5IYCK

Human core-pic in the initial transcribing state
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
117
Chain Sequence
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna
total genus 29
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5iycK00
5C3EC 4BBSK 3K7AK 2NVQK 1TWFC 3CQZC 3H0GK 3RZDK 1Y1WC 2JA6K 4QIWL 2E2HC 2B63K 3S2HK 3GTOC 4QIWD 4C3JK 5C3EK 1BDFA 1SFOC 4YG2A 1TWFK 2E2JC 3S1NC 5C44K 3GTMK 4A3DC 5TMCA 1TWHK 5IYCC 2E2HK 4C2MK 4A3LC 3GTOK 5M3FK 3S1MC 2R7ZC 2Y0SL 4Q5SA 5IYBC 1I3QK 4XLPA 1Y1VC 1SFOK 4A3MC 2Y0SD 4Q4ZA 4A3DK 3S1RC 2CW0A 3HOXC 4MEXA 5IYCK 5IYDC 3GTLC 4MEYA 3HOWC 4OINA 2JA5K 3S1MK 2R7ZK 5IYBK 4A3IK 2A68A 1Y1VK 4A3MK 2NVYK 2JA7K 1WCMC 3S15C 3S2DC 4OIQA 3S1RK 3GTLK 4ZH4A 5C4JC 4OIPA 4A3JC 5IYDK 3FKIK 3S16C 2A69A 2R92C 4XSXA 1HQMA 3DXJA 3GTGC 4A3CK 3I4NC 5C4XC 4A3FC 2R93K 1WCMK 1TWCC 3HKZL 1I6HC 3PO2C 2JA8C 4BY7C 4A3JK 3HKZD 1I6VA 3CQZK 4QJVB 4AYBL 3GTKC 1YNJA 3S16K 1Y1WK 4A3BC 3GTGK 4AYBD 5C4XK 4A3FK 1TWGC 3GTPC 1TWCK 2WAQL 3PO2K 4MQ9A 2JA8K 5IP9C 4A3GC 2E2JK 3S1NK 4Y7NC 3GTKK 2WAQD 2PMZL 4A3BK 4LLGA 4LK0A 2A6EA 4JK1A 3I4MC 2PMZD 4KN4A 3GTQC 4A3LK 4C3HK 2NVTC 1TWGK 1YNNA 4QJVA 5FLMC 4A3GK 5IP9K 1ZYRA 4YFNA 2WB1L 4YFXA 4BY1C 3PO3C 3GTJC 3HOXK 3I4MK 3HOUC 3GTQK 2WB1D 3HOWK 3M4OC 2PA8L 2NVTK 3H3VL 4BXXC 5M5YK 1K83C 5FLMK 2PA8D 3H3VD 1I50C 2VUMC 1R9TC 4LK1A 4G7HA 3S15K 3S2DK 4BY1K 3PO3K 3GTJK 3RZOC 3HOUK 5C4JK 3S1QC 2O5IA 3EQLA 4KMUA 4A3EC 2R92K 4X6AC 1I50K 3I4NK 2VUMK 3K7AC 2NVQC 4A3KC 3S14C 1I6HK 4BY7K 4YFKA 3RZOK 2JA6C 3HOYC 3S2HC 3HOZC 3S1QK 3HOVC 1XPPA 4X6AK 3M3YC 5IP7C 4G7OA 3GTPK 4A3KK 3S14K 5C44C 3GTMC 4GZYA 4Y7NK 1SMYA 2A6HA 4BBRC 1TWHC 2NVXC 2YU9C 4OIRA 3HOYK 3HOZK 3HOVK 4A93C 2PPBA 3M3YK 5IP7K 4XLNA 1I3QC 4Y52C 2BE5A 5M5WK 4G7ZA 1TWAC 4OIOA 1IW7A 2NVXK 3WODA 4BBRK 5D4DA 2YU9K 4KN7A 4A93K 3M4OK 2JA5C 4A3IC 4BXXK 3S17C 4C3IK 1K83K 2NVYC 2E2IC 2JA7C 1TWAK 2R93C 4Y52K 4XSZA 5M5XK 1R9TK 4BBSC 4LJZA 2O5JA 3FKIC 3H0GC 4NOIA 3RZDC 5M3MK 5FJ8K 2B63C 3S17K 4A3CC 2E2IK 4A3EK 5TMFA
chains in the Genus database with same CATH superfamily
4BBSK 3K7AK 5L46A 3CQZC 1USMA 3JSTA 2B63K 3GSIA 3GTOC 1BDFA 1SFOC 1TWFK 1XXBA 1DCOA 3TFIA 2ZFZA 2D6FC 1Y1WA 1TWHK 4GTAA 1V5VA 1Y1VC 3GTKA 4Q4ZA 4A3DK 5CJ9A 3S1RC 4MEXA 1ISEA 3HOWC 3GEIA 4KMDA 3G4CA 5IOTA 4OINA 2R7ZK 4A3MK 4KB2A 2NVYK 3Q3QA 1WCMC 3S2DC 1XZPB 1AB4A 5IYDK 3S16C 2A69A 2R92C 2W7VA 4XSXA 1TWCC 4FZBA 3CAGA 4A3JK 1I6VA 3CQZK 4KB4A 3A8JA 4WJ3M 3PO2K 2PMZL 3A8KA 1C0AA 2A6EA 2PMZD 4KN4A 3GTQC 4LOWA 4KM8A 2NVTC 5FLMC 4YFXA 1BJTA 4BY1C 3HOWK 4BXXC 5M5YK 1I50C 3S2DK 3GTJK 1O25A 3HOUK 1X31C 3S1QC 2XCQA 3AQOA 4KMUA 4A3EC 4G0UA 1TWAA 2R92K 2VUMK 1R9TA 1F7UA 2NVQC 1WQFA 1BGWA 4AH6A 4BLAA 4RMFA 3HOZC 3LAJA 1XPPA 4X6AK 2GAHC 4KASA 4C3JC 4P5AA 3LAPA 3S14K 1DCHA 3GTMC 4GZYA 1F93A 1DCPA 3HOYK 2JA6A 4C2MC 4A93C 1WIHA 5IP7K 4XLNA 4GTFA 2NVXK 4BBRK 1IQ0A 1IL2A 3GTOA 2JA5C 4BXXK 1I3QA 1SFOA 1JVIA 2JA7C 5M5XK 5EGEA 4BBSC 1WSRA 2O5JA 3FKIC 2JH3A 2B63C 1Y1VA 3S17K 4A3CC 4A3EK 5TMFA 2PHCB 2NVQK 1TWFC 4C45A 3RZDK 2R93A 4C3JK 5C3EK 4KMHA 3S1NC 3GTMK 4A3DC 4FM9A 1B4AA 4C2MK 1WQHA 2R7ZC 4Q5SA 4A3MC 3OEPA 5IYCK 5IYDC 2JA5K 5IYBK 2A68A 2JA7K 3ADAC 1RU0A 4OIQA 3GTLA 4A3JC 4OIPA 3GTQA 3FKIK 3MMLB 4A3CK 1WSVA 3HKZL 4KARA 3PO2C 1GE9A 3HKZD 4O2DA 1PJ5A 4J3NA 3GTGK 1XZQB 1I50A 4A3FK 4GTLA 4KAWX 2WAQL 3S1NK 4Y7NC 2WAQD 4A3BK 3IPJA 4LLGA 1TWGK 3GTPA 1YNNA 3T02A 4A3GK 3GDZA 3SZYA 4YFNA 2WB1L 1PJ6A 4KMAA 3GTJC 3HOUC 2WB1D 1EH1A 2PA8L 3N0CA 4C3IC 2PA8D 2VUMC 2GSUA 4GFQA 2RH6A 1WQGA 1K83A 4XCHA 1J98A 5JFEA 4X6AC 2V6SA 3S14C 2XCRB 4YFKA 4KM9A 3HOYC 5IP7C 5C44C 4Y7NK 1SMYA 2A6HA 4BBRC 2NVXC 4OIRA 2B63A 1IS1A 1IBAA 1EK8A 2PPBA 5E68A 4WJ4A 1TWFA 1J6WA 2BE5A 4G7ZA 4ILDA 2YU9K 1TWHA 1WOPA 4KN7A 1YX2A 1ZQ1C 3S17C 4C3IK 2FQTA 1KQ4A 1WORA 1O2BA 2CFAA 1VGXA 4LJZA 5HL8A 4KC6A 3RZDC 2E2IK 2NVYA 5C3EC 3AD8C 3H0GK 1Y1WC 4GTCA 1YCLA 1XXCA 4WILA 4YG2A 2E2JC 3BP3A 3LPXA 5C44K 3CQZA 5TMCA 2E2HK 5IYCC 2EBBA 2RGRA 5IYBC 1EI6A 3ERED 2CW0A 1ZXOA 3HOXC 3AD9C 3S1MK 1F9NA 4KATA 1PJ7A 3GTLK 4ZH4A 5C4JC 4LR2A 3SZZA 3GTGC 3I4NC 4P9SA 1O28A 4A3FC 1WCMA 1I6HC 4BY7C 3GTJA 4QJVB 4A3BC 1Y1WK 3TTGA 2R92A 5C4XK 2VUMA 1O29A 1O27A 1TWGC 1VRQC 3G4AA 1TWCA 4MQ9A 2JA8K 4A3GC 2E2JK 1VJEA 3GTKK 1EFWA 4JK1A 5IORA 1JOEA 3VA7A 5IP9K 4BLBA 3TFJA 3HOXK 3I4MK 4GTBA 3H3VL 1ZBSA 2GAGC 1ZVUA 3H3VD 1R9TC 4LK1A 4G7HA 4G0VA 3PO3K 1O2FB 3AH5A 5C4JK 2O5IA 4PAAA 1XZPA 2V6UA 3I4NK 3T00A 3V4GA 1I6HK 4BY7K 3RZOK 2JA6C 1J6VA 3S2HC 1J6XA 3GIRA 4A3KK 5CHPA 2YU9C 3HOVK 3GEEA 3FHZA 3M3YK 3N0BA 1I3QC 5M5WK 4G0WA 3GTMA 1IW7A 3OREA 3WODA 5D4DA 2ZUEA 4A3IC 5TJ3A 1O24A 4Y52K 2E2IC 1TWAK 4XSZA 5JVOA 1R9TK 3L4JA 3H0GC 4NOIA 4LQYA 5M3MK 2JA5A 5FJ8K 1B4BA 3FOFA 2GSNA 2R93C 2JA7A 2V6TA 3GEHA 3FKIA 2JA6K 4QIWL 2E2HC 3S2HK 1L0WA 1O26A 4QIWD 5IOSA 1G51A 2P5MA 1F7VA 1WOSA 3GTGA 4A3LC 4C3HC 3GTOK 5M3FK 4KDDA 3S1MC 2Y0SL 3QX3A 4XLPA 1I3QK 1SFOK 2Y0SD 4GTEA 3GTLC 4MEYA 1TWGA 2R7ZA 1HI9A 4A3IK 1Y1VK 3S15C 3S1RK 1EQRA 2Y3PA 3A8IA 2ZUFA 4P5BA 1HQMA 3DXJA 5EGHA 5C4XC 2R93K 1WCMK 2FQOA 3HXAA 2JA8C 3BP8C 3GTKC 4AYBL 1VH2A 3S16K 1YNJA 3AQPA 4BKWA 4AYBD 1WOOA 3GTPC 1TWCK 5IP9C 2GSOA 1IE0A 4LK0A 3I4MC 4DDQA 1USOA 4C3HK 4A3LK 3BUEA 4QJVA 3AD7C 1ZYRA 2CFAB 3PO3C 1VLOA 3GTQK 3M4OC 2NVTK 1K83C 5FLMK 2KWAA 5IOQA 1DD5A 2YU9A 3S15K 1INNA 4BY1K 3RZOC 4GTDA 3EQLA 1XXAA 1I50K 3NUHA 3K7AC 4A3KC 1UV7A 3OPFA 3S1QK 3HOVC 1BS2A 2E2IA 3M3YC 3S0XA 4G7OA 3GTPK 3H0GA 1XZQA 4PABA 1TWHC 3HOZK 3N3YA 4Y52C 1TWAC 4OIOA 4GT9A 2NVXA 2E2HA 2P8TA 4M1XA 4A93K 3TFHA 2XCOA 3M4OK 3L4KA 3T01A 1K83K 2NVYC 1O2AA 1JQWA 3FOEA
chains in the Genus database with same CATH topology
5C3EC 4BBSK 3K7AK 2NVQK 1TWFC 3CQZC 3H0GK 3RZDK 1Y1WC 2JA6K 4QIWL 2E2HC 2B63K 3S2HK 3GTOC 4QIWD 4C3JK 5C3EK 1BDFA 1SFOC 4YG2A 1TWFK 2E2JC 3S1NC 5C44K 3GTMK 4A3DC 5TMCA 1TWHK 5IYCC 2E2HK 4C2MK 4A3LC 3GTOK 5M3FK 3S1MC 2R7ZC 2Y0SL 4Q5SA 5IYBC 1I3QK 4XLPA 1Y1VC 1SFOK 4A3MC 2Y0SD 4Q4ZA 4A3DK 3S1RC 2CW0A 3HOXC 4MEXA 5IYCK 5IYDC 3GTLC 4MEYA 3HOWC 4OINA 2JA5K 3S1MK 2R7ZK 5IYBK 4A3IK 2A68A 1Y1VK 4A3MK 2NVYK 2JA7K 1WCMC 3S15C 3S2DC 4OIQA 3S1RK 3GTLK 4ZH4A 5C4JC 4OIPA 4A3JC 5IYDK 3FKIK 3S16C 2A69A 2R92C 4XSXA 1HQMA 3DXJA 3GTGC 4A3CK 3I4NC 5C4XC 4A3FC 2R93K 1WCMK 1TWCC 3HKZL 1I6HC 3PO2C 2JA8C 4BY7C 4A3JK 3HKZD 1I6VA 3CQZK 4QJVB 4AYBL 3GTKC 1YNJA 3S16K 1Y1WK 4A3BC 3GTGK 4AYBD 5C4XK 4A3FK 1TWGC 3GTPC 1TWCK 2WAQL 3PO2K 4MQ9A 2JA8K 5IP9C 4A3GC 2E2JK 3S1NK 4Y7NC 3GTKK 2WAQD 2PMZL 4A3BK 4LLGA 4LK0A 2A6EA 4JK1A 3I4MC 2PMZD 4KN4A 3GTQC 4A3LK 4C3HK 2NVTC 1TWGK 1YNNA 4QJVA 5FLMC 4A3GK 5IP9K 1ZYRA 4YFNA 2WB1L 4YFXA 4BY1C 3PO3C 3GTJC 3HOXK 3I4MK 3HOUC 3GTQK 2WB1D 3HOWK 3M4OC 2PA8L 2NVTK 3H3VL 4BXXC 5M5YK 1K83C 5FLMK 2PA8D 3H3VD 1I50C 2VUMC 1R9TC 4LK1A 4G7HA 3S15K 3S2DK 4BY1K 3PO3K 3GTJK 3RZOC 3HOUK 5C4JK 3S1QC 2O5IA 3EQLA 4KMUA 4A3EC 2R92K 4X6AC 1I50K 3I4NK 2VUMK 3K7AC 2NVQC 4A3KC 3S14C 1I6HK 4BY7K 4YFKA 3RZOK 2JA6C 3HOYC 3S2HC 3HOZC 3S1QK 3HOVC 1XPPA 4X6AK 3M3YC 5IP7C 4G7OA 3GTPK 4A3KK 3S14K 5C44C 3GTMC 4GZYA 4Y7NK 1SMYA 2A6HA 4BBRC 1TWHC 2NVXC 2YU9C 4OIRA 3HOYK 3HOZK 3HOVK 4A93C 2PPBA 3M3YK 5IP7K 4XLNA 1I3QC 4Y52C 2BE5A 5M5WK 4G7ZA 1TWAC 4OIOA 1IW7A 2NVXK 3WODA 4BBRK 5D4DA 2YU9K 4KN7A 4A93K 3M4OK 2JA5C 4A3IC 4BXXK 3S17C 4C3IK 1K83K 2NVYC 2E2IC 2JA7C 1TWAK 2R93C 4Y52K 4XSZA 5M5XK 1R9TK 4BBSC 4LJZA 2O5JA 3FKIC 3H0GC 4NOIA 3RZDC 5M3MK 5FJ8K 2B63C 3S17K 4A3CC 2E2IK 4A3EK 5TMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3E C;  4BBS K;  3K7A K;  2NVQ K;  1TWF C;  3CQZ C;  3H0G K;  3RZD K;  1Y1W C;  2JA6 K;  4QIW L;  2E2H C;  2B63 K;  3S2H K;  3GTO C;  4QIW D;  4C3J K;  5C3E K;  1BDF A;  1SFO C;  4YG2 A;  1TWF K;  2E2J C;  3S1N C;  5C44 K;  3GTM K;  4A3D C;  5TMC A;  1TWH K;  5IYC C;  2E2H K;  4C2M K;  4A3L C;  3GTO K;  5M3F K;  3S1M C;  2R7Z C;  2Y0S L;  4Q5S A;  5IYB C;  1I3Q K;  4XLP A;  1Y1V C;  1SFO K;  4A3M C;  2Y0S D;  4Q4Z A;  4A3D K;  3S1R C;  2CW0 A;  3HOX C;  4MEX A;  5IYC K;  5IYD C;  3GTL C;  4MEY A;  3HOW C;  4OIN A;  2JA5 K;  3S1M K;  2R7Z K;  5IYB K;  4A3I K;  2A68 A;  1Y1V K;  4A3M K;  2NVY K;  2JA7 K;  1WCM C;  3S15 C;  3S2D C;  4OIQ A;  3S1R K;  3GTL K;  4ZH4 A;  5C4J C;  4OIP A;  4A3J C;  5IYD K;  3FKI K;  3S16 C;  2A69 A;  2R92 C;  4XSX A;  1HQM A;  3DXJ A;  3GTG C;  4A3C K;  3I4N C;  5C4X C;  4A3F C;  2R93 K;  1WCM K;  1TWC C;  3HKZ L;  1I6H C;  3PO2 C;  2JA8 C;  4BY7 C;  4A3J K;  3HKZ D;  1I6V A;  3CQZ K;  4QJV B;  4AYB L;  3GTK C;  1YNJ A;  3S16 K;  1Y1W K;  4A3B C;  3GTG K;  4AYB D;  5C4X K;  4A3F K;  1TWG C;  3GTP C;  1TWC K;  2WAQ L;  3PO2 K;  4MQ9 A;  2JA8 K;  5IP9 C;  4A3G C;  2E2J K;  3S1N K;  4Y7N C;  3GTK K;  2WAQ D;  2PMZ L;  4A3B K;  4LLG A;  4LK0 A;  2A6E A;  4JK1 A;  3I4M C;  2PMZ D;  4KN4 A;  3GTQ C;  4A3L K;  4C3H K;  2NVT C;  1TWG K;  1YNN A;  4QJV A;  5FLM C;  4A3G K;  5IP9 K;  1ZYR A;  4YFN A;  2WB1 L;  4YFX A;  4BY1 C;  3PO3 C;  3GTJ C;  3HOX K;  3I4M K;  3HOU C;  3GTQ K;  2WB1 D;  3HOW K;  3M4O C;  2PA8 L;  2NVT K;  3H3V L;  4BXX C;  5M5Y K;  1K83 C;  5FLM K;  2PA8 D;  3H3V D;  1I50 C;  2VUM C;  1R9T C;  4LK1 A;  4G7H A;  3S15 K;  3S2D K;  4BY1 K;  3PO3 K;  3GTJ K;  3RZO C;  3HOU K;  5C4J K;  3S1Q C;  2O5I A;  3EQL A;  4KMU A;  4A3E C;  2R92 K;  4X6A C;  1I50 K;  3I4N K;  2VUM K;  3K7A C;  2NVQ C;  4A3K C;  3S14 C;  1I6H K;  4BY7 K;  4YFK A;  3RZO K;  2JA6 C;  3HOY C;  3S2H C;  3HOZ C;  3S1Q K;  3HOV C;  1XPP A;  4X6A K;  3M3Y C;  5IP7 C;  4G7O A;  3GTP K;  4A3K K;  3S14 K;  5C44 C;  3GTM C;  4GZY A;  4Y7N K;  1SMY A;  2A6H A;  4BBR C;  1TWH C;  2NVX C;  2YU9 C;  4OIR A;  3HOY K;  3HOZ K;  3HOV K;  4A93 C;  2PPB A;  3M3Y K;  5IP7 K;  4XLN A;  1I3Q C;  4Y52 C;  2BE5 A;  5M5W K;  4G7Z A;  1TWA C;  4OIO A;  1IW7 A;  2NVX K;  3WOD A;  4BBR K;  5D4D A;  2YU9 K;  4KN7 A;  4A93 K;  3M4O K;  2JA5 C;  4A3I C;  4BXX K;  3S17 C;  4C3I K;  1K83 K;  2NVY C;  2E2I C;  2JA7 C;  1TWA K;  2R93 C;  4Y52 K;  4XSZ A;  5M5X K;  1R9T K;  4BBS C;  4LJZ A;  2O5J A;  3FKI C;  3H0G C;  4NOI A;  3RZD C;  5M3M K;  5FJ8 K;  2B63 C;  3S17 K;  4A3C C;  2E2I K;  4A3E K;  5TMF A; 
#chains in the Genus database with same CATH topology
 4BBS K;  3K7A K;  5L46 A;  3CQZ C;  1USM A;  3JST A;  2B63 K;  3GSI A;  3GTO C;  1BDF A;  1SFO C;  1TWF K;  1XXB A;  1DCO A;  3TFI A;  2ZFZ A;  2D6F C;  1Y1W A;  1TWH K;  4GTA A;  1V5V A;  1Y1V C;  3GTK A;  4Q4Z A;  4A3D K;  5CJ9 A;  3S1R C;  4MEX A;  1ISE A;  3HOW C;  3GEI A;  4KMD A;  3G4C A;  5IOT A;  4OIN A;  2R7Z K;  4A3M K;  4KB2 A;  2NVY K;  3Q3Q A;  1WCM C;  3S2D C;  1XZP B;  1AB4 A;  5IYD K;  3S16 C;  2A69 A;  2R92 C;  2W7V A;  4XSX A;  1TWC C;  4FZB A;  3CAG A;  4A3J K;  1I6V A;  3CQZ K;  4KB4 A;  3A8J A;  4WJ3 M;  3PO2 K;  2PMZ L;  3A8K A;  1C0A A;  2A6E A;  2PMZ D;  4KN4 A;  3GTQ C;  4LOW A;  4KM8 A;  2NVT C;  5FLM C;  4YFX A;  1BJT A;  4BY1 C;  3HOW K;  4BXX C;  5M5Y K;  1I50 C;  3S2D K;  3GTJ K;  1O25 A;  3HOU K;  1X31 C;  3S1Q C;  2XCQ A;  3AQO A;  4KMU A;  4A3E C;  4G0U A;  1TWA A;  2R92 K;  2VUM K;  1R9T A;  1F7U A;  2NVQ C;  1WQF A;  1BGW A;  4AH6 A;  4BLA A;  4RMF A;  3HOZ C;  3LAJ A;  1XPP A;  4X6A K;  2GAH C;  4KAS A;  4C3J C;  4P5A A;  3LAP A;  3S14 K;  1DCH A;  3GTM C;  4GZY A;  1F93 A;  1DCP A;  3HOY K;  2JA6 A;  4C2M C;  4A93 C;  1WIH A;  5IP7 K;  4XLN A;  4GTF A;  2NVX K;  4BBR K;  1IQ0 A;  1IL2 A;  3GTO A;  2JA5 C;  4BXX K;  1I3Q A;  1SFO A;  1JVI A;  2JA7 C;  5M5X K;  5EGE A;  4BBS C;  1WSR A;  2O5J A;  3FKI C;  2JH3 A;  2B63 C;  1Y1V A;  3S17 K;  4A3C C;  4A3E K;  5TMF A;  2PHC B;  2NVQ K;  1TWF C;  4C45 A;  3RZD K;  2R93 A;  4C3J K;  5C3E K;  4KMH A;  3S1N C;  3GTM K;  4A3D C;  4FM9 A;  1B4A A;  4C2M K;  1WQH A;  2R7Z C;  4Q5S A;  4A3M C;  3OEP A;  5IYC K;  5IYD C;  2JA5 K;  5IYB K;  2A68 A;  2JA7 K;  3ADA C;  1RU0 A;  4OIQ A;  3GTL A;  4A3J C;  4OIP A;  3GTQ A;  3FKI K;  3MML B;  4A3C K;  1WSV A;  3HKZ L;  4KAR A;  3PO2 C;  1GE9 A;  3HKZ D;  4O2D A;  1PJ5 A;  4J3N A;  3GTG K;  1XZQ B;  1I50 A;  4A3F K;  4GTL A;  4KAW X;  2WAQ L;  3S1N K;  4Y7N C;  2WAQ D;  4A3B K;  3IPJ A;  4LLG A;  1TWG K;  3GTP A;  1YNN A;  3T02 A;  4A3G K;  3GDZ A;  3SZY A;  4YFN A;  2WB1 L;  1PJ6 A;  4KMA A;  3GTJ C;  3HOU C;  2WB1 D;  1EH1 A;  2PA8 L;  3N0C A;  4C3I C;  2PA8 D;  2VUM C;  2GSU A;  4GFQ A;  2RH6 A;  1WQG A;  1K83 A;  4XCH A;  1J98 A;  5JFE A;  4X6A C;  2V6S A;  3S14 C;  2XCR B;  4YFK A;  4KM9 A;  3HOY C;  5IP7 C;  5C44 C;  4Y7N K;  1SMY A;  2A6H A;  4BBR C;  2NVX C;  4OIR A;  2B63 A;  1IS1 A;  1IBA A;  1EK8 A;  2PPB A;  5E68 A;  4WJ4 A;  1TWF A;  1J6W A;  2BE5 A;  4G7Z A;  4ILD A;  2YU9 K;  1TWH A;  1WOP A;  4KN7 A;  1YX2 A;  1ZQ1 C;  3S17 C;  4C3I K;  2FQT A;  1KQ4 A;  1WOR A;  1O2B A;  2CFA A;  1VGX A;  4LJZ A;  5HL8 A;  4KC6 A;  3RZD C;  2E2I K;  2NVY A;  5C3E C;  3AD8 C;  3H0G K;  1Y1W C;  4GTC A;  1YCL A;  1XXC A;  4WIL A;  4YG2 A;  2E2J C;  3BP3 A;  3LPX A;  5C44 K;  3CQZ A;  5TMC A;  2E2H K;  5IYC C;  2EBB A;  2RGR A;  5IYB C;  1EI6 A;  3ERE D;  2CW0 A;  1ZXO A;  3HOX C;  3AD9 C;  3S1M K;  1F9N A;  4KAT A;  1PJ7 A;  3GTL K;  4ZH4 A;  5C4J C;  4LR2 A;  3SZZ A;  3GTG C;  3I4N C;  4P9S A;  1O28 A;  4A3F C;  1WCM A;  1I6H C;  4BY7 C;  3GTJ A;  4QJV B;  4A3B C;  1Y1W K;  3TTG A;  2R92 A;  5C4X K;  2VUM A;  1O29 A;  1O27 A;  1TWG C;  1VRQ C;  3G4A A;  1TWC A;  4MQ9 A;  2JA8 K;  4A3G C;  2E2J K;  1VJE A;  3GTK K;  1EFW A;  4JK1 A;  5IOR A;  1JOE A;  3VA7 A;  5IP9 K;  4BLB A;  3TFJ A;  3HOX K;  3I4M K;  4GTB A;  3H3V L;  1ZBS A;  2GAG C;  1ZVU A;  3H3V D;  1R9T C;  4LK1 A;  4G7H A;  4G0V A;  3PO3 K;  1O2F B;  3AH5 A;  5C4J K;  2O5I A;  4PAA A;  1XZP A;  2V6U A;  3I4N K;  3T00 A;  3V4G A;  1I6H K;  4BY7 K;  3RZO K;  2JA6 C;  1J6V A;  3S2H C;  1J6X A;  3GIR A;  4A3K K;  5CHP A;  2YU9 C;  3HOV K;  3GEE A;  3FHZ A;  3M3Y K;  3N0B A;  1I3Q C;  5M5W K;  4G0W A;  3GTM A;  1IW7 A;  3ORE A;  3WOD A;  5D4D A;  2ZUE A;  4A3I C;  5TJ3 A;  1O24 A;  4Y52 K;  2E2I C;  1TWA K;  4XSZ A;  5JVO A;  1R9T K;  3L4J A;  3H0G C;  4NOI A;  4LQY A;  5M3M K;  2JA5 A;  5FJ8 K;  1B4B A;  3FOF A;  2GSN A;  2R93 C;  2JA7 A;  2V6T A;  3GEH A;  3FKI A;  2JA6 K;  4QIW L;  2E2H C;  3S2H K;  1L0W A;  1O26 A;  4QIW D;  5IOS A;  1G51 A;  2P5M A;  1F7V A;  1WOS A;  3GTG A;  4A3L C;  4C3H C;  3GTO K;  5M3F K;  4KDD A;  3S1M C;  2Y0S L;  3QX3 A;  4XLP A;  1I3Q K;  1SFO K;  2Y0S D;  4GTE A;  3GTL C;  4MEY A;  1TWG A;  2R7Z A;  1HI9 A;  4A3I K;  1Y1V K;  3S15 C;  3S1R K;  1EQR A;  2Y3P A;  3A8I A;  2ZUF A;  4P5B A;  1HQM A;  3DXJ A;  5EGH A;  5C4X C;  2R93 K;  1WCM K;  2FQO A;  3HXA A;  2JA8 C;  3BP8 C;  3GTK C;  4AYB L;  1VH2 A;  3S16 K;  1YNJ A;  3AQP A;  4BKW A;  4AYB D;  1WOO A;  3GTP C;  1TWC K;  5IP9 C;  2GSO A;  1IE0 A;  4LK0 A;  3I4M C;  4DDQ A;  1USO A;  4C3H K;  4A3L K;  3BUE A;  4QJV A;  3AD7 C;  1ZYR A;  2CFA B;  3PO3 C;  1VLO A;  3GTQ K;  3M4O C;  2NVT K;  1K83 C;  5FLM K;  2KWA A;  5IOQ A;  1DD5 A;  2YU9 A;  3S15 K;  1INN A;  4BY1 K;  3RZO C;  4GTD A;  3EQL A;  1XXA A;  1I50 K;  3NUH A;  3K7A C;  4A3K C;  1UV7 A;  3OPF A;  3S1Q K;  3HOV C;  1BS2 A;  2E2I A;  3M3Y C;  3S0X A;  4G7O A;  3GTP K;  3H0G A;  1XZQ A;  4PAB A;  1TWH C;  3HOZ K;  3N3Y A;  4Y52 C;  1TWA C;  4OIO A;  4GT9 A;  2NVX A;  2E2H A;  2P8T A;  4M1X A;  4A93 K;  3TFH A;  2XCO A;  3M4O K;  3L4K A;  3T01 A;  1K83 K;  2NVY C;  1O2A A;  1JQW A;  3FOE A; 
#chains in the Genus database with same CATH homology
 5C3E C;  4BBS K;  3K7A K;  2NVQ K;  1TWF C;  3CQZ C;  3H0G K;  3RZD K;  1Y1W C;  2JA6 K;  4QIW L;  2E2H C;  2B63 K;  3S2H K;  3GTO C;  4QIW D;  4C3J K;  5C3E K;  1BDF A;  1SFO C;  4YG2 A;  1TWF K;  2E2J C;  3S1N C;  5C44 K;  3GTM K;  4A3D C;  5TMC A;  1TWH K;  5IYC C;  2E2H K;  4C2M K;  4A3L C;  3GTO K;  5M3F K;  3S1M C;  2R7Z C;  2Y0S L;  4Q5S A;  5IYB C;  1I3Q K;  4XLP A;  1Y1V C;  1SFO K;  4A3M C;  2Y0S D;  4Q4Z A;  4A3D K;  3S1R C;  2CW0 A;  3HOX C;  4MEX A;  5IYC K;  5IYD C;  3GTL C;  4MEY A;  3HOW C;  4OIN A;  2JA5 K;  3S1M K;  2R7Z K;  5IYB K;  4A3I K;  2A68 A;  1Y1V K;  4A3M K;  2NVY K;  2JA7 K;  1WCM C;  3S15 C;  3S2D C;  4OIQ A;  3S1R K;  3GTL K;  4ZH4 A;  5C4J C;  4OIP A;  4A3J C;  5IYD K;  3FKI K;  3S16 C;  2A69 A;  2R92 C;  4XSX A;  1HQM A;  3DXJ A;  3GTG C;  4A3C K;  3I4N C;  5C4X C;  4A3F C;  2R93 K;  1WCM K;  1TWC C;  3HKZ L;  1I6H C;  3PO2 C;  2JA8 C;  4BY7 C;  4A3J K;  3HKZ D;  1I6V A;  3CQZ K;  4QJV B;  4AYB L;  3GTK C;  1YNJ A;  3S16 K;  1Y1W K;  4A3B C;  3GTG K;  4AYB D;  5C4X K;  4A3F K;  1TWG C;  3GTP C;  1TWC K;  2WAQ L;  3PO2 K;  4MQ9 A;  2JA8 K;  5IP9 C;  4A3G C;  2E2J K;  3S1N K;  4Y7N C;  3GTK K;  2WAQ D;  2PMZ L;  4A3B K;  4LLG A;  4LK0 A;  2A6E A;  4JK1 A;  3I4M C;  2PMZ D;  4KN4 A;  3GTQ C;  4A3L K;  4C3H K;  2NVT C;  1TWG K;  1YNN A;  4QJV A;  5FLM C;  4A3G K;  5IP9 K;  1ZYR A;  4YFN A;  2WB1 L;  4YFX A;  4BY1 C;  3PO3 C;  3GTJ C;  3HOX K;  3I4M K;  3HOU C;  3GTQ K;  2WB1 D;  3HOW K;  3M4O C;  2PA8 L;  2NVT K;  3H3V L;  4BXX C;  5M5Y K;  1K83 C;  5FLM K;  2PA8 D;  3H3V D;  1I50 C;  2VUM C;  1R9T C;  4LK1 A;  4G7H A;  3S15 K;  3S2D K;  4BY1 K;  3PO3 K;  3GTJ K;  3RZO C;  3HOU K;  5C4J K;  3S1Q C;  2O5I A;  3EQL A;  4KMU A;  4A3E C;  2R92 K;  4X6A C;  1I50 K;  3I4N K;  2VUM K;  3K7A C;  2NVQ C;  4A3K C;  3S14 C;  1I6H K;  4BY7 K;  4YFK A;  3RZO K;  2JA6 C;  3HOY C;  3S2H C;  3HOZ C;  3S1Q K;  3HOV C;  1XPP A;  4X6A K;  3M3Y C;  5IP7 C;  4G7O A;  3GTP K;  4A3K K;  3S14 K;  5C44 C;  3GTM C;  4GZY A;  4Y7N K;  1SMY A;  2A6H A;  4BBR C;  1TWH C;  2NVX C;  2YU9 C;  4OIR A;  3HOY K;  3HOZ K;  3HOV K;  4A93 C;  2PPB A;  3M3Y K;  5IP7 K;  4XLN A;  1I3Q C;  4Y52 C;  2BE5 A;  5M5W K;  4G7Z A;  1TWA C;  4OIO A;  1IW7 A;  2NVX K;  3WOD A;  4BBR K;  5D4D A;  2YU9 K;  4KN7 A;  4A93 K;  3M4O K;  2JA5 C;  4A3I C;  4BXX K;  3S17 C;  4C3I K;  1K83 K;  2NVY C;  2E2I C;  2JA7 C;  1TWA K;  2R93 C;  4Y52 K;  4XSZ A;  5M5X K;  1R9T K;  4BBS C;  4LJZ A;  2O5J A;  3FKI C;  3H0G C;  4NOI A;  3RZD C;  5M3M K;  5FJ8 K;  2B63 C;  3S17 K;  4A3C C;  2E2I K;  4A3E K;  5TMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...