5IYCK

Human core-pic in the initial transcribing state
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
117
Chain Sequence
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 29
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5iycK00
5IP7C 2NVYK 3HOYC 2R7ZK 3M4OK 2O5IA 5IYDK 4XSXA 4KN7A 1SFOK 4G7ZA 4C3JK 3HOUC 3K7AK 3S2DC 1Y1WK 2NVQK 4OIPA 4OIRA 3S14K 5C44C 3HKZL 3GTGK 2PA8D 4A3FC 4A93K 3WODA 3RZOK 4A3LC 5IP9K 4A3CC 2E2HC 1YNNA 5FJ8K 1ZYRA 3S17C 2E2HK 4A3DC 1I6VA 4LK0A 4ZH4A 3RZDK 3H0GK 2E2IK 2VUMK 3S1MK 1I3QK 3GTPC 4BY1C 4OIQA 4Y52K 2NVYC 2JA5K 4A3JC 4BBRK 2A68A 5M3MK 3GTQK 3M4OC 3S1RK 4BY1K 5FLMK 3HOVK 1TWCC 4YG2A 2YU9K 4A3BC 4BXXC 5FLMC 3HOVC 4A3BK 4A3EC 3S2DK 3HOWK 4G7HA 1YNJA 5C44K 3HOWC 3I4MK 3HOUK 4YFXA 1Y1WC 2PPBA 3S15K 3GTLC 4BY7C 3GTGC 1BDFA 4QIWD 4A3LK 3GTLK 2PA8L 3RZOC 5IYCC 5TMCA 4LLGA 2B63C 3S1QK 2PMZD 3DXJA 3RZDC 4A3CK 1I50K 2WB1L 2NVTK 3S2HK 2WAQL 1I50C 1XPPA 3GTMC 3FKIC 4BBRC 2BE5A 2E2IC 4OINA 4A3KC 5C3EC 4AYBD 2YU9C 4QJVA 4Y52C 4A3MK 1SMYA 2O5JA 3HOXC 2E2JK 3GTJC 3GTQC 4A3MC 2R93C 4YFNA 4LJZA 3I4MC 1K83C 3S15C 4KN4A 4BY7K 4A3IC 3I4NC 1Y1VC 2JA8C 1Y1VK 2WAQD 4LK1A 4A3GC 4C3IK 4MQ9A 4Y7NK 4A3GK 4QIWL 1TWAK 2NVXC 2JA6K 3PO2C 2JA6C 3FKIK 3GTOK 2JA7C 3HOZK 1TWFC 2PMZL 3H3VD 3GTMK 3HOXK 2E2JC 5C4XC 2JA5C 5C3EK 4C3HK 5C4XK 3CQZK 4MEXA 4QJVB 3GTJK 3CQZC 3M3YC 2R93K 3S1NK 3EQLA 5M5WK 4NOIA 3I4NK 1SFOC 3K7AC 4Q5SA 1I6HK 1K83K 3S14C 1I6HC 5IYBK 2JA8K 4XLPA 4A93C 2Y0SD 4X6AC 3GTKK 4X6AK 2R92C 4YFKA 5IYCK 1R9TK 2A6HA 2R92K 1TWFK 2WB1D 4KMUA 5M5YK 3S16C 4XSZA 2JA7K 3HOZC 1I3QC 3GTPK 4G7OA 4Q4ZA 2B63K 4A3JK 1HQMA 1WCMC 5IP7K 5IYDC 2R7ZC 3S1NC 1WCMK 2CW0A 1TWCK 3PO3K 4A3DK 1TWAC 1TWHC 4A3EK 4C2MK 3M3YK 3HKZD 3HOYK 2NVQC 1IW7A 2Y0SL 1TWGK 4A3IK 2A69A 4A3FK 1TWGC 3GTKC 5M5XK 2A6EA 1R9TC 4MEYA 4OIOA 5TMFA 5IYBC 5D4DA 3S16K 3S1QC 4Y7NC 5M3FK 2NVXK 3PO2K 4XLNA 3S17K 2NVTC 3GTOC 5IP9C 3S2HC 3H0GC 4BBSC 4BBSK 4BXXK 3H3VL 5C4JC 4A3KK 4GZYA 5C4JK 4JK1A 2VUMC 3PO3C 3S1RC 4AYBL 3S1MC 1TWHK
chains in the Genus database with same CATH superfamily
2R7ZK 3TTGA 2O5IA 3GTGA 4G7ZA 1V5VA 3Q3QA 3HKZL 5E68A 3GTGK 4A3FC 4KM9A 1JVIA 3RZOK 1XZQB 4KARA 3NUHA 3BP8C 3H0GA 2E2HC 2E2IK 4GTFA 4GT9A 3GTPC 3GEHA 4BY1C 2JA5K 4AYBL 1IQ0A 3S1RK 4BY1K 5JFEA 3AD8C 3HOVC 1O2AA 3S2DK 3HOWC 1WOPA 1WCMA 4A3LK 1KQ4A 2PA8L 2B63A 1I3QA 1O27A 3G4CA 4KATA 3JSTA 2NVTK 3FKIC 2E2IC 4BLBA 4LOWA 4QJVA 3LAPA 4A3MK 2ZUFA 2GAGC 3HOXC 2E2JK 3GTQC 2O5JA 4LJZA 3I4MC 2XCOA 4BY7K 4KN4A 3I4NC 1IS1A 1B4AA 1ZBSA 1DD5A 4MQ9A 4C3IK 3PO2C 2JA7C 3HOZK 2NVXA 3S0XA 5EGEA 3GTMK 5C3EK 4AH6A 4QJVB 1IE0A 2ZFZA 4Q5SA 2V6TA 2JA8K 4P5AA 5IYCK 3GTMA 4C3IC 2R92K 3A8JA 3S16C 1TWFA 1ZVUA 1I3QC 4A3JK 2RH6A 3S1NC 2CW0A 2Y3PA 3PO3K 1WOSA 1TWAC 5IOQA 4A3EK 3T00A 2Y0SL 3N0BA 1HI9A 3GTKC 1C0AA 1XXBA 4OIOA 5IYBC 3S1QC 3PO2K 3S17K 3H3VL 1WQHA 3MMLB 5C4JK 3S1MC 4BXXK 1F7VA 3M4OK 1Y1WA 1SFOK 3HOUC 3S2DC 1XXCA 1USMA 3WODA 4FM9A 4M1XA 4A3CC 5IORA 1YX2A 1ZYRA 2E2HK 3S17C 1I6VA 4KMHA 4ZH4A 3H0GK 2VUMK 2CFAA 4OIQA 2NVYC 4A3JC 4BBRK 3HOVK 4BKWA 3BP3A 3HOWK 4G7HA 5C44K 2JH3A 1ZQ1C 1Y1WC 2PPBA 1RU0A 3S15K 2R7ZA 1YCLA 3GTLK 3S1QK 4LLGA 3DXJA 4A3CK 1VGXA 2WB1L 3S2HK 1I50C 2BE5A 3G4AA 4C45A 3LPXA 1BJTA 4KMAA 4Y52C 3GTJC 2R93C 4A3MC 1TWGA 3GSIA 1EH1A 1K83C 4A3IC 1Y1VC 1TWAA 4BLAA 3TFJA 1IL2A 4Y7NK 4QIWL 2JA6K 1TWFC 2PMZL 2RGRA 1VH2A 4KDDA 3HOXK 2E2JC 1Y1VA 4MEXA 4C2MC 3AD9C 3AD7C 3GTJK 2R93K 5IOTA 5M5WK 1K83A 4P5BA 3OREA 3S14C 1DCOA 2V6UA 1I6HC 4G0VA 3CQZA 4A93C 3GEEA 4PAAA 4KB2A 2JA5A 2WB1D 5M5YK 2W7VA 1J6XA 3AQOA 4G7OA 1WQGA 4Q4ZA 1O2BA 1WORA 4RMFA 1HQMA 2R7ZC 1O24A 4A3DK 1XZQA 2V6SA 3M3YK 1XXAA 3HOYK 2NVQC 3V4GA 5TMFA 3GTQA 1INNA 3S16K 5M3FK 1ISEA 4XLNA 4P9SA 1B4BA 4KC6A 3ADAC 4BBSK 3SZYA 2VUMC 1JOEA 1TWAK 1VLOA 3FOFA 5IP7C 2NVYK 4XSXA 4KN7A 4GTBA 4C3JK 3K7AK 2NVQK 3S14K 5C44C 4GTLA 4A93K 1TWCA 4KMDA 4PABA 5IP9K 1YNNA 3GTPA 3L4JA 4LK0A 3RZDK 4WJ3M 3S1MK 3N0CA 3M4OC 1R9TA 5M3MK 3GTQK 3GTKA 5FLMK 1TWCC 4A3BK 3FHZA 2PHCB 1YNJA 3N3YA 3GTLC 3GTGC 4QIWD 3RZOC 5IYCC 2VUMA 2GAHC 2XCRB 3ERED 1I50K 1UV7A 2WAQL 1XPPA 1EK8A 3GTMC 4BBRC 4OINA 5C3EC 3AH5A 2YU9C 1WSRA 1BGWA 1SMYA 1SFOA 1O29A 3S15C 2JA8C 4KASA 4KM8A 1Y1VK 1O25A 3AQPA 4A3GK 2NVXC 2JA7A 2JA6C 3GTOK 1WIHA 4GTDA 3H3VD 4XCHA 4C3HC 2JA5C 1EI6A 5C4XK 3HXAA 3CQZC 3EQLA 1EQRA 5EGHA 4NOIA 1SFOC 2GSNA 4GFQA 3QX3A 1I6HK 3T02A 5IYBK 2YU9A 2Y0SD 1WQFA 4X6AK 3LAJA 1VJEA 2A6HA 1TWFK 4XSZA 1GE9A 2JA7K 3HOZC 1DCHA 2ZUEA 1WCMC 5IYDC 3GTLA 4KB4A 1TWHC 3HKZD 1X31C 1IW7A 4GTAA 1TWGC 5IOSA 5M5XK 1R9TC 4MEYA 4FZBA 3IPJA 1PJ6A 2NVXK 2FQTA 3S2HC 3GTOC 5IP9C 3GEIA 1O28A 2KWAA 3H0GC 5CJ9A 1F7UA 1I50A 4BBSC 1TWHK 2E2HA 4A3KK 1F9NA 4JK1A 4A3DC 1WOOA 1WSVA 1O26A 5IYDK 3HOYC 1J6WA 1PJ7A 1Y1WK 4C3JC 4GTEA 4WILA 4OIPA 1L0WA 4OIRA 2PA8D 1O2FB 1VRQC 4A3LC 1IBAA 5FJ8K 3GDZA 1I3QK 4Y52K 2A68A 5L46A 4BXXC 4O2DA 4A3BC 4YG2A 2YU9K 4LQYA 5FLMC 2GSOA 4A3EC 1J98A 3I4MK 1DCPA 4YFXA 3HOUK 1ZXOA 1F93A 4BY7C 1BDFA 5JVOA 4GTCA 2B63C 2PMZD 3RZDC 1BS2A 1JQWA 2GSUA 3GTOA 2R92A 4A3KC 4AYBD 4KAWX 4YFNA 1XZPB 1TWHA 4G0UA 2WAQD 4LK1A 4A3GC 4LR2A 3TFIA 4J3NA 3FKIK 1PJ5A 4ILDA 3TFHA 3A8KA 3OEPA 2P8TA 5C4XC 2EBBA 4C3HK 3CQZK 4WJ4A 3M3YC 3S1NK 5HL8A 5TJ3A 3I4NK 3K7AC 1J6VA 1K83K 3GTJA 2R93A 3VA7A 4XLPA 4X6AC 3OPFA 3GTKK 2R92C 4YFKA 1R9TK 4KMUA 4DDQA 2FQOA 4G0WA 3GTPK 2JA6A 2P5MA 2D6FC 2B63K 5IP7K 1WCMK 1TWCK 3SZZA 4C2MK 2CFAB 3L4KA 2XCQA 1TWGK 3BUEA 4A3IK 2A69A 4A3FK 3A8IA 2A6EA 1EFWA 2NVYA 5D4DA 4Y7NC 1USOA 3FOEA 3S1RC 2E2IA 2NVTC 3FKIA 1G51A 1AB4A 3GIRA 5C4JC 4GZYA 5CHPA 1XZPA 3PO3C 3T01A 5TMCA 3CAGA
chains in the Genus database with same CATH topology
5IP7C 2NVYK 3HOYC 2R7ZK 3M4OK 2O5IA 5IYDK 4XSXA 4KN7A 1SFOK 4G7ZA 4C3JK 3HOUC 3K7AK 3S2DC 1Y1WK 2NVQK 4OIPA 4OIRA 3S14K 5C44C 3HKZL 3GTGK 2PA8D 4A3FC 4A93K 3WODA 3RZOK 4A3LC 5IP9K 4A3CC 2E2HC 1YNNA 5FJ8K 1ZYRA 3S17C 2E2HK 4A3DC 1I6VA 4LK0A 4ZH4A 3RZDK 3H0GK 2E2IK 2VUMK 3S1MK 1I3QK 3GTPC 4BY1C 4OIQA 4Y52K 2NVYC 2JA5K 4A3JC 4BBRK 2A68A 5M3MK 3GTQK 3M4OC 3S1RK 4BY1K 5FLMK 3HOVK 1TWCC 4YG2A 2YU9K 4A3BC 4BXXC 5FLMC 3HOVC 4A3BK 4A3EC 3S2DK 3HOWK 4G7HA 1YNJA 5C44K 3HOWC 3I4MK 3HOUK 4YFXA 1Y1WC 2PPBA 3S15K 3GTLC 4BY7C 3GTGC 1BDFA 4QIWD 4A3LK 3GTLK 2PA8L 3RZOC 5IYCC 5TMCA 4LLGA 2B63C 3S1QK 2PMZD 3DXJA 3RZDC 4A3CK 1I50K 2WB1L 2NVTK 3S2HK 2WAQL 1I50C 1XPPA 3GTMC 3FKIC 4BBRC 2BE5A 2E2IC 4OINA 4A3KC 5C3EC 4AYBD 2YU9C 4QJVA 4Y52C 4A3MK 1SMYA 2O5JA 3HOXC 2E2JK 3GTJC 3GTQC 4A3MC 2R93C 4YFNA 4LJZA 3I4MC 1K83C 3S15C 4KN4A 4BY7K 4A3IC 3I4NC 1Y1VC 2JA8C 1Y1VK 2WAQD 4LK1A 4A3GC 4C3IK 4MQ9A 4Y7NK 4A3GK 4QIWL 1TWAK 2NVXC 2JA6K 3PO2C 2JA6C 3FKIK 3GTOK 2JA7C 3HOZK 1TWFC 2PMZL 3H3VD 3GTMK 3HOXK 2E2JC 5C4XC 2JA5C 5C3EK 4C3HK 5C4XK 3CQZK 4MEXA 4QJVB 3GTJK 3CQZC 3M3YC 2R93K 3S1NK 3EQLA 5M5WK 4NOIA 3I4NK 1SFOC 3K7AC 4Q5SA 1I6HK 1K83K 3S14C 1I6HC 5IYBK 2JA8K 4XLPA 4A93C 2Y0SD 4X6AC 3GTKK 4X6AK 2R92C 4YFKA 5IYCK 1R9TK 2A6HA 2R92K 1TWFK 2WB1D 4KMUA 5M5YK 3S16C 4XSZA 2JA7K 3HOZC 1I3QC 3GTPK 4G7OA 4Q4ZA 2B63K 4A3JK 1HQMA 1WCMC 5IP7K 5IYDC 2R7ZC 3S1NC 1WCMK 2CW0A 1TWCK 3PO3K 4A3DK 1TWAC 1TWHC 4A3EK 4C2MK 3M3YK 3HKZD 3HOYK 2NVQC 1IW7A 2Y0SL 1TWGK 4A3IK 2A69A 4A3FK 1TWGC 3GTKC 5M5XK 2A6EA 1R9TC 4MEYA 4OIOA 5TMFA 5IYBC 5D4DA 3S16K 3S1QC 4Y7NC 5M3FK 2NVXK 3PO2K 4XLNA 3S17K 2NVTC 3GTOC 5IP9C 3S2HC 3H0GC 4BBSC 4BBSK 4BXXK 3H3VL 5C4JC 4A3KK 4GZYA 5C4JK 4JK1A 2VUMC 3PO3C 3S1RC 4AYBL 3S1MC 1TWHK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP7 C;  2NVY K;  3HOY C;  2R7Z K;  3M4O K;  2O5I A;  5IYD K;  4XSX A;  4KN7 A;  1SFO K;  4G7Z A;  4C3J K;  3HOU C;  3K7A K;  3S2D C;  1Y1W K;  2NVQ K;  4OIP A;  4OIR A;  3S14 K;  5C44 C;  3HKZ L;  3GTG K;  2PA8 D;  4A3F C;  4A93 K;  3WOD A;  3RZO K;  4A3L C;  5IP9 K;  4A3C C;  2E2H C;  1YNN A;  5FJ8 K;  1ZYR A;  3S17 C;  2E2H K;  4A3D C;  1I6V A;  4LK0 A;  4ZH4 A;  3RZD K;  3H0G K;  2E2I K;  2VUM K;  3S1M K;  1I3Q K;  3GTP C;  4BY1 C;  4OIQ A;  4Y52 K;  2NVY C;  2JA5 K;  4A3J C;  4BBR K;  2A68 A;  5M3M K;  3GTQ K;  3M4O C;  3S1R K;  4BY1 K;  5FLM K;  3HOV K;  1TWC C;  4YG2 A;  2YU9 K;  4A3B C;  4BXX C;  5FLM C;  3HOV C;  4A3B K;  4A3E C;  3S2D K;  3HOW K;  4G7H A;  1YNJ A;  5C44 K;  3HOW C;  3I4M K;  3HOU K;  4YFX A;  1Y1W C;  2PPB A;  3S15 K;  3GTL C;  4BY7 C;  3GTG C;  1BDF A;  4QIW D;  4A3L K;  3GTL K;  2PA8 L;  3RZO C;  5IYC C;  5TMC A;  4LLG A;  2B63 C;  3S1Q K;  2PMZ D;  3DXJ A;  3RZD C;  4A3C K;  1I50 K;  2WB1 L;  2NVT K;  3S2H K;  2WAQ L;  1I50 C;  1XPP A;  3GTM C;  3FKI C;  4BBR C;  2BE5 A;  2E2I C;  4OIN A;  4A3K C;  5C3E C;  4AYB D;  2YU9 C;  4QJV A;  4Y52 C;  4A3M K;  1SMY A;  2O5J A;  3HOX C;  2E2J K;  3GTJ C;  3GTQ C;  4A3M C;  2R93 C;  4YFN A;  4LJZ A;  3I4M C;  1K83 C;  3S15 C;  4KN4 A;  4BY7 K;  4A3I C;  3I4N C;  1Y1V C;  2JA8 C;  1Y1V K;  2WAQ D;  4LK1 A;  4A3G C;  4C3I K;  4MQ9 A;  4Y7N K;  4A3G K;  4QIW L;  1TWA K;  2NVX C;  2JA6 K;  3PO2 C;  2JA6 C;  3FKI K;  3GTO K;  2JA7 C;  3HOZ K;  1TWF C;  2PMZ L;  3H3V D;  3GTM K;  3HOX K;  2E2J C;  5C4X C;  2JA5 C;  5C3E K;  4C3H K;  5C4X K;  3CQZ K;  4MEX A;  4QJV B;  3GTJ K;  3CQZ C;  3M3Y C;  2R93 K;  3S1N K;  3EQL A;  5M5W K;  4NOI A;  3I4N K;  1SFO C;  3K7A C;  4Q5S A;  1I6H K;  1K83 K;  3S14 C;  1I6H C;  5IYB K;  2JA8 K;  4XLP A;  4A93 C;  2Y0S D;  4X6A C;  3GTK K;  4X6A K;  2R92 C;  4YFK A;  5IYC K;  1R9T K;  2A6H A;  2R92 K;  1TWF K;  2WB1 D;  4KMU A;  5M5Y K;  3S16 C;  4XSZ A;  2JA7 K;  3HOZ C;  1I3Q C;  3GTP K;  4G7O A;  4Q4Z A;  2B63 K;  4A3J K;  1HQM A;  1WCM C;  5IP7 K;  5IYD C;  2R7Z C;  3S1N C;  1WCM K;  2CW0 A;  1TWC K;  3PO3 K;  4A3D K;  1TWA C;  1TWH C;  4A3E K;  4C2M K;  3M3Y K;  3HKZ D;  3HOY K;  2NVQ C;  1IW7 A;  2Y0S L;  1TWG K;  4A3I K;  2A69 A;  4A3F K;  1TWG C;  3GTK C;  5M5X K;  2A6E A;  1R9T C;  4MEY A;  4OIO A;  5TMF A;  5IYB C;  5D4D A;  3S16 K;  3S1Q C;  4Y7N C;  5M3F K;  2NVX K;  3PO2 K;  4XLN A;  3S17 K;  2NVT C;  3GTO C;  5IP9 C;  3S2H C;  3H0G C;  4BBS C;  4BBS K;  4BXX K;  3H3V L;  5C4J C;  4A3K K;  4GZY A;  5C4J K;  4JK1 A;  2VUM C;  3PO3 C;  3S1R C;  4AYB L;  3S1M C;  1TWH K; 
#chains in the Genus database with same CATH topology
 2R7Z K;  3TTG A;  2O5I A;  3GTG A;  4G7Z A;  1V5V A;  3Q3Q A;  3HKZ L;  5E68 A;  3GTG K;  4A3F C;  4KM9 A;  1JVI A;  3RZO K;  1XZQ B;  4KAR A;  3NUH A;  3BP8 C;  3H0G A;  2E2H C;  2E2I K;  4GTF A;  4GT9 A;  3GTP C;  3GEH A;  4BY1 C;  2JA5 K;  4AYB L;  1IQ0 A;  3S1R K;  4BY1 K;  5JFE A;  3AD8 C;  3HOV C;  1O2A A;  3S2D K;  3HOW C;  1WOP A;  1WCM A;  4A3L K;  1KQ4 A;  2PA8 L;  2B63 A;  1I3Q A;  1O27 A;  3G4C A;  4KAT A;  3JST A;  2NVT K;  3FKI C;  2E2I C;  4BLB A;  4LOW A;  4QJV A;  3LAP A;  4A3M K;  2ZUF A;  2GAG C;  3HOX C;  2E2J K;  3GTQ C;  2O5J A;  4LJZ A;  3I4M C;  2XCO A;  4BY7 K;  4KN4 A;  3I4N C;  1IS1 A;  1B4A A;  1ZBS A;  1DD5 A;  4MQ9 A;  4C3I K;  3PO2 C;  2JA7 C;  3HOZ K;  2NVX A;  3S0X A;  5EGE A;  3GTM K;  5C3E K;  4AH6 A;  4QJV B;  1IE0 A;  2ZFZ A;  4Q5S A;  2V6T A;  2JA8 K;  4P5A A;  5IYC K;  3GTM A;  4C3I C;  2R92 K;  3A8J A;  3S16 C;  1TWF A;  1ZVU A;  1I3Q C;  4A3J K;  2RH6 A;  3S1N C;  2CW0 A;  2Y3P A;  3PO3 K;  1WOS A;  1TWA C;  5IOQ A;  4A3E K;  3T00 A;  2Y0S L;  3N0B A;  1HI9 A;  3GTK C;  1C0A A;  1XXB A;  4OIO A;  5IYB C;  3S1Q C;  3PO2 K;  3S17 K;  3H3V L;  1WQH A;  3MML B;  5C4J K;  3S1M C;  4BXX K;  1F7V A;  3M4O K;  1Y1W A;  1SFO K;  3HOU C;  3S2D C;  1XXC A;  1USM A;  3WOD A;  4FM9 A;  4M1X A;  4A3C C;  5IOR A;  1YX2 A;  1ZYR A;  2E2H K;  3S17 C;  1I6V A;  4KMH A;  4ZH4 A;  3H0G K;  2VUM K;  2CFA A;  4OIQ A;  2NVY C;  4A3J C;  4BBR K;  3HOV K;  4BKW A;  3BP3 A;  3HOW K;  4G7H A;  5C44 K;  2JH3 A;  1ZQ1 C;  1Y1W C;  2PPB A;  1RU0 A;  3S15 K;  2R7Z A;  1YCL A;  3GTL K;  3S1Q K;  4LLG A;  3DXJ A;  4A3C K;  1VGX A;  2WB1 L;  3S2H K;  1I50 C;  2BE5 A;  3G4A A;  4C45 A;  3LPX A;  1BJT A;  4KMA A;  4Y52 C;  3GTJ C;  2R93 C;  4A3M C;  1TWG A;  3GSI A;  1EH1 A;  1K83 C;  4A3I C;  1Y1V C;  1TWA A;  4BLA A;  3TFJ A;  1IL2 A;  4Y7N K;  4QIW L;  2JA6 K;  1TWF C;  2PMZ L;  2RGR A;  1VH2 A;  4KDD A;  3HOX K;  2E2J C;  1Y1V A;  4MEX A;  4C2M C;  3AD9 C;  3AD7 C;  3GTJ K;  2R93 K;  5IOT A;  5M5W K;  1K83 A;  4P5B A;  3ORE A;  3S14 C;  1DCO A;  2V6U A;  1I6H C;  4G0V A;  3CQZ A;  4A93 C;  3GEE A;  4PAA A;  4KB2 A;  2JA5 A;  2WB1 D;  5M5Y K;  2W7V A;  1J6X A;  3AQO A;  4G7O A;  1WQG A;  4Q4Z A;  1O2B A;  1WOR A;  4RMF A;  1HQM A;  2R7Z C;  1O24 A;  4A3D K;  1XZQ A;  2V6S A;  3M3Y K;  1XXA A;  3HOY K;  2NVQ C;  3V4G A;  5TMF A;  3GTQ A;  1INN A;  3S16 K;  5M3F K;  1ISE A;  4XLN A;  4P9S A;  1B4B A;  4KC6 A;  3ADA C;  4BBS K;  3SZY A;  2VUM C;  1JOE A;  1TWA K;  1VLO A;  3FOF A;  5IP7 C;  2NVY K;  4XSX A;  4KN7 A;  4GTB A;  4C3J K;  3K7A K;  2NVQ K;  3S14 K;  5C44 C;  4GTL A;  4A93 K;  1TWC A;  4KMD A;  4PAB A;  5IP9 K;  1YNN A;  3GTP A;  3L4J A;  4LK0 A;  3RZD K;  4WJ3 M;  3S1M K;  3N0C A;  3M4O C;  1R9T A;  5M3M K;  3GTQ K;  3GTK A;  5FLM K;  1TWC C;  4A3B K;  3FHZ A;  2PHC B;  1YNJ A;  3N3Y A;  3GTL C;  3GTG C;  4QIW D;  3RZO C;  5IYC C;  2VUM A;  2GAH C;  2XCR B;  3ERE D;  1I50 K;  1UV7 A;  2WAQ L;  1XPP A;  1EK8 A;  3GTM C;  4BBR C;  4OIN A;  5C3E C;  3AH5 A;  2YU9 C;  1WSR A;  1BGW A;  1SMY A;  1SFO A;  1O29 A;  3S15 C;  2JA8 C;  4KAS A;  4KM8 A;  1Y1V K;  1O25 A;  3AQP A;  4A3G K;  2NVX C;  2JA7 A;  2JA6 C;  3GTO K;  1WIH A;  4GTD A;  3H3V D;  4XCH A;  4C3H C;  2JA5 C;  1EI6 A;  5C4X K;  3HXA A;  3CQZ C;  3EQL A;  1EQR A;  5EGH A;  4NOI A;  1SFO C;  2GSN A;  4GFQ A;  3QX3 A;  1I6H K;  3T02 A;  5IYB K;  2YU9 A;  2Y0S D;  1WQF A;  4X6A K;  3LAJ A;  1VJE A;  2A6H A;  1TWF K;  4XSZ A;  1GE9 A;  2JA7 K;  3HOZ C;  1DCH A;  2ZUE A;  1WCM C;  5IYD C;  3GTL A;  4KB4 A;  1TWH C;  3HKZ D;  1X31 C;  1IW7 A;  4GTA A;  1TWG C;  5IOS A;  5M5X K;  1R9T C;  4MEY A;  4FZB A;  3IPJ A;  1PJ6 A;  2NVX K;  2FQT A;  3S2H C;  3GTO C;  5IP9 C;  3GEI A;  1O28 A;  2KWA A;  3H0G C;  5CJ9 A;  1F7U A;  1I50 A;  4BBS C;  1TWH K;  2E2H A;  4A3K K;  1F9N A;  4JK1 A;  4A3D C;  1WOO A;  1WSV A;  1O26 A;  5IYD K;  3HOY C;  1J6W A;  1PJ7 A;  1Y1W K;  4C3J C;  4GTE A;  4WIL A;  4OIP A;  1L0W A;  4OIR A;  2PA8 D;  1O2F B;  1VRQ C;  4A3L C;  1IBA A;  5FJ8 K;  3GDZ A;  1I3Q K;  4Y52 K;  2A68 A;  5L46 A;  4BXX C;  4O2D A;  4A3B C;  4YG2 A;  2YU9 K;  4LQY A;  5FLM C;  2GSO A;  4A3E C;  1J98 A;  3I4M K;  1DCP A;  4YFX A;  3HOU K;  1ZXO A;  1F93 A;  4BY7 C;  1BDF A;  5JVO A;  4GTC A;  2B63 C;  2PMZ D;  3RZD C;  1BS2 A;  1JQW A;  2GSU A;  3GTO A;  2R92 A;  4A3K C;  4AYB D;  4KAW X;  4YFN A;  1XZP B;  1TWH A;  4G0U A;  2WAQ D;  4LK1 A;  4A3G C;  4LR2 A;  3TFI A;  4J3N A;  3FKI K;  1PJ5 A;  4ILD A;  3TFH A;  3A8K A;  3OEP A;  2P8T A;  5C4X C;  2EBB A;  4C3H K;  3CQZ K;  4WJ4 A;  3M3Y C;  3S1N K;  5HL8 A;  5TJ3 A;  3I4N K;  3K7A C;  1J6V A;  1K83 K;  3GTJ A;  2R93 A;  3VA7 A;  4XLP A;  4X6A C;  3OPF A;  3GTK K;  2R92 C;  4YFK A;  1R9T K;  4KMU A;  4DDQ A;  2FQO A;  4G0W A;  3GTP K;  2JA6 A;  2P5M A;  2D6F C;  2B63 K;  5IP7 K;  1WCM K;  1TWC K;  3SZZ A;  4C2M K;  2CFA B;  3L4K A;  2XCQ A;  1TWG K;  3BUE A;  4A3I K;  2A69 A;  4A3F K;  3A8I A;  2A6E A;  1EFW A;  2NVY A;  5D4D A;  4Y7N C;  1USO A;  3FOE A;  3S1R C;  2E2I A;  2NVT C;  3FKI A;  1G51 A;  1AB4 A;  3GIR A;  5C4J C;  4GZY A;  5CHP A;  1XZP A;  3PO3 C;  3T01 A;  5TMC A;  3CAG A; 
#chains in the Genus database with same CATH homology
 5IP7 C;  2NVY K;  3HOY C;  2R7Z K;  3M4O K;  2O5I A;  5IYD K;  4XSX A;  4KN7 A;  1SFO K;  4G7Z A;  4C3J K;  3HOU C;  3K7A K;  3S2D C;  1Y1W K;  2NVQ K;  4OIP A;  4OIR A;  3S14 K;  5C44 C;  3HKZ L;  3GTG K;  2PA8 D;  4A3F C;  4A93 K;  3WOD A;  3RZO K;  4A3L C;  5IP9 K;  4A3C C;  2E2H C;  1YNN A;  5FJ8 K;  1ZYR A;  3S17 C;  2E2H K;  4A3D C;  1I6V A;  4LK0 A;  4ZH4 A;  3RZD K;  3H0G K;  2E2I K;  2VUM K;  3S1M K;  1I3Q K;  3GTP C;  4BY1 C;  4OIQ A;  4Y52 K;  2NVY C;  2JA5 K;  4A3J C;  4BBR K;  2A68 A;  5M3M K;  3GTQ K;  3M4O C;  3S1R K;  4BY1 K;  5FLM K;  3HOV K;  1TWC C;  4YG2 A;  2YU9 K;  4A3B C;  4BXX C;  5FLM C;  3HOV C;  4A3B K;  4A3E C;  3S2D K;  3HOW K;  4G7H A;  1YNJ A;  5C44 K;  3HOW C;  3I4M K;  3HOU K;  4YFX A;  1Y1W C;  2PPB A;  3S15 K;  3GTL C;  4BY7 C;  3GTG C;  1BDF A;  4QIW D;  4A3L K;  3GTL K;  2PA8 L;  3RZO C;  5IYC C;  5TMC A;  4LLG A;  2B63 C;  3S1Q K;  2PMZ D;  3DXJ A;  3RZD C;  4A3C K;  1I50 K;  2WB1 L;  2NVT K;  3S2H K;  2WAQ L;  1I50 C;  1XPP A;  3GTM C;  3FKI C;  4BBR C;  2BE5 A;  2E2I C;  4OIN A;  4A3K C;  5C3E C;  4AYB D;  2YU9 C;  4QJV A;  4Y52 C;  4A3M K;  1SMY A;  2O5J A;  3HOX C;  2E2J K;  3GTJ C;  3GTQ C;  4A3M C;  2R93 C;  4YFN A;  4LJZ A;  3I4M C;  1K83 C;  3S15 C;  4KN4 A;  4BY7 K;  4A3I C;  3I4N C;  1Y1V C;  2JA8 C;  1Y1V K;  2WAQ D;  4LK1 A;  4A3G C;  4C3I K;  4MQ9 A;  4Y7N K;  4A3G K;  4QIW L;  1TWA K;  2NVX C;  2JA6 K;  3PO2 C;  2JA6 C;  3FKI K;  3GTO K;  2JA7 C;  3HOZ K;  1TWF C;  2PMZ L;  3H3V D;  3GTM K;  3HOX K;  2E2J C;  5C4X C;  2JA5 C;  5C3E K;  4C3H K;  5C4X K;  3CQZ K;  4MEX A;  4QJV B;  3GTJ K;  3CQZ C;  3M3Y C;  2R93 K;  3S1N K;  3EQL A;  5M5W K;  4NOI A;  3I4N K;  1SFO C;  3K7A C;  4Q5S A;  1I6H K;  1K83 K;  3S14 C;  1I6H C;  5IYB K;  2JA8 K;  4XLP A;  4A93 C;  2Y0S D;  4X6A C;  3GTK K;  4X6A K;  2R92 C;  4YFK A;  5IYC K;  1R9T K;  2A6H A;  2R92 K;  1TWF K;  2WB1 D;  4KMU A;  5M5Y K;  3S16 C;  4XSZ A;  2JA7 K;  3HOZ C;  1I3Q C;  3GTP K;  4G7O A;  4Q4Z A;  2B63 K;  4A3J K;  1HQM A;  1WCM C;  5IP7 K;  5IYD C;  2R7Z C;  3S1N C;  1WCM K;  2CW0 A;  1TWC K;  3PO3 K;  4A3D K;  1TWA C;  1TWH C;  4A3E K;  4C2M K;  3M3Y K;  3HKZ D;  3HOY K;  2NVQ C;  1IW7 A;  2Y0S L;  1TWG K;  4A3I K;  2A69 A;  4A3F K;  1TWG C;  3GTK C;  5M5X K;  2A6E A;  1R9T C;  4MEY A;  4OIO A;  5TMF A;  5IYB C;  5D4D A;  3S16 K;  3S1Q C;  4Y7N C;  5M3F K;  2NVX K;  3PO2 K;  4XLN A;  3S17 K;  2NVT C;  3GTO C;  5IP9 C;  3S2H C;  3H0G C;  4BBS C;  4BBS K;  4BXX K;  3H3V L;  5C4J C;  4A3K K;  4GZY A;  5C4J K;  4JK1 A;  2VUM C;  3PO3 C;  3S1R C;  4AYB L;  3S1M C;  1TWH K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...