5IYCK

Human core-pic in the initial transcribing state
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
117
Chain Sequence
b'MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transcription, transferase/dna
source organism Homo sapiens
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
total genus 29
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5iycK00
4JK1A 3M4OC 4G7HA 5IYBK 4X6AK 3S2HC 4MEXA 1K83C 2JA5C 3FKIC 4BY7K 4G7OA 4C2MK 3S17C 3GTKC 2NVXC 1I3QK 2A6HA 5FJ8K 1WCMK 1I50C 3S15C 5IYDK 4A3KK 4A3CK 3M3YC 5C44K 2PPBA 2NVYK 1K83K 1BDFA 1SFOC 4QJVA 1R9TK 2JA7C 4Q5SA 4XLNA 4A3IK 5TMFA 4Y7NC 3I4NK 4ZH4A 5FLMK 2JA8C 3S1NK 2JA5K 2B63K 4YFNA 2JA6C 3FKIK 4OIPA 3GTJK 2A6EA 4Q4ZA 4XSXA 3S1RC 1Y1VK 4A3FK 4A3IC 2PMZD 5M5XK 2O5IA 2WAQD 2R92C 3H3VD 3PO2C 5IP7K 4A3JK 2NVTK 3GTQC 4XLPA 3PO3K 3S1NC 4BXXC 5IP9C 4QIWD 2PA8D 4BBRC 3S2DC 2WB1L 3RZDC 2JA7K 1Y1VC 4A3FC 1I6HK 3HKZL 4A3EK 4QJVB 3S16K 1SMYA 3WODA 4A3LC 4MEYA 2JA8K 3GTLC 4C3IK 1WCMC 2VUMK 2Y0SL 2R7ZC 5IYBC 4C3HK 3HKZD 4X6AC 1TWFK 3RZOK 1TWHK 4A93K 4LK1A 4BBRK 3M3YK 5M3FK 2Y0SD 2R7ZK 3H3VL 5IYDC 3S15K 3S1MC 4OIOA 5C4JC 3S16C 3HOYK 1TWCK 3GTMC 3HOUC 3S1RK 5C3EK 2WB1D 2A69A 4NOIA 3CQZC 2B63C 2PA8L 1I6VA 4QIWL 5IP7C 5FLMC 4Y7NK 4Y52C 5C4JK 4A3JC 3GTOC 4KN4A 1HQMA 2WAQL 1TWFC 3HOXK 2PMZL 2YU9C 1TWHC 3GTGK 4A93C 2E2HC 3HOWC 4GZYA 3H0GC 1Y1WK 2BE5A 1I3QC 1TWGK 3HOYC 1I50K 4G7ZA 3S14C 2NVQK 3I4NC 2E2JC 4MQ9A 2NVXK 4BY1K 3HOVC 3EQLA 3S1QC 2R93K 1I6HC 1YNJA 4BBSK 4A3EC 4A3LK 2NVYC 1IW7A 4YG2A 2YU9K 3K7AC 5M3MK 3GTGC 2E2JK 2VUMC 3HOXC 4A3GC 2R93C 4YFXA 4OINA 4A3MC 3H0GK 3HOWK 3GTJC 3I4MK 1TWGC 3DXJA 5C4XC 4LJZA 5TMCA 5M5YK 3M4OK 2O5JA 3S2HK 4XSZA 4BXXK 5D4DA 5IP9K 2R92K 3S1MK 2A68A 4A3BK 3S2DK 4A3DC 4OIQA 3GTPK 5C3EC 3K7AK 3CQZK 3HOZK 4LLGA 4AYBL 4A3KC 4A3CC 5IYCK 4KMUA 5C44C 3I4MC 2CW0A 4C3JK 3GTLK 2NVQC 1TWAK 3HOZC 4AYBD 1Y1WC 2E2HK 5IYCC 3RZOC 1XPPA 4YFKA 1SFOK 4A3BC 4A3DK 3GTPC 1ZYRA 3S1QK 1YNNA 3S14K 1TWAC 3PO2K 2E2IK 4BY1C 2NVTC 3GTQK 3HOVK 3PO3C 4BY7C 4LK0A 3GTKK 3GTMK 3S17K 5M5WK 5C4XK 2JA6K 3RZDK 1TWCC 3HOUK 2E2IC 4OIRA 4KN7A 3GTOK 4A3GK 4A3MK 4BBSC 1R9TC 4Y52K
chains in the Genus database with same CATH superfamily
3S2HC 4GTBA 3GSIA 1K83C 4C2MK 3S17C 5EGHA 1WCMK 1UV7A 1ZBSA 3GEEA 4AH6A 4KARA 4A3KK 5IOQA 2NVYK 1K83K 3GEIA 4BLBA 2JA7C 1R9TK 4Q5SA 3A8JA 4XLNA 5TMFA 4Y7NC 1XZQA 3AQOA 2JA6C 1AB4A 4OIPA 2RH6A 4ILDA 4XSXA 4GTEA 1Y1VK 3I4NC 2JA7A 5M5XK 2WAQD 1XXBA 2CFAA 4XLPA 5E68A 2PA8D 1C0AA 3N3YA 3LAJA 4A3FC 2NVYA 3GTLC 1BS2A 2VUMK 2R92A 4X6AC 4C3HK 3GTMA 3RZOK 1TWHK 3FKIA 3FOFA 3GTOA 1O29A 1VJEA 3CQZA 4J3NA 3HOYK 3ERED 3TFHA 1TWCK 3GTMC 5C3EK 2EBBA 5FLMC 4A3JC 3GIRA 2YU9C 2WAQL 3HOXK 3GTGK 1TWHC 2FQTA 4P5AA 3AQPA 1O24A 4KM8A 4GZYA 1TWGK 2GSOA 3OEPA 5L46A 1WQGA 3HOVC 1O25A 1YNJA 5IOSA 5EGEA 4YG2A 3K7AC 1DCOA 4A3GC 2V6TA 3GTJC 3I4MK 5M5YK 1USOA 3S2HK 1BGWA 4BXXK 1PJ5A 4A3DC 3GTPK 5C3EC 1YX2A 1TWFA 2E2HA 3LAPA 1G51A 1TWAK 1Y1WC 2JH3A 4C3HC 4YFKA 4GTLA 3GTPC 1YNNA 3S14K 3A8KA 3PO2K 2E2IK 3GTQK 3GTMK 5C4XK 5JFEA 2GSUA 4KASA 3GTKA 1WORA 4FM9A 4OIRA 3GTOK 1IBAA 2RGRA 4KAWX 4BBSC 4Y52K 3M4OC 4G7HA 4X6AK 4LOWA 4MEXA 1TWAA 3FOEA 3FKIC 3A8IA 1I3QK 3S15C 4A3CK 3GEHA 2V6SA 3T00A 3I4NK 3GTGA 1Y1VA 4ZH4A 5FLMK 3S1NK 2V6UA 4WILA 1I50A 3PO2C 1IL2A 1JQWA 3H3VD 5IP7K 4BXXC 1BJTA 3AD8C 4QIWD 5IP9C 2WB1L 3RZDC 1I6HK 4A3LC 1SMYA 3WODA 4PAAA 4C3JC 3OREA 3BUEA 3MMLB 2R7ZC 1WOSA 4KMAA 1TWFK 5HL8A 1XXAA 3TTGA 3S15K 3GTPA 4OIOA 3S16C 1J98A 3CQZC 1I6VA 4Y7NK 4Y52C 1HQMA 1TWFC 3T01A 2JA5A 2E2HC 3HOWC 4KB4A 2XCRB 1PJ6A 2NVQK 3S1QC 1L0WA 4M1XA 3EQLA 1EI6A 1I6HC 1IW7A 4BKWA 1JVIA 2YU9K 4XCHA 2E2JK 2VUMC 4A3MC 1EH1A 4LJZA 5TMCA 1IS1A 3S0XA 1F7UA 3S1MK 3S2DK 3CQZK 4GTDA 2D6FC 1TWHA 4A3CC 2R93A 5IYCK 4KMUA 1B4BA 3I4MC 3GTLK 2NVQC 1O2AA 3HOZC 1TWCA 4AYBD 2W7VA 3LPXA 1SFOK 2E2IA 4A3BC 4P5BA 4G0WA 1O2FB 4KM9A 2NVTC 1J6WA 3HOVK 3PO3C 3GTKK 2JA6K 4RMFA 1KQ4A 2E2IC 1R9TC 4JK1A 4KMDA 3H0GA 5IYBK 2GSNA 1PJ7A 3GTKC 4O2DA 5FJ8K 3Q3QA 5C44K 1BDFA 1SFOC 3AD7C 3G4CA 4BLAA 1ZVUA 4GTAA 2JA8C 2JA5K 4KB2A 4YFNA 3FKIK 5IOTA 3GTJK 3SZZA 4A3FK 4A3IC 2R92C 3S1NC 2NVTK 3PO3K 1JOEA 1XZQB 4BBRC 3S2DC 1O28A 1Y1VC 3OPFA 3HKZL 4A3EK 3S16K 4MEYA 2JA8K 2ZUFA 3HKZD 3VA7A 1K83A 4A93K 4KATA 2NVXA 3S1MC 1I3QA 5C4JC 2XCOA 3S1RK 4C45A 3FHZA 2B63C 2PA8L 5C4JK 5IP7C 1WQFA 2GAHC 2P8TA 2ZUEA 1X31C 2PMZL 1ZQ1C 4A93C 1EQRA 4FZBA 1IE0A 3H0GC 3QX3A 1Y1WK 2BE5A 1I50K 4GTCA 2NVXK 4BY1K 1V5VA 4A3EC 4KDDA 4YFXA 1F7VA 3L4KA 3H0GK 1TWGC 3DXJA 1J6VA 1ISEA 3M4OK 2O5JA 5JVOA 4XSZA 5IP9K 4A3BK 2A68A 3G4AA 1WSRA 4OIQA 1DCPA 3K7AK 1RU0A 3HOZK 4A3KC 3GTJA 4G0VA 5C44C 4C3JK 1SFOA 1O27A 1EK8A 4WJ4A 3RZOC 1INNA 3S1QK 4G0UA 4KMHA 1YCLA 4KC6A 4BY7C 1O26A 4LK0A 5M5WK 3BP8C 1TWCC 3AD9C 2YU9A 4KN7A 3T02A 3ADAC 2B63A 1WCMA 1F93A 2JA5C 1WIHA 4G7OA 4GFQA 3TFJA 4BY7K 2NVXC 2A6HA 1I50C 2CFAB 5IYDK 1WOOA 3BP3A 2PPBA 3M3YC 5CHPA 3AH5A 1Y1WA 4QJVA 4A3IK 4GTFA 3GTLA 2B63K 4PABA 1XZPB 4C3IC 4C2MC 3GTQA 1VH2A 2A6EA 4Q4ZA 3S1RC 1TWGA 2O5IA 2PMZD 1EFWA 4A3JK 3GTQC 1WOPA 5IORA 4LQYA 2JA7K 2P5MA 4QJVB 2GAGC 4LR2A 4C3IK 1O2BA 2ZFZA 1WCMC 2PHCB 2XCQA 2Y0SL 5IYBC 1IQ0A 2KWAA 3IPJA 3N0BA 4LK1A 4BBRK 3M3YK 5M3FK 5TJ3A 2Y0SD 3GDZA 2R7ZK 3H3VL 4GT9A 5IYDC 1F9NA 3HOUC 1HI9A 2WB1D 2A69A 4NOIA 4QIWL 4BBSK 3GTOC 4KN4A 3NUHA 1I3QC 3HOYC 3HXAA 4G7ZA 1VRQC 3S14C 1DD5A 4MQ9A 3CAGA 2Y3PA 3TFIA 2E2JC 2R93K 1VGXA 1B4AA 4A3LK 2FQOA 2NVYC 5M3MK 3GTGC 3HOXC 1J6XA 5CJ9A 2R93C 4OINA 2JA6A 3HOWK 2R7ZA 5C4XC 3V4GA 1ZXOA 5D4DA 2R92K 2VUMA 1XXCA 1XZPA 4LLGA 1GE9A 4AYBL 1WQHA 2CW0A 3JSTA 1DCHA 2E2HK 5IYCC 1R9TA 1XPPA 3SZYA 1VLOA 4A3DK 4WJ3M 1WSVA 1ZYRA 1TWAC 4BY1C 4DDQA 3S17K 4P9SA 3RZDK 3HOUK 3L4JA 4A3GK 1USMA 4A3MK 3N0CA
chains in the Genus database with same CATH topology
4JK1A 3M4OC 4G7HA 5IYBK 4X6AK 3S2HC 4MEXA 1K83C 2JA5C 3FKIC 4BY7K 4G7OA 4C2MK 3S17C 3GTKC 2NVXC 1I3QK 2A6HA 5FJ8K 1WCMK 1I50C 3S15C 5IYDK 4A3KK 4A3CK 3M3YC 5C44K 2PPBA 2NVYK 1K83K 1BDFA 1SFOC 4QJVA 1R9TK 2JA7C 4Q5SA 4XLNA 4A3IK 5TMFA 4Y7NC 3I4NK 4ZH4A 5FLMK 2JA8C 3S1NK 2JA5K 2B63K 4YFNA 2JA6C 3FKIK 4OIPA 3GTJK 2A6EA 4Q4ZA 4XSXA 3S1RC 1Y1VK 4A3FK 4A3IC 2PMZD 5M5XK 2O5IA 2WAQD 2R92C 3H3VD 3PO2C 5IP7K 4A3JK 2NVTK 3GTQC 4XLPA 3PO3K 3S1NC 4BXXC 5IP9C 4QIWD 2PA8D 4BBRC 3S2DC 2WB1L 3RZDC 2JA7K 1Y1VC 4A3FC 1I6HK 3HKZL 4A3EK 4QJVB 3S16K 1SMYA 3WODA 4A3LC 4MEYA 2JA8K 3GTLC 4C3IK 1WCMC 2VUMK 2Y0SL 2R7ZC 5IYBC 4C3HK 3HKZD 4X6AC 1TWFK 3RZOK 1TWHK 4A93K 4LK1A 4BBRK 3M3YK 5M3FK 2Y0SD 2R7ZK 3H3VL 5IYDC 3S15K 3S1MC 4OIOA 5C4JC 3S16C 3HOYK 1TWCK 3GTMC 3HOUC 3S1RK 5C3EK 2WB1D 2A69A 4NOIA 3CQZC 2B63C 2PA8L 1I6VA 4QIWL 5IP7C 5FLMC 4Y7NK 4Y52C 5C4JK 4A3JC 3GTOC 4KN4A 1HQMA 2WAQL 1TWFC 3HOXK 2PMZL 2YU9C 1TWHC 3GTGK 4A93C 2E2HC 3HOWC 4GZYA 3H0GC 1Y1WK 2BE5A 1I3QC 1TWGK 3HOYC 1I50K 4G7ZA 3S14C 2NVQK 3I4NC 2E2JC 4MQ9A 2NVXK 4BY1K 3HOVC 3EQLA 3S1QC 2R93K 1I6HC 1YNJA 4BBSK 4A3EC 4A3LK 2NVYC 1IW7A 4YG2A 2YU9K 3K7AC 5M3MK 3GTGC 2E2JK 2VUMC 3HOXC 4A3GC 2R93C 4YFXA 4OINA 4A3MC 3H0GK 3HOWK 3GTJC 3I4MK 1TWGC 3DXJA 5C4XC 4LJZA 5TMCA 5M5YK 3M4OK 2O5JA 3S2HK 4XSZA 4BXXK 5D4DA 5IP9K 2R92K 3S1MK 2A68A 4A3BK 3S2DK 4A3DC 4OIQA 3GTPK 5C3EC 3K7AK 3CQZK 3HOZK 4LLGA 4AYBL 4A3KC 4A3CC 5IYCK 4KMUA 5C44C 3I4MC 2CW0A 4C3JK 3GTLK 2NVQC 1TWAK 3HOZC 4AYBD 1Y1WC 2E2HK 5IYCC 3RZOC 1XPPA 4YFKA 1SFOK 4A3BC 4A3DK 3GTPC 1ZYRA 3S1QK 1YNNA 3S14K 1TWAC 3PO2K 2E2IK 4BY1C 2NVTC 3GTQK 3HOVK 3PO3C 4BY7C 4LK0A 3GTKK 3GTMK 3S17K 5M5WK 5C4XK 2JA6K 3RZDK 1TWCC 3HOUK 2E2IC 4OIRA 4KN7A 3GTOK 4A3GK 4A3MK 4BBSC 1R9TC 4Y52K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JK1 A;  3M4O C;  4G7H A;  5IYB K;  4X6A K;  3S2H C;  4MEX A;  1K83 C;  2JA5 C;  3FKI C;  4BY7 K;  4G7O A;  4C2M K;  3S17 C;  3GTK C;  2NVX C;  1I3Q K;  2A6H A;  5FJ8 K;  1WCM K;  1I50 C;  3S15 C;  5IYD K;  4A3K K;  4A3C K;  3M3Y C;  5C44 K;  2PPB A;  2NVY K;  1K83 K;  1BDF A;  1SFO C;  4QJV A;  1R9T K;  2JA7 C;  4Q5S A;  4XLN A;  4A3I K;  5TMF A;  4Y7N C;  3I4N K;  4ZH4 A;  5FLM K;  2JA8 C;  3S1N K;  2JA5 K;  2B63 K;  4YFN A;  2JA6 C;  3FKI K;  4OIP A;  3GTJ K;  2A6E A;  4Q4Z A;  4XSX A;  3S1R C;  1Y1V K;  4A3F K;  4A3I C;  2PMZ D;  5M5X K;  2O5I A;  2WAQ D;  2R92 C;  3H3V D;  3PO2 C;  5IP7 K;  4A3J K;  2NVT K;  3GTQ C;  4XLP A;  3PO3 K;  3S1N C;  4BXX C;  5IP9 C;  4QIW D;  2PA8 D;  4BBR C;  3S2D C;  2WB1 L;  3RZD C;  2JA7 K;  1Y1V C;  4A3F C;  1I6H K;  3HKZ L;  4A3E K;  4QJV B;  3S16 K;  1SMY A;  3WOD A;  4A3L C;  4MEY A;  2JA8 K;  3GTL C;  4C3I K;  1WCM C;  2VUM K;  2Y0S L;  2R7Z C;  5IYB C;  4C3H K;  3HKZ D;  4X6A C;  1TWF K;  3RZO K;  1TWH K;  4A93 K;  4LK1 A;  4BBR K;  3M3Y K;  5M3F K;  2Y0S D;  2R7Z K;  3H3V L;  5IYD C;  3S15 K;  3S1M C;  4OIO A;  5C4J C;  3S16 C;  3HOY K;  1TWC K;  3GTM C;  3HOU C;  3S1R K;  5C3E K;  2WB1 D;  2A69 A;  4NOI A;  3CQZ C;  2B63 C;  2PA8 L;  1I6V A;  4QIW L;  5IP7 C;  5FLM C;  4Y7N K;  4Y52 C;  5C4J K;  4A3J C;  3GTO C;  4KN4 A;  1HQM A;  2WAQ L;  1TWF C;  3HOX K;  2PMZ L;  2YU9 C;  1TWH C;  3GTG K;  4A93 C;  2E2H C;  3HOW C;  4GZY A;  3H0G C;  1Y1W K;  2BE5 A;  1I3Q C;  1TWG K;  3HOY C;  1I50 K;  4G7Z A;  3S14 C;  2NVQ K;  3I4N C;  2E2J C;  4MQ9 A;  2NVX K;  4BY1 K;  3HOV C;  3EQL A;  3S1Q C;  2R93 K;  1I6H C;  1YNJ A;  4BBS K;  4A3E C;  4A3L K;  2NVY C;  1IW7 A;  4YG2 A;  2YU9 K;  3K7A C;  5M3M K;  3GTG C;  2E2J K;  2VUM C;  3HOX C;  4A3G C;  2R93 C;  4YFX A;  4OIN A;  4A3M C;  3H0G K;  3HOW K;  3GTJ C;  3I4M K;  1TWG C;  3DXJ A;  5C4X C;  4LJZ A;  5TMC A;  5M5Y K;  3M4O K;  2O5J A;  3S2H K;  4XSZ A;  4BXX K;  5D4D A;  5IP9 K;  2R92 K;  3S1M K;  2A68 A;  4A3B K;  3S2D K;  4A3D C;  4OIQ A;  3GTP K;  5C3E C;  3K7A K;  3CQZ K;  3HOZ K;  4LLG A;  4AYB L;  4A3K C;  4A3C C;  5IYC K;  4KMU A;  5C44 C;  3I4M C;  2CW0 A;  4C3J K;  3GTL K;  2NVQ C;  1TWA K;  3HOZ C;  4AYB D;  1Y1W C;  2E2H K;  5IYC C;  3RZO C;  1XPP A;  4YFK A;  1SFO K;  4A3B C;  4A3D K;  3GTP C;  1ZYR A;  3S1Q K;  1YNN A;  3S14 K;  1TWA C;  3PO2 K;  2E2I K;  4BY1 C;  2NVT C;  3GTQ K;  3HOV K;  3PO3 C;  4BY7 C;  4LK0 A;  3GTK K;  3GTM K;  3S17 K;  5M5W K;  5C4X K;  2JA6 K;  3RZD K;  1TWC C;  3HOU K;  2E2I C;  4OIR A;  4KN7 A;  3GTO K;  4A3G K;  4A3M K;  4BBS C;  1R9T C;  4Y52 K; 
#chains in the Genus database with same CATH topology
 3S2H C;  4GTB A;  3GSI A;  1K83 C;  4C2M K;  3S17 C;  5EGH A;  1WCM K;  1UV7 A;  1ZBS A;  3GEE A;  4AH6 A;  4KAR A;  4A3K K;  5IOQ A;  2NVY K;  1K83 K;  3GEI A;  4BLB A;  2JA7 C;  1R9T K;  4Q5S A;  3A8J A;  4XLN A;  5TMF A;  4Y7N C;  1XZQ A;  3AQO A;  2JA6 C;  1AB4 A;  4OIP A;  2RH6 A;  4ILD A;  4XSX A;  4GTE A;  1Y1V K;  3I4N C;  2JA7 A;  5M5X K;  2WAQ D;  1XXB A;  2CFA A;  4XLP A;  5E68 A;  2PA8 D;  1C0A A;  3N3Y A;  3LAJ A;  4A3F C;  2NVY A;  3GTL C;  1BS2 A;  2VUM K;  2R92 A;  4X6A C;  4C3H K;  3GTM A;  3RZO K;  1TWH K;  3FKI A;  3FOF A;  3GTO A;  1O29 A;  1VJE A;  3CQZ A;  4J3N A;  3HOY K;  3ERE D;  3TFH A;  1TWC K;  3GTM C;  5C3E K;  2EBB A;  5FLM C;  4A3J C;  3GIR A;  2YU9 C;  2WAQ L;  3HOX K;  3GTG K;  1TWH C;  2FQT A;  4P5A A;  3AQP A;  1O24 A;  4KM8 A;  4GZY A;  1TWG K;  2GSO A;  3OEP A;  5L46 A;  1WQG A;  3HOV C;  1O25 A;  1YNJ A;  5IOS A;  5EGE A;  4YG2 A;  3K7A C;  1DCO A;  4A3G C;  2V6T A;  3GTJ C;  3I4M K;  5M5Y K;  1USO A;  3S2H K;  1BGW A;  4BXX K;  1PJ5 A;  4A3D C;  3GTP K;  5C3E C;  1YX2 A;  1TWF A;  2E2H A;  3LAP A;  1G51 A;  1TWA K;  1Y1W C;  2JH3 A;  4C3H C;  4YFK A;  4GTL A;  3GTP C;  1YNN A;  3S14 K;  3A8K A;  3PO2 K;  2E2I K;  3GTQ K;  3GTM K;  5C4X K;  5JFE A;  2GSU A;  4KAS A;  3GTK A;  1WOR A;  4FM9 A;  4OIR A;  3GTO K;  1IBA A;  2RGR A;  4KAW X;  4BBS C;  4Y52 K;  3M4O C;  4G7H A;  4X6A K;  4LOW A;  4MEX A;  1TWA A;  3FOE A;  3FKI C;  3A8I A;  1I3Q K;  3S15 C;  4A3C K;  3GEH A;  2V6S A;  3T00 A;  3I4N K;  3GTG A;  1Y1V A;  4ZH4 A;  5FLM K;  3S1N K;  2V6U A;  4WIL A;  1I50 A;  3PO2 C;  1IL2 A;  1JQW A;  3H3V D;  5IP7 K;  4BXX C;  1BJT A;  3AD8 C;  4QIW D;  5IP9 C;  2WB1 L;  3RZD C;  1I6H K;  4A3L C;  1SMY A;  3WOD A;  4PAA A;  4C3J C;  3ORE A;  3BUE A;  3MML B;  2R7Z C;  1WOS A;  4KMA A;  1TWF K;  5HL8 A;  1XXA A;  3TTG A;  3S15 K;  3GTP A;  4OIO A;  3S16 C;  1J98 A;  3CQZ C;  1I6V A;  4Y7N K;  4Y52 C;  1HQM A;  1TWF C;  3T01 A;  2JA5 A;  2E2H C;  3HOW C;  4KB4 A;  2XCR B;  1PJ6 A;  2NVQ K;  3S1Q C;  1L0W A;  4M1X A;  3EQL A;  1EI6 A;  1I6H C;  1IW7 A;  4BKW A;  1JVI A;  2YU9 K;  4XCH A;  2E2J K;  2VUM C;  4A3M C;  1EH1 A;  4LJZ A;  5TMC A;  1IS1 A;  3S0X A;  1F7U A;  3S1M K;  3S2D K;  3CQZ K;  4GTD A;  2D6F C;  1TWH A;  4A3C C;  2R93 A;  5IYC K;  4KMU A;  1B4B A;  3I4M C;  3GTL K;  2NVQ C;  1O2A A;  3HOZ C;  1TWC A;  4AYB D;  2W7V A;  3LPX A;  1SFO K;  2E2I A;  4A3B C;  4P5B A;  4G0W A;  1O2F B;  4KM9 A;  2NVT C;  1J6W A;  3HOV K;  3PO3 C;  3GTK K;  2JA6 K;  4RMF A;  1KQ4 A;  2E2I C;  1R9T C;  4JK1 A;  4KMD A;  3H0G A;  5IYB K;  2GSN A;  1PJ7 A;  3GTK C;  4O2D A;  5FJ8 K;  3Q3Q A;  5C44 K;  1BDF A;  1SFO C;  3AD7 C;  3G4C A;  4BLA A;  1ZVU A;  4GTA A;  2JA8 C;  2JA5 K;  4KB2 A;  4YFN A;  3FKI K;  5IOT A;  3GTJ K;  3SZZ A;  4A3F K;  4A3I C;  2R92 C;  3S1N C;  2NVT K;  3PO3 K;  1JOE A;  1XZQ B;  4BBR C;  3S2D C;  1O28 A;  1Y1V C;  3OPF A;  3HKZ L;  4A3E K;  3S16 K;  4MEY A;  2JA8 K;  2ZUF A;  3HKZ D;  3VA7 A;  1K83 A;  4A93 K;  4KAT A;  2NVX A;  3S1M C;  1I3Q A;  5C4J C;  2XCO A;  3S1R K;  4C45 A;  3FHZ A;  2B63 C;  2PA8 L;  5C4J K;  5IP7 C;  1WQF A;  2GAH C;  2P8T A;  2ZUE A;  1X31 C;  2PMZ L;  1ZQ1 C;  4A93 C;  1EQR A;  4FZB A;  1IE0 A;  3H0G C;  3QX3 A;  1Y1W K;  2BE5 A;  1I50 K;  4GTC A;  2NVX K;  4BY1 K;  1V5V A;  4A3E C;  4KDD A;  4YFX A;  1F7V A;  3L4K A;  3H0G K;  1TWG C;  3DXJ A;  1J6V A;  1ISE A;  3M4O K;  2O5J A;  5JVO A;  4XSZ A;  5IP9 K;  4A3B K;  2A68 A;  3G4A A;  1WSR A;  4OIQ A;  1DCP A;  3K7A K;  1RU0 A;  3HOZ K;  4A3K C;  3GTJ A;  4G0V A;  5C44 C;  4C3J K;  1SFO A;  1O27 A;  1EK8 A;  4WJ4 A;  3RZO C;  1INN A;  3S1Q K;  4G0U A;  4KMH A;  1YCL A;  4KC6 A;  4BY7 C;  1O26 A;  4LK0 A;  5M5W K;  3BP8 C;  1TWC C;  3AD9 C;  2YU9 A;  4KN7 A;  3T02 A;  3ADA C;  2B63 A;  1WCM A;  1F93 A;  2JA5 C;  1WIH A;  4G7O A;  4GFQ A;  3TFJ A;  4BY7 K;  2NVX C;  2A6H A;  1I50 C;  2CFA B;  5IYD K;  1WOO A;  3BP3 A;  2PPB A;  3M3Y C;  5CHP A;  3AH5 A;  1Y1W A;  4QJV A;  4A3I K;  4GTF A;  3GTL A;  2B63 K;  4PAB A;  1XZP B;  4C3I C;  4C2M C;  3GTQ A;  1VH2 A;  2A6E A;  4Q4Z A;  3S1R C;  1TWG A;  2O5I A;  2PMZ D;  1EFW A;  4A3J K;  3GTQ C;  1WOP A;  5IOR A;  4LQY A;  2JA7 K;  2P5M A;  4QJV B;  2GAG C;  4LR2 A;  4C3I K;  1O2B A;  2ZFZ A;  1WCM C;  2PHC B;  2XCQ A;  2Y0S L;  5IYB C;  1IQ0 A;  2KWA A;  3IPJ A;  3N0B A;  4LK1 A;  4BBR K;  3M3Y K;  5M3F K;  5TJ3 A;  2Y0S D;  3GDZ A;  2R7Z K;  3H3V L;  4GT9 A;  5IYD C;  1F9N A;  3HOU C;  1HI9 A;  2WB1 D;  2A69 A;  4NOI A;  4QIW L;  4BBS K;  3GTO C;  4KN4 A;  3NUH A;  1I3Q C;  3HOY C;  3HXA A;  4G7Z A;  1VRQ C;  3S14 C;  1DD5 A;  4MQ9 A;  3CAG A;  2Y3P A;  3TFI A;  2E2J C;  2R93 K;  1VGX A;  1B4A A;  4A3L K;  2FQO A;  2NVY C;  5M3M K;  3GTG C;  3HOX C;  1J6X A;  5CJ9 A;  2R93 C;  4OIN A;  2JA6 A;  3HOW K;  2R7Z A;  5C4X C;  3V4G A;  1ZXO A;  5D4D A;  2R92 K;  2VUM A;  1XXC A;  1XZP A;  4LLG A;  1GE9 A;  4AYB L;  1WQH A;  2CW0 A;  3JST A;  1DCH A;  2E2H K;  5IYC C;  1R9T A;  1XPP A;  3SZY A;  1VLO A;  4A3D K;  4WJ3 M;  1WSV A;  1ZYR A;  1TWA C;  4BY1 C;  4DDQ A;  3S17 K;  4P9S A;  3RZD K;  3HOU K;  3L4J A;  4A3G K;  1USM A;  4A3M K;  3N0C A; 
#chains in the Genus database with same CATH homology
 4JK1 A;  3M4O C;  4G7H A;  5IYB K;  4X6A K;  3S2H C;  4MEX A;  1K83 C;  2JA5 C;  3FKI C;  4BY7 K;  4G7O A;  4C2M K;  3S17 C;  3GTK C;  2NVX C;  1I3Q K;  2A6H A;  5FJ8 K;  1WCM K;  1I50 C;  3S15 C;  5IYD K;  4A3K K;  4A3C K;  3M3Y C;  5C44 K;  2PPB A;  2NVY K;  1K83 K;  1BDF A;  1SFO C;  4QJV A;  1R9T K;  2JA7 C;  4Q5S A;  4XLN A;  4A3I K;  5TMF A;  4Y7N C;  3I4N K;  4ZH4 A;  5FLM K;  2JA8 C;  3S1N K;  2JA5 K;  2B63 K;  4YFN A;  2JA6 C;  3FKI K;  4OIP A;  3GTJ K;  2A6E A;  4Q4Z A;  4XSX A;  3S1R C;  1Y1V K;  4A3F K;  4A3I C;  2PMZ D;  5M5X K;  2O5I A;  2WAQ D;  2R92 C;  3H3V D;  3PO2 C;  5IP7 K;  4A3J K;  2NVT K;  3GTQ C;  4XLP A;  3PO3 K;  3S1N C;  4BXX C;  5IP9 C;  4QIW D;  2PA8 D;  4BBR C;  3S2D C;  2WB1 L;  3RZD C;  2JA7 K;  1Y1V C;  4A3F C;  1I6H K;  3HKZ L;  4A3E K;  4QJV B;  3S16 K;  1SMY A;  3WOD A;  4A3L C;  4MEY A;  2JA8 K;  3GTL C;  4C3I K;  1WCM C;  2VUM K;  2Y0S L;  2R7Z C;  5IYB C;  4C3H K;  3HKZ D;  4X6A C;  1TWF K;  3RZO K;  1TWH K;  4A93 K;  4LK1 A;  4BBR K;  3M3Y K;  5M3F K;  2Y0S D;  2R7Z K;  3H3V L;  5IYD C;  3S15 K;  3S1M C;  4OIO A;  5C4J C;  3S16 C;  3HOY K;  1TWC K;  3GTM C;  3HOU C;  3S1R K;  5C3E K;  2WB1 D;  2A69 A;  4NOI A;  3CQZ C;  2B63 C;  2PA8 L;  1I6V A;  4QIW L;  5IP7 C;  5FLM C;  4Y7N K;  4Y52 C;  5C4J K;  4A3J C;  3GTO C;  4KN4 A;  1HQM A;  2WAQ L;  1TWF C;  3HOX K;  2PMZ L;  2YU9 C;  1TWH C;  3GTG K;  4A93 C;  2E2H C;  3HOW C;  4GZY A;  3H0G C;  1Y1W K;  2BE5 A;  1I3Q C;  1TWG K;  3HOY C;  1I50 K;  4G7Z A;  3S14 C;  2NVQ K;  3I4N C;  2E2J C;  4MQ9 A;  2NVX K;  4BY1 K;  3HOV C;  3EQL A;  3S1Q C;  2R93 K;  1I6H C;  1YNJ A;  4BBS K;  4A3E C;  4A3L K;  2NVY C;  1IW7 A;  4YG2 A;  2YU9 K;  3K7A C;  5M3M K;  3GTG C;  2E2J K;  2VUM C;  3HOX C;  4A3G C;  2R93 C;  4YFX A;  4OIN A;  4A3M C;  3H0G K;  3HOW K;  3GTJ C;  3I4M K;  1TWG C;  3DXJ A;  5C4X C;  4LJZ A;  5TMC A;  5M5Y K;  3M4O K;  2O5J A;  3S2H K;  4XSZ A;  4BXX K;  5D4D A;  5IP9 K;  2R92 K;  3S1M K;  2A68 A;  4A3B K;  3S2D K;  4A3D C;  4OIQ A;  3GTP K;  5C3E C;  3K7A K;  3CQZ K;  3HOZ K;  4LLG A;  4AYB L;  4A3K C;  4A3C C;  5IYC K;  4KMU A;  5C44 C;  3I4M C;  2CW0 A;  4C3J K;  3GTL K;  2NVQ C;  1TWA K;  3HOZ C;  4AYB D;  1Y1W C;  2E2H K;  5IYC C;  3RZO C;  1XPP A;  4YFK A;  1SFO K;  4A3B C;  4A3D K;  3GTP C;  1ZYR A;  3S1Q K;  1YNN A;  3S14 K;  1TWA C;  3PO2 K;  2E2I K;  4BY1 C;  2NVT C;  3GTQ K;  3HOV K;  3PO3 C;  4BY7 C;  4LK0 A;  3GTK K;  3GTM K;  3S17 K;  5M5W K;  5C4X K;  2JA6 K;  3RZD K;  1TWC C;  3HOU K;  2E2I C;  4OIR A;  4KN7 A;  3GTO K;  4A3G K;  4A3M K;  4BBS C;  1R9T C;  4Y52 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...