G 3TSSA 1SN8A 2I5HA 4JPBW 1R9TH 1N33L 1QVGA 3KLSX 1HH2P 1HRJA 4RHRA 1WYDA 2K5NA 3CQZB 4JC0A 4NMZA 4LF8L 4LF7Q 1PZID 2K28A 1MIUA 2QEXA 4LF6L 1Y1VB 1O7YA 3HOWB 3K0XA 4PV1C 2EPBA 1G8ZD 2NBFA 2IX3A 1TS5A 4IFDH 2G5DA 4HSPA 4A3IG 3QIAA 3RZOB 1TU2B 3ULJA 3CAMA 4DV3Q 3KYHC 3GTQB 1D6EC 3I4MH 1G51A 1N9WA 1PH9A 4U673 1CTMA 1KTKA 4C2MH 3CD6A 1PH8A 3M85A 2A6ED 3FP9A 2R92G 4DN4M 4WJ3M 1YIJA 2K5WA 5IT9c 2VNUD 3CCMA 2UXDL 4DUYQ 4ABNA 5IT9E 3HOVH 2ZTDA 2H5XA 3DWPA 1C9OA 4POGA 2F3WA 2UU9L 4KI0A 3C1FA 4F8MA 2HQEA 3TP5A 5BN3A 4A3BG 3BYTB 3I4LA 1NMFA 4A3JB 2A68C 1XTDA 4YHHQ 1WTOA 4K2LA 2YU9B 5KNBA 3IFTA 4UHVA 4OX9Q 4JCVE 3CXCA 1S5DD 4GN4B 5EBDA 1PTOB 4A3FB 3URYA 1SMYC 2IX1A 1H9SB 1TY2A 4G7OC 1GO3E 2MGSA 2CWAA 3MEFA 1ZYRC 2LY7A 2AQ3B 2BDNA 4IALA 1BDOA 1SEBD 1PYWD 1X65A 1PZKD 3D6WA 1K0SA 1M1KC 2EJFC 4A76A 1X6OA 1NTGA 1A2TA 3I3CA 3H15A 1D5XC 2EJGC 1EU3A 1EZ6A 4WORA 4A3MG 4K5XA 3T16A 4IUUA 2NZ1D 3DMUA 5M5XB 5K36H 1A3VA 1MGSA 1KD1C 2AQ2B 1OXSC 2VY3A 3BDCA 5FLXE 2NWGA 2EXZA 1XMOQ 1HTLD 4JOIA 1BBWA 2FFKB 1WTWA 4LF4Q 3UE0A 2M2LA 3S1QB 4Q0FA 4DKAC 2JA5B 4G7HC 3CW2C 1H9RA 4K6LA 4RH6A 4GKJQ 5C44B 3HKZE 3D6CA 3EN2A 2NVXH 5J22A 3CCLA 3IAYA 5FK9C 5FKAC 3E0JA 1UWVA 1KABA 4B9WA 2XVSA 4TKOB 3NTKA 1WJJA 2QEJC 3FKIH 4OWTB 4C3JH 4DR3Q 3F2UA 2XSCA 3E9IA 1PFBA 2F4IA 2Z6KC 3OYYA 2ZT9C 1SYCA 1JWUD 4OIJA 1TWCB 3CC7A 3ZYYX 3K5OA 1SFOB 4X3KA 1ENFA 3NUCA 2KJXA 2B2WA 4DV2L 2ZXPA 2V1CC 4GOPA 5DEHA 5C6AA 4BS9A 2YTVA 1GVPA 4DF7A 1JICA 3T1HQ 1VQAA 1FD7D 4KMUC 4DR6L 3RNUA 2CHBD 1TS3A 5CC4A 4BBRB 1IYUA 3BJUA 4CKEA 5CORA 3PIOA 5KEEA 1EIFA 3ZJYC 3L2PA 2G9DA 4X65Q 1K8OA 1H9MA 4DR5Q 1E7ZA 1GUGA 3WOEA 1ENAA 4C1NI 4LUVA 2K04A
chains in the Genus database with same CATH topology
4A3LH 2K14A 3CPFA 4A3BG 4IJLA 3ULLA 1V1QA 1X3FA 2AHOB 4DR4L 3DM3A 2JA9A 2B29A 1QUQA 3F1ZA 3OTOQ 2VQEL 2ZJRA 2ES2A 2NZHA 4MNOA 4UP9A 4DR3L 1VQ8A 1CSPA 3GTPH 2ZTEA 4EQ5A 5M3MG 1RL2A 1PHJA 3I7FA 5ELNA 4DUZL 1X3EA 4DV7L 2ZJPA 4JI4L 3LGJA 4JV5Q 4OO1I 2D62A 2ALYB 4LW1A 1HJPA 1PH5A 5IP9G 3W1GA 1KRSA 2PQAB 3U4VA 1PH1A 4X6AH 3ER0A 1JE5A 1YHBA 1GM5A 1I94Q 2IY5B 2JA5G 4IFDG 3CMEA 4A93G 2B3GA 2K50A 1VCIA 3CCUA 4DV0L 2Y0SE 1QZHA 3FHWA 1VQOA 4KHZA 4MZ9A 4DR2L 2YTYA 5C44G 4C3HH 4R4TA 4DAYB 3CCSA 1NJIC 3I4MG 2VQFQ 4LWCA 4UPAA 4HJ9A 1FJGL 3TRZA 4X64L 1C0AA 4HJ8A 1KHIA 1UEBA 2YV5A 1JJGA 4DV3L 4IOAA 4JI8Q 4IPCA 1J5EQ 2E2JH 1PYSB 1K8GA 1YITA 5J3BA 1E1OA 2UUCL 5M3FH 3GTGH 3HOVG 1HNXL 2JE6I 1A63A 2MQHA 2WFWA 2F4VQ 2CFMA 1VQHA 3KF6A 1J6QA 4X65L 1D7QA 3W5OA 4DR5L 4X62L 2VS1A 3M4PA 1MKHA 3PUVA 4BY1G 4JI3L 4A3DH 1X55A 4DUYL 4AQYQ 4JI2L 4GKKQ 4A3CH 4Y7NH 3IRBA 1WFQA 1Y1VG 2LSSA 2RHQB 2PQAA 1UE5A 1V43A 2HIVA 1Y1WH 4NB3A 4DV6L 1K73C 3H0GG 3JAMi 3J81c 2R7DA 3HKZG 3STBC 1V9PA 4C3IH 2FXQA 1UE6A 1AE2A 2Q2TA 1CUKA 1L1OC 4NXNQ 1XNRQ 2JA8H 1XMQQ 5IYDG 3T1YQ 4BBRG 2K4KA 4R4QA 4LF6Q 1K83H 1VQPA 2RHSB 2YTXA 3EBEA 4GNXC 1PH4A 2CWPA 2OTLA 2KCTA 4B3SL 1VS0A 4BY7H 1G6PA 3UE1A 1YNXA 1P16A 1A62A 2AMCB 3PUZA 4P74A 3S1NH 3L0OA 3M9BA 4OO1G 3Q8DA 5FLMG 1I3QH 2VQFL 4DPGA 2F3IA 2C35B 4QY7A 1HZBA 2DUDA 2OCEA 3HOUH 2ASBA 2E8GA 1YJNA 3G48A 1QZGA 2I5LX 3PCOB 1SLJA 3JC66 1AE3A 2R7ZH 1CKNB 1OXUA 1D8LA 1KXLA 3PGZA 3S2HH 1WCMH 4A3IH 4B3RL 1J5EL 3HOZG 1YI2A 1QUQB 4PZ6A 4KLKA 1ASZA 4HJ7A 3PV0A 3S15H 2JA6H 3SGIA 5K36G 3PSIA 2UXDQ 1TXYA 5JEAG 4LNQA 1K3RA 5JJIA 4JI1Q 3S1RH 1WOCA 2ZM6L 4AYBE 4DNIA 4B3TQ 3J80i 1JMCA 2R92H 2PI2A 3EIVA 2RCNA 1UE1A 1GD7A 1L2FA 2D0PA 5GADC 2ZTCA 4AQYL 1B7YB 2NVQH 2CCZA 2NZOA 4B3MQ 4JI6L 3RLFA 1SMXA 4J15A 3OW2A 1XMOL 2GVAA 2E5LQ 4R4IA 1Q82C 2ATWA 1Z47A 3RN2A 1N36Q 2IHFA 1TWHH 3PF5A 2VUMG 3S1MH 4LF4L 1N32Q 4A3BH 3UDGA 5FJ8H 3GTLH 3F2BA 4A75A 1IBKL 5IYBH 2WAQG 4L5TA 4NXNL 3PUXA 4AH6A 4DV5Q 4TQUS 5BR8Q 2PMZE 4A4IA 4GKJL 3FKIG 4K0KL 3K8AA 1P8LA 4X66Q 4JOIC 3NELA 1YBYA 5C3EH 3HOXH 1PH6A 1KC8C 1QVCA 2WAQE 4QIWE 5LMUL 3D31A 4OXPA 3F8TA 1ASYA 1VQGA 4JYAQ 1CKNA 3ULPA 4JG2A 1HR0L 4DV4L 2I0QA 2IHEA 4NXMQ 3KF6B 4OONA 4JBMA 1T9HA 4GLAC 2Q2IA 4BA1I 3B6YA 5IYCG 2OWOA 1I6HH 4JI0L 1NBWA 1JJCB 2RF4A 5C4XH 1VQNA 4LF5Q 4A3EH 2Q2HA 3GTMH 3J81i 2CKZB 4A3KH 1IZ6A 2Y0SG 5E7NA 4LUOA 4PZ7A 1Q81C 2JA7H 1JJ2A 3UDFA 3J7ZC 4IPHA 2XTIA 2A8VA 2B63H 3A5ZB 1VQKA 4YCVA 4JBWA 3PO2G 2UXCQ 1Q8KA 3S16H 3J80c 2KBNA 4JI1L 3RR5A 4A3GG 4JI7Q 1VQDA 2PI2E 4B3TL 2R6GA 1HNZL 1IYJB 1E24A 4QJFA 3T1HL 2Z0SA 3CQZH 2UUAQ 1TWFH 4GN3B 4A3MH 4BA2I 2VL6A 4B3ML 2HIXA 3BZKA 1W2BA 2E5LL 4BBSG 1L0WA 4GOPC 5C0XI 1M90C 2DGYA 1Y1VH 1YVCA 1VQBA 3U4ZA 1N36L 5H1SE 1VQJA 2N78A 3HOWH 1VQ6A 2UXBQ 5GAHC 4QGUA 4IOCA 2N8NA 1XPRA 4A3LG 3NEMA 2XGTA 2Z6KA 3NBHB 4LUZA 3RLOA 1E1TA 5JEAJ 5BR8L 1VQ9A 3RZOH 1I5FA 1PFSA 3CF5A 1G291 2VZAA 3GTQH 4X66L 2UUBL 2R93H 4YWKA 4OWXB 5C0XJ 3ICEA 3AQQA 4IPGA 3CCQA 1PH2A 1X56A 1IBMQ 1HNWL 1XJVA 1S72A 1DGSA 1NMGA 1K8AC 1B70B 3CCJA 1CKMA 2KHJA 1U0LA 1JB7A 3OTOL 1N33Q 4FDBA 4DR7Q 1KAWA 4R4OA 3I4OA 3G71A 4KHPQ 5C4JH 4JBKA 4YWLA 4LF8Q 2WP8J 5IP7H 2JQOA 1QVFA 4DV1Q 2HT1A 4JV5L 3E9HA 3M7NA 3M3YH 5GQOA 3PF4A 4DV2Q 2YYZA 2K5VA 2HQLA 4O0AA 2OTJA 5FLXc 3PO3H 3S2DH 1I94L 3J81j 2UXCL 2I5MX 1FGUA 1S3OA 4A3JH 4LFCQ 1KL9A 3DLLA 1SRUA 4HJ5A 1EUJA 4P73A 1X9NA 3MXNB 1SROA 1NY4A 3KOJA 3CMAA 3F2DA 2YU9H 4QQBX 3I2ZA 4GS3A 3GO5A 3I4NH 2VW9A 3KDFB 3KF8B 5M3FG 5IWAQ 4UP7A 2QA4A 3CCVA 4PZ8A 4A3FH 2OQ0A 5IE8A 3K7AH 4BXXH 5LMNW 4JI8L 4YY3Q 1Q1EA 5LMNQ 2L15A 4AYBG 1PV4A 2UXBL 1U5KA 4A3DG 3CPWA 3RLNA 4A3CG 2E2HH 3GD7A 3HOYH 5GAGC 2F4VL 4MTNA 1PA6A 1YHAA 1SE8A 4ME3A 1X3GA 5C0XG 1Y1WG 1PH3A 2UU9Q 2GVBA 4DR4Q 4NPSA 1EOVA 1MJCA 3STBD 4P72A 1IBML 4LF9Q 3M4OH 4P75A 4GKKL 4DAMA 5HY6A 1IBLQ 1EYGA 1EWIA 2GN5A 2WB1G 2JA8G 3W1BA 3TS0A 1SN8A 2I5HA 4DV7Q 4JI4Q 3KLWA 1R9TH 1N33L 1QVGA 4BY7G 4DK3C 3H3VH 2CQOA 1A8VA 1HH2P 1VQLA 1VQCA 2A1AA 5M5WH 5IYCH 4KHPL 3GDEA 1WYDA 2K5NA 2WB1E 4JC0A 5M5XH 4LF8L 1XNQQ 3HKSA 5M3MH 4LF7Q 4DV0Q 1XNRL 3J7A5 1XMQL 3T1YL 4DR2Q 1MIUA 2QEXA 3WWVA 4LF6L 1KRTA 1N8RC 3KDFA 1N34Q 3HOUG 3ERSX 5IP9H 2BH8A 3HFZB 3TREA 3KJOA 2F52A 3K0XA 3AYHB 5ELOA 1YHQA 1VQ5A 1E3PA 4IO9A 3S1QH 2N3SA 4LFCL 3VDYA 2JA5H 2R7ZG 3S14H 4A93H 1EQQA 2MNAA 1WCMG 4A3IG 1K0RA 4JI5Q 1PYBA 3ULJA 3CAMA 5HGQA 2JEBI 4DV3Q 3KYHC 1EFWA 1XPUA 5C44H 1Z9FA 2JA6G 2LXKA 1G51A 1N9WA 2BA1A 1PH9A 3I4MH 1WI5A 3G4SA 1LM0A 2UUCQ 3PIPA 4C2MH 1HNXQ 1PH8A 3CD6A 3F2CA 3M85A 3FP9A 2R92G 1RIPA 1YJ9A 4WJ3M 3BU2A 1YIJA 1VQ7A 5IT9c 2IT1A 2MO1A 2VNUD 4JBJA 3CCMA 4XTCS 2LXJA 2UXDL 1OTCA 4JI3Q 2PNHA 4DUYQ 1VQMA 4JI2Q 2KENA 3HOVH 1L1OA 2JK8A 2ZTDA 3K81C 2H5XA 2JEAI 1C9OA 2K52A 3RN5A 4POGA 2UU9L 4KI0A 4GNXA 1PVOA 3AFPA 4DV6Q 3TS2A 1X54A 2AKWB 4LF9L 4IPDA 1TWCH 3UDIA 5FJ8G 1NMFA 1IBLL 4RG1A 3L7ZC 5IYBG 4UY8C 3GTKH 3A5UA 4BY1H 1SFOH 1OXVA 1XTDA 4YHHQ 2NVTH 2AWNA 3CP0A 3TEHB 4APVA 3I55A 5C3EG 1NE3A 3HOXG 4B3SQ 1HZCA 4OX9Q 4DR1Q 1N32L 4JCVE 3H0GH 3CXCA 4GN4B 4RMFA 4LF7L 3RZDH 1XNQL 4HIKA 4DV5L 1GKHA 1E22A 3PUYA 2IX1A 1VQIA 5IYDH 1N34L 3A74A 4BBRH 4LFBQ 1VQEA 1YEZA 5C4XG 2EXDA 4A3EG 5DLQE 4Y52H 4HIOA 4JYAL 1GO3E 1YZ6A 2ZJQA 4OWWB 1IL2A 4A3KG 3NENA 2JA7G 2CWAA 3MEFA 4JI5L 1SR3A 4NXML 1O7IA 2B63G 4B3RQ 3I56A 4IJHA 5FLMH 1X65A 5IY0A 1M1KC 4LF5L 1KIXA 4A76A 5AJ3Q 1X6OA 4O2DA 2KCMA 4L5QA 2JJQA 2OQKA 1UE7A 2MO0A 2ZM6Q 1NTGA 2D0OA 1K9MC 3H15A 1JT8A 4QL5A 3HOZH 2AWOA 4A3MG 3GTOH 4DR6Q 2HHHQ 1W3SA 2NVYH 1KD1C 1CSQA 5GAEC 2VY3A 1OXSC 1OXXK 4PMWA 4JI6Q 4JI7L 3CC2A 1H95A 3GTJH 4GOPB 5GROA 1XMOQ 1Q86C 2E2IH 3HOWG 3CCEA 1CKOA 1LUZA 1AH9A 4JOIA 1BBWA 2ID0A 2K5HA 2QGQA 1Q1BA 4R4CA 3CCRA 1BBUA 2NN6I 2UUAL 4LF4Q 3E0EA 3UE0A 4DKAC 4YHHL 1IBKQ 3CW2C 4GLVB 1LYLA 2R7FA 3D0FA 4L5RC 5EAYA 3H3VI 4LFAQ 2R93G 4GKJQ 1XPOA 4TVAB 3HKZE 4OX9L 1HZ9A 3EN2A 4DR1L 2NVXH 3CCLA 1EQRA 2VUMH 1I50H 2EIFA 3CC4A 5LMUQ 1PH7A 1OXTA 1UWVA 1HR0W 1HR0Q 4AIMA 4DV4Q 4POFA 4LFBL 3M4QA 1YJWA 1Y14B 1WJJA 3FKIH 4OWTB 2VQEQ 4C3JH 4JI0Q 3BZCA 4ALPA 4DR3Q 4IFDI 5IP7G 4H02A 3E9IA 4DUZQ 2Z6KC 1KQSA 4EX5A 3G6EA 1L1OB 4PG3A 4YWMA 3OYYA 4P71A 3UDXA 1HZAA 3PUWA 4DR7L 2MFIA 3PO3G 4XIGS 2BA0A 4GNXB 4HJAA 5JJKA 1BVSA 1A0IA 3CC7A 4A3JG 5AJ3L 4DV1L 4YCUA 4HIMA 1MJEA 4IFDJ 3KJPA 2Q2UA 2KHIA 3A0JA 3AFQA 4DV2L 4GOPA 2V1CC 4UP8A 2BH2A 3I4NG 1HNZQ 3S17H 5JJLA 2YTVA 1GVPA 3T1HQ 1VQAA 2IX0A 3K7UC 2HHHL 4DR6L 1FJGQ 4X64Q 3RNUA 3PO2H 4A3FG 4DK6C 3S24A 1IXRA 3AEVA 4BXXG 3JAMc 1C7YA 4A3GH 4L5SA 2N49A 3K80C 2A19A 1Q7YC 1FL0A 1FVIA 3BJUA 5IWAL 1VQ4A 4WJ4A 3HOYG 3PIOA 1TWGH 2EQSA 1BKBA 2K75A 4R1JA 1VQFA 1EIFA 1TWAH 1S40A 4HIDA 4YCWA 4LFAL 3ZJYC 3L2PA 4YY3L 5M5YH 4BBSH 5LMNL 3KFUA 4K0KQ 4X65Q 1LTLA 3U50C 1Q46A 3U58A 2UUBQ 4DR5Q 4X62Q 4GN5A 3TQYA 1E7ZA 1Q12A 1HNWQ 1EIYB 4GLXA 2NN6G 4LUVA 1B8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3L H;  2K14 A;  3CPF A;  4A3B G;  4IJL A;  3ULL A;  1V1Q A;  1X3F A;  2AHO B;  4DR4 L;  3DM3 A;  2JA9 A;  2B29 A;  1QUQ A;  3F1Z A;  3OTO Q;  2VQE L;  2ZJR A;  2ES2 A;  2NZH A;  4MNO A;  4UP9 A;  4DR3 L;  1VQ8 A;  1CSP A;  3GTP H;  2ZTE A;  4EQ5 A;  5M3M G;  1RL2 A;  1PHJ A;  3I7F A;  5ELN A;  4DUZ L;  1X3E A;  4DV7 L;  2ZJP A;  4JI4 L;  3LGJ A;  4JV5 Q;  4OO1 I;  2D62 A;  2ALY B;  4LW1 A;  1HJP A;  1PH5 A;  5IP9 G;  3W1G A;  1KRS A;  2PQA B;  3U4V A;  1PH1 A;  4X6A H;  3ER0 A;  1JE5 A;  1YHB A;  1GM5 A;  1I94 Q;  2IY5 B;  2JA5 G;  4IFD G;  3CME A;  4A93 G;  2B3G A;  2K50 A;  1VCI A;  3CCU A;  4DV0 L;  2Y0S E;  1QZH A;  3FHW A;  1VQO A;  4KHZ A;  4MZ9 A;  4DR2 L;  2YTY A;  5C44 G;  4C3H H;  4R4T A;  4DAY B;  3CCS A;  1NJI C;  3I4M G;  2VQF Q;  4LWC A;  4UPA A;  4HJ9 A;  1FJG L;  3TRZ A;  4X64 L;  1C0A A;  4HJ8 A;  1KHI A;  1UEB A;  2YV5 A;  1JJG A;  4DV3 L;  4IOA A;  4JI8 Q;  4IPC A;  1J5E Q;  2E2J H;  1PYS B;  1K8G A;  1YIT A;  5J3B A;  1E1O A;  2UUC L;  5M3F H;  3GTG H;  3HOV G;  1HNX L;  2JE6 I;  1A63 A;  2MQH A;  2WFW A;  2F4V Q;  2CFM A;  1VQH A;  3KF6 A;  1J6Q A;  4X65 L;  1D7Q A;  3W5O A;  4DR5 L;  4X62 L;  2VS1 A;  3M4P A;  1MKH A;  3PUV A;  4BY1 G;  4JI3 L;  4A3D H;  1X55 A;  4DUY L;  4AQY Q;  4JI2 L;  4GKK Q;  4A3C H;  4Y7N H;  3IRB A;  1WFQ A;  1Y1V G;  2LSS A;  2RHQ B;  2PQA A;  1UE5 A;  1V43 A;  2HIV A;  1Y1W H;  4NB3 A;  4DV6 L;  1K73 C;  3H0G G;  3JAM i;  3J81 c;  2R7D A;  3HKZ G;  3STB C;  1V9P A;  4C3I H;  2FXQ A;  1UE6 A;  1AE2 A;  2Q2T A;  1CUK A;  1L1O C;  4NXN Q;  1XNR Q;  2JA8 H;  1XMQ Q;  5IYD G;  3T1Y Q;  4BBR G;  2K4K A;  4R4Q A;  4LF6 Q;  1K83 H;  1VQP A;  2RHS B;  2YTX A;  3EBE A;  4GNX C;  1PH4 A;  2CWP A;  2OTL A;  2KCT A;  4B3S L;  1VS0 A;  4BY7 H;  1G6P A;  3UE1 A;  1YNX A;  1P16 A;  1A62 A;  2AMC B;  3PUZ A;  4P74 A;  3S1N H;  3L0O A;  3M9B A;  4OO1 G;  3Q8D A;  5FLM G;  1I3Q H;  2VQF L;  4DPG A;  2F3I A;  2C35 B;  4QY7 A;  1HZB A;  2DUD A;  2OCE A;  3HOU H;  2ASB A;  2E8G A;  1YJN A;  3G48 A;  1QZG A;  2I5L X;  3PCO B;  1SLJ A;  3JC6 6;  1AE3 A;  2R7Z H;  1CKN B;  1OXU A;  1D8L A;  1KXL A;  3PGZ A;  3S2H H;  1WCM H;  4A3I H;  4B3R L;  1J5E L;  3HOZ G;  1YI2 A;  1QUQ B;  4PZ6 A;  4KLK A;  1ASZ A;  4HJ7 A;  3PV0 A;  3S15 H;  2JA6 H;  3SGI A;  5K36 G;  3PSI A;  2UXD Q;  1TXY A;  5JEA G;  4LNQ A;  1K3R A;  5JJI A;  4JI1 Q;  3S1R H;  1WOC A;  2ZM6 L;  4AYB E;  4DNI A;  4B3T Q;  3J80 i;  1JMC A;  2R92 H;  2PI2 A;  3EIV A;  2RCN A;  1UE1 A;  1GD7 A;  1L2F A;  2D0P A;  5GAD C;  2ZTC A;  4AQY L;  1B7Y B;  2NVQ H;  2CCZ A;  2NZO A;  4B3M Q;  4JI6 L;  3RLF A;  1SMX A;  4J15 A;  3OW2 A;  1XMO L;  2GVA A;  2E5L Q;  4R4I A;  1Q82 C;  2ATW A;  1Z47 A;  3RN2 A;  1N36 Q;  2IHF A;  1TWH H;  3PF5 A;  2VUM G;  3S1M H;  4LF4 L;  1N32 Q;  4A3B H;  3UDG A;  5FJ8 H;  3GTL H;  3F2B A;  4A75 A;  1IBK L;  5IYB H;  2WAQ G;  4L5T A;  4NXN L;  3PUX A;  4AH6 A;  4DV5 Q;  4TQU S;  5BR8 Q;  2PMZ E;  4A4I A;  4GKJ L;  3FKI G;  4K0K L;  3K8A A;  1P8L A;  4X66 Q;  4JOI C;  3NEL A;  1YBY A;  5C3E H;  3HOX H;  1PH6 A;  1KC8 C;  1QVC A;  2WAQ E;  4QIW E;  5LMU L;  3D31 A;  4OXP A;  3F8T A;  1ASY A;  1VQG A;  4JYA Q;  1CKN A;  3ULP A;  4JG2 A;  1HR0 L;  4DV4 L;  2I0Q A;  2IHE A;  4NXM Q;  3KF6 B;  4OON A;  4JBM A;  1T9H A;  4GLA C;  2Q2I A;  4BA1 I;  3B6Y A;  5IYC G;  2OWO A;  1I6H H;  4JI0 L;  1NBW A;  1JJC B;  2RF4 A;  5C4X H;  1VQN A;  4LF5 Q;  4A3E H;  2Q2H A;  3GTM H;  3J81 i;  2CKZ B;  4A3K H;  1IZ6 A;  2Y0S G;  5E7N A;  4LUO A;  4PZ7 A;  1Q81 C;  2JA7 H;  1JJ2 A;  3UDF A;  3J7Z C;  4IPH A;  2XTI A;  2A8V A;  2B63 H;  3A5Z B;  1VQK A;  4YCV A;  4JBW A;  3PO2 G;  2UXC Q;  1Q8K A;  3S16 H;  3J80 c;  2KBN A;  4JI1 L;  3RR5 A;  4A3G G;  4JI7 Q;  1VQD A;  2PI2 E;  4B3T L;  2R6G A;  1HNZ L;  1IYJ B;  1E24 A;  4QJF A;  3T1H L;  2Z0S A;  3CQZ H;  2UUA Q;  1TWF H;  4GN3 B;  4A3M H;  4BA2 I;  2VL6 A;  4B3M L;  2HIX A;  3BZK A;  1W2B A;  2E5L L;  4BBS G;  1L0W A;  4GOP C;  5C0X I;  1M90 C;  2DGY A;  1Y1V H;  1YVC A;  1VQB A;  3U4Z A;  1N36 L;  5H1S E;  1VQJ A;  2N78 A;  3HOW H;  1VQ6 A;  2UXB Q;  5GAH C;  4QGU A;  4IOC A;  2N8N A;  1XPR A;  4A3L G;  3NEM A;  2XGT A;  2Z6K A;  3NBH B;  4LUZ A;  3RLO A;  1E1T A;  5JEA J;  5BR8 L;  1VQ9 A;  3RZO H;  1I5F A;  1PFS A;  3CF5 A;  1G29 1;  2VZA A;  3GTQ H;  4X66 L;  2UUB L;  2R93 H;  4YWK A;  4OWX B;  5C0X J;  3ICE A;  3AQQ A;  4IPG A;  3CCQ A;  1PH2 A;  1X56 A;  1IBM Q;  1HNW L;  1XJV A;  1S72 A;  1DGS A;  1NMG A;  1K8A C;  1B70 B;  3CCJ A;  1CKM A;  2KHJ A;  1U0L A;  1JB7 A;  3OTO L;  1N33 Q;  4FDB A;  4DR7 Q;  1KAW A;  4R4O A;  3I4O A;  3G71 A;  4KHP Q;  5C4J H;  4JBK A;  4YWL A;  4LF8 Q;  2WP8 J;  5IP7 H;  2JQO A;  1QVF A;  4DV1 Q;  2HT1 A;  4JV5 L;  3E9H A;  3M7N A;  3M3Y H;  5GQO A;  3PF4 A;  4DV2 Q;  2YYZ A;  2K5V A;  2HQL A;  4O0A A;  2OTJ A;  5FLX c;  3PO3 H;  3S2D H;  1I94 L;  3J81 j;  2UXC L;  2I5M X;  1FGU A;  1S3O A;  4A3J H;  4LFC Q;  1KL9 A;  3DLL A;  1SRU A;  4HJ5 A;  1EUJ A;  4P73 A;  1X9N A;  3MXN B;  1SRO A;  1NY4 A;  3KOJ A;  3CMA A;  3F2D A;  2YU9 H;  4QQB X;  3I2Z A;  4GS3 A;  3GO5 A;  3I4N H;  2VW9 A;  3KDF B;  3KF8 B;  5M3F G;  5IWA Q;  4UP7 A;  2QA4 A;  3CCV A;  4PZ8 A;  4A3F H;  2OQ0 A;  5IE8 A;  3K7A H;  4BXX H;  5LMN W;  4JI8 L;  4YY3 Q;  1Q1E A;  5LMN Q;  2L15 A;  4AYB G;  1PV4 A;  2UXB L;  1U5K A;  4A3D G;  3CPW A;  3RLN A;  4A3C G;  2E2H H;  3GD7 A;  3HOY H;  5GAG C;  2F4V L;  4MTN A;  1PA6 A;  1YHA A;  1SE8 A;  4ME3 A;  1X3G A;  5C0X G;  1Y1W G;  1PH3 A;  2UU9 Q;  2GVB A;  4DR4 Q;  4NPS A;  1EOV A;  1MJC A;  3STB D;  4P72 A;  1IBM L;  4LF9 Q;  3M4O H;  4P75 A;  4GKK L;  4DAM A;  5HY6 A;  1IBL Q;  1EYG A;  1EWI A;  2GN5 A;  2WB1 G;  2JA8 G;  3W1B A;  3TS0 A;  1SN8 A;  2I5H A;  4DV7 Q;  4JI4 Q;  3KLW A;  1R9T H;  1N33 L;  1QVG A;  4BY7 G;  4DK3 C;  3H3V H;  2CQO A;  1A8V A;  1HH2 P;  1VQL A;  1VQC A;  2A1A A;  5M5W H;  5IYC H;  4KHP L;  3GDE A;  1WYD A;  2K5N A;  2WB1 E;  4JC0 A;  5M5X H;  4LF8 L;  1XNQ Q;  3HKS A;  5M3M H;  4LF7 Q;  4DV0 Q;  1XNR L;  3J7A 5;  1XMQ L;  3T1Y L;  4DR2 Q;  1MIU A;  2QEX A;  3WWV A;  4LF6 L;  1KRT A;  1N8R C;  3KDF A;  1N34 Q;  3HOU G;  3ERS X;  5IP9 H;  2BH8 A;  3HFZ B;  3TRE A;  3KJO A;  2F52 A;  3K0X A;  3AYH B;  5ELO A;  1YHQ A;  1VQ5 A;  1E3P A;  4IO9 A;  3S1Q H;  2N3S A;  4LFC L;  3VDY A;  2JA5 H;  2R7Z G;  3S14 H;  4A93 H;  1EQQ A;  2MNA A;  1WCM G;  4A3I G;  1K0R A;  4JI5 Q;  1PYB A;  3ULJ A;  3CAM A;  5HGQ A;  2JEB I;  4DV3 Q;  3KYH C;  1EFW A;  1XPU A;  5C44 H;  1Z9F A;  2JA6 G;  2LXK A;  1G51 A;  1N9W A;  2BA1 A;  1PH9 A;  3I4M H;  1WI5 A;  3G4S A;  1LM0 A;  2UUC Q;  3PIP A;  4C2M H;  1HNX Q;  1PH8 A;  3CD6 A;  3F2C A;  3M85 A;  3FP9 A;  2R92 G;  1RIP A;  1YJ9 A;  4WJ3 M;  3BU2 A;  1YIJ A;  1VQ7 A;  5IT9 c;  2IT1 A;  2MO1 A;  2VNU D;  4JBJ A;  3CCM A;  4XTC S;  2LXJ A;  2UXD L;  1OTC A;  4JI3 Q;  2PNH A;  4DUY Q;  1VQM A;  4JI2 Q;  2KEN A;  3HOV H;  1L1O A;  2JK8 A;  2ZTD A;  3K81 C;  2H5X A;  2JEA I;  1C9O A;  2K52 A;  3RN5 A;  4POG A;  2UU9 L;  4KI0 A;  4GNX A;  1PVO A;  3AFP A;  4DV6 Q;  3TS2 A;  1X54 A;  2AKW B;  4LF9 L;  4IPD A;  1TWC H;  3UDI A;  5FJ8 G;  1NMF A;  1IBL L;  4RG1 A;  3L7Z C;  5IYB G;  4UY8 C;  3GTK H;  3A5U A;  4BY1 H;  1SFO H;  1OXV A;  1XTD A;  4YHH Q;  2NVT H;  2AWN A;  3CP0 A;  3TEH B;  4APV A;  3I55 A;  5C3E G;  1NE3 A;  3HOX G;  4B3S Q;  1HZC A;  4OX9 Q;  4DR1 Q;  1N32 L;  4JCV E;  3H0G H;  3CXC A;  4GN4 B;  4RMF A;  4LF7 L;  3RZD H;  1XNQ L;  4HIK A;  4DV5 L;  1GKH A;  1E22 A;  3PUY A;  2IX1 A;  1VQI A;  5IYD H;  1N34 L;  3A74 A;  4BBR H;  4LFB Q;  1VQE A;  1YEZ A;  5C4X G;  2EXD A;  4A3E G;  5DLQ E;  4Y52 H;  4HIO A;  4JYA L;  1GO3 E;  1YZ6 A;  2ZJQ A;  4OWW B;  1IL2 A;  4A3K G;  3NEN A;  2JA7 G;  2CWA A;  3MEF A;  4JI5 L;  1SR3 A;  4NXM L;  1O7I A;  2B63 G;  4B3R Q;  3I56 A;  4IJH A;  5FLM H;  1X65 A;  5IY0 A;  1M1K C;  4LF5 L;  1KIX A;  4A76 A;  5AJ3 Q;  1X6O A;  4O2D A;  2KCM A;  4L5Q A;  2JJQ A;  2OQK A;  1UE7 A;  2MO0 A;  2ZM6 Q;  1NTG A;  2D0O A;  1K9M C;  3H15 A;  1JT8 A;  4QL5 A;  3HOZ H;  2AWO A;  4A3M G;  3GTO H;  4DR6 Q;  2HHH Q;  1W3S A;  2NVY H;  1KD1 C;  1CSQ A;  5GAE C;  2VY3 A;  1OXS C;  1OXX K;  4PMW A;  4JI6 Q;  4JI7 L;  3CC2 A;  1H95 A;  3GTJ H;  4GOP B;  5GRO A;  1XMO Q;  1Q86 C;  2E2I H;  3HOW G;  3CCE A;  1CKO A;  1LUZ A;  1AH9 A;  4JOI A;  1BBW A;  2ID0 A;  2K5H A;  2QGQ A;  1Q1B A;  4R4C A;  3CCR A;  1BBU A;  2NN6 I;  2UUA L;  4LF4 Q;  3E0E A;  3UE0 A;  4DKA C;  4YHH L;  1IBK Q;  3CW2 C;  4GLV B;  1LYL A;  2R7F A;  3D0F A;  4L5R C;  5EAY A;  3H3V I;  4LFA Q;  2R93 G;  4GKJ Q;  1XPO A;  4TVA B;  3HKZ E;  4OX9 L;  1HZ9 A;  3EN2 A;  4DR1 L;  2NVX H;  3CCL A;  1EQR A;  2VUM H;  1I50 H;  2EIF A;  3CC4 A;  5LMU Q;  1PH7 A;  1OXT A;  1UWV A;  1HR0 W;  1HR0 Q;  4AIM A;  4DV4 Q;  4POF A;  4LFB L;  3M4Q A;  1YJW A;  1Y14 B;  1WJJ A;  3FKI H;  4OWT B;  2VQE Q;  4C3J H;  4JI0 Q;  3BZC A;  4ALP A;  4DR3 Q;  4IFD I;  5IP7 G;  4H02 A;  3E9I A;  4DUZ Q;  2Z6K C;  1KQS A;  4EX5 A;  3G6E A;  1L1O B;  4PG3 A;  4YWM A;  3OYY A;  4P71 A;  3UDX A;  1HZA A;  3PUW A;  4DR7 L;  2MFI A;  3PO3 G;  4XIG S;  2BA0 A;  4GNX B;  4HJA A;  5JJK A;  1BVS A;  1A0I A;  3CC7 A;  4A3J G;  5AJ3 L;  4DV1 L;  4YCU A;  4HIM A;  1MJE A;  4IFD J;  3KJP A;  2Q2U A;  2KHI A;  3A0J A;  3AFQ A;  4DV2 L;  4GOP A;  2V1C C;  4UP8 A;  2BH2 A;  3I4N G;  1HNZ Q;  3S17 H;  5JJL A;  2YTV A;  1GVP A;  3T1H Q;  1VQA A;  2IX0 A;  3K7U C;  2HHH L;  4DR6 L;  1FJG Q;  4X64 Q;  3RNU A;  3PO2 H;  4A3F G;  4DK6 C;  3S24 A;  1IXR A;  3AEV A;  4BXX G;  3JAM c;  1C7Y A;  4A3G H;  4L5S A;  2N49 A;  3K80 C;  2A19 A;  1Q7Y C;  1FL0 A;  1FVI A;  3BJU A;  5IWA L;  1VQ4 A;  4WJ4 A;  3HOY G;  3PIO A;  1TWG H;  2EQS A;  1BKB A;  2K75 A;  4R1J A;  1VQF A;  1EIF A;  1TWA H;  1S40 A;  4HID A;  4YCW A;  4LFA L;  3ZJY C;  3L2P A;  4YY3 L;  5M5Y H;  4BBS H;  5LMN L;  3KFU A;  4K0K Q;  4X65 Q;  1LTL A;  3U50 C;  1Q46 A;  3U58 A;  2UUB Q;  4DR5 Q;  4X62 Q;  4GN5 A;  3TQY A;  1E7Z A;  1Q12 A;  1HNW Q;  1EIY B;  4GLX A;  2NN6 G;  4LUV A;  1B8A A; 
#chains in the Genus database with same CATH topology
 3DWA A;  3CPF A;  4DU9 A;  2AHO B;  2MJ8 A;  4DR4 L;  1JOK A;  2VQE L;  4UP9 A;  1MSG A;  2Q8T A;  1C8C A;  5M3M G;  2B39 A;  2NVY B;  4DUZ L;  1D1K A;  4OO1 I;  1LAC A;  2F0J A;  3GTJ B;  2PQA B;  4ULL A;  2L12 A;  4NW2 A;  2B2U C;  5ELE A;  2L5T A;  1MD2 D;  1I94 Q;  5E4W C;  4C3I B;  4R8I A;  2PCF B;  5EGT A;  2DNC A;  1VQO A;  2F0W A;  4KHZ A;  1M8A A;  1EEF D;  1HA5 A;  4R4T A;  3CCS A;  1NJI C;  1UEA B;  4HJ9 A;  4UPA A;  3QOL A;  1HFG A;  1XX8 A;  1B3A A;  4HSV A;  2FMM A;  2OXP A;  4OIK A;  4IUR A;  1NR4 A;  4DV3 L;  5IIF A;  4JI8 Q;  4IPC A;  1PYS B;  3TP7 A;  3R2I A;  5M3F H;  2ZXR A;  5EBC A;  1MSH A;  1VQH A;  5EPK A;  1J6Q A;  1WCM B;  4RGM A;  3W5O A;  4KY6 A;  2I07 B;  2VS1 A;  3M4P A;  3O13 A;  4X62 L;  4L6T B;  3E6Z X;  4A3D H;  4DUY L;  1WFQ A;  2LSS A;  3A7L A;  2Y0S B;  5C0X H;  1Y1W H;  1K73 C;  3JAM i;  1UUP A;  2QIL A;  1F9S A;  2AUK A;  1XNR Q;  3NSW A;  2JA8 H;  3T1Y Q;  1I4Q A;  1A15 A;  1K83 H;  1I4G A;  4HCE A;  3EBE A;  1PH4 A;  4K0K Q;  2XWB B;  3KBG A;  1EL0 A;  2HD3 A;  1TWG B;  1YNX A;  1A62 A;  1F2L A;  1TWA B;  4P74 A;  3L0O A;  4OO1 G;  1DM0 B;  2XRQ D;  5M5Y B;  4BBS B;  3Q8D A;  3CRK C;  1GJX A;  2C35 B;  2DUD A;  1BCP B;  1YJN A;  1GHK A;  3S9W A;  1SYD A;  1CKN B;  1STG A;  1KXL A;  4A3I H;  1YI2 A;  4K14 A;  1QUQ B;  2B2T C;  4RKB A;  3GTP B;  4P2C B;  3PSI A;  2B2V C;  4LNQ A;  2R92 H;  1JMC A;  3EIV A;  1GD7 A;  2D0P A;  5GAD C;  1LTA D;  4RGT A;  1U4P A;  3OW2 A;  2EYH A;  1XMO L;  1EY8 A;  4R4I A;  4CHT B;  4C3H B;  4HED A;  3OMC A;  2IHF A;  1TWH H;  4FVM A;  3PQI A;  4LF4 L;  2K6A A;  2DNE A;  3UDG A;  4A3B H;  1NSN S;  4QUF A;  2SNS A;  2F0Q A;  2L11 A;  2JXM B;  1A2U A;  3PUX A;  2HCC A;  1SDF A;  4DV5 Q;  4FP5 D;  4GKJ L;  2EE1 A;  2E2J B;  1KDC A;  4X66 Q;  3NEL A;  2QDB A;  3EQL C;  4U68 A;  3GTG B;  2Z1C A;  3ULP A;  4JG2 A;  2QKI C;  3Q6S A;  5A2Q L;  2KHS A;  3KF6 B;  4JBM A;  2OWO A;  2E76 C;  1TY0 A;  5KNC A;  1EYA A;  3GTM H;  2RCF A;  2M00 A;  5JVG 3;  4FF3 A;  4LUO A;  1JJ2 A;  3UDF A;  3OIQ A;  3RUZ A;  1XTC D;  5C4J B;  2UXC Q;  1Q8K A;  3TP8 A;  2PPB C;  4JI7 Q;  1W6J A;  4IN3 A;  1IYJ B;  3DEP A;  2AUJ D;  4QJF A;  2WIN B;  3T1H L;  2PMZ B;  1F2Y A;  4BA2 I;  4A3M H;  5CR3 A;  2HIX A;  3ONA B;  3BZK A;  2R3Z A;  4QIW B;  4X3T A;  1YVC A;  1I3Q B;  3U4Z A;  1VQ6 A;  1D5Z C;  2PYK A;  3AU7 A;  1IL8 A;  1AEX A;  4QGU A;  2N8N A;  1PTO D;  3NEM A;  3RLO A;  2ENB A;  4LUZ A;  1SNM A;  1E1T A;  1VQ9 A;  3K7A B;  1I5F A;  2D9U A;  1SNQ A;  3CF5 A;  4OWX B;  1GHJ A;  1GXD C;  4KJO A;  2F0M A;  4UDU C;  1KDA A;  1PFM A;  1AFP A;  1B70 B;  1CKM A;  3S1R B;  2KHJ A;  1U0L A;  1JB7 A;  2LMC B;  1N33 Q;  4DR7 Q;  1KAW A;  3SXH A;  3G6J B;  2RQX A;  4LF8 Q;  4EVO A;  1QVF A;  4DV1 Q;  4CJ0 B;  2HQL A;  1MI2 A;  1I94 L;  3S1M B;  3Q22 A;  4K5V A;  4GZY C;  1CHQ D;  4P73 A;  1NY4 A;  1EOT A;  2CH4 W;  1LT3 D;  2J7Z A;  5C3E B;  4UP7 A;  3BDO A;  3NPP A;  4ZK9 B;  4K8I A;  4PZ8 A;  2EY5 A;  3TBI B;  4DGZ A;  3R93 A;  5JVH 3;  4JI8 L;  4YY3 Q;  2Z4H A;  1LLR D;  4DAP A;  4AYB G;  1PV4 A;  2F0P A;  2QCP X;  3CPW A;  1IHZ A;  4MIU A;  1U4L A;  4NKL A;  4A3E B;  2F0G A;  4I7Z C;  4X3U A;  3MFG A;  1SE8 A;  2JA7 B;  1KNA A;  3I70 A;  3MWY W;  2UU9 Q;  5CMD A;  2XRS D;  3J80 L;  2EY1 A;  1DD2 A;  5HY6 A;  3BVM A;  2QW7 A;  3TS0 A;  4JI4 Q;  5C4H A;  1LTB D;  4DA2 A;  3LX0 A;  1F2M A;  1BUV T;  2CQO A;  2D2C C;  2KUM A;  5ISR A;  1VQC A;  2A1A A;  2XWJ B;  1VQL A;  1J8I A;  5M3M H;  3IL8 A;  4DV0 Q;  1XNR L;  3T1Y L;  1VF7 A;  3WWV A;  1LTR D;  2L0C A;  1SE4 A;  3HOU G;  3ERS X;  2BH8 A;  4KN4 C;  3KJO A;  3AYH B;  4IO9 A;  3HKZ B;  2N3S A;  5I6W A;  3VDY A;  3S14 H;  5F2D A;  3LWU A;  5CV8 A;  1EQQ A;  3RD4 A;  1X3P A;  1XPU A;  3A56 A;  4FXG C;  2BDO A;  2JA6 G;  3PIP 3;  3AB9 A;  3BYY B;  2BA1 A;  1WI5 A;  1LM0 A;  1RJT A;  1QG7 A;  2XIW A;  3HP3 A;  1EEI D;  1YJ9 A;  1AZQ A;  2IT1 A;  2MO1 A;  1EWH A;  4XTC S;  4KKS A;  4JI3 Q;  2KEN A;  4DK0 A;  2PQE A;  1L1O A;  2JK8 A;  3K81 C;  3P20 A;  3RN5 A;  2FMC A;  3OWE B;  3MXG A;  4I7A A;  3HGB A;  3Q24 A;  4GNX A;  1EY9 A;  4DV6 Q;  3S2D B;  1Y8O B;  2H1E A;  3HEJ A;  3UI2 A;  4RG1 A;  3L7Z C;  2C9O A;  2D5D A;  1OXV A;  3ND9 A;  2NVT H;  3ND8 A;  1RTN A;  1B53 A;  3I4N B;  3HOX G;  1HZC A;  2FIN B;  1LTI D;  3RZD H;  2IWH A;  4DV5 L;  4TSS A;  1E22 A;  4RHS A;  1AZP A;  2Z6B A;  1N34 L;  1YEZ A;  3K0Y A;  3J7A F;  3CRL C;  2IJ0 A;  4OGQ C;  1W6K A;  1WD0 A;  1YZ6 A;  4OWW B;  1IL2 A;  1PXU A;  5HUR A;  2A69 C;  4V19 0;  1LT4 D;  4JK1 C;  2B63 G;  4OO1 H;  3KUP A;  3I56 A;  2FJ2 A;  4IJH A;  1BCP C;  3M4O B;  1KIX A;  4OEM B;  2N88 A;  2OQK A;  5IOC A;  4LAA A;  2ZM6 Q;  1BXT A;  2D0O A;  2GA4 B;  1K9M C;  2OF1 A;  5M5W B;  1F9R A;  2O4X A;  3VR6 A;  3GTO H;  4DR6 Q;  4HMJ A;  1CSQ A;  3OPO A;  3NBI A;  4PMW A;  4TRD A;  4JI7 L;  5A2Q E;  2DJF C;  2PZT A;  4GOP B;  3HOW G;  1X32 A;  4KKU A;  1AH9 A;  4C1N K;  3V96 A;  2K5H A;  3CCR A;  1Q1B A;  2WKD A;  2NN6 I;  1CQV A;  4NDX A;  5M9O A;  2R7F A;  1KLU D;  3D0F A;  4L5R C;  3H3V I;  1XPO A;  1HZ9 A;  4DR1 L;  1E0B A;  1EQR A;  4ZCK A;  3CC4 A;  1JWS D;  4QB4 A;  3LNN A;  2C5C A;  1HR0 Q;  4AIM A;  2CVR A;  4POF A;  5AFW A;  4LFB L;  4F88 A;  1YJW A;  2VQE Q;  1IW7 D;  4KY5 A;  3VA5 A;  1V1P B;  4H02 A;  4DUZ Q;  3G6E A;  4P71 A;  5CV5 A;  4DR7 L;  2MFI A;  1QJO A;  1BBX C;  1I6V C;  4XIG S;  2BA0 A;  5JJK A;  1J9O A;  4A3J G;  2B8G A;  3GTK B;  5AJ3 L;  1SND A;  4DV1 L;  1HQM C;  4BY1 B;  3SK6 A;  3A0J A;  3I91 A;  1VMP A;  1B1Z A;  2CQA A;  3K7U C;  3H0G B;  1FR3 A;  4A3F G;  3AEV A;  1IXR A;  3OWF A;  1C7Y A;  1MBY A;  3KK7 A;  4L8J A;  1PDQ A;  2N49 A;  3FPU B;  1NUC A;  1RF2 D;  2CW0 D;  3MA2 B;  1FL0 A;  4WJ4 A;  1CT1 D;  1DYQ A;  5EKI A;  4OHJ A;  3M4Y A;  4Z9C B;  3NQI A;  1HCZ A;  3R8B A;  4YY3 L;  1UAP A;  2ZXO A;  1JQY D;  2UUB Q;  3U58 A;  4RA8 A;  4X62 Q;  4RCO A;  1GUO A;  3GV3 A;  1Q12 A;  4CDE C;  3DM1 A;  4GLX A;  2NN6 G;  2JP1 A;  1D1I A;  4J8Q A;  4IJL A;  3DM3 A;  2ICI A;  3HS0 C;  5KIX A;  2ZJR A;  1EQT A;  3HOZ B;  1STN A;  1EY7 A;  2KCN A;  1BO0 A;  1PHJ A;  3NWS A;  1X3E A;  4JI4 L;  4EQO A;  4JV5 Q;  4LW1 A;  1DXM A;  2E2I B;  2IPK D;  1KRS A;  3E3X A;  3U4V A;  1Y1W B;  1JE5 A;  1YHB A;  4N8X 1;  2JA5 G;  3CME A;  1NAP A;  1PTO F;  3VR5 A;  2B3G A;  4DV0 L;  2JA8 B;  2YTY A;  5C44 G;  1AP0 A;  3ITP A;  2PW5 A;  2F0K A;  4QF4 A;  1FJG L;  2VUM B;  1I50 B;  4K5W A;  1C0A A;  1S5F D;  2QDL A;  5CBE E;  5D14 A;  2MHV A;  5TSS A;  1LT6 D;  3D4R A;  1YIT A;  5J3B A;  4XXE A;  3TN2 A;  3VYR A;  5IGF A;  3GV6 A;  1A63 A;  1FNU A;  4ZRZ A;  3SK5 A;  1D7Q A;  3PUV A;  4JI3 L;  1EYD A;  1SNO A;  1X55 A;  2A68 D;  5E3F A;  2WAC A;  1KDB A;  2RHQ B;  2NYZ D;  1TKW B;  1QB5 D;  4QUC A;  3S17 B;  1R4Q B;  4DV6 L;  1IKM A;  3J81 c;  1V8Q A;  3T56 B;  2K33 A;  3STB C;  3HG9 A;  2HCI A;  2WII B;  3PO2 B;  1PMR A;  3J81 E;  5I6Y A;  1SMY D;  1XMQ Q;  4KJN A;  4A3G B;  4BBR G;  1T5E A;  3KBX A;  4IUV A;  2OTL A;  2RHS B;  2YTX A;  1GOZ A;  2KCT A;  1VS0 A;  1TWH B;  1G6P A;  3CKI B;  3RMH A;  3EVQ A;  3I73 A;  1ZYR D;  1WTV A;  3PUZ A;  3S1N H;  2RKS A;  4ZQ3 A;  5EQ0 A;  2VQF L;  3C3L A;  3HOU H;  2SDF A;  2E8G A;  1QZG A;  1WVL A;  3D3R A;  5IGD A;  1OXU A;  1J5E L;  3QB3 A;  4PZ6 A;  1ESF A;  3PV0 A;  2JA6 H;  1X3Q A;  1TXY A;  3FMC A;  4ZUI A;  5JJI A;  3NXW A;  2ZM6 L;  4AYB E;  3NHH A;  1LT5 D;  1LV9 A;  3DWQ A;  1L2F A;  2KED A;  5LL6 X;  4AQY L;  3H6M A;  1B7Y B;  1RTO A;  2NVQ H;  2CCZ A;  5E1F A;  4J15 A;  3OOC A;  3GTL H;  1AW7 A;  1MHW C;  3F2B A;  4A75 A;  4XQN A;  2XNA C;  1SYG A;  4AH6 A;  3SK4 A;  1G2S A;  4TQU S;  2X6L A;  4A4I A;  1QWY A;  3K8A A;  4XT1 B;  1P8L A;  4JOI C;  1YBY A;  3FVQ A;  3HOX H;  2R61 A;  1KC8 C;  1QVC A;  2WAQ E;  3S15 H;  5CGK A;  1QE6 A;  3D31 A;  3F8T A;  2MPM A;  1VQG A;  4OXP A;  1EWC A;  5ELD A;  5KYL A;  3DUZ A;  1HR0 L;  2I0Q A;  1SYB A;  5I2Y A;  4OON A;  1I6H H;  4CDF C;  1NBW A;  1JJC B;  2RF4 A;  1VQN A;  3MVV A;  2SNM A;  2PZW A;  4LF5 Q;  3C1E A;  2Q2H A;  5I9O A;  4Y7N B;  2CKZ B;  2Y0S G;  1QNK A;  4C56 C;  2XTI A;  4ZAI A;  2B63 H;  3A8K E;  3S16 H;  2KBN A;  4JI1 L;  5L37 A;  2EYM A;  4IUT A;  1E24 A;  4KV6 A;  4BY7 B;  2Z0S A;  3CQZ H;  2UUA Q;  2F0D A;  3G7L A;  2VL6 A;  4MN3 A;  1W2B A;  4OL7 A;  2E5L L;  4BBS G;  2B2W C;  4GOP C;  2DGY A;  1Y1V H;  1I4R A;  3HOW H;  5GAH C;  2XGT A;  2R7Z B;  5BR8 L;  1SJH D;  5D65 A;  3RZO H;  3S2H B;  1PFS A;  3GTQ H;  1G29 1;  1GUN A;  2UUB L;  4YWK A;  4IPG A;  1PH2 A;  1XJV A;  2FHT A;  1NMG A;  1D2B A;  2L1B A;  4FDB A;  2RDF A;  3JAM L;  1TQO A;  3VYS A;  4JV5 L;  3E9H A;  5GQO A;  4C3H G;  2A73 B;  2B2Y A;  3PF4 A;  2YYZ A;  2K5V A;  3VR2 A;  1BNZ A;  5HGT A;  2F0U A;  2OTJ A;  4CGY B;  4O1N A;  1STE A;  1S3O A;  4A3J H;  1GUW A;  5KND A;  3DLL A;  4HJ5 A;  1EUJ A;  4RGN A;  1STH A;  3MXN B;  3KOJ A;  2YU9 H;  4QQB X;  4GS3 A;  3I2Z A;  3GO5 A;  3KLS A;  4PNY A;  1BCP F;  1RD9 D;  5IWA Q;  3NBH A;  3W2D A;  1WTQ A;  4B9X A;  1EIG A;  1PTO H;  1DJR D;  2VB2 X;  4A3F H;  1TVX A;  5K5P A;  2WKC A;  2RDH A;  2UXB L;  1U5K A;  5A35 A;  5C4X B;  5GAG C;  5I2X A;  4A3K B;  5JJZ A;  4JW0 A;  1SJE D;  1CQF A;  5CV6 A;  4P72 A;  1IBM L;  2GN5 A;  2PW7 A;  1F9Q A;  2NN6 H;  3W1B A;  4DV7 Q;  5DM6 3;  1E2V A;  3H3V H;  3IKJ A;  1ET6 A;  2WB1 E;  5M5X H;  3HKS A;  1SSO A;  4G7Z C;  1XMQ L;  1N8R C;  1N34 Q;  3KF8 A;  3TRE A;  2E74 C;  1YHQ A;  1SE2 A;  1E3P A;  1EY4 A;  3S1Q H;  4LFC L;  2JA5 H;  1HUM A;  4CDD C;  4DAV A;  1K0R A;  3H91 A;  5HGQ A;  2JEB I;  2R93 B;  5C44 H;  1Z9F A;  2RBM A;  2CH4 A;  2LXK A;  3NTI A;  5C3W A;  5DAU A;  3G4S A;  2UUC Q;  3PIP A;  1HNX Q;  1KAA A;  3F2C A;  1Z7T A;  2RSO A;  4KN7 C;  1VQ7 A;  4H7B A;  2A6H C;  2EYO A;  4JBJ A;  1HPC A;  5IGB A;  5FO8 B;  2PNH A;  2EVB A;  2AQ1 B;  3M3Y B;  2K52 A;  1PVO A;  3AFP A;  3TS2 A;  3PO3 B;  3K6O A;  1X54 A;  2AKW B;  4LF9 L;  4IPD A;  1TWC H;  5FJ8 G;  2A5H A;  1IBL L;  3GTO B;  5IYB G;  3A5U A;  1SFO H;  3SHL A;  2AWN A;  4EQP A;  5IOD A;  1ZEQ X;  3ERO A;  5C3E G;  4B3S Q;  1E2Z A;  4DR1 Q;  1EFI D;  3C46 A;  4RMF A;  1XNQ L;  4CBV A;  4IUQ A;  3EJI A;  4UAI A;  1HA6 A;  4G4K A;  3A74 A;  3GQB A;  4BBR H;  4LFB Q;  1KNE A;  4A3E G;  3X3M A;  4Y52 H;  4ZKB B;  3HOY B;  2K03 A;  1QIL A;  3NEN A;  2JA7 G;  2EJM A;  4JI5 L;  1SR3 A;  1O7I A;  2Q8R E;  1M4V A;  1HTP A;  3K5M A;  3TZD A;  5IY0 A;  5EJW A;  4LF5 L;  3QG1 A;  5AJ3 Q;  4FF1 A;  1JCK B;  2KCM A;  4L5Q A;  1R9T B;  1UE7 A;  2H4O A;  1K3B C;  2JYO A;  2AWO A;  2NVY H;  4PMC A;  4JI6 Q;  1H95 A;  1I4P A;  3GTJ H;  1Q86 C;  5J39 A;  5G3L D;  1LUZ A;  1UNS A;  2ID0 A;  4R4C A;  2UUA L;  1BBU A;  3QWN A;  1IBK Q;  5IGC A;  4KY7 A;  1LYL A;  5CYU A;  4TVA B;  5LHY 1;  3K59 A;  3I4M B;  4C2M B;  1HR0 W;  5IT9 L;  5EPL A;  2LKV A;  4HMI A;  1G2T A;  1B50 A;  4XYO A;  1FNV A;  4JI0 Q;  5CBA E;  4ALP A;  1HXY D;  5IP7 G;  2MP1 A;  1KQS A;  3HOV B;  2DJG C;  4PG3 A;  1HZA A;  3PUW A;  1RKN A;  1BVS A;  4HTH A;  1A0I A;  1A3T A;  4YCU A;  1MJE A;  4ZUJ A;  4IFD J;  2Q2U A;  1YNJ C;  2KHI A;  3AFQ A;  2BH2 A;  4UP8 A;  3I4N G;  1HNZ Q;  1FNW A;  1BR9 A;  3FEW X;  3VR4 A;  2HHH L;  1FJG Q;  1WTH A;  1VDZ A;  1O80 A;  4RCN A;  3BG3 A;  3JAM c;  4L5S A;  5CV9 A;  5IWA L;  1VQ4 A;  4F87 A;  1NCV A;  1TWG H;  2EQS A;  1BKB A;  2F0O A;  2K75 A;  1H9J A;  4R1J A;  1TWA H;  1S40 A;  2E2D C;  4HID A;  4LFA L;  5M5Y H;  4BBS H;  1EY0 A;  3KFU A;  2KEC A;  1LTL A;  3U50 C;  1ILQ A;  4GN5 A;  1EIY B;  1LTT D;  2K14 A;  5FLX L;  4FXD A;  2BE5 C;  1X3F A;  3OTO Q;  2ES2 A;  1WD1 A;  1QUQ A;  1I4X A;  3F1Z A;  4RKL A;  2NZH A;  3GTP H;  1VQ8 A;  1SBB B;  1Y8P B;  2ZTE A;  2IL8 A;  4RFB A;  2E75 C;  2I46 A;  4DV7 L;  2ZJP A;  3LGJ A;  2D62 A;  2ALY B;  1B44 D;  2X69 A;  3I90 A;  1HJP A;  3A54 A;  5IP9 G;  2K32 A;  1PRT C;  3W1G A;  4X6A H;  1PH1 A;  3ER0 A;  4OEL B;  4A93 G;  1IYV A;  2K50 A;  1QZH A;  3CCU A;  2Y0S E;  3FHW A;  4MZ9 A;  1Q90 A;  1B4O A;  2G9H D;  4C3H H;  2VQF Q;  4LWC A;  2NVX B;  1G6Z A;  3L9A X;  3TRZ A;  4X64 L;  4HJ8 A;  2YV5 A;  2WAQ B;  4KD4 A;  4IOA A;  5COY A;  1J5E Q;  2E2J H;  3VYU A;  3FKI B;  1K8G A;  4C3J B;  3C2P A;  4ZKC B;  2UUC L;  2O2L D;  3GTG H;  1HNX L;  2JE6 I;  2MQH A;  2B8F A;  2CFM A;  3KF6 A;  1QCB D;  5IGG A;  1DOK A;  1QNU A;  2JA6 B;  3L3O C;  4BY1 G;  1I4H A;  2KCC A;  4AQY Q;  3HRZ C;  3TP6 A;  4K8J A;  3TZU A;  3ERQ A;  1Y1V G;  4FNF A;  5CV7 A;  4PQX A;  1STA A;  1YNN D;  4NB3 A;  5JOB A;  3H0G G;  2R7D A;  1AE2 A;  4K6D A;  2Q2T A;  2NVQ B;  1CUK A;  1L1O C;  2HDL A;  1EY5 A;  4DAY A;  1CI3 M;  4CJ1 B;  5IYD G;  4R4Q A;  1VQP A;  4B3S L;  1F77 A;  4GNX C;  2RSN A;  5C3X A;  2PZU A;  3UE1 A;  2A69 D;  1DZ1 A;  2AMC B;  1CFM A;  2F0V A;  5FLM G;  1I3Q H;  2EOT A;  4DPG A;  2F3I A;  1BCP D;  4QY7 A;  4F7X A;  3G48 A;  4DFA A;  4L63 B;  1BQQ T;  1KLG D;  1SLJ A;  1AE3 A;  1D8L A;  4XQQ A;  3HOZ G;  2EZV A;  4KLK A;  1ASZ A;  4HJ7 A;  5JEA G;  2X6G A;  4JI1 Q;  4QCL A;  1B9N A;  5I4D A;  3S1R H;  2A6E C;  4DNI A;  3N52 A;  2Z9H A;  4R8N A;  1ONL A;  1UE1 A;  5ELF A;  1R4P B;  4JI6 L;  3RLF A;  3SEB A;  2E5L Q;  4FYD A;  2ATW A;  3RN2 A;  3PF5 A;  2LS0 1;  2VUM G;  3S1M H;  1N32 Q;  5FJ8 H;  1IBK L;  2F0I A;  5IYB H;  1HHV A;  1H9K A;  4NXN L;  4L5T A;  5BR8 Q;  2PMZ E;  4KHV A;  1O7L A;  3P1H A;  2BCO A;  1CHP D;  5C3E H;  4QIW E;  5M3F B;  4JYA Q;  1ASY A;  2J4X A;  1CA6 A;  2K1B A;  1BOS A;  1WTX A;  1LO5 D;  4NXM Q;  1T9H A;  4GLA C;  2Q2I A;  4HCS A;  4BA1 I;  1WTR A;  4JI0 L;  1CA5 A;  2LFN A;  2JSO A;  4A3D B;  3V05 A;  4A3E H;  2TSS A;  3HZX A;  4KD3 A;  4CJ2 C;  2JA7 H;  1Q81 C;  1PZJ D;  3J7Z C;  1DCZ A;  3A5Z B;  3KLR A;  1VQK A;  3PO2 G;  4JBW A;  2KEE A;  4XT3 B;  4HR7 B;  3J80 c;  3A55 A;  2WB1 B;  4A3G G;  1VQD A;  5ELB A;  4B3T L;  2R6G A;  2K7V A;  3NE5 B;  5E4X A;  1HNZ L;  1CM9 A;  1K83 B;  3PMF A;  3J80 E;  3CHB D;  1TWF H;  4B3M L;  1L0W A;  1A3U A;  1M90 C;  1TT2 A;  1N36 L;  4FO2 A;  1VQJ A;  2N78 A;  3OIP A;  5H1S E;  2UXB Q;  4IOC A;  1JC7 A;  4A3L G;  2Z6K A;  3NBH B;  1Y69 U;  1ICW A;  1Q3L A;  5JEA J;  3MC0 B;  4IUN A;  4A3I B;  2VZA A;  3H09 A;  5C0X J;  4ILW A;  3ICE A;  1IBM Q;  1X56 A;  3D8G A;  1B9M A;  3MFY A;  1DGS A;  1U4R A;  4E6I A;  5BN5 A;  1K8A C;  4FF4 A;  1JE4 A;  5D3D A;  3OTO L;  5IGE A;  2R92 B;  5G3L F;  3I4O A;  4S3S A;  4JBK A;  4YWL A;  2IW3 A;  2WP8 J;  5IP7 H;  2JQO A;  3NQT A;  3M7N A;  5C5M A;  3TDQ A;  2EYF A;  1SYF A;  2BOS A;  4O0A A;  4H44 C;  5FLX c;  3S2D H;  4A3B B;  3K58 A;  1ROD A;  4LFC Q;  1KL9 A;  2SEB D;  1SRU A;  1D5M C;  1SRO A;  2XN9 C;  3F2D A;  5EKK A;  2VW9 A;  3I4N H;  3KF8 B;  1DOL A;  2ICE C;  2QA4 A;  3CCV A;  2EYJ A;  5LMN Q;  3T4A C;  4A3C G;  3RLN A;  2E2H H;  1E2W A;  3GD7 A;  3QR8 A;  3GTM B;  4MTN A;  1F2Z A;  1SYE A;  4FXK C;  4ME3 A;  1X3G A;  3QOJ A;  1PH3 A;  1K28 A;  4NPS A;  1EOV A;  4C3I G;  1MJC A;  2B2U A;  3STB D;  2K01 A;  1L0Y B;  4LF9 Q;  3M4O H;  4DAM A;  1IBL Q;  1EYG A;  1EWI A;  1B3Q A;  3KLW A;  4BY7 G;  4DK3 C;  1A8V A;  5IYC H;  2O5I C;  5M5W H;  3SR1 A;  4KHP L;  3GDE A;  4A3M B;  2PNR C;  5FOB B;  1XNQ Q;  3J7A 5;  2Q8I B;  4DR2 Q;  1EYC A;  1SE3 A;  4EGV A;  1KRT A;  4R9W A;  3KDF A;  3FDT A;  5IP9 H;  4G57 A;  1FYC A;  3HFZ B;  1VQ5 A;  2F52 A;  1FGB D;  3EFX D;  5ELO A;  5C4Z A;  2R7Z G;  4A93 H;  1NR2 A;  2MNA A;  1WCM G;  3MXP A;  2A74 C;  4JI5 Q;  1PYB A;  1EFW A;  1HUN A;  4HN7 A;  1ESR A;  2F0H A;  3T53 B;  5JAV A;  1RIP A;  4K2K A;  3BU2 A;  3X3N A;  1RCV D;  1V1P A;  2LXJ A;  3M7G A;  1OTC A;  1VQM A;  4JI2 Q;  2JEA I;  4YIJ A;  2J0T D;  1F9P A;  3UDI A;  1CK1 A;  3V2T A;  3GTK H;  4UY8 C;  4BY1 H;  2JN4 A;  2HUG A;  3P7J A;  3CP0 A;  3TEH B;  4APV A;  3QJY A;  3I55 A;  1ZXT A;  3J7Y W;  1NE3 A;  3A7A B;  2MUY A;  1N32 L;  3H0G H;  3DHQ A;  4LF7 L;  2DY7 A;  4HIK A;  1GKH A;  4CKC A;  1C48 A;  3PUY A;  1IKL A;  1VQI A;  4O42 A;  5KRU A;  2F03 A;  5IYD H;  5DNF A;  1VQE A;  2B2T A;  3SK8 A;  5C4X G;  2OT2 A;  2EXD A;  4WJW A;  5DLQ E;  4HIO A;  4DNR B;  4NP5 A;  2B2V A;  1JB3 A;  2ZJQ A;  4JYA L;  4A3K G;  4HAE A;  3T13 A;  4NXM L;  1PRT F;  1GUT A;  4B3R Q;  3NK9 A;  1PRT B;  5FLM H;  1U4M A;  2K5D A;  1NNX A;  4KTA A;  4O2D A;  4LJZ C;  2JJQ A;  3FRP B;  2MO0 A;  1TS2 A;  1JT8 A;  4QL5 A;  3HOZ H;  5C5L A;  3I8Z A;  2HHH Q;  1W3S A;  2PO4 A;  5GAE C;  4H13 C;  1HFN A;  5M3M B;  1OXX K;  5JEA H;  3CC2 A;  4XDX A;  5GRO A;  2E2I H;  3CCE A;  1CKO A;  4N9P A;  3MXU A;  5FO7 B;  2QGQ A;  3E0E A;  3S14 B;  4YHH L;  4IZ8 A;  4GLV B;  1GUS A;  5EAY A;  2R93 G;  4LFA Q;  1H9S A;  1AN8 A;  1G91 A;  3T51 B;  4OX9 L;  3NTH A;  4N9T A;  3QO2 A;  2OEO A;  2VUM H;  1I50 H;  2EIF A;  3EA6 A;  4PMB A;  5LMU Q;  1PH7 A;  3A8I E;  1OXT A;  2L55 A;  4DV4 Q;  2DN8 A;  2P5Z X;  3M4Q A;  1Y14 B;  2Z4I A;  3BZC A;  3AMU A;  4IFD I;  4XYQ A;  4EX5 A;  3OHX C;  1L1O B;  3DEO A;  4YWM A;  3UDX A;  3MTS A;  3K5N A;  2EYP A;  3PO3 G;  4GNX B;  4HJA A;  1BF4 A;  3SVM A;  1S5E D;  3A8J E;  4HIM A;  3VA7 A;  3KJP A;  2NVT B;  3K57 A;  1O7Z A;  2VXW A;  5JJL A;  3S17 H;  3BVG A;  1OO9 B;  2TMP A;  4RAU C;  2IX0 A;  3BS1 A;  4X64 Q;  3PO2 H;  3RZD B;  4DK6 C;  3S24 A;  4BXX G;  3MHB A;  2B2Y C;  5KGU A;  4A3G H;  3K80 C;  5T1G A;  2A19 A;  4MHE A;  3PIO 3;  1Q7Y C;  1FVI A;  3HOY G;  2F0T A;  1VQF A;  4YCW A;  4RGO S;  4CKB A;  5LMN L;  4J6H A;  5EPJ A;  1PLF A;  1Q46 A;  3TQY A;  3P75 A;  5JPN C;  1HNW Q;  1TR5 A;  1VF5 C;  1LTG D;  4V0B A;  1ICF B;  1B8A A;  4A3L H;  1PTO C;  4JVZ A;  3ULL A;  1V1Q A;  3MAQ A;  3J7A V;  4ME5 A;  2JA9 A;  2B29 A;  4MNO A;  4ZYS A;  2EDG A;  4DR3 L;  1CSP A;  4EQ5 A;  3SE0 A;  1RL2 A;  3I7F A;  5ELN A;  3WDN A;  4MTK A;  4BWG B;  1PH5 A;  4RWS C;  1GM5 A;  1SNP A;  2IY5 B;  4IFD G;  1VCI A;  1S5C D;  2M9V A;  3WOF A;  4DR2 L;  1TII D;  3LWE A;  2K05 A;  4DAY B;  3H3V C;  3I4M G;  2O5J C;  2KA7 A;  1II3 A;  1XYI A;  1ET9 A;  3Q0A A;  1WTP A;  1KHI A;  1PFN A;  1UEB A;  2KOL A;  1JJG A;  2A6H D;  3D4D A;  4DK1 A;  2F0E A;  2L9H A;  1E1O A;  3FPP A;  3HOV G;  1CZG A;  2WFW A;  1SNC A;  2F4V Q;  4X65 L;  1CZW A;  2L4N A;  4DR5 L;  1MKH A;  3SDZ A;  2WV6 D;  4GKK Q;  4A3C H;  4JI2 L;  4Y7N H;  3IRB A;  2EY6 A;  1LAB A;  1B2T A;  2PQA A;  1UE5 A;  1V43 A;  2HIV A;  3HKZ G;  1V9P A;  4C3I H;  2FXQ A;  1UE6 A;  1JR0 D;  4NXN Q;  2K4K A;  4N8F A;  3BVZ A;  4LF6 Q;  3TME A;  4BY7 H;  2CWP A;  1TS4 A;  3CU7 A;  3H94 A;  2F1M A;  3GP7 A;  1P16 A;  2F0N A;  3M9B A;  1HQR D;  2F3V A;  1HZB A;  2OCE A;  3OW7 A;  1JOR A;  2ASB A;  5KYI A;  2I5L X;  3PCO B;  2NTS A;  4I65 A;  3JC6 6;  2R7Z H;  3PGZ A;  1LTS D;  1WCM H;  3S2H H;  4B3R L;  4IQZ A;  1JOO A;  4ZLT F;  1V1O A;  5K36 G;  4B08 A;  3SGI A;  3VR3 A;  2UXD Q;  4H0L C;  4DNT B;  1QOH A;  1K3R A;  3N6R A;  1ENC A;  4LK1 C;  3Q23 A;  1WOC A;  4B3T Q;  2F0S A;  3J80 i;  2V4D A;  2PI2 A;  4X3S A;  2RCN A;  2ZTC A;  2NZO A;  4B3M Q;  5JPM C;  1SMX A;  2GVA A;  1EZ8 A;  4ID6 A;  1Q82 C;  5NUC A;  1Z47 A;  3OMG A;  2EY2 A;  4XQJ A;  1N36 Q;  3JAM E;  1TWF B;  2K5Q A;  2WAQ G;  3MXN A;  3W3A A;  3FKI G;  4K0K L;  4C3J G;  3BZD B;  1SXT A;  4DXG A;  1PH6 A;  1L0X B;  4M8A A;  5LMU L;  5EKL A;  1T5X D;  4KK7 A;  1CKN A;  1S4Z A;  2HDM A;  4DV4 L;  2IHE A;  5DM7 3;  5IYC G;  1XXG A;  3B6Y A;  3OSO A;  4AYB B;  1Z6H A;  5C4X H;  1C4Q A;  5FO9 B;  1ML0 D;  1YNJ D;  3J81 i;  3IFD A;  1IZ6 A;  5E7N A;  3J81 L;  2RVL A;  4PZ7 A;  4Q5V A;  4A3K H;  4IPH A;  2A8V A;  5I9P A;  4YCV A;  1VMC A;  5D3I B;  1DON A;  3NWT A;  4CDC C;  1JOQ A;  3RR5 A;  2PI2 E;  1K8M A;  1EQV A;  3U9S A;  4GN3 B;  3R2T A;  1O78 A;  5BN4 A;  3MZ5 A;  2F0L A;  3I72 A;  3S1N B;  5C0X I;  1EIH A;  1VQB A;  1YNN C;  3HOU B;  2F0F A;  4KKT A;  1STB A;  1XPR A;  3DXJ C;  2BE5 D;  2R93 H;  4X66 L;  1STY A;  2KQ3 A;  2NB0 A;  4M1U B;  3AQQ A;  2N55 A;  3CCQ A;  1HNW L;  3R3O A;  2E2H B;  1S72 A;  2NUC A;  1JWM D;  3CCJ A;  1PRT D;  4DXF A;  4R4O A;  2SOB A;  3G71 A;  1IW7 C;  1EY6 A;  3BDL A;  5C4J H;  3MEH A;  2Z8L A;  4KHP Q;  4FF2 A;  2HT1 A;  1ILP A;  3M3Y H;  4WRD A;  4DV2 Q;  2VB3 X;  5CV4 A;  1U9R A;  4EQN A;  4J1M A;  5J1Z A;  3PO3 H;  3E5S A;  3J81 j;  2UXC L;  2I5M X;  5T1I A;  1FGU A;  3GTL B;  3U9O A;  1Y8N B;  2KVM A;  5LL6 S;  1X9N A;  3CMA A;  1Q8I A;  1XWE A;  1EU4 A;  4WFN 3;  2DY8 A;  3KDF B;  1SAP A;  5M3F G;  3HOX B;  3NP8 A;  3S15 B;  2RA4 A;  1A6X A;  4A93 B;  2QF7 A;  2OQ0 A;  5IE8 A;  3K7A H;  4BXX H;  5LMN W;  5ELC A;  1Q1E A;  1RHP A;  2L15 A;  3D4W A;  1I6H B;  2RDG A;  4QMG A;  2CW0 C;  4A3D G;  4LMQ D;  2NTT A;  3HOY H;  2F4V L;  1RDP D;  1PA6 A;  1DOM A;  1YHA A;  1S5B D;  5C0X G;  1Y1W G;  3K5L A;  2EYL A;  2GVB A;  4DR4 Q;  1ZKO A;  3VYT A;  4ODG A;  2B63 B;  4P75 A;  4GKK L;  4IUP A;  2WB1 G;  3S16 B;  2JA8 G;  3TSS A;  1SN8 A;  2I5H A;  4JPB W;  1R9T H;  1N33 L;  1QVG A;  3KLS X;  1HH2 P;  1HRJ A;  4RHR A;  1WYD A;  2K5N A;  3CQZ B;  4JC0 A;  4NMZ A;  4LF8 L;  4LF7 Q;  1PZI D;  2K28 A;  1MIU A;  2QEX A;  4LF6 L;  1Y1V B;  1O7Y A;  3HOW B;  3K0X A;  4PV1 C;  2EPB A;  1G8Z D;  2NBF A;  2IX3 A;  1TS5 A;  4IFD H;  2G5D A;  4HSP A;  4A3I G;  3QIA A;  3RZO B;  1TU2 B;  3ULJ A;  3CAM A;  4DV3 Q;  3KYH C;  3GTQ B;  1D6E C;  3I4M H;  1G51 A;  1N9W A;  1PH9 A;  4U67 3;  1CTM A;  1KTK A;  4C2M H;  3CD6 A;  1PH8 A;  3M85 A;  2A6E D;  3FP9 A;  2R92 G;  4DN4 M;  4WJ3 M;  1YIJ A;  2K5W A;  5IT9 c;  2VNU D;  3CCM A;  2UXD L;  4DUY Q;  4ABN A;  5IT9 E;  3HOV H;  2ZTD A;  2H5X A;  3DWP A;  1C9O A;  4POG A;  2F3W A;  2UU9 L;  4KI0 A;  3C1F A;  4F8M A;  2HQE A;  3TP5 A;  5BN3 A;  4A3B G;  3BYT B;  3I4L A;  1NMF A;  4A3J B;  2A68 C;  1XTD A;  4YHH Q;  1WTO A;  4K2L A;  2YU9 B;  5KNB A;  3IFT A;  4UHV A;  4OX9 Q;  4JCV E;  3CXC A;  1S5D D;  4GN4 B;  5EBD A;  1PTO B;  4A3F B;  3URY A;  1SMY C;  2IX1 A;  1H9S B;  1TY2 A;  4G7O C;  1GO3 E;  2MGS A;  2CWA A;  3MEF A;  1ZYR C;  2LY7 A;  2AQ3 B;  2BDN A;  4IAL A;  1BDO A;  1SEB D;  1PYW D;  1X65 A;  1PZK D;  3D6W A;  1K0S A;  1M1K C;  2EJF C;  4A76 A;  1X6O A;  1NTG A;  1A2T A;  3I3C A;  3H15 A;  1D5X C;  2EJG C;  1EU3 A;  1EZ6 A;  4WOR A;  4A3M G;  4K5X A;  3T16 A;  4IUU A;  2NZ1 D;  3DMU A;  5M5X B;  5K36 H;  1A3V A;  1MGS A;  1KD1 C;  2AQ2 B;  1OXS C;  2VY3 A;  3BDC A;  5FLX E;  2NWG A;  2EXZ A;  1XMO Q;  1HTL D;  4JOI A;  1BBW A;  2FFK B;  1WTW A;  4LF4 Q;  3UE0 A;  2M2L A;  3S1Q B;  4Q0F A;  4DKA C;  2JA5 B;  4G7H C;  3CW2 C;  1H9R A;  4K6L A;  4RH6 A;  4GKJ Q;  5C44 B;  3HKZ E;  3D6C A;  3EN2 A;  2NVX H;  5J22 A;  3CCL A;  3IAY A;  5FK9 C;  5FKA C;  3E0J A;  1UWV A;  1KAB A;  4B9W A;  2XVS A;  4TKO B;  3NTK A;  1WJJ A;  2QEJ C;  3FKI H;  4OWT B;  4C3J H;  4DR3 Q;  3F2U A;  2XSC A;  3E9I A;  1PFB A;  2F4I A;  2Z6K C;  3OYY A;  2ZT9 C;  1SYC A;  1JWU D;  4OIJ A;  1TWC B;  3CC7 A;  3ZYY X;  3K5O A;  1SFO B;  4X3K A;  1ENF A;  3NUC A;  2KJX A;  2B2W A;  4DV2 L;  2ZXP A;  2V1C C;  4GOP A;  5DEH A;  5C6A A;  4BS9 A;  2YTV A;  1GVP A;  4DF7 A;  1JIC A;  3T1H Q;  1VQA A;  1FD7 D;  4KMU C;  4DR6 L;  3RNU A;  2CHB D;  1TS3 A;  5CC4 A;  4BBR B;  1IYU A;  3BJU A;  4CKE A;  5COR A;  3PIO A;  5KEE A;  1EIF A;  3ZJY C;  3L2P A;  2G9D A;  4X65 Q;  1K8O A;  1H9M A;  4DR5 Q;  1E7Z A;  1GUG A;  3WOE A;  1ENA A;  4C1N I;  4LUV A;  2K04 A; 
#chains in the Genus database with same CATH homology
 4A3L H;  2K14 A;  3CPF A;  4A3B G;  4IJL A;  3ULL A;  1V1Q A;  1X3F A;  2AHO B;  4DR4 L;  3DM3 A;  2JA9 A;  2B29 A;  1QUQ A;  3F1Z A;  3OTO Q;  2VQE L;  2ZJR A;  2ES2 A;  2NZH A;  4MNO A;  4UP9 A;  4DR3 L;  1VQ8 A;  1CSP A;  3GTP H;  2ZTE A;  4EQ5 A;  5M3M G;  1RL2 A;  1PHJ A;  3I7F A;  5ELN A;  4DUZ L;  1X3E A;  4DV7 L;  2ZJP A;  4JI4 L;  3LGJ A;  4JV5 Q;  4OO1 I;  2D62 A;  2ALY B;  4LW1 A;  1HJP A;  1PH5 A;  5IP9 G;  3W1G A;  1KRS A;  2PQA B;  3U4V A;  1PH1 A;  4X6A H;  3ER0 A;  1JE5 A;  1YHB A;  1GM5 A;  1I94 Q;  2IY5 B;  2JA5 G;  4IFD G;  3CME A;  4A93 G;  2B3G A;  2K50 A;  1VCI A;  3CCU A;  4DV0 L;  2Y0S E;  1QZH A;  3FHW A;  1VQO A;  4KHZ A;  4MZ9 A;  4DR2 L;  2YTY A;  5C44 G;  4C3H H;  4R4T A;  4DAY B;  3CCS A;  1NJI C;  3I4M G;  2VQF Q;  4LWC A;  4UPA A;  4HJ9 A;  1FJG L;  3TRZ A;  4X64 L;  1C0A A;  4HJ8 A;  1KHI A;  1UEB A;  2YV5 A;  1JJG A;  4DV3 L;  4IOA A;  4JI8 Q;  4IPC A;  1J5E Q;  2E2J H;  1PYS B;  1K8G A;  1YIT A;  5J3B A;  1E1O A;  2UUC L;  5M3F H;  3GTG H;  3HOV G;  1HNX L;  2JE6 I;  1A63 A;  2MQH A;  2WFW A;  2F4V Q;  2CFM A;  1VQH A;  3KF6 A;  1J6Q A;  4X65 L;  1D7Q A;  3W5O A;  4DR5 L;  4X62 L;  2VS1 A;  3M4P A;  1MKH A;  3PUV A;  4BY1 G;  4JI3 L;  4A3D H;  1X55 A;  4DUY L;  4AQY Q;  4JI2 L;  4GKK Q;  4A3C H;  4Y7N H;  3IRB A;  1WFQ A;  1Y1V G;  2LSS A;  2RHQ B;  2PQA A;  1UE5 A;  1V43 A;  2HIV A;  1Y1W H;  4NB3 A;  4DV6 L;  1K73 C;  3H0G G;  3JAM i;  3J81 c;  2R7D A;  3HKZ G;  3STB C;  1V9P A;  4C3I H;  2FXQ A;  1UE6 A;  1AE2 A;  2Q2T A;  1CUK A;  1L1O C;  4NXN Q;  1XNR Q;  2JA8 H;  1XMQ Q;  5IYD G;  3T1Y Q;  4BBR G;  2K4K A;  4R4Q A;  4LF6 Q;  1K83 H;  1VQP A;  2RHS B;  2YTX A;  3EBE A;  4GNX C;  1PH4 A;  2CWP A;  2OTL A;  2KCT A;  4B3S L;  1VS0 A;  4BY7 H;  1G6P A;  3UE1 A;  1YNX A;  1P16 A;  1A62 A;  2AMC B;  3PUZ A;  4P74 A;  3S1N H;  3L0O A;  3M9B A;  4OO1 G;  3Q8D A;  5FLM G;  1I3Q H;  2VQF L;  4DPG A;  2F3I A;  2C35 B;  4QY7 A;  1HZB A;  2DUD A;  2OCE A;  3HOU H;  2ASB A;  2E8G A;  1YJN A;  3G48 A;  1QZG A;  2I5L X;  3PCO B;  1SLJ A;  3JC6 6;  1AE3 A;  2R7Z H;  1CKN B;  1OXU A;  1D8L A;  1KXL A;  3PGZ A;  3S2H H;  1WCM H;  4A3I H;  4B3R L;  1J5E L;  3HOZ G;  1YI2 A;  1QUQ B;  4PZ6 A;  4KLK A;  1ASZ A;  4HJ7 A;  3PV0 A;  3S15 H;  2JA6 H;  3SGI A;  5K36 G;  3PSI A;  2UXD Q;  1TXY A;  5JEA G;  4LNQ A;  1K3R A;  5JJI A;  4JI1 Q;  3S1R H;  1WOC A;  2ZM6 L;  4AYB E;  4DNI A;  4B3T Q;  3J80 i;  1JMC A;  2R92 H;  2PI2 A;  3EIV A;  2RCN A;  1UE1 A;  1GD7 A;  1L2F A;  2D0P A;  5GAD C;  2ZTC A;  4AQY L;  1B7Y B;  2NVQ H;  2CCZ A;  2NZO A;  4B3M Q;  4JI6 L;  3RLF A;  1SMX A;  4J15 A;  3OW2 A;  1XMO L;  2GVA A;  2E5L Q;  4R4I A;  1Q82 C;  2ATW A;  1Z47 A;  3RN2 A;  1N36 Q;  2IHF A;  1TWH H;  3PF5 A;  2VUM G;  3S1M H;  4LF4 L;  1N32 Q;  4A3B H;  3UDG A;  5FJ8 H;  3GTL H;  3F2B A;  4A75 A;  1IBK L;  5IYB H;  2WAQ G;  4L5T A;  4NXN L;  3PUX A;  4AH6 A;  4DV5 Q;  4TQU S;  5BR8 Q;  2PMZ E;  4A4I A;  4GKJ L;  3FKI G;  4K0K L;  3K8A A;  1P8L A;  4X66 Q;  4JOI C;  3NEL A;  1YBY A;  5C3E H;  3HOX H;  1PH6 A;  1KC8 C;  1QVC A;  2WAQ E;  4QIW E;  5LMU L;  3D31 A;  4OXP A;  3F8T A;  1ASY A;  1VQG A;  4JYA Q;  1CKN A;  3ULP A;  4JG2 A;  1HR0 L;  4DV4 L;  2I0Q A;  2IHE A;  4NXM Q;  3KF6 B;  4OON A;  4JBM A;  1T9H A;  4GLA C;  2Q2I A;  4BA1 I;  3B6Y A;  5IYC G;  2OWO A;  1I6H H;  4JI0 L;  1NBW A;  1JJC B;  2RF4 A;  5C4X H;  1VQN A;  4LF5 Q;  4A3E H;  2Q2H A;  3GTM H;  3J81 i;  2CKZ B;  4A3K H;  1IZ6 A;  2Y0S G;  5E7N A;  4LUO A;  4PZ7 A;  1Q81 C;  2JA7 H;  1JJ2 A;  3UDF A;  3J7Z C;  4IPH A;  2XTI A;  2A8V A;  2B63 H;  3A5Z B;  1VQK A;  4YCV A;  4JBW A;  3PO2 G;  2UXC Q;  1Q8K A;  3S16 H;  3J80 c;  2KBN A;  4JI1 L;  3RR5 A;  4A3G G;  4JI7 Q;  1VQD A;  2PI2 E;  4B3T L;  2R6G A;  1HNZ L;  1IYJ B;  1E24 A;  4QJF A;  3T1H L;  2Z0S A;  3CQZ H;  2UUA Q;  1TWF H;  4GN3 B;  4A3M H;  4BA2 I;  2VL6 A;  4B3M L;  2HIX A;  3BZK A;  1W2B A;  2E5L L;  4BBS G;  1L0W A;  4GOP C;  5C0X I;  1M90 C;  2DGY A;  1Y1V H;  1YVC A;  1VQB A;  3U4Z A;  1N36 L;  5H1S E;  1VQJ A;  2N78 A;  3HOW H;  1VQ6 A;  2UXB Q;  5GAH C;  4QGU A;  4IOC A;  2N8N A;  1XPR A;  4A3L G;  3NEM A;  2XGT A;  2Z6K A;  3NBH B;  4LUZ A;  3RLO A;  1E1T A;  5JEA J;  5BR8 L;  1VQ9 A;  3RZO H;  1I5F A;  1PFS A;  3CF5 A;  1G29 1;  2VZA A;  3GTQ H;  4X66 L;  2UUB L;  2R93 H;  4YWK A;  4OWX B;  5C0X J;  3ICE A;  3AQQ A;  4IPG A;  3CCQ A;  1PH2 A;  1X56 A;  1IBM Q;  1HNW L;  1XJV A;  1S72 A;  1DGS A;  1NMG A;  1K8A C;  1B70 B;  3CCJ A;  1CKM A;  2KHJ A;  1U0L A;  1JB7 A;  3OTO L;  1N33 Q;  4FDB A;  4DR7 Q;  1KAW A;  4R4O A;  3I4O A;  3G71 A;  4KHP Q;  5C4J H;  4JBK A;  4YWL A;  4LF8 Q;  2WP8 J;  5IP7 H;  2JQO A;  1QVF A;  4DV1 Q;  2HT1 A;  4JV5 L;  3E9H A;  3M7N A;  3M3Y H;  5GQO A;  3PF4 A;  4DV2 Q;  2YYZ A;  2K5V A;  2HQL A;  4O0A A;  2OTJ A;  5FLX c;  3PO3 H;  3S2D H;  1I94 L;  3J81 j;  2UXC L;  2I5M X;  1FGU A;  1S3O A;  4A3J H;  4LFC Q;  1KL9 A;  3DLL A;  1SRU A;  4HJ5 A;  1EUJ A;  4P73 A;  1X9N A;  3MXN B;  1SRO A;  1NY4 A;  3KOJ A;  3CMA A;  3F2D A;  2YU9 H;  4QQB X;  3I2Z A;  4GS3 A;  3GO5 A;  3I4N H;  2VW9 A;  3KDF B;  3KF8 B;  5M3F G;  5IWA Q;  4UP7 A;  2QA4 A;  3CCV A;  4PZ8 A;  4A3F H;  2OQ0 A;  5IE8 A;  3K7A H;  4BXX H;  5LMN W;  4JI8 L;  4YY3 Q;  1Q1E A;  5LMN Q;  2L15 A;  4AYB G;  1PV4 A;  2UXB L;  1U5K A;  4A3D G;  3CPW A;  3RLN A;  4A3C G;  2E2H H;  3GD7 A;  3HOY H;  5GAG C;  2F4V L;  4MTN A;  1PA6 A;  1YHA A;  1SE8 A;  4ME3 A;  1X3G A;  5C0X G;  1Y1W G;  1PH3 A;  2UU9 Q;  2GVB A;  4DR4 Q;  4NPS A;  1EOV A;  1MJC A;  3STB D;  4P72 A;  1IBM L;  4LF9 Q;  3M4O H;  4P75 A;  4GKK L;  4DAM A;  5HY6 A;  1IBL Q;  1EYG A;  1EWI A;  2GN5 A;  2WB1 G;  2JA8 G;  3W1B A;  3TS0 A;  1SN8 A;  2I5H A;  4DV7 Q;  4JI4 Q;  3KLW A;  1R9T H;  1N33 L;  1QVG A;  4BY7 G;  4DK3 C;  3H3V H;  2CQO A;  1A8V A;  1HH2 P;  1VQL A;  1VQC A;  2A1A A;  5M5W H;  5IYC H;  4KHP L;  3GDE A;  1WYD A;  2K5N A;  2WB1 E;  4JC0 A;  5M5X H;  4LF8 L;  1XNQ Q;  3HKS A;  5M3M H;  4LF7 Q;  4DV0 Q;  1XNR L;  3J7A 5;  1XMQ L;  3T1Y L;  4DR2 Q;  1MIU A;  2QEX A;  3WWV A;  4LF6 L;  1KRT A;  1N8R C;  3KDF A;  1N34 Q;  3HOU G;  3ERS X;  5IP9 H;  2BH8 A;  3HFZ B;  3TRE A;  3KJO A;  2F52 A;  3K0X A;  3AYH B;  5ELO A;  1YHQ A;  1VQ5 A;  1E3P A;  4IO9 A;  3S1Q H;  2N3S A;  4LFC L;  3VDY A;  2JA5 H;  2R7Z G;  3S14 H;  4A93 H;  1EQQ A;  2MNA A;  1WCM G;  4A3I G;  1K0R A;  4JI5 Q;  1PYB A;  3ULJ A;  3CAM A;  5HGQ A;  2JEB I;  4DV3 Q;  3KYH C;  1EFW A;  1XPU A;  5C44 H;  1Z9F A;  2JA6 G;  2LXK A;  1G51 A;  1N9W A;  2BA1 A;  1PH9 A;  3I4M H;  1WI5 A;  3G4S A;  1LM0 A;  2UUC Q;  3PIP A;  4C2M H;  1HNX Q;  1PH8 A;  3CD6 A;  3F2C A;  3M85 A;  3FP9 A;  2R92 G;  1RIP A;  1YJ9 A;  4WJ3 M;  3BU2 A;  1YIJ A;  1VQ7 A;  5IT9 c;  2IT1 A;  2MO1 A;  2VNU D;  4JBJ A;  3CCM A;  4XTC S;  2LXJ A;  2UXD L;  1OTC A;  4JI3 Q;  2PNH A;  4DUY Q;  1VQM A;  4JI2 Q;  2KEN A;  3HOV H;  1L1O A;  2JK8 A;  2ZTD A;  3K81 C;  2H5X A;  2JEA I;  1C9O A;  2K52 A;  3RN5 A;  4POG A;  2UU9 L;  4KI0 A;  4GNX A;  1PVO A;  3AFP A;  4DV6 Q;  3TS2 A;  1X54 A;  2AKW B;  4LF9 L;  4IPD A;  1TWC H;  3UDI A;  5FJ8 G;  1NMF A;  1IBL L;  4RG1 A;  3L7Z C;  5IYB G;  4UY8 C;  3GTK H;  3A5U A;  4BY1 H;  1SFO H;  1OXV A;  1XTD A;  4YHH Q;  2NVT H;  2AWN A;  3CP0 A;  3TEH B;  4APV A;  3I55 A;  5C3E G;  1NE3 A;  3HOX G;  4B3S Q;  1HZC A;  4OX9 Q;  4DR1 Q;  1N32 L;  4JCV E;  3H0G H;  3CXC A;  4GN4 B;  4RMF A;  4LF7 L;  3RZD H;  1XNQ L;  4HIK A;  4DV5 L;  1GKH A;  1E22 A;  3PUY A;  2IX1 A;  1VQI A;  5IYD H;  1N34 L;  3A74 A;  4BBR H;  4LFB Q;  1VQE A;  1YEZ A;  5C4X G;  2EXD A;  4A3E G;  5DLQ E;  4Y52 H;  4HIO A;  4JYA L;  1GO3 E;  1YZ6 A;  2ZJQ A;  4OWW B;  1IL2 A;  4A3K G;  3NEN A;  2JA7 G;  2CWA A;  3MEF A;  4JI5 L;  1SR3 A;  4NXM L;  1O7I A;  2B63 G;  4B3R Q;  3I56 A;  4IJH A;  5FLM H;  1X65 A;  5IY0 A;  1M1K C;  4LF5 L;  1KIX A;  4A76 A;  5AJ3 Q;  1X6O A;  4O2D A;  2KCM A;  4L5Q A;  2JJQ A;  2OQK A;  1UE7 A;  2MO0 A;  2ZM6 Q;  1NTG A;  2D0O A;  1K9M C;  3H15 A;  1JT8 A;  4QL5 A;  3HOZ H;  2AWO A;  4A3M G;  3GTO H;  4DR6 Q;  2HHH Q;  1W3S A;  2NVY H;  1KD1 C;  1CSQ A;  5GAE C;  2VY3 A;  1OXS C;  1OXX K;  4PMW A;  4JI6 Q;  4JI7 L;  3CC2 A;  1H95 A;  3GTJ H;  4GOP B;  5GRO A;  1XMO Q;  1Q86 C;  2E2I H;  3HOW G;  3CCE A;  1CKO A;  1LUZ A;  1AH9 A;  4JOI A;  1BBW A;  2ID0 A;  2K5H A;  2QGQ A;  1Q1B A;  4R4C A;  3CCR A;  1BBU A;  2NN6 I;  2UUA L;  4LF4 Q;  3E0E A;  3UE0 A;  4DKA C;  4YHH L;  1IBK Q;  3CW2 C;  4GLV B;  1LYL A;  2R7F A;  3D0F A;  4L5R C;  5EAY A;  3H3V I;  4LFA Q;  2R93 G;  4GKJ Q;  1XPO A;  4TVA B;  3HKZ E;  4OX9 L;  1HZ9 A;  3EN2 A;  4DR1 L;  2NVX H;  3CCL A;  1EQR A;  2VUM H;  1I50 H;  2EIF A;  3CC4 A;  5LMU Q;  1PH7 A;  1OXT A;  1UWV A;  1HR0 W;  1HR0 Q;  4AIM A;  4DV4 Q;  4POF A;  4LFB L;  3M4Q A;  1YJW A;  1Y14 B;  1WJJ A;  3FKI H;  4OWT B;  2VQE Q;  4C3J H;  4JI0 Q;  3BZC A;  4ALP A;  4DR3 Q;  4IFD I;  5IP7 G;  4H02 A;  3E9I A;  4DUZ Q;  2Z6K C;  1KQS A;  4EX5 A;  3G6E A;  1L1O B;  4PG3 A;  4YWM A;  3OYY A;  4P71 A;  3UDX A;  1HZA A;  3PUW A;  4DR7 L;  2MFI A;  3PO3 G;  4XIG S;  2BA0 A;  4GNX B;  4HJA A;  5JJK A;  1BVS A;  1A0I A;  3CC7 A;  4A3J G;  5AJ3 L;  4DV1 L;  4YCU A;  4HIM A;  1MJE A;  4IFD J;  3KJP A;  2Q2U A;  2KHI A;  3A0J A;  3AFQ A;  4DV2 L;  4GOP A;  2V1C C;  4UP8 A;  2BH2 A;  3I4N G;  1HNZ Q;  3S17 H;  5JJL A;  2YTV A;  1GVP A;  3T1H Q;  1VQA A;  2IX0 A;  3K7U C;  2HHH L;  4DR6 L;  1FJG Q;  4X64 Q;  3RNU A;  3PO2 H;  4A3F G;  4DK6 C;  3S24 A;  1IXR A;  3AEV A;  4BXX G;  3JAM c;  1C7Y A;  4A3G H;  4L5S A;  2N49 A;  3K80 C;  2A19 A;  1Q7Y C;  1FL0 A;  1FVI A;  3BJU A;  5IWA L;  1VQ4 A;  4WJ4 A;  3HOY G;  3PIO A;  1TWG H;  2EQS A;  1BKB A;  2K75 A;  4R1J A;  1VQF A;  1EIF A;  1TWA H;  1S40 A;  4HID A;  4YCW A;  4LFA L;  3ZJY C;  3L2P A;  4YY3 L;  5M5Y H;  4BBS H;  5LMN L;  3KFU A;  4K0K Q;  4X65 Q;  1LTL A;  3U50 C;  1Q46 A;  3U58 A;  2UUB Q;  4DR5 Q;  4X62 Q;  4GN5 A;  3TQY A;  1E7Z A;  1Q12 A;  1HNW Q;  1EIY B;  4GLX A;  2NN6 G;  4LUV A;  1B8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...