5IYDL

Human core-pic in the initial transcribing state (no iis)
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
46
structure length
46
Chain Sequence
QPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna/rna
total genus 1
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF03604 DNA_RNApol_7kD DNA directed RNA polymerase, 7 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.30 Mainly Beta Single Sheet Rubrerythrin, domain 2 RNA polymerase ii, chain L 5iydL00
3CQZL 3S1QL 3S2DL 4A93L 3HOZL 5FLML 3HOWL 5IYCL 4QIWP 4Y52L 3GTML 5C4XL 4A3IL 2JA7L 4C3JL 2B63L 3HOYL 4BBSL 3HOUL 1SFOL 2Y0SP 2R93L 4A3JL 2E2HL 3RZOL 3H0GL 5M3ML 4Y7NL 3M4OL 2VUML 3GTJL 5M3FL 2YU9L 3H3VM 4BY7L 3RZDL 3HKZP 2WAQP 4BY1L 2NVXL 2JA8L 1R9TL 1TWHL 2JA6L 3GTQL 5C4JL 5IYDL 3I4NL 5M5XL 3GTKL 1Y1VL 3HOXL 3GTOL 3S16L 3S14L 4BBRL 2JA5L 1WCML 1TWCL 1TWAL 4BXXL 5IP9L 3PO3L 3I4ML 2R7ZL 2R92L 4A3ML 1Y1WL 4A3GL 1I50L 3HOVL 4A3BL 2NVQL 3S17L 3GTLL 4C3HL 2WB1P 1TWGL 5IP7L 1I3QL 3S1ML 1K83L 3S1NL 4C3IL 4A3KL 4AYBP 3S2HL 2NVTL 4A3DL 2NVYL 2PMZP 3GTGL 1I6HL 3M3YL 5M5WL 4A3FL 5IYBL 3K7AL 4X6AL 1TWFL 4A3LL 4A3EL 3FKIL 3PO2L 2E2IL 5C3EL 3GTPL 3S15L 2E2JL 5M5YL 4A3CL 5C44L 5FJ8L 3S1RL 4C2M1
chains in the Genus database with same CATH superfamily
1Z92B 2PSMC 2XJUA 3ZG6A 2Z3RB 1F4LA 5IYCL 4JAEA 2XJRA 1RWDA 4A3IL 4JAFA 1VZGA 2DSXA 5DM71 4K9FA 1DX8A 4ZN1B 5RXNA 4A3JL 2E2HL 2PVXA 5MGNA 1R0FA 3HJWB 3M4OL 2VUML 3IU3I 1BQ9A 5M3FL 4V196 1RYTA 3K35A 3RZDL 4BY1L 4UY81 1R9TL 4AHWA 2JA6L 1QYBA 1DVBA 3I4NL 1LTLA 3B0AB 1PFWA 2V0EA 1WCML 1YUXA 3PZAA 1TWAL 3PO3L 2R7ZL 1S24A 3RZTA 2KKDA 3VPBE 3MPSA 1Y1WL 1QQTA 1SMWA 4A3BL 7RXNA 1P7PA 4G6BA 2HR5A 5IP7L 1IROA 3KYUA 4A3KL 3QQCE 2PMZP 1I6HL 3KYXA 4AR5A 2JI1A 4YWMA 3K7AL 4AI3A 4X6AL 1TWFL 5MLC3 1LKOA 4AI1A 2H12A 2AQCA 4LHLA 5C3EL 1ZRPA 3LWRB 5JVG1 1R0GA 5FJ8L 4AR4A 5EIOC 3CQZL 4A93L 5FLML 4B8CD 1FHMA 4E6YA 4ME3A 3B08B 5GADc 5C4XL 2NYDA 1CAAA 4C3JL 2AUSB 3WWNB 4BBSL 1PFUA 2Y0SP 2A6ED 3RZOL 5M3ML 5AN9H 2CKAA 1SMMA 4AHZA 3H3VM 1OWCA 3KYVA 2ERJA 1H7VA 2WAQP 2CR8A 1TWHL 4TPUA 2O5JD 5M5XL 1Y1VL 3PWFA 3GTOL 3H97A 4GS7D 2JA5L 1JYBA 3MQKB 4BXXL 5IP9L 4AR3A 1PFVA 2R92L 4A3ML 4A3GL 2M4YA 1YK5A 3HOVL 2LCQA 2GMGA 6RXNA 3S17L 3KYWA 3GTLL 1S2ZA 4JAGA 5DM61 1RB9A 3J7Y1 2NVTL 2K2DA 3GTGL 1BRFA 1SMUA 2MS3A 4A3FL 3LWPB 3RZ6A 2APOB 4A3EL 3PO2L 3H9CA 4ZN3B 1RDGA 1YK4A 2M6PA 2E2IL 4AHXA 2JI2A 3PKJA 1WJVA 3S15L 1BFYA 1NXGA 4C2M1 3S1QL 4XXBB 3HOZL 1BE7A 3HOWL 3RYGA 4QIWP 4AI0A 3H99A 1VCXA 3KYYA 5AI2A 2B63L 5JVH1 3HOYL 1CADA 1IW7D 3PL5A 5K2ME 3LWVB 3A44A 3H0GL 1B13A 2C6AA 1R0JA 4Y7NL 2AYJA 4WFN1 3GTJL 3LWQB 1B2OA 2YU9L 1R0IA 4BY7L 1IU5A 2XJSA 2PPTA 5GAGc 4LHNA 3HKZP 2NVXL 1PZXA 2JA8L 2XJPA 3GTQL 5C4JL 3GTKL 3HOXL 2ZIXA 2A69D 3S14L 3HJYB 1LKPA 1RYQA 3NFPI 2JI3A 1RDVA 2XJVA 2PYAA 3PIP1 2QL0A 1T9OA 2NVQL 2V3BB 4C3HL 3QVDA 2WB1P 3P8BA 1TWGL 2XJTA 1I3QL 4U671 1E8JA 4AYBP 3J7Z1 2PVEA 3S2HL 1NNQA 3FDJA 1S30A 5M5WL 5IYBL 2RFKB 2HVYC 3WWLA 4JADA 4A3LL 4AI2A 3FKIL 3GTPL 1VZIA 2M4VA 5C44L 3SS2A 3S1RL 3S1ML 3S2DL 3LNLA 5GAHc 4POFA 1C09A 2A6HD 2Z3QB 2B5ID 4Y52L 3GTML 1NXEA 2JA7L 3HOUL 2BE5D 1FHHA 1SFOL 2R93L 2VL6A 1YUZA 1QCVA 4AHYA 3JR7A 3H9BA 5MFPA 5AI3A 2KN9A 3PIO1 4TVMA 2A68D 2J9UB 1B2JA 2ERSA 3HAXC 3LWOB 2RDVA 2EY4E 5IYDL 2L0ZA 2V0FA 1IRNA 3S16L 2M6OA 4BBRL 1R0HA 1PFYA 1TWCL 1VZHA 2C6BA 5MFZA 3I4ML 1ODHA 4XGHA 1BQ8A 3P2AA 1LKMA 2CKCA 1I50L 5GAEc 3PKIA 4YWLA 2XJQA 1YV1A 1B71A 1IU6A 1T9PA 4AR6A 5MF6A 1K83L 3S1NL 4C3IL 1T9QA 4RXNA 4A3DL 2NVYL 3M3YL 3MSUA 5H1Sc 3LPEB 4POGA 1OWBA 5EINC 2E2JL 5M5YL 4A3CL 8RXNA 5IY0A
chains in the Genus database with same CATH topology
3CQZL 3S1QL 3S2DL 4A93L 3HOZL 5FLML 3HOWL 5IYCL 4QIWP 4Y52L 3GTML 5C4XL 4A3IL 2JA7L 4C3JL 2B63L 3HOYL 4BBSL 3HOUL 1SFOL 2Y0SP 2R93L 4A3JL 2E2HL 3RZOL 3H0GL 5M3ML 4Y7NL 3M4OL 2VUML 3GTJL 5M3FL 2YU9L 3H3VM 4BY7L 3RZDL 3HKZP 2WAQP 4BY1L 2NVXL 2JA8L 1R9TL 1TWHL 2JA6L 3GTQL 5C4JL 5IYDL 3I4NL 5M5XL 3GTKL 1Y1VL 3HOXL 3GTOL 3S16L 3S14L 4BBRL 2JA5L 1WCML 1TWCL 1TWAL 4BXXL 5IP9L 3PO3L 3I4ML 2R7ZL 2R92L 4A3ML 1Y1WL 4A3GL 1I50L 3HOVL 4A3BL 2NVQL 3S17L 3GTLL 4C3HL 2WB1P 1TWGL 5IP7L 1I3QL 3S1ML 1K83L 3S1NL 4C3IL 4A3KL 4AYBP 3S2HL 2NVTL 4A3DL 2NVYL 2PMZP 3GTGL 1I6HL 3M3YL 5M5WL 4A3FL 5IYBL 3K7AL 4X6AL 1TWFL 4A3LL 4A3EL 3FKIL 3PO2L 2E2IL 5C3EL 3GTPL 3S15L 2E2JL 5M5YL 4A3CL 5C44L 5FJ8L 3S1RL 4C2M1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQZ L;  3S1Q L;  3S2D L;  4A93 L;  3HOZ L;  5FLM L;  3HOW L;  5IYC L;  4QIW P;  4Y52 L;  3GTM L;  5C4X L;  4A3I L;  2JA7 L;  4C3J L;  2B63 L;  3HOY L;  4BBS L;  3HOU L;  1SFO L;  2Y0S P;  2R93 L;  4A3J L;  2E2H L;  3RZO L;  3H0G L;  5M3M L;  4Y7N L;  3M4O L;  2VUM L;  3GTJ L;  5M3F L;  2YU9 L;  3H3V M;  4BY7 L;  3RZD L;  3HKZ P;  2WAQ P;  4BY1 L;  2NVX L;  2JA8 L;  1R9T L;  1TWH L;  2JA6 L;  3GTQ L;  5C4J L;  5IYD L;  3I4N L;  5M5X L;  3GTK L;  1Y1V L;  3HOX L;  3GTO L;  3S16 L;  3S14 L;  4BBR L;  2JA5 L;  1WCM L;  1TWC L;  1TWA L;  4BXX L;  5IP9 L;  3PO3 L;  3I4M L;  2R7Z L;  2R92 L;  4A3M L;  1Y1W L;  4A3G L;  1I50 L;  3HOV L;  4A3B L;  2NVQ L;  3S17 L;  3GTL L;  4C3H L;  2WB1 P;  1TWG L;  5IP7 L;  1I3Q L;  3S1M L;  1K83 L;  3S1N L;  4C3I L;  4A3K L;  4AYB P;  3S2H L;  2NVT L;  4A3D L;  2NVY L;  2PMZ P;  3GTG L;  1I6H L;  3M3Y L;  5M5W L;  4A3F L;  5IYB L;  3K7A L;  4X6A L;  1TWF L;  4A3L L;  4A3E L;  3FKI L;  3PO2 L;  2E2I L;  5C3E L;  3GTP L;  3S15 L;  2E2J L;  5M5Y L;  4A3C L;  5C44 L;  5FJ8 L;  3S1R L;  4C2M 1; 
#chains in the Genus database with same CATH topology
 1Z92 B;  2PSM C;  2XJU A;  3ZG6 A;  2Z3R B;  1F4L A;  5IYC L;  4JAE A;  2XJR A;  1RWD A;  4A3I L;  4JAF A;  1VZG A;  2DSX A;  5DM7 1;  4K9F A;  1DX8 A;  4ZN1 B;  5RXN A;  4A3J L;  2E2H L;  2PVX A;  5MGN A;  1R0F A;  3HJW B;  3M4O L;  2VUM L;  3IU3 I;  1BQ9 A;  5M3F L;  4V19 6;  1RYT A;  3K35 A;  3RZD L;  4BY1 L;  4UY8 1;  1R9T L;  4AHW A;  2JA6 L;  1QYB A;  1DVB A;  3I4N L;  1LTL A;  3B0A B;  1PFW A;  2V0E A;  1WCM L;  1YUX A;  3PZA A;  1TWA L;  3PO3 L;  2R7Z L;  1S24 A;  3RZT A;  2KKD A;  3VPB E;  3MPS A;  1Y1W L;  1QQT A;  1SMW A;  4A3B L;  7RXN A;  1P7P A;  4G6B A;  2HR5 A;  5IP7 L;  1IRO A;  3KYU A;  4A3K L;  3QQC E;  2PMZ P;  1I6H L;  3KYX A;  4AR5 A;  2JI1 A;  4YWM A;  3K7A L;  4AI3 A;  4X6A L;  1TWF L;  5MLC 3;  1LKO A;  4AI1 A;  2H12 A;  2AQC A;  4LHL A;  5C3E L;  1ZRP A;  3LWR B;  5JVG 1;  1R0G A;  5FJ8 L;  4AR4 A;  5EIO C;  3CQZ L;  4A93 L;  5FLM L;  4B8C D;  1FHM A;  4E6Y A;  4ME3 A;  3B08 B;  5GAD c;  5C4X L;  2NYD A;  1CAA A;  4C3J L;  2AUS B;  3WWN B;  4BBS L;  1PFU A;  2Y0S P;  2A6E D;  3RZO L;  5M3M L;  5AN9 H;  2CKA A;  1SMM A;  4AHZ A;  3H3V M;  1OWC A;  3KYV A;  2ERJ A;  1H7V A;  2WAQ P;  2CR8 A;  1TWH L;  4TPU A;  2O5J D;  5M5X L;  1Y1V L;  3PWF A;  3GTO L;  3H97 A;  4GS7 D;  2JA5 L;  1JYB A;  3MQK B;  4BXX L;  5IP9 L;  4AR3 A;  1PFV A;  2R92 L;  4A3M L;  4A3G L;  2M4Y A;  1YK5 A;  3HOV L;  2LCQ A;  2GMG A;  6RXN A;  3S17 L;  3KYW A;  3GTL L;  1S2Z A;  4JAG A;  5DM6 1;  1RB9 A;  3J7Y 1;  2NVT L;  2K2D A;  3GTG L;  1BRF A;  1SMU A;  2MS3 A;  4A3F L;  3LWP B;  3RZ6 A;  2APO B;  4A3E L;  3PO2 L;  3H9C A;  4ZN3 B;  1RDG A;  1YK4 A;  2M6P A;  2E2I L;  4AHX A;  2JI2 A;  3PKJ A;  1WJV A;  3S15 L;  1BFY A;  1NXG A;  4C2M 1;  3S1Q L;  4XXB B;  3HOZ L;  1BE7 A;  3HOW L;  3RYG A;  4QIW P;  4AI0 A;  3H99 A;  1VCX A;  3KYY A;  5AI2 A;  2B63 L;  5JVH 1;  3HOY L;  1CAD A;  1IW7 D;  3PL5 A;  5K2M E;  3LWV B;  3A44 A;  3H0G L;  1B13 A;  2C6A A;  1R0J A;  4Y7N L;  2AYJ A;  4WFN 1;  3GTJ L;  3LWQ B;  1B2O A;  2YU9 L;  1R0I A;  4BY7 L;  1IU5 A;  2XJS A;  2PPT A;  5GAG c;  4LHN A;  3HKZ P;  2NVX L;  1PZX A;  2JA8 L;  2XJP A;  3GTQ L;  5C4J L;  3GTK L;  3HOX L;  2ZIX A;  2A69 D;  3S14 L;  3HJY B;  1LKP A;  1RYQ A;  3NFP I;  2JI3 A;  1RDV A;  2XJV A;  2PYA A;  3PIP 1;  2QL0 A;  1T9O A;  2NVQ L;  2V3B B;  4C3H L;  3QVD A;  2WB1 P;  3P8B A;  1TWG L;  2XJT A;  1I3Q L;  4U67 1;  1E8J A;  4AYB P;  3J7Z 1;  2PVE A;  3S2H L;  1NNQ A;  3FDJ A;  1S30 A;  5M5W L;  5IYB L;  2RFK B;  2HVY C;  3WWL A;  4JAD A;  4A3L L;  4AI2 A;  3FKI L;  3GTP L;  1VZI A;  2M4V A;  5C44 L;  3SS2 A;  3S1R L;  3S1M L;  3S2D L;  3LNL A;  5GAH c;  4POF A;  1C09 A;  2A6H D;  2Z3Q B;  2B5I D;  4Y52 L;  3GTM L;  1NXE A;  2JA7 L;  3HOU L;  2BE5 D;  1FHH A;  1SFO L;  2R93 L;  2VL6 A;  1YUZ A;  1QCV A;  4AHY A;  3JR7 A;  3H9B A;  5MFP A;  5AI3 A;  2KN9 A;  3PIO 1;  4TVM A;  2A68 D;  2J9U B;  1B2J A;  2ERS A;  3HAX C;  3LWO B;  2RDV A;  2EY4 E;  5IYD L;  2L0Z A;  2V0F A;  1IRN A;  3S16 L;  2M6O A;  4BBR L;  1R0H A;  1PFY A;  1TWC L;  1VZH A;  2C6B A;  5MFZ A;  3I4M L;  1ODH A;  4XGH A;  1BQ8 A;  3P2A A;  1LKM A;  2CKC A;  1I50 L;  5GAE c;  3PKI A;  4YWL A;  2XJQ A;  1YV1 A;  1B71 A;  1IU6 A;  1T9P A;  4AR6 A;  5MF6 A;  1K83 L;  3S1N L;  4C3I L;  1T9Q A;  4RXN A;  4A3D L;  2NVY L;  3M3Y L;  3MSU A;  5H1S c;  3LPE B;  4POG A;  1OWB A;  5EIN C;  2E2J L;  5M5Y L;  4A3C L;  8RXN A;  5IY0 A; 
#chains in the Genus database with same CATH homology
 3CQZ L;  3S1Q L;  3S2D L;  4A93 L;  3HOZ L;  5FLM L;  3HOW L;  5IYC L;  4QIW P;  4Y52 L;  3GTM L;  5C4X L;  4A3I L;  2JA7 L;  4C3J L;  2B63 L;  3HOY L;  4BBS L;  3HOU L;  1SFO L;  2Y0S P;  2R93 L;  4A3J L;  2E2H L;  3RZO L;  3H0G L;  5M3M L;  4Y7N L;  3M4O L;  2VUM L;  3GTJ L;  5M3F L;  2YU9 L;  3H3V M;  4BY7 L;  3RZD L;  3HKZ P;  2WAQ P;  4BY1 L;  2NVX L;  2JA8 L;  1R9T L;  1TWH L;  2JA6 L;  3GTQ L;  5C4J L;  5IYD L;  3I4N L;  5M5X L;  3GTK L;  1Y1V L;  3HOX L;  3GTO L;  3S16 L;  3S14 L;  4BBR L;  2JA5 L;  1WCM L;  1TWC L;  1TWA L;  4BXX L;  5IP9 L;  3PO3 L;  3I4M L;  2R7Z L;  2R92 L;  4A3M L;  1Y1W L;  4A3G L;  1I50 L;  3HOV L;  4A3B L;  2NVQ L;  3S17 L;  3GTL L;  4C3H L;  2WB1 P;  1TWG L;  5IP7 L;  1I3Q L;  3S1M L;  1K83 L;  3S1N L;  4C3I L;  4A3K L;  4AYB P;  3S2H L;  2NVT L;  4A3D L;  2NVY L;  2PMZ P;  3GTG L;  1I6H L;  3M3Y L;  5M5W L;  4A3F L;  5IYB L;  3K7A L;  4X6A L;  1TWF L;  4A3L L;  4A3E L;  3FKI L;  3PO2 L;  2E2I L;  5C3E L;  3GTP L;  3S15 L;  2E2J L;  5M5Y L;  4A3C L;  5C44 L;  5FJ8 L;  3S1R L;  4C2M 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...