5IYCK

Human core-pic in the initial transcribing state
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
117
Chain Sequence
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 29
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5iycK00
4A3EC 5TMCA 4A3DC 3FKIC 3S1MC 4BBRC 3GTMC 5D4DA 5C4XK 3I4MC 3S16C 2JA8K 1I6HC 2WAQL 2PPBA 4BXXC 4X6AC 2PA8D 2A68A 3GTQK 5M3FK 3CQZC 4YG2A 3PO3K 3GTLC 3K7AK 4A3KC 3WODA 2NVXC 3GTQC 4A3LC 5M5WK 2A69A 3HOXK 1TWCK 2JA8C 3HOWK 2A6HA 3S2DK 1I6HK 3H3VL 1TWHK 4QIWD 4GZYA 2NVXK 1TWGK 3FKIK 3H0GC 3GTOC 4JK1A 2A6EA 2NVYC 3HOZC 3GTKC 3I4NK 1Y1WC 5IP7K 3HOXC 3H3VD 4NOIA 4BBSC 2JA5K 3HKZD 4QJVA 2R93C 4KMUA 3GTGC 3S1MK 4Y7NC 4BBSK 1TWAC 3DXJA 4A3IK 3RZOK 3S17K 5C44C 3HOVC 2NVQK 3I4NC 4BXXK 2R7ZC 4QJVB 4Y52K 5C3EC 2R92C 4A3CK 2Y0SD 1WCMC 3HKZL 4BY1C 4XSZA 4A3JC 4MQ9A 4YFKA 4BY7K 4Y52C 3CQZK 2NVQC 1SFOC 2YU9C 1I6VA 1K83K 2JA6C 3GTGK 5IYCC 4A3FC 4A3MC 4KN4A 4X6AK 3RZDC 4A3EK 4LK1A 5IP7C 1BDFA 4G7OA 2NVYK 2O5IA 5TMFA 3GTLK 3RZDK 4OIQA 4BY1K 2PMZL 3PO2K 3M3YK 2PA8L 4A3FK 2WAQD 2Y0SL 2O5JA 4G7HA 5FLMK 1YNJA 3K7AC 4A3KK 1TWAK 2PMZD 3S1QK 3HOZK 4C2MK 3HOYC 5IYDK 1XPPA 2CW0A 4XLNA 2JA7K 1YNNA 3S14C 2R93K 4OIPA 1TWCC 3HOWC 5C4JC 3GTPK 4A3JK 3M4OK 3S2DC 5C4XC 4BBRK 2JA7C 4OIOA 3GTMK 3I4MK 1Y1WK 4A3IC 3PO2C 3GTOK 3S17C 4A3BC 5M5YK 2VUMC 2R7ZK 4XLPA 1I3QK 3S15C 2BE5A 3GTJC 4C3JK 4A3LK 4KN7A 4Y7NK 5C4JK 1R9TK 3M4OC 2E2HC 1TWFK 4OIRA 3M3YC 2E2JC 2NVTC 4C3HK 4A3CC 4MEXA 2E2IC 1TWHC 4C3IK 3GTKK 3GTPC 1I50K 1Y1VC 3S2HK 5IYBC 5FLMC 4A93C 4BY7C 1R9TC 4G7ZA 2NVTK 4A3GK 4A3MK 2E2HK 4YFNA 2VUMK 4LLGA 4LK0A 5IYBK 3S15K 2YU9K 1K83C 2JA5C 2JA6K 3S1QC 4Q5SA 4Q4ZA 3GTJK 2E2IK 3HOVK 1SFOK 4A3GC 2B63K 1I50C 5M3MK 3S2HC 3HOUK 5IP9K 1TWFC 4QIWL 4A3BK 2E2JK 1SMYA 2WB1D 1WCMK 3HOYK 4OINA 4A3DK 5C3EK 2R92K 5IP9C 4AYBL 3S1RK 1Y1VK 4A93K 1ZYRA 1IW7A 4XSXA 3RZOC 1I3QC 4YFXA 3S1NK 4AYBD 1TWGC 3H0GK 4LJZA 5FJ8K 3S1RC 3PO3C 5IYCK 3EQLA 5M5XK 2WB1L 1HQMA 4ZH4A 4MEYA 3S1NC 2B63C 3HOUC 3S16K 3S14K 5IYDC 5C44K
chains in the Genus database with same CATH superfamily
2EBBA 4A3EC 3GEIA 5TMCA 3FKIC 3S1MC 3SZYA 3S16C 5TJ3A 1O2BA 3FHZA 3FKIA 1WQFA 2NVXC 1ZBSA 4C3JC 4A3LC 2A69A 3HOWK 3S2DK 1PJ5A 2NVXK 3G4CA 2D6FC 3TFJA 1I3QA 4BLBA 3H3VD 4KATA 3HKZD 4QJVA 2YU9A 3S1MK 1O26A 3DXJA 3S17K 3RZOK 2B63A 5C44C 1IBAA 4LQYA 4M1XA 1TWGA 2GSUA 3HKZL 1J6XA 4XSZA 1F9NA 4YFKA 1O24A 2NVQC 4PAAA 5L46A 1XXAA 2YU9C 1K83K 1ZXOA 5IYCC 3LPXA 4XCHA 3RZDC 4KMHA 2NVYK 5TMFA 3GTJA 3RZDK 3AD7C 3PO2K 1O2AA 3GTPA 1XZPA 1TWHA 2NVXA 4G7HA 4BLAA 3K7AC 2PMZD 3S1QK 3HOZK 4WJ3M 3LAPA 5HL8A 4P9SA 1TWCC 4A3JK 4BBRK 4OIOA 3PO2C 3S17C 1J6WA 4A3BC 2CFAA 3FOFA 1R9TK 4OIRA 1AB4A 3GTMA 4GTAA 4C3HK 1WOPA 2E2IC 1TWHC 3GTKK 1V5VA 3GTPC 4C45A 5IYBC 3S15K 4LK0A 3N0BA 3LAJA 2YU9K 1SFOK 1I50C 5IP9K 1VJEA 4QIWL 2E2JK 1SMYA 1JQWA 3L4KA 4OINA 4KASA 2KWAA 4AYBL 3QX3A 4XSXA 1XXCA 3TFIA 2RGRA 4DDQA 2E2HA 1TWGC 4BKWA 3PO3C 3FOEA 1O2FB 1R9TA 5C4XC 3S14K 5C44K 3AQOA 1XZPB 3OREA 4BBRC 5D4DA 5C4XK 3IPJA 1I6HC 4BXXC 4PABA 2PA8D 3GTQK 3GTOA 4C3HC 3PO3K 2VUMA 4A3KC 3GTQC 1IQ0A 5M5WK 2A6HA 3NUHA 1TWHK 3CQZA 3MMLB 3H0GC 2XCRB 4JK1A 1X31C 2NVYC 3BUEA 5IP7K 4LR2A 3HOXC 3GTGC 4Y7NC 4BBSK 3Q3QA 1RU0A 2NVQK 2FQTA 3I4NC 4QJVB 3L4JA 4Y52K 1G51A 2Y0SD 1WCMC 4A3JC 4Y52C 3CQZK 4J3NA 1SFOC 2V6UA 1I6VA 2JA6C 3GTGK 1IS1A 4A3MC 4KN4A 1PJ6A 1WIHA 1Y1WA 5IP7C 5E68A 4G7OA 3CAGA 2O5IA 4OIQA 3GTGA 4KAWX 1YNJA 4A3KK 1TWCA 4XLNA 1F7VA 2JA7K 4KM9A 5C4JC 3M4OK 1USMA 4A3IC 2XCQA 3AQPA 5M5YK 2VUMC 3GTJC 4KN7A 4Y7NK 1WSRA 2E2HC 2P5MA 4A3CC 3OPFA 2GAGC 1I50K 4AH6A 5FLMC 3GDZA 1R9TC 1DCPA 2VUMK 4KM8A 4LLGA 2JA6K 3T00A 3GTJK 2E2IK 1VH2A 3HOUK 2WB1D 1WCMK 2R92K 1O25A 1F93A 1J6VA 1ZYRA 3RZOC 1WSVA 3S1NK 1YX2A 3EQLA 5M5XK 1J98A 3AD9C 3BP8C 4GTFA 1HQMA 4MEYA 3GIRA 3S16K 4GTLA 1EQRA 3GEEA 4A3DC 1DCHA 3GTMC 3I4MC 1EK8A 1IL2A 2WAQL 2NVYA 2PPBA 4X6AC 2A68A 5M3FK 2ZFZA 3CQZC 3K7AK 3WODA 1GE9A 3HOXK 2JA8C 1I6HK 4WILA 3H3VL 2P8TA 4QIWD 4GZYA 3FKIK 3GTOC 4P5BA 2A6EA 3HOZC 4FM9A 3GTKC 3I4NK 1INNA 2JA5K 2FQOA 4GTCA 1JVIA 1TWAC 2W7VA 3HOVC 2GSNA 4KDDA 5C3EC 2R92C 1XZQB 1F7UA 4MQ9A 4BY7K 4GTBA 3ADAC 1WQGA 4A3FC 4X6AK 1BS2A 1YCLA 4A3EK 4LK1A 2JH3A 3SZZA 2R92A 1EFWA 2PHCB 4KMAA 2PMZL 3A8IA 3GSIA 2WAQD 2O5JA 4GT9A 2E2IA 2JA7A 4C2MK 3HOYC 5IYDK 1JOEA 1XPPA 2CW0A 1EH1A 1YNNA 3S14C 4P5AA 1O27A 3GTPK 3V4GA 1VGXA 4GTDA 3S15C 4XLPA 1I3QK 4WJ4A 4C3JK 4A3LK 5C4JK 3M4OC 1BJTA 2E2JC 2ZUFA 1Y1VC 4A93C 4BY7C 4G7ZA 2E2HK 5IYBK 4GFQA 1K83C 4Q5SA 3HOVK 2JA5A 2B63K 3S2HC 1XZQA 1ISEA 5M3MK 1VLOA 2R7ZA 4A3BK 1WOOA 3ERED 3AH5A 2XCOA 5IP9C 3S1RK 1Y1VK 4A93K 2R93A 1IW7A 5EGHA 4YFXA 5JFEA 3H0GK 3S1RC 3T01A 5IYCK 4KB4A 4KARA 1KQ4A 2WB1L 1DD5A 2B63C 1TWAA 5IYDC 1UV7A 1WQHA 4KB2A 3GTQA 3GTLA 3VA7A 3N3YA 3HXAA 3AD8C 2JA8K 3A8JA 5IOSA 5IORA 4YG2A 1WORA 3N0CA 5IOTA 1USOA 3TTGA 3GTLC 3TFHA 1TWCK 1BGWA 1TWGK 2ZUEA 2CFAB 1C0AA 4C3IC 1Y1WC 4NOIA 4O2DA 4BBSC 3OEPA 2R93C 4KMUA 3BP3A 1SFOA 4A3IK 4BXXK 2R7ZC 1ZVUA 1I50A 4A3CK 1B4AA 4BY1C 1IE0A 2V6TA 2GSOA 1TWFA 1WCMA 1BDFA 3A8KA 4KC6A 3GTLK 4BY1K 3M3YK 2PA8L 4A3FK 1DCOA 2Y0SL 3JSTA 2V6SA 5FLMK 1TWAK 4G0WA 4RMFA 5CHPA 3G4AA 3H0GA 4KMDA 2R93K 4OIPA 5CJ9A 3HOWC 3T02A 3S2DC 3GTMK 3S0XA 2JA7C 3I4MK 1Y1WK 3GTOK 2Y3PA 2R7ZK 2BE5A 1WOSA 4GTEA 5IOQA 4ILDA 1TWFK 1ZQ1C 2GAHC 3M3YC 2NVTC 5EGEA 4MEXA 4C3IK 3S2HK 1O28A 2NVTK 4A3GK 2RH6A 4A3MK 4YFNA 4G0VA 2JA5C 3S1QC 4A3GC 4Q4ZA 1XXBA 1EI6A 1TWFC 1O29A 4LOWA 2JA6A 3HOYK 1PJ7A 4A3DK 1B4BA 5C3EK 4FZBA 1I3QC 5FJ8K 1HI9A 4AYBD 4LJZA 3GEHA 1K83A 3GTKA 4G0UA 1VRQC 4ZH4A 3S1NC 5JVOA 3HOUC 1L0WA 1Y1VA 4C2MC
chains in the Genus database with same CATH topology
4A3EC 5TMCA 4A3DC 3FKIC 3S1MC 4BBRC 3GTMC 5D4DA 5C4XK 3I4MC 3S16C 2JA8K 1I6HC 2WAQL 2PPBA 4BXXC 4X6AC 2PA8D 2A68A 3GTQK 5M3FK 3CQZC 4YG2A 3PO3K 3GTLC 3K7AK 4A3KC 3WODA 2NVXC 3GTQC 4A3LC 5M5WK 2A69A 3HOXK 1TWCK 2JA8C 3HOWK 2A6HA 3S2DK 1I6HK 3H3VL 1TWHK 4QIWD 4GZYA 2NVXK 1TWGK 3FKIK 3H0GC 3GTOC 4JK1A 2A6EA 2NVYC 3HOZC 3GTKC 3I4NK 1Y1WC 5IP7K 3HOXC 3H3VD 4NOIA 4BBSC 2JA5K 3HKZD 4QJVA 2R93C 4KMUA 3GTGC 3S1MK 4Y7NC 4BBSK 1TWAC 3DXJA 4A3IK 3RZOK 3S17K 5C44C 3HOVC 2NVQK 3I4NC 4BXXK 2R7ZC 4QJVB 4Y52K 5C3EC 2R92C 4A3CK 2Y0SD 1WCMC 3HKZL 4BY1C 4XSZA 4A3JC 4MQ9A 4YFKA 4BY7K 4Y52C 3CQZK 2NVQC 1SFOC 2YU9C 1I6VA 1K83K 2JA6C 3GTGK 5IYCC 4A3FC 4A3MC 4KN4A 4X6AK 3RZDC 4A3EK 4LK1A 5IP7C 1BDFA 4G7OA 2NVYK 2O5IA 5TMFA 3GTLK 3RZDK 4OIQA 4BY1K 2PMZL 3PO2K 3M3YK 2PA8L 4A3FK 2WAQD 2Y0SL 2O5JA 4G7HA 5FLMK 1YNJA 3K7AC 4A3KK 1TWAK 2PMZD 3S1QK 3HOZK 4C2MK 3HOYC 5IYDK 1XPPA 2CW0A 4XLNA 2JA7K 1YNNA 3S14C 2R93K 4OIPA 1TWCC 3HOWC 5C4JC 3GTPK 4A3JK 3M4OK 3S2DC 5C4XC 4BBRK 2JA7C 4OIOA 3GTMK 3I4MK 1Y1WK 4A3IC 3PO2C 3GTOK 3S17C 4A3BC 5M5YK 2VUMC 2R7ZK 4XLPA 1I3QK 3S15C 2BE5A 3GTJC 4C3JK 4A3LK 4KN7A 4Y7NK 5C4JK 1R9TK 3M4OC 2E2HC 1TWFK 4OIRA 3M3YC 2E2JC 2NVTC 4C3HK 4A3CC 4MEXA 2E2IC 1TWHC 4C3IK 3GTKK 3GTPC 1I50K 1Y1VC 3S2HK 5IYBC 5FLMC 4A93C 4BY7C 1R9TC 4G7ZA 2NVTK 4A3GK 4A3MK 2E2HK 4YFNA 2VUMK 4LLGA 4LK0A 5IYBK 3S15K 2YU9K 1K83C 2JA5C 2JA6K 3S1QC 4Q5SA 4Q4ZA 3GTJK 2E2IK 3HOVK 1SFOK 4A3GC 2B63K 1I50C 5M3MK 3S2HC 3HOUK 5IP9K 1TWFC 4QIWL 4A3BK 2E2JK 1SMYA 2WB1D 1WCMK 3HOYK 4OINA 4A3DK 5C3EK 2R92K 5IP9C 4AYBL 3S1RK 1Y1VK 4A93K 1ZYRA 1IW7A 4XSXA 3RZOC 1I3QC 4YFXA 3S1NK 4AYBD 1TWGC 3H0GK 4LJZA 5FJ8K 3S1RC 3PO3C 5IYCK 3EQLA 5M5XK 2WB1L 1HQMA 4ZH4A 4MEYA 3S1NC 2B63C 3HOUC 3S16K 3S14K 5IYDC 5C44K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3E C;  5TMC A;  4A3D C;  3FKI C;  3S1M C;  4BBR C;  3GTM C;  5D4D A;  5C4X K;  3I4M C;  3S16 C;  2JA8 K;  1I6H C;  2WAQ L;  2PPB A;  4BXX C;  4X6A C;  2PA8 D;  2A68 A;  3GTQ K;  5M3F K;  3CQZ C;  4YG2 A;  3PO3 K;  3GTL C;  3K7A K;  4A3K C;  3WOD A;  2NVX C;  3GTQ C;  4A3L C;  5M5W K;  2A69 A;  3HOX K;  1TWC K;  2JA8 C;  3HOW K;  2A6H A;  3S2D K;  1I6H K;  3H3V L;  1TWH K;  4QIW D;  4GZY A;  2NVX K;  1TWG K;  3FKI K;  3H0G C;  3GTO C;  4JK1 A;  2A6E A;  2NVY C;  3HOZ C;  3GTK C;  3I4N K;  1Y1W C;  5IP7 K;  3HOX C;  3H3V D;  4NOI A;  4BBS C;  2JA5 K;  3HKZ D;  4QJV A;  2R93 C;  4KMU A;  3GTG C;  3S1M K;  4Y7N C;  4BBS K;  1TWA C;  3DXJ A;  4A3I K;  3RZO K;  3S17 K;  5C44 C;  3HOV C;  2NVQ K;  3I4N C;  4BXX K;  2R7Z C;  4QJV B;  4Y52 K;  5C3E C;  2R92 C;  4A3C K;  2Y0S D;  1WCM C;  3HKZ L;  4BY1 C;  4XSZ A;  4A3J C;  4MQ9 A;  4YFK A;  4BY7 K;  4Y52 C;  3CQZ K;  2NVQ C;  1SFO C;  2YU9 C;  1I6V A;  1K83 K;  2JA6 C;  3GTG K;  5IYC C;  4A3F C;  4A3M C;  4KN4 A;  4X6A K;  3RZD C;  4A3E K;  4LK1 A;  5IP7 C;  1BDF A;  4G7O A;  2NVY K;  2O5I A;  5TMF A;  3GTL K;  3RZD K;  4OIQ A;  4BY1 K;  2PMZ L;  3PO2 K;  3M3Y K;  2PA8 L;  4A3F K;  2WAQ D;  2Y0S L;  2O5J A;  4G7H A;  5FLM K;  1YNJ A;  3K7A C;  4A3K K;  1TWA K;  2PMZ D;  3S1Q K;  3HOZ K;  4C2M K;  3HOY C;  5IYD K;  1XPP A;  2CW0 A;  4XLN A;  2JA7 K;  1YNN A;  3S14 C;  2R93 K;  4OIP A;  1TWC C;  3HOW C;  5C4J C;  3GTP K;  4A3J K;  3M4O K;  3S2D C;  5C4X C;  4BBR K;  2JA7 C;  4OIO A;  3GTM K;  3I4M K;  1Y1W K;  4A3I C;  3PO2 C;  3GTO K;  3S17 C;  4A3B C;  5M5Y K;  2VUM C;  2R7Z K;  4XLP A;  1I3Q K;  3S15 C;  2BE5 A;  3GTJ C;  4C3J K;  4A3L K;  4KN7 A;  4Y7N K;  5C4J K;  1R9T K;  3M4O C;  2E2H C;  1TWF K;  4OIR A;  3M3Y C;  2E2J C;  2NVT C;  4C3H K;  4A3C C;  4MEX A;  2E2I C;  1TWH C;  4C3I K;  3GTK K;  3GTP C;  1I50 K;  1Y1V C;  3S2H K;  5IYB C;  5FLM C;  4A93 C;  4BY7 C;  1R9T C;  4G7Z A;  2NVT K;  4A3G K;  4A3M K;  2E2H K;  4YFN A;  2VUM K;  4LLG A;  4LK0 A;  5IYB K;  3S15 K;  2YU9 K;  1K83 C;  2JA5 C;  2JA6 K;  3S1Q C;  4Q5S A;  4Q4Z A;  3GTJ K;  2E2I K;  3HOV K;  1SFO K;  4A3G C;  2B63 K;  1I50 C;  5M3M K;  3S2H C;  3HOU K;  5IP9 K;  1TWF C;  4QIW L;  4A3B K;  2E2J K;  1SMY A;  2WB1 D;  1WCM K;  3HOY K;  4OIN A;  4A3D K;  5C3E K;  2R92 K;  5IP9 C;  4AYB L;  3S1R K;  1Y1V K;  4A93 K;  1ZYR A;  1IW7 A;  4XSX A;  3RZO C;  1I3Q C;  4YFX A;  3S1N K;  4AYB D;  1TWG C;  3H0G K;  4LJZ A;  5FJ8 K;  3S1R C;  3PO3 C;  5IYC K;  3EQL A;  5M5X K;  2WB1 L;  1HQM A;  4ZH4 A;  4MEY A;  3S1N C;  2B63 C;  3HOU C;  3S16 K;  3S14 K;  5IYD C;  5C44 K; 
#chains in the Genus database with same CATH topology
 2EBB A;  4A3E C;  3GEI A;  5TMC A;  3FKI C;  3S1M C;  3SZY A;  3S16 C;  5TJ3 A;  1O2B A;  3FHZ A;  3FKI A;  1WQF A;  2NVX C;  1ZBS A;  4C3J C;  4A3L C;  2A69 A;  3HOW K;  3S2D K;  1PJ5 A;  2NVX K;  3G4C A;  2D6F C;  3TFJ A;  1I3Q A;  4BLB A;  3H3V D;  4KAT A;  3HKZ D;  4QJV A;  2YU9 A;  3S1M K;  1O26 A;  3DXJ A;  3S17 K;  3RZO K;  2B63 A;  5C44 C;  1IBA A;  4LQY A;  4M1X A;  1TWG A;  2GSU A;  3HKZ L;  1J6X A;  4XSZ A;  1F9N A;  4YFK A;  1O24 A;  2NVQ C;  4PAA A;  5L46 A;  1XXA A;  2YU9 C;  1K83 K;  1ZXO A;  5IYC C;  3LPX A;  4XCH A;  3RZD C;  4KMH A;  2NVY K;  5TMF A;  3GTJ A;  3RZD K;  3AD7 C;  3PO2 K;  1O2A A;  3GTP A;  1XZP A;  1TWH A;  2NVX A;  4G7H A;  4BLA A;  3K7A C;  2PMZ D;  3S1Q K;  3HOZ K;  4WJ3 M;  3LAP A;  5HL8 A;  4P9S A;  1TWC C;  4A3J K;  4BBR K;  4OIO A;  3PO2 C;  3S17 C;  1J6W A;  4A3B C;  2CFA A;  3FOF A;  1R9T K;  4OIR A;  1AB4 A;  3GTM A;  4GTA A;  4C3H K;  1WOP A;  2E2I C;  1TWH C;  3GTK K;  1V5V A;  3GTP C;  4C45 A;  5IYB C;  3S15 K;  4LK0 A;  3N0B A;  3LAJ A;  2YU9 K;  1SFO K;  1I50 C;  5IP9 K;  1VJE A;  4QIW L;  2E2J K;  1SMY A;  1JQW A;  3L4K A;  4OIN A;  4KAS A;  2KWA A;  4AYB L;  3QX3 A;  4XSX A;  1XXC A;  3TFI A;  2RGR A;  4DDQ A;  2E2H A;  1TWG C;  4BKW A;  3PO3 C;  3FOE A;  1O2F B;  1R9T A;  5C4X C;  3S14 K;  5C44 K;  3AQO A;  1XZP B;  3ORE A;  4BBR C;  5D4D A;  5C4X K;  3IPJ A;  1I6H C;  4BXX C;  4PAB A;  2PA8 D;  3GTQ K;  3GTO A;  4C3H C;  3PO3 K;  2VUM A;  4A3K C;  3GTQ C;  1IQ0 A;  5M5W K;  2A6H A;  3NUH A;  1TWH K;  3CQZ A;  3MML B;  3H0G C;  2XCR B;  4JK1 A;  1X31 C;  2NVY C;  3BUE A;  5IP7 K;  4LR2 A;  3HOX C;  3GTG C;  4Y7N C;  4BBS K;  3Q3Q A;  1RU0 A;  2NVQ K;  2FQT A;  3I4N C;  4QJV B;  3L4J A;  4Y52 K;  1G51 A;  2Y0S D;  1WCM C;  4A3J C;  4Y52 C;  3CQZ K;  4J3N A;  1SFO C;  2V6U A;  1I6V A;  2JA6 C;  3GTG K;  1IS1 A;  4A3M C;  4KN4 A;  1PJ6 A;  1WIH A;  1Y1W A;  5IP7 C;  5E68 A;  4G7O A;  3CAG A;  2O5I A;  4OIQ A;  3GTG A;  4KAW X;  1YNJ A;  4A3K K;  1TWC A;  4XLN A;  1F7V A;  2JA7 K;  4KM9 A;  5C4J C;  3M4O K;  1USM A;  4A3I C;  2XCQ A;  3AQP A;  5M5Y K;  2VUM C;  3GTJ C;  4KN7 A;  4Y7N K;  1WSR A;  2E2H C;  2P5M A;  4A3C C;  3OPF A;  2GAG C;  1I50 K;  4AH6 A;  5FLM C;  3GDZ A;  1R9T C;  1DCP A;  2VUM K;  4KM8 A;  4LLG A;  2JA6 K;  3T00 A;  3GTJ K;  2E2I K;  1VH2 A;  3HOU K;  2WB1 D;  1WCM K;  2R92 K;  1O25 A;  1F93 A;  1J6V A;  1ZYR A;  3RZO C;  1WSV A;  3S1N K;  1YX2 A;  3EQL A;  5M5X K;  1J98 A;  3AD9 C;  3BP8 C;  4GTF A;  1HQM A;  4MEY A;  3GIR A;  3S16 K;  4GTL A;  1EQR A;  3GEE A;  4A3D C;  1DCH A;  3GTM C;  3I4M C;  1EK8 A;  1IL2 A;  2WAQ L;  2NVY A;  2PPB A;  4X6A C;  2A68 A;  5M3F K;  2ZFZ A;  3CQZ C;  3K7A K;  3WOD A;  1GE9 A;  3HOX K;  2JA8 C;  1I6H K;  4WIL A;  3H3V L;  2P8T A;  4QIW D;  4GZY A;  3FKI K;  3GTO C;  4P5B A;  2A6E A;  3HOZ C;  4FM9 A;  3GTK C;  3I4N K;  1INN A;  2JA5 K;  2FQO A;  4GTC A;  1JVI A;  1TWA C;  2W7V A;  3HOV C;  2GSN A;  4KDD A;  5C3E C;  2R92 C;  1XZQ B;  1F7U A;  4MQ9 A;  4BY7 K;  4GTB A;  3ADA C;  1WQG A;  4A3F C;  4X6A K;  1BS2 A;  1YCL A;  4A3E K;  4LK1 A;  2JH3 A;  3SZZ A;  2R92 A;  1EFW A;  2PHC B;  4KMA A;  2PMZ L;  3A8I A;  3GSI A;  2WAQ D;  2O5J A;  4GT9 A;  2E2I A;  2JA7 A;  4C2M K;  3HOY C;  5IYD K;  1JOE A;  1XPP A;  2CW0 A;  1EH1 A;  1YNN A;  3S14 C;  4P5A A;  1O27 A;  3GTP K;  3V4G A;  1VGX A;  4GTD A;  3S15 C;  4XLP A;  1I3Q K;  4WJ4 A;  4C3J K;  4A3L K;  5C4J K;  3M4O C;  1BJT A;  2E2J C;  2ZUF A;  1Y1V C;  4A93 C;  4BY7 C;  4G7Z A;  2E2H K;  5IYB K;  4GFQ A;  1K83 C;  4Q5S A;  3HOV K;  2JA5 A;  2B63 K;  3S2H C;  1XZQ A;  1ISE A;  5M3M K;  1VLO A;  2R7Z A;  4A3B K;  1WOO A;  3ERE D;  3AH5 A;  2XCO A;  5IP9 C;  3S1R K;  1Y1V K;  4A93 K;  2R93 A;  1IW7 A;  5EGH A;  4YFX A;  5JFE A;  3H0G K;  3S1R C;  3T01 A;  5IYC K;  4KB4 A;  4KAR A;  1KQ4 A;  2WB1 L;  1DD5 A;  2B63 C;  1TWA A;  5IYD C;  1UV7 A;  1WQH A;  4KB2 A;  3GTQ A;  3GTL A;  3VA7 A;  3N3Y A;  3HXA A;  3AD8 C;  2JA8 K;  3A8J A;  5IOS A;  5IOR A;  4YG2 A;  1WOR A;  3N0C A;  5IOT A;  1USO A;  3TTG A;  3GTL C;  3TFH A;  1TWC K;  1BGW A;  1TWG K;  2ZUE A;  2CFA B;  1C0A A;  4C3I C;  1Y1W C;  4NOI A;  4O2D A;  4BBS C;  3OEP A;  2R93 C;  4KMU A;  3BP3 A;  1SFO A;  4A3I K;  4BXX K;  2R7Z C;  1ZVU A;  1I50 A;  4A3C K;  1B4A A;  4BY1 C;  1IE0 A;  2V6T A;  2GSO A;  1TWF A;  1WCM A;  1BDF A;  3A8K A;  4KC6 A;  3GTL K;  4BY1 K;  3M3Y K;  2PA8 L;  4A3F K;  1DCO A;  2Y0S L;  3JST A;  2V6S A;  5FLM K;  1TWA K;  4G0W A;  4RMF A;  5CHP A;  3G4A A;  3H0G A;  4KMD A;  2R93 K;  4OIP A;  5CJ9 A;  3HOW C;  3T02 A;  3S2D C;  3GTM K;  3S0X A;  2JA7 C;  3I4M K;  1Y1W K;  3GTO K;  2Y3P A;  2R7Z K;  2BE5 A;  1WOS A;  4GTE A;  5IOQ A;  4ILD A;  1TWF K;  1ZQ1 C;  2GAH C;  3M3Y C;  2NVT C;  5EGE A;  4MEX A;  4C3I K;  3S2H K;  1O28 A;  2NVT K;  4A3G K;  2RH6 A;  4A3M K;  4YFN A;  4G0V A;  2JA5 C;  3S1Q C;  4A3G C;  4Q4Z A;  1XXB A;  1EI6 A;  1TWF C;  1O29 A;  4LOW A;  2JA6 A;  3HOY K;  1PJ7 A;  4A3D K;  1B4B A;  5C3E K;  4FZB A;  1I3Q C;  5FJ8 K;  1HI9 A;  4AYB D;  4LJZ A;  3GEH A;  1K83 A;  3GTK A;  4G0U A;  1VRQ C;  4ZH4 A;  3S1N C;  5JVO A;  3HOU C;  1L0W A;  1Y1V A;  4C2M C; 
#chains in the Genus database with same CATH homology
 4A3E C;  5TMC A;  4A3D C;  3FKI C;  3S1M C;  4BBR C;  3GTM C;  5D4D A;  5C4X K;  3I4M C;  3S16 C;  2JA8 K;  1I6H C;  2WAQ L;  2PPB A;  4BXX C;  4X6A C;  2PA8 D;  2A68 A;  3GTQ K;  5M3F K;  3CQZ C;  4YG2 A;  3PO3 K;  3GTL C;  3K7A K;  4A3K C;  3WOD A;  2NVX C;  3GTQ C;  4A3L C;  5M5W K;  2A69 A;  3HOX K;  1TWC K;  2JA8 C;  3HOW K;  2A6H A;  3S2D K;  1I6H K;  3H3V L;  1TWH K;  4QIW D;  4GZY A;  2NVX K;  1TWG K;  3FKI K;  3H0G C;  3GTO C;  4JK1 A;  2A6E A;  2NVY C;  3HOZ C;  3GTK C;  3I4N K;  1Y1W C;  5IP7 K;  3HOX C;  3H3V D;  4NOI A;  4BBS C;  2JA5 K;  3HKZ D;  4QJV A;  2R93 C;  4KMU A;  3GTG C;  3S1M K;  4Y7N C;  4BBS K;  1TWA C;  3DXJ A;  4A3I K;  3RZO K;  3S17 K;  5C44 C;  3HOV C;  2NVQ K;  3I4N C;  4BXX K;  2R7Z C;  4QJV B;  4Y52 K;  5C3E C;  2R92 C;  4A3C K;  2Y0S D;  1WCM C;  3HKZ L;  4BY1 C;  4XSZ A;  4A3J C;  4MQ9 A;  4YFK A;  4BY7 K;  4Y52 C;  3CQZ K;  2NVQ C;  1SFO C;  2YU9 C;  1I6V A;  1K83 K;  2JA6 C;  3GTG K;  5IYC C;  4A3F C;  4A3M C;  4KN4 A;  4X6A K;  3RZD C;  4A3E K;  4LK1 A;  5IP7 C;  1BDF A;  4G7O A;  2NVY K;  2O5I A;  5TMF A;  3GTL K;  3RZD K;  4OIQ A;  4BY1 K;  2PMZ L;  3PO2 K;  3M3Y K;  2PA8 L;  4A3F K;  2WAQ D;  2Y0S L;  2O5J A;  4G7H A;  5FLM K;  1YNJ A;  3K7A C;  4A3K K;  1TWA K;  2PMZ D;  3S1Q K;  3HOZ K;  4C2M K;  3HOY C;  5IYD K;  1XPP A;  2CW0 A;  4XLN A;  2JA7 K;  1YNN A;  3S14 C;  2R93 K;  4OIP A;  1TWC C;  3HOW C;  5C4J C;  3GTP K;  4A3J K;  3M4O K;  3S2D C;  5C4X C;  4BBR K;  2JA7 C;  4OIO A;  3GTM K;  3I4M K;  1Y1W K;  4A3I C;  3PO2 C;  3GTO K;  3S17 C;  4A3B C;  5M5Y K;  2VUM C;  2R7Z K;  4XLP A;  1I3Q K;  3S15 C;  2BE5 A;  3GTJ C;  4C3J K;  4A3L K;  4KN7 A;  4Y7N K;  5C4J K;  1R9T K;  3M4O C;  2E2H C;  1TWF K;  4OIR A;  3M3Y C;  2E2J C;  2NVT C;  4C3H K;  4A3C C;  4MEX A;  2E2I C;  1TWH C;  4C3I K;  3GTK K;  3GTP C;  1I50 K;  1Y1V C;  3S2H K;  5IYB C;  5FLM C;  4A93 C;  4BY7 C;  1R9T C;  4G7Z A;  2NVT K;  4A3G K;  4A3M K;  2E2H K;  4YFN A;  2VUM K;  4LLG A;  4LK0 A;  5IYB K;  3S15 K;  2YU9 K;  1K83 C;  2JA5 C;  2JA6 K;  3S1Q C;  4Q5S A;  4Q4Z A;  3GTJ K;  2E2I K;  3HOV K;  1SFO K;  4A3G C;  2B63 K;  1I50 C;  5M3M K;  3S2H C;  3HOU K;  5IP9 K;  1TWF C;  4QIW L;  4A3B K;  2E2J K;  1SMY A;  2WB1 D;  1WCM K;  3HOY K;  4OIN A;  4A3D K;  5C3E K;  2R92 K;  5IP9 C;  4AYB L;  3S1R K;  1Y1V K;  4A93 K;  1ZYR A;  1IW7 A;  4XSX A;  3RZO C;  1I3Q C;  4YFX A;  3S1N K;  4AYB D;  1TWG C;  3H0G K;  4LJZ A;  5FJ8 K;  3S1R C;  3PO3 C;  5IYC K;  3EQL A;  5M5X K;  2WB1 L;  1HQM A;  4ZH4 A;  4MEY A;  3S1N C;  2B63 C;  3HOU C;  3S16 K;  3S14 K;  5IYD C;  5C44 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...