5IYCK

Human core-pic in the initial transcribing state
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
117
Chain Sequence
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna
total genus 29
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5iycK00
2R93C 1R9TK 3H0GK 4BY1K 2PMZL 2PA8L 5IYDK 3GTJC 3RZOK 2A69A 1I50K 5IP7C 1I6VA 4Y52K 2O5IA 4OIOA 1TWGK 4GZYA 3HOVC 5C44C 1HQMA 3S15K 2NVYC 4OIPA 5M5XK 3H3VD 5FLMK 2NVQC 3EQLA 4A3MK 5FJ8K 1Y1WK 1TWCC 1K83C 2JA8C 3GTQK 3H3VL 2R7ZC 3HOWK 2VUMK 3GTGK 4A3KC 4C3JK 4C3IK 3FKIK 5C4JC 4LK1A 1SFOK 3CQZK 1BDFA 2JA5C 4G7OA 3S2DC 3K7AK 1I3QC 4A93K 1WCMK 1TWAC 4G7HA 4BBRC 5TMFA 5IYCC 4MQ9A 4XLNA 2R93K 2E2JC 2NVTK 1I6HC 2A68A 3GTJK 3M4OK 5M5WK 5IP7K 4C2MK 1Y1VC 3WODA 3PO2C 3HOVK 5C44K 2NVXK 1XPPA 4BBSC 2NVYK 2YU9C 3GTMC 2NVQK 5D4DA 4BXXC 3S1MC 3HOZK 4YG2A 3HOYC 4YFKA 1TWCK 1K83K 2JA7C 4YFNA 2E2IC 2R7ZK 2WAQD 3S1NC 4A3KK 3S14K 4KMUA 4BY7C 2B63C 3I4NK 3M3YC 5M5YK 4XSXA 4A3BC 2JA5K 2WAQL 4KN7A 4Y7NC 3RZDK 3S2HC 1I3QK 1TWFC 5IYBC 1TWAK 3PO3C 2WB1D 4MEYA 4BBRK 4OINA 1TWHC 3HKZD 5IYCK 5M3MK 2E2HC 2JA6C 3GTOC 4A3LC 2E2JK 3GTLC 2WB1L 4OIQA 1I6HK 3HKZL 3GTPC 4A3GC 2CW0A 4XLPA 4Q4ZA 2R92C 5IP9C 3S15C 1Y1VK 5C4XC 3GTKC 4MEXA 4KN4A 3S16C 2Y0SD 5C3EC 3PO2K 4A3CC 4A3EC 4LLGA 4A3FC 3DXJA 4XSZA 1Y1WC 3HOWC 2YU9K 3S1QC 4BBSK 3GTMK 2Y0SL 4NOIA 4YFXA 3HOXC 4BXXK 2O5JA 4JK1A 3HOUC 3S1MK 1IW7A 3FKIC 4A3JC 2JA7K 2JA8K 2E2IK 3I4MC 3S1NK 4X6AC 4BY7K 3S1RK 3S17C 2B63K 1SMYA 3M3YK 5C4JK 4C3HK 2A6EA 4A3DC 1WCMC 4A3IC 4Y7NK 3S1RC 3S2HK 3S2DK 1TWFK 5IYBK 1R9TC 3PO3K 3H0GC 4Q5SA 4BY1C 4QIWD 2NVTC 3GTOK 1TWHK 5IYDC 2E2HK 2JA6K 2BE5A 3M4OC 4A3LK 3RZOC 3GTLK 1I50C 4AYBD 4QIWL 4Y52C 1YNJA 3GTPK 4A3GK 1TWGC 2PPBA 2R92K 2NVXC 4QJVB 5IP9K 4AYBL 5C4XK 4OIRA 3GTKK 3S16K 5FLMC 5C3EK 4A3CK 4A3EK 1YNNA 4A3FK 3HOZC 4A3MC 3S1QK 3GTQC 2A6HA 3HOXK 3S14C 4LJZA 4ZH4A 2VUMC 3GTGC 3HOUK 3I4NC 4A3JK 3HOYK 5TMCA 1SFOC 3I4MK 4X6AK 3CQZC 4G7ZA 4QJVA 3S17K 3RZDC 5M3FK 3K7AC 4A3DK 4A3BK 4A93C 4A3IK 2PMZD 2PA8D 1ZYRA 4LK0A
chains in the Genus database with same CATH superfamily
1GE9A 1R9TK 2V6UA 3Q3QA 3GTJC 4C2MC 2GSUA 3HOVC 3H3VD 1VJEA 2JA8C 4A3KC 1I3QA 1SFOK 3TFJA 3VA7A 4G7OA 3K7AK 2NVTK 1I6HC 2A68A 1PJ7A 5M5WK 3L4KA 4GTFA 1Y1VC 3AD8C 3GEHA 3GTMA 4BBSC 3GIRA 1F9NA 2NVYK 3T00A 5D4DA 4WJ4A 4YFKA 1TWCK 1K83K 2ZUEA 4YFNA 2R7ZK 2WAQD 3S14K 2B63C 1TWFA 2JA5K 4KN7A 2GAGC 1IBAA 4PAAA 3PO3C 1O28A 2WB1D 4MEYA 1F7UA 3T01A 2E2JK 3GTLC 3MMLB 3HKZL 2CW0A 2R92C 4P9SA 4BLBA 3S15C 4MEXA 2Y0SD 4A3EC 4LLGA 3DXJA 1O2AA 3TTGA 1Y1WC 3S1QC 4BXXK 3HOXC 3N3YA 3HOUC 1EK8A 3ADAC 4A3JC 2JA8K 1WCMA 1USOA 3S17C 4O2DA 2A6EA 3H0GA 3AD7C 4Y7NK 1AB4A 1R9TC 3LPXA 3GTOK 1TWHK 4GFQA 2XCRB 1TWGA 2JA6K 4PABA 4QIWL 4A3GK 2NVXC 5TJ3A 3GTKK 1WOPA 3S16K 2CFAB 4A3CK 3FHZA 1DD5A 1YNNA 3HOZC 3V4GA 1L0WA 4KARA 4G0WA 3I4NC 1J6VA 1SFOC 4X6AK 5M3FK 1VH2A 2CFAA 3K7AC 4A3DK 1INNA 2PMZD 1ZYRA 3LAJA 2PA8L 3CAGA 5EGEA 1I50K 2O5IA 4KM9A 4GZYA 4LQYA 3S15K 2NVYC 5FJ8K 1B4BA 1Y1WK 1TWCC 1K83C 2R7ZC 2VUMK 3FOEA 3N0BA 1WORA 1BDFA 3CQZK 2JA5C 1BGWA 3S2DC 1J6XA 5IOTA 4A93K 3A8IA 2R93K 2E2JC 4GTLA 2W7VA 3S0XA 5IORA 2ZFZA 2YU9A 2Y3PA 2NVXK 1JVIA 2JA7A 4BXXC 2PHCB 3HOZK 4KC6A 4YG2A 3HOYC 5CHPA 1XZQB 1DCOA 3A8JA 3I4NK 5M5YK 4A3BC 3BP8C 1BJTA 1EH1A 4Y7NC 2E2HA 1I3QK 3GTOC 1USMA 1TWHC 1XZQA 5IYCK 3GTPA 2JA6C 4A3GC 1ZQ1C 3GTKC 3S16C 4A3CC 1J98A 1YX2A 3T02A 4XSZA 2O5JA 3GTMK 4NOIA 3TFHA 3FKIC 1EFWA 2E2IK 3S1NK 4X6AC 4BY7K 1IE0A 4A3DC 2ZUFA 2D6FC 3S2DK 1TWFK 5IYBK 4Q5SA 1F93A 3SZYA 3M4OC 1JQWA 1I50C 4AYBD 1YNJA 4KATA 5L46A 3HXAA 4QJVB 5IP9K 3GTQA 2R7ZA 3GEEA 3GTGA 1O27A 4LJZA 2VUMC 1DCHA 3HOYK 4KMDA 1XXAA 3CQZC 2KWAA 4QJVA 3RZDC 4G0UA 3NUHA 4A3BK 4A93C 1WOOA 4A3IK 4G0VA 4C45A 3GTJA 3TFIA 2R93C 3H0GK 1IQ0A 2A69A 3QX3A 1I6VA 1EI6A 1TWGK 1WOSA 1JOEA 5M5XK 3EQLA 4A3MK 2FQOA 3H3VL 5E68A 1G51A 3FKIK 2GSNA 3OPFA 1TWHA 2JA6A 1I3QC 2V6TA 4M1XA 1ZXOA 4G7HA 1WSVA 1WQFA 5TMFA 5IYCC 4MQ9A 1C0AA 1Y1VA 4KB4A 2FQTA 1F7VA 3M4OK 4KDDA 5IP7K 1WSRA 2XCQA 5C44K 1X31C 1XPPA 2V6SA 4RMFA 3GTMC 3IPJA 2NVQK 2B63A 2RGRA 2E2IC 3S1NC 4BY7C 1O2FB 4GTEA 4GTCA 2WAQL 3RZDK 1RU0A 4GTAA 1TWFC 3A8KA 5IYBC 3GTLA 1TWAK 4BBRK 3AQPA 3HKZD 2R92A 2WB1L 5HL8A 4BKWA 4XLPA 5IP9C 1Y1WA 4KN4A 3PO2K 3HOWC 2YU9K 2Y0SL 4JK1A 3S1MK 1IW7A 2JA7K 3ERED 3JSTA 3M3YK 4C3HK 1R9TA 3AH5A 1WCMC 4XCHA 4A3IC 1VRQC 4FZBA 1B4AA 4KASA 4P5AA 3S2HK 3G4AA 3GEIA 3H0GC 4KM8A 4QIWD 2E2HK 4A3LK 2BE5A 5IOSA 2NVXA 4LR2A 3GTPK 1TWGC 5C4XK 1XXCA 3GDZA 4OIRA 5C3EK 4WJ3M 1O25A 4A3FK 4A3MC 3BUEA 2GAHC 4DDQA 1WIHA 1SFOA 4ZH4A 2RH6A 1DCPA 3I4MK 4WILA 2PA8D 4LK0A 3S1RK 4GT9A 4J3NA 4BY1K 2PMZL 3AD9C 5IYDK 3RZOK 5IP7C 1ZBSA 2NVYA 4Y52K 4OIOA 5C44C 1HQMA 1TWCA 4OIPA 1K83A 2E2IA 5FLMK 2NVQC 1EQRA 2GSOA 4KMAA 3HOWK 3GTQK 2JA5A 3GTGK 4C3JK 4C3IK 3G4CA 3BP3A 5C4JC 4LK1A 2XCOA 1WQHA 1O29A 1WCMK 1TWAC 5JFEA 4BBRC 2P8TA 1O24A 4XLNA 3FOFA 4LOWA 3GTJK 4BLAA 1ISEA 4P5BA 4C2MK 4KB2A 3WODA 3PO2C 1VLOA 3HOVK 5CJ9A 2P5MA 2YU9C 3OREA 3S1MC 1YCLA 1PJ5A 2JA7C 1UV7A 4A3KK 4KMUA 3GSIA 2EBBA 1PJ6A 4GTDA 3M3YC 4XSXA 4C3HC 3GTOA 3S2HC 3N0CA 4OINA 5M3MK 2E2HC 4A3LC 1XXBA 5EGHA 4OIQA 4AH6A 5JVOA 3GTKA 3GTPC 1I6HK 1O26A 4Q4ZA 1O2BA 1BS2A 4KAWX 1Y1VK 5C4XC 5C3EC 4FM9A 3FKIA 4A3FC 4BBSK 1J6WA 1IL2A 4YFXA 3OEPA 3LAPA 4KMHA 3I4MC 3AQOA 1ZVUA 2B63K 1SMYA 5C4JK 1WQGA 3S1RC 1I50A 3PO3K 4BY1C 2NVTC 5IYDC 3RZOC 3GTLK 1KQ4A 3SZZA 4Y52C 2PPBA 2R92K 4AYBL 1IS1A 1XZPB 5FLMC 5IOQA 2VUMA 4A3EK 3S1QK 3L4JA 3GTQC 2A6HA 3CQZA 3HOXK 3S14C 3HOUK 3GTGC 1VGXA 4C3JC 4C3IC 2JH3A 4A3JK 5TMCA 1TWAA 4G7ZA 3S17K 1XZPA 2R93A 4ILDA 1V5VA 1HI9A 4GTBA
chains in the Genus database with same CATH topology
2R93C 1R9TK 3H0GK 4BY1K 2PMZL 2PA8L 5IYDK 3GTJC 3RZOK 2A69A 1I50K 5IP7C 1I6VA 4Y52K 2O5IA 4OIOA 1TWGK 4GZYA 3HOVC 5C44C 1HQMA 3S15K 2NVYC 4OIPA 5M5XK 3H3VD 5FLMK 2NVQC 3EQLA 4A3MK 5FJ8K 1Y1WK 1TWCC 1K83C 2JA8C 3GTQK 3H3VL 2R7ZC 3HOWK 2VUMK 3GTGK 4A3KC 4C3JK 4C3IK 3FKIK 5C4JC 4LK1A 1SFOK 3CQZK 1BDFA 2JA5C 4G7OA 3S2DC 3K7AK 1I3QC 4A93K 1WCMK 1TWAC 4G7HA 4BBRC 5TMFA 5IYCC 4MQ9A 4XLNA 2R93K 2E2JC 2NVTK 1I6HC 2A68A 3GTJK 3M4OK 5M5WK 5IP7K 4C2MK 1Y1VC 3WODA 3PO2C 3HOVK 5C44K 2NVXK 1XPPA 4BBSC 2NVYK 2YU9C 3GTMC 2NVQK 5D4DA 4BXXC 3S1MC 3HOZK 4YG2A 3HOYC 4YFKA 1TWCK 1K83K 2JA7C 4YFNA 2E2IC 2R7ZK 2WAQD 3S1NC 4A3KK 3S14K 4KMUA 4BY7C 2B63C 3I4NK 3M3YC 5M5YK 4XSXA 4A3BC 2JA5K 2WAQL 4KN7A 4Y7NC 3RZDK 3S2HC 1I3QK 1TWFC 5IYBC 1TWAK 3PO3C 2WB1D 4MEYA 4BBRK 4OINA 1TWHC 3HKZD 5IYCK 5M3MK 2E2HC 2JA6C 3GTOC 4A3LC 2E2JK 3GTLC 2WB1L 4OIQA 1I6HK 3HKZL 3GTPC 4A3GC 2CW0A 4XLPA 4Q4ZA 2R92C 5IP9C 3S15C 1Y1VK 5C4XC 3GTKC 4MEXA 4KN4A 3S16C 2Y0SD 5C3EC 3PO2K 4A3CC 4A3EC 4LLGA 4A3FC 3DXJA 4XSZA 1Y1WC 3HOWC 2YU9K 3S1QC 4BBSK 3GTMK 2Y0SL 4NOIA 4YFXA 3HOXC 4BXXK 2O5JA 4JK1A 3HOUC 3S1MK 1IW7A 3FKIC 4A3JC 2JA7K 2JA8K 2E2IK 3I4MC 3S1NK 4X6AC 4BY7K 3S1RK 3S17C 2B63K 1SMYA 3M3YK 5C4JK 4C3HK 2A6EA 4A3DC 1WCMC 4A3IC 4Y7NK 3S1RC 3S2HK 3S2DK 1TWFK 5IYBK 1R9TC 3PO3K 3H0GC 4Q5SA 4BY1C 4QIWD 2NVTC 3GTOK 1TWHK 5IYDC 2E2HK 2JA6K 2BE5A 3M4OC 4A3LK 3RZOC 3GTLK 1I50C 4AYBD 4QIWL 4Y52C 1YNJA 3GTPK 4A3GK 1TWGC 2PPBA 2R92K 2NVXC 4QJVB 5IP9K 4AYBL 5C4XK 4OIRA 3GTKK 3S16K 5FLMC 5C3EK 4A3CK 4A3EK 1YNNA 4A3FK 3HOZC 4A3MC 3S1QK 3GTQC 2A6HA 3HOXK 3S14C 4LJZA 4ZH4A 2VUMC 3GTGC 3HOUK 3I4NC 4A3JK 3HOYK 5TMCA 1SFOC 3I4MK 4X6AK 3CQZC 4G7ZA 4QJVA 3S17K 3RZDC 5M3FK 3K7AC 4A3DK 4A3BK 4A93C 4A3IK 2PMZD 2PA8D 1ZYRA 4LK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R93 C;  1R9T K;  3H0G K;  4BY1 K;  2PMZ L;  2PA8 L;  5IYD K;  3GTJ C;  3RZO K;  2A69 A;  1I50 K;  5IP7 C;  1I6V A;  4Y52 K;  2O5I A;  4OIO A;  1TWG K;  4GZY A;  3HOV C;  5C44 C;  1HQM A;  3S15 K;  2NVY C;  4OIP A;  5M5X K;  3H3V D;  5FLM K;  2NVQ C;  3EQL A;  4A3M K;  5FJ8 K;  1Y1W K;  1TWC C;  1K83 C;  2JA8 C;  3GTQ K;  3H3V L;  2R7Z C;  3HOW K;  2VUM K;  3GTG K;  4A3K C;  4C3J K;  4C3I K;  3FKI K;  5C4J C;  4LK1 A;  1SFO K;  3CQZ K;  1BDF A;  2JA5 C;  4G7O A;  3S2D C;  3K7A K;  1I3Q C;  4A93 K;  1WCM K;  1TWA C;  4G7H A;  4BBR C;  5TMF A;  5IYC C;  4MQ9 A;  4XLN A;  2R93 K;  2E2J C;  2NVT K;  1I6H C;  2A68 A;  3GTJ K;  3M4O K;  5M5W K;  5IP7 K;  4C2M K;  1Y1V C;  3WOD A;  3PO2 C;  3HOV K;  5C44 K;  2NVX K;  1XPP A;  4BBS C;  2NVY K;  2YU9 C;  3GTM C;  2NVQ K;  5D4D A;  4BXX C;  3S1M C;  3HOZ K;  4YG2 A;  3HOY C;  4YFK A;  1TWC K;  1K83 K;  2JA7 C;  4YFN A;  2E2I C;  2R7Z K;  2WAQ D;  3S1N C;  4A3K K;  3S14 K;  4KMU A;  4BY7 C;  2B63 C;  3I4N K;  3M3Y C;  5M5Y K;  4XSX A;  4A3B C;  2JA5 K;  2WAQ L;  4KN7 A;  4Y7N C;  3RZD K;  3S2H C;  1I3Q K;  1TWF C;  5IYB C;  1TWA K;  3PO3 C;  2WB1 D;  4MEY A;  4BBR K;  4OIN A;  1TWH C;  3HKZ D;  5IYC K;  5M3M K;  2E2H C;  2JA6 C;  3GTO C;  4A3L C;  2E2J K;  3GTL C;  2WB1 L;  4OIQ A;  1I6H K;  3HKZ L;  3GTP C;  4A3G C;  2CW0 A;  4XLP A;  4Q4Z A;  2R92 C;  5IP9 C;  3S15 C;  1Y1V K;  5C4X C;  3GTK C;  4MEX A;  4KN4 A;  3S16 C;  2Y0S D;  5C3E C;  3PO2 K;  4A3C C;  4A3E C;  4LLG A;  4A3F C;  3DXJ A;  4XSZ A;  1Y1W C;  3HOW C;  2YU9 K;  3S1Q C;  4BBS K;  3GTM K;  2Y0S L;  4NOI A;  4YFX A;  3HOX C;  4BXX K;  2O5J A;  4JK1 A;  3HOU C;  3S1M K;  1IW7 A;  3FKI C;  4A3J C;  2JA7 K;  2JA8 K;  2E2I K;  3I4M C;  3S1N K;  4X6A C;  4BY7 K;  3S1R K;  3S17 C;  2B63 K;  1SMY A;  3M3Y K;  5C4J K;  4C3H K;  2A6E A;  4A3D C;  1WCM C;  4A3I C;  4Y7N K;  3S1R C;  3S2H K;  3S2D K;  1TWF K;  5IYB K;  1R9T C;  3PO3 K;  3H0G C;  4Q5S A;  4BY1 C;  4QIW D;  2NVT C;  3GTO K;  1TWH K;  5IYD C;  2E2H K;  2JA6 K;  2BE5 A;  3M4O C;  4A3L K;  3RZO C;  3GTL K;  1I50 C;  4AYB D;  4QIW L;  4Y52 C;  1YNJ A;  3GTP K;  4A3G K;  1TWG C;  2PPB A;  2R92 K;  2NVX C;  4QJV B;  5IP9 K;  4AYB L;  5C4X K;  4OIR A;  3GTK K;  3S16 K;  5FLM C;  5C3E K;  4A3C K;  4A3E K;  1YNN A;  4A3F K;  3HOZ C;  4A3M C;  3S1Q K;  3GTQ C;  2A6H A;  3HOX K;  3S14 C;  4LJZ A;  4ZH4 A;  2VUM C;  3GTG C;  3HOU K;  3I4N C;  4A3J K;  3HOY K;  5TMC A;  1SFO C;  3I4M K;  4X6A K;  3CQZ C;  4G7Z A;  4QJV A;  3S17 K;  3RZD C;  5M3F K;  3K7A C;  4A3D K;  4A3B K;  4A93 C;  4A3I K;  2PMZ D;  2PA8 D;  1ZYR A;  4LK0 A; 
#chains in the Genus database with same CATH topology
 1GE9 A;  1R9T K;  2V6U A;  3Q3Q A;  3GTJ C;  4C2M C;  2GSU A;  3HOV C;  3H3V D;  1VJE A;  2JA8 C;  4A3K C;  1I3Q A;  1SFO K;  3TFJ A;  3VA7 A;  4G7O A;  3K7A K;  2NVT K;  1I6H C;  2A68 A;  1PJ7 A;  5M5W K;  3L4K A;  4GTF A;  1Y1V C;  3AD8 C;  3GEH A;  3GTM A;  4BBS C;  3GIR A;  1F9N A;  2NVY K;  3T00 A;  5D4D A;  4WJ4 A;  4YFK A;  1TWC K;  1K83 K;  2ZUE A;  4YFN A;  2R7Z K;  2WAQ D;  3S14 K;  2B63 C;  1TWF A;  2JA5 K;  4KN7 A;  2GAG C;  1IBA A;  4PAA A;  3PO3 C;  1O28 A;  2WB1 D;  4MEY A;  1F7U A;  3T01 A;  2E2J K;  3GTL C;  3MML B;  3HKZ L;  2CW0 A;  2R92 C;  4P9S A;  4BLB A;  3S15 C;  4MEX A;  2Y0S D;  4A3E C;  4LLG A;  3DXJ A;  1O2A A;  3TTG A;  1Y1W C;  3S1Q C;  4BXX K;  3HOX C;  3N3Y A;  3HOU C;  1EK8 A;  3ADA C;  4A3J C;  2JA8 K;  1WCM A;  1USO A;  3S17 C;  4O2D A;  2A6E A;  3H0G A;  3AD7 C;  4Y7N K;  1AB4 A;  1R9T C;  3LPX A;  3GTO K;  1TWH K;  4GFQ A;  2XCR B;  1TWG A;  2JA6 K;  4PAB A;  4QIW L;  4A3G K;  2NVX C;  5TJ3 A;  3GTK K;  1WOP A;  3S16 K;  2CFA B;  4A3C K;  3FHZ A;  1DD5 A;  1YNN A;  3HOZ C;  3V4G A;  1L0W A;  4KAR A;  4G0W A;  3I4N C;  1J6V A;  1SFO C;  4X6A K;  5M3F K;  1VH2 A;  2CFA A;  3K7A C;  4A3D K;  1INN A;  2PMZ D;  1ZYR A;  3LAJ A;  2PA8 L;  3CAG A;  5EGE A;  1I50 K;  2O5I A;  4KM9 A;  4GZY A;  4LQY A;  3S15 K;  2NVY C;  5FJ8 K;  1B4B A;  1Y1W K;  1TWC C;  1K83 C;  2R7Z C;  2VUM K;  3FOE A;  3N0B A;  1WOR A;  1BDF A;  3CQZ K;  2JA5 C;  1BGW A;  3S2D C;  1J6X A;  5IOT A;  4A93 K;  3A8I A;  2R93 K;  2E2J C;  4GTL A;  2W7V A;  3S0X A;  5IOR A;  2ZFZ A;  2YU9 A;  2Y3P A;  2NVX K;  1JVI A;  2JA7 A;  4BXX C;  2PHC B;  3HOZ K;  4KC6 A;  4YG2 A;  3HOY C;  5CHP A;  1XZQ B;  1DCO A;  3A8J A;  3I4N K;  5M5Y K;  4A3B C;  3BP8 C;  1BJT A;  1EH1 A;  4Y7N C;  2E2H A;  1I3Q K;  3GTO C;  1USM A;  1TWH C;  1XZQ A;  5IYC K;  3GTP A;  2JA6 C;  4A3G C;  1ZQ1 C;  3GTK C;  3S16 C;  4A3C C;  1J98 A;  1YX2 A;  3T02 A;  4XSZ A;  2O5J A;  3GTM K;  4NOI A;  3TFH A;  3FKI C;  1EFW A;  2E2I K;  3S1N K;  4X6A C;  4BY7 K;  1IE0 A;  4A3D C;  2ZUF A;  2D6F C;  3S2D K;  1TWF K;  5IYB K;  4Q5S A;  1F93 A;  3SZY A;  3M4O C;  1JQW A;  1I50 C;  4AYB D;  1YNJ A;  4KAT A;  5L46 A;  3HXA A;  4QJV B;  5IP9 K;  3GTQ A;  2R7Z A;  3GEE A;  3GTG A;  1O27 A;  4LJZ A;  2VUM C;  1DCH A;  3HOY K;  4KMD A;  1XXA A;  3CQZ C;  2KWA A;  4QJV A;  3RZD C;  4G0U A;  3NUH A;  4A3B K;  4A93 C;  1WOO A;  4A3I K;  4G0V A;  4C45 A;  3GTJ A;  3TFI A;  2R93 C;  3H0G K;  1IQ0 A;  2A69 A;  3QX3 A;  1I6V A;  1EI6 A;  1TWG K;  1WOS A;  1JOE A;  5M5X K;  3EQL A;  4A3M K;  2FQO A;  3H3V L;  5E68 A;  1G51 A;  3FKI K;  2GSN A;  3OPF A;  1TWH A;  2JA6 A;  1I3Q C;  2V6T A;  4M1X A;  1ZXO A;  4G7H A;  1WSV A;  1WQF A;  5TMF A;  5IYC C;  4MQ9 A;  1C0A A;  1Y1V A;  4KB4 A;  2FQT A;  1F7V A;  3M4O K;  4KDD A;  5IP7 K;  1WSR A;  2XCQ A;  5C44 K;  1X31 C;  1XPP A;  2V6S A;  4RMF A;  3GTM C;  3IPJ A;  2NVQ K;  2B63 A;  2RGR A;  2E2I C;  3S1N C;  4BY7 C;  1O2F B;  4GTE A;  4GTC A;  2WAQ L;  3RZD K;  1RU0 A;  4GTA A;  1TWF C;  3A8K A;  5IYB C;  3GTL A;  1TWA K;  4BBR K;  3AQP A;  3HKZ D;  2R92 A;  2WB1 L;  5HL8 A;  4BKW A;  4XLP A;  5IP9 C;  1Y1W A;  4KN4 A;  3PO2 K;  3HOW C;  2YU9 K;  2Y0S L;  4JK1 A;  3S1M K;  1IW7 A;  2JA7 K;  3ERE D;  3JST A;  3M3Y K;  4C3H K;  1R9T A;  3AH5 A;  1WCM C;  4XCH A;  4A3I C;  1VRQ C;  4FZB A;  1B4A A;  4KAS A;  4P5A A;  3S2H K;  3G4A A;  3GEI A;  3H0G C;  4KM8 A;  4QIW D;  2E2H K;  4A3L K;  2BE5 A;  5IOS A;  2NVX A;  4LR2 A;  3GTP K;  1TWG C;  5C4X K;  1XXC A;  3GDZ A;  4OIR A;  5C3E K;  4WJ3 M;  1O25 A;  4A3F K;  4A3M C;  3BUE A;  2GAH C;  4DDQ A;  1WIH A;  1SFO A;  4ZH4 A;  2RH6 A;  1DCP A;  3I4M K;  4WIL A;  2PA8 D;  4LK0 A;  3S1R K;  4GT9 A;  4J3N A;  4BY1 K;  2PMZ L;  3AD9 C;  5IYD K;  3RZO K;  5IP7 C;  1ZBS A;  2NVY A;  4Y52 K;  4OIO A;  5C44 C;  1HQM A;  1TWC A;  4OIP A;  1K83 A;  2E2I A;  5FLM K;  2NVQ C;  1EQR A;  2GSO A;  4KMA A;  3HOW K;  3GTQ K;  2JA5 A;  3GTG K;  4C3J K;  4C3I K;  3G4C A;  3BP3 A;  5C4J C;  4LK1 A;  2XCO A;  1WQH A;  1O29 A;  1WCM K;  1TWA C;  5JFE A;  4BBR C;  2P8T A;  1O24 A;  4XLN A;  3FOF A;  4LOW A;  3GTJ K;  4BLA A;  1ISE A;  4P5B A;  4C2M K;  4KB2 A;  3WOD A;  3PO2 C;  1VLO A;  3HOV K;  5CJ9 A;  2P5M A;  2YU9 C;  3ORE A;  3S1M C;  1YCL A;  1PJ5 A;  2JA7 C;  1UV7 A;  4A3K K;  4KMU A;  3GSI A;  2EBB A;  1PJ6 A;  4GTD A;  3M3Y C;  4XSX A;  4C3H C;  3GTO A;  3S2H C;  3N0C A;  4OIN A;  5M3M K;  2E2H C;  4A3L C;  1XXB A;  5EGH A;  4OIQ A;  4AH6 A;  5JVO A;  3GTK A;  3GTP C;  1I6H K;  1O26 A;  4Q4Z A;  1O2B A;  1BS2 A;  4KAW X;  1Y1V K;  5C4X C;  5C3E C;  4FM9 A;  3FKI A;  4A3F C;  4BBS K;  1J6W A;  1IL2 A;  4YFX A;  3OEP A;  3LAP A;  4KMH A;  3I4M C;  3AQO A;  1ZVU A;  2B63 K;  1SMY A;  5C4J K;  1WQG A;  3S1R C;  1I50 A;  3PO3 K;  4BY1 C;  2NVT C;  5IYD C;  3RZO C;  3GTL K;  1KQ4 A;  3SZZ A;  4Y52 C;  2PPB A;  2R92 K;  4AYB L;  1IS1 A;  1XZP B;  5FLM C;  5IOQ A;  2VUM A;  4A3E K;  3S1Q K;  3L4J A;  3GTQ C;  2A6H A;  3CQZ A;  3HOX K;  3S14 C;  3HOU K;  3GTG C;  1VGX A;  4C3J C;  4C3I C;  2JH3 A;  4A3J K;  5TMC A;  1TWA A;  4G7Z A;  3S17 K;  1XZP A;  2R93 A;  4ILD A;  1V5V A;  1HI9 A;  4GTB A; 
#chains in the Genus database with same CATH homology
 2R93 C;  1R9T K;  3H0G K;  4BY1 K;  2PMZ L;  2PA8 L;  5IYD K;  3GTJ C;  3RZO K;  2A69 A;  1I50 K;  5IP7 C;  1I6V A;  4Y52 K;  2O5I A;  4OIO A;  1TWG K;  4GZY A;  3HOV C;  5C44 C;  1HQM A;  3S15 K;  2NVY C;  4OIP A;  5M5X K;  3H3V D;  5FLM K;  2NVQ C;  3EQL A;  4A3M K;  5FJ8 K;  1Y1W K;  1TWC C;  1K83 C;  2JA8 C;  3GTQ K;  3H3V L;  2R7Z C;  3HOW K;  2VUM K;  3GTG K;  4A3K C;  4C3J K;  4C3I K;  3FKI K;  5C4J C;  4LK1 A;  1SFO K;  3CQZ K;  1BDF A;  2JA5 C;  4G7O A;  3S2D C;  3K7A K;  1I3Q C;  4A93 K;  1WCM K;  1TWA C;  4G7H A;  4BBR C;  5TMF A;  5IYC C;  4MQ9 A;  4XLN A;  2R93 K;  2E2J C;  2NVT K;  1I6H C;  2A68 A;  3GTJ K;  3M4O K;  5M5W K;  5IP7 K;  4C2M K;  1Y1V C;  3WOD A;  3PO2 C;  3HOV K;  5C44 K;  2NVX K;  1XPP A;  4BBS C;  2NVY K;  2YU9 C;  3GTM C;  2NVQ K;  5D4D A;  4BXX C;  3S1M C;  3HOZ K;  4YG2 A;  3HOY C;  4YFK A;  1TWC K;  1K83 K;  2JA7 C;  4YFN A;  2E2I C;  2R7Z K;  2WAQ D;  3S1N C;  4A3K K;  3S14 K;  4KMU A;  4BY7 C;  2B63 C;  3I4N K;  3M3Y C;  5M5Y K;  4XSX A;  4A3B C;  2JA5 K;  2WAQ L;  4KN7 A;  4Y7N C;  3RZD K;  3S2H C;  1I3Q K;  1TWF C;  5IYB C;  1TWA K;  3PO3 C;  2WB1 D;  4MEY A;  4BBR K;  4OIN A;  1TWH C;  3HKZ D;  5IYC K;  5M3M K;  2E2H C;  2JA6 C;  3GTO C;  4A3L C;  2E2J K;  3GTL C;  2WB1 L;  4OIQ A;  1I6H K;  3HKZ L;  3GTP C;  4A3G C;  2CW0 A;  4XLP A;  4Q4Z A;  2R92 C;  5IP9 C;  3S15 C;  1Y1V K;  5C4X C;  3GTK C;  4MEX A;  4KN4 A;  3S16 C;  2Y0S D;  5C3E C;  3PO2 K;  4A3C C;  4A3E C;  4LLG A;  4A3F C;  3DXJ A;  4XSZ A;  1Y1W C;  3HOW C;  2YU9 K;  3S1Q C;  4BBS K;  3GTM K;  2Y0S L;  4NOI A;  4YFX A;  3HOX C;  4BXX K;  2O5J A;  4JK1 A;  3HOU C;  3S1M K;  1IW7 A;  3FKI C;  4A3J C;  2JA7 K;  2JA8 K;  2E2I K;  3I4M C;  3S1N K;  4X6A C;  4BY7 K;  3S1R K;  3S17 C;  2B63 K;  1SMY A;  3M3Y K;  5C4J K;  4C3H K;  2A6E A;  4A3D C;  1WCM C;  4A3I C;  4Y7N K;  3S1R C;  3S2H K;  3S2D K;  1TWF K;  5IYB K;  1R9T C;  3PO3 K;  3H0G C;  4Q5S A;  4BY1 C;  4QIW D;  2NVT C;  3GTO K;  1TWH K;  5IYD C;  2E2H K;  2JA6 K;  2BE5 A;  3M4O C;  4A3L K;  3RZO C;  3GTL K;  1I50 C;  4AYB D;  4QIW L;  4Y52 C;  1YNJ A;  3GTP K;  4A3G K;  1TWG C;  2PPB A;  2R92 K;  2NVX C;  4QJV B;  5IP9 K;  4AYB L;  5C4X K;  4OIR A;  3GTK K;  3S16 K;  5FLM C;  5C3E K;  4A3C K;  4A3E K;  1YNN A;  4A3F K;  3HOZ C;  4A3M C;  3S1Q K;  3GTQ C;  2A6H A;  3HOX K;  3S14 C;  4LJZ A;  4ZH4 A;  2VUM C;  3GTG C;  3HOU K;  3I4N C;  4A3J K;  3HOY K;  5TMC A;  1SFO C;  3I4M K;  4X6A K;  3CQZ C;  4G7Z A;  4QJV A;  3S17 K;  3RZD C;  5M3F K;  3K7A C;  4A3D K;  4A3B K;  4A93 C;  4A3I K;  2PMZ D;  2PA8 D;  1ZYR A;  4LK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...