5IYPA

Protruding domain of gii.4 human norovirus chdc2094 in complex with hbga type a (triglycan)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
305
structure length
303
Chain Sequence
KPFTVPILTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTTQLSAVNICNFRGDVTRVGISHDYTMNLVSQNWNNYDPTEEIPAPLGTPDFVGKIQGLLTQTTRADGSTRAHKATVSTGSVHFTPKLGSVQFTTDTNNDFQTGQNTKFTPVGVIQDGHQNEPQQWVLPNYSGTSGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLDCLLPQEWVSHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYITVAHTGPYDLVIPPNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Four decades of structural evolution of GII.4 norovirus
rcsb
source organism Norovirus hu/gii.4/chdc2094/1974/us
molecule tags Viral protein
total genus 71
structure length 303
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5iypA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5iypA01
3RY8A 3Q6RA 4QV2A 4OPVA 4OPOA 3BQJA 2ZL6A 4RDKA 4X0CA 4OP7A 5J35A 3SJPA 4X06A 4OOVA 3SKBA 4Z4YA 4P26A 3PA2A 4P12A 4WZEA 3R6JA 3SLDA 4Z4ZA 4QVAA 3LQEA 3R6KA 4Z4TA 4P2NA 4OOSA 5IYQA 3Q6QA 4ROXA 4RPDA 5F4OA 3Q39A 4X7FA 3SLNA 5IYWA 4RM0A 5J3OA 2OBSA 5IYRA 5KW9A 4OPSA 4RDJA 4QVJA 5BSXA 2ZL7A 4QUZA 2OBRA 4Z4WA 1IHMA 4P25A 3PUMA 3PUNA 4P1VA 5BSYA 3PVDA 3BY2A 3ONYA 3ASPA 4X05A 5HZBA 4Z4UA 3ASTA 4X7EA 4X7DA 5IYNA 4Z4RA 4WZKA 3SEJA 2ZL5A 4Z4VA 3Q38A 5IYPA 4OOXA 4RDLA 4RPBA 3ASSA 4X07A 4WZTA 3ASRA 3D26A 3LQ6A 4Z4SA 5E6TA 4P3IA 4WZLA 3Q3AA 3PA1A 5HZAA 2OBTA 4X7CA 3ASQA 3BY1A 5F4JA 4RLZA 3ONUA 3V7AA 5F4MA
chains in the Genus database with same CATH superfamily
3RY8A 1E79A 3QFRA 3OAAA 4QV2A 3OEHA 1JB9A 1CNFA 2CBXA 4HIZA 4HE5A 1FNDA 4YAFA 1E63A 4YELA 2ZL6A 4RDKA 5A8AA 2BSAA 3G05A 1BJKA 2C77A 4YALA 2NV4A 1EXMA 2QGGA 3AVWA 3H9NA 2HDNB 2F4NA 1HA3A 4G1BA 2GQFA 1I7PA 3E20A 4OOVA 5A88A 1D8TA 3ZC3A 3B78A 1Y0RA 1YJNB 1UMKA 2GJPA 2JJ2A 3WBJA 3B8HA 5FNZA 3SLDA 2ZZQA 1WOPA 4XLFA 4R71A 1VHOA 2LZJA 1YHQB 4QVAA 3LQEA 1WOOA 4Z4TA 4LBWA 4P2NA 4OOSA 2GPJA 5IYQA 2BPOA 4XLEA 2BGIA 5IYWA 3T56B 3WXMA 2XZPA 1QGYA 4EH1A 4PC3A 4XN3A 2HCJB 5IYRA 3VO2A 2VBUA 4P3YA 4C0SA 3CRZA 2OTLB 1ZM2A 2QE7A 1T6ZA 2C4TA 3KEWA 2RC5A 2ZL7A 4TMZA 3W2EA 3CCQB 4P25A 3PUMA 2CNDA 1NJID 3P26A 4JMQA 2DYIA 4TMTA 1OB2A 2CF4A 4YHBA 3CCJB 4DQKA 3NE5B 3WQZA 2OTJB 2D3LA 1EFTA 3OPOA 4M0LA 3QFCA 4M2LA 4K1XA 3T53B 5HZBA 1VQOB 1KTVA 1E62A 1GJRA 2BN4A 2VNIA 3ASTA 4NBSA 2VJIA 3GQBA 1VLYA 2C78A 4ACBA 2WZPP 1D1NA 1EFCA 1E43A 3CC4B 3SEJA 1XQBA 3OEEA 4RCYA 1QGAA 2ZL5A 3JQRA 2X85A 5IYPA 5KSWB 2CK3A 2BV3A 1W34A 1E1QA 1QH0A 2X6XA 3A3GA 3CTAA 2WSSA 3CP8A 5E6TA 4WWVA 2B5OA 2WR8A 3CCSB 1VF7A 3LO8A 1N06A 3MMPA 4LBYA 3BCDA 3E1YE 4UAJA 2E1RA 2GJKA 1P4MA 1PKVA 4X7CA 2YWEA 1JJ2B 2AHOA 2CRVA 1UD8A 2QTLA 1OB5A 4L8JA 5KNLA 4U9UA 1W2BB 4ACAA 3CMEB 1JA0A 3BCFA 1CQXA 1KK3A 1KMHA 2HMAA 2V7QA 2VBSA 2X6WA 1QFJA 3V7AA 4AF6A 5F4MA 2XZOA 3A8JA 3JQPA 1QGZA 1UD3A 1ZM9A 3CW2A 4TN1A 1ELOA 3GIRA 3ZZTA 5IK2A 1QVFB 4X0CA 4OP7A 3SJPA 2Z6BD 4X06A 1BLIA 2CW5A 4DK1A 3HAGA 4ASUA 2Q6LA 4RJLA 3GSIA 3G71B 2VNJA 1JA1A 1D2EA 5DSZA 1GAQA 4P26A 1RQPA 3KL9A 1Q82D 1KC8D 3PA2A 2EIXA 3R6JA 4Y9RA 4TMWA 5HXBA 1GVHA 1S4MA 3VR6A 1V0EA 3ZIAA 1NDHA 2VJJA 4BPRA 3CMAB 3AVTA 4H9GA 4PAAA 3CPWB 4ROXA 4LC0A 4RPDA 4YEJA 5F4OA 4F7DA 2I1LA 4FK8A 4C43A 2WZNA 3SLNA 4E0FA 1N8RD 2OBSA 4FN5A 3QFTA 2FVGA 5TRDA 1QVGB 2VBTA 4OPSA 4KKUA 3OOCA 1K73D 1HZEA 2KVOA 4QVJA 4PC1A 4YAOA 3H94A 1KJZA 5BSXA 4XD7A 1VQ9B 3J81k 4QUZA 2BGJA 2VNKA 2OYNA 1HVXA 1DDIA 1GAWA 4XONA 4XOPA 5H5JA 1K9MD 4YAUA 2XEXA 1KD1D 3DDYA 4YXWA 1VJSA 5BSYA 2X0KA 4XN0A 3ZBUA 2ZXHA 1PJ7A 1A8PA 1YJWB 2ZZFA 3ZPNA 3BY2A 4UZUA 3OW7A 1U2RA 3QFSA 4X05A 1VQ5B 2XZLA 4Z4UA 4P6YA 5AN9A 4X7EA 2X53S 1BMFA 2W6IA 3CCMB 2ZZEA 4IW3B 2V7TA 1V0FA 1R5OA 1NBMA 4G1VA 3Q38A 2GK6A 4OOXA 5THXA 2WPDA 2JN9A 3OFNA 3VNUA 4XQFA 1KRHA 4TMVA 1M1KD 2YWHA 1BQEA 1FRQA 4TT3A 4Z4SA 2ZTNA 1WOSA 1FNBA 2X3UA 1KK1A 3OW2B 1QG0A 3QSYA 1F20A 2QEXB 4PABA 2BM0A 2QN6A 3CB4A 1NRKA 4RD1A 5TR9A 1MABA 4XR6A 3AVUA 1I8DA 2VBVA 3A35A 4XKWA 1ZM3A 1WP6A 3ASQA 1OHHA 4YAWA 5H59A 1VHEA 3VO1A 1T5EA 1Y0YA 4NNJA 1WPCA 4RLZA 1KQSB 2X8KA 1KK0A 2QTZA 3ONUA 1EP1B 4PC7A 5DN6A 4P9SA 3ISXA 4G7WA 1KK2A 4M53A 3Q6RA 1QFZA 5TY0A 3G6EB 4AC9A 1FX0A 4OPVA 3ZZ0A 4XORA 1DDGA 1UD4A 2X6YA 3BQJA 2ZZGA 4AVZA 2C5HA 1E3ZA 5J35A 1W0JA 3CC7B 1IJEA 1VQLB 1G7SA 2QA4B 5FO1A 4B3XA 2V4DA 2V7XA 4CQJA 3B82A 4XOTA 3WBKA 1VQKB 1W9XA 2VZLA 3JQQA 4ZCMA 4X8IA 3SKBA 1VQNB 1K8AD 2D9RA 3BH4A 4P12A 4WZEA 1N0UA 1H85A 4DNRB 3A1PA 3MCAA 4M4SA 3CCRB 3FKSA 5CDFA 2PMDA 1FRNA 4Z4ZA 2C5BA 5FIUA 3WY9A 4Y7CA 3WNBA 1VQMB 3OZVA 2WYRA 4DQLA 2XNCA 1S0UA 2YWFA 1PJ6A 1Q81D 1H8EA 1G7CA 1UD5A 2ZBUA 3Q39A 1H42A 4RM0A 4UZEA 4X7FA 2EFGA 4XM3A 2V7WA 5KW9A 2VNHA 3WYAA 4ZGQB 1S72B 4FXUA 3MHPA 3ZUGA 4G6IA 2D74A 2OK7A 1EP3B 4XLAA 2BM1A 5GV8A 1EFRA 1DARA 2QMUA 5HKKA 3U6KA 2ZITA 2OBRA 4Z4WA 2B7BA 2DCUA 1YX2A 4FWTA 1BPLA 5FL7A 4P1VA 1KZLA 2B7CA 2FX3A 1I18A 5DS0A 3AVVA 1E3XA 1CNEA 1UD6A 3A3BA 3CD6B 3PVDA 1WSRA 3A8IA 1ZUNB 3I56B 1N0VC 2R6HA 3CCVB 1SKQA 2CC2A 1W35A 4ZCLA 2GK7A 3PENA 1PJ5A 2C4UA 4X7DA 5IYNA 2JJ1A 2ZBVA 4Z4RA 3U2QA 5A89A 5LMZA 3W2IA 2DEUA 4XL9A 2E1BA 2W6JA 1XFOA 1TTTA 3WNDA 1Q7YD 1G7RA 1NB0A 4XMYA 4B48A 2V31A 1RQRA 1BX1A 2NPFA 1WDTA 3AVYA 1W0KA 1QUEA 2DETA 4RPBA 3ASSA 4WQMA 5GV7A 4DNTB 4B47A 1T6XA 2JDIA 2PIAA 3D26A 3LQ6A 3CMMA 1YJ9B 4P3IA 3BC9A 1YITB 3W5HA 1OGJA 4RD0A 5HZAA 1YI2B 2PLFA 4RCZA 1WSVA 2GREA 1V5VA 4G7XA 3CP2A 4QFMA 4Q7JB 4LBZA 3GVJA 2XNDA 3BY1A 3GVKA 3GVLA 1DG1G 5F4JA 1QUFA 1QX4A 4P22A 1WU8A 2WJYA 1R5BA 4UZFA 3FJOA 1VQPB 3ZZUA 3SJZA 1J9ZA 1WORA 4OPOA 3VMFA 1Q9SA 3LVBA 2F43A 1EWYA 3ZBTA 2F1LA 3W2HA 1IJFA 1TUIA 4G5GA 1G7TA 2P3MA 1MRZA 4AF7A 1W87A 1YIJB 1H8HA 3ES9A 5FO0A 3I1FA 2XGJA 1T6YA 2HLDA 4Z1MA 4Z4YA 3A8KA 2DOGA 1AIPA 4TSFA 3T51B 1M90D 4B3GA 2Q6OA 4TKOB 1E64A 2V7UA 3CXCB 1ZM4A 3OJXA 3R6KA 5EMNA 4II3A 4PC2A 1YLOA 3CCLB 1XB2A 3FPPA 3Q6QA 3OP1A 4GQNA 3OJWA 1E1RA 2JIZA 5J3OA 3W5VA 1TLLA 1XE1A 3BNWA 4PC6A 4MYTA 5JBQA 4RDJA 3W2FA 1K28D 4TMXA 3OE7A 3I55B 3VNVA 4XLCA 1N05A 4XNFA 1OGIA 1F60A 1QFYA 4J0QA 2D3NA 2V7VA 1AMOA 1IHMA 1B2RA 1VLOA 5TV2A 1VQ4B 3PUNA 3AGPA 4RD2A 3JU4A 3OKXA 4XLHA 1FDRA 4KKTA 3OZWA 2C2WA 2XNJA 3ONYA 4Y9UA 3ASPA 2OK8A 4RD4A 2WJVA 1EFUA 1OB0A 3W2GA 2YWGA 4RD3A 1SM4A 3CCUB 4B3FX 1BX0A 1GO2A 4ZCIA 2QDXA 1TVCA 1VQ7B 1B23P 4WZKA 5B6IA 2Q6KA 4LBVA 2VYQA 4MYUA 4DK0A 4ZGNB 2DIEA 2Q6IA 2RC6A 3LNNA 1VQ8B 4Z4VA 3CC2B 3AGQA 3QE2A 4RDLA 1Q86D 1VQ6B 1EP2B 1SKYB 4X07A 4WZTA 2F1MA 2R9VA 3WNCA 4II2A 4XKVA 4N3GA 3ASRA 3CESA 3CPXA 1N08A 1R5NA 2ZTGA 4QHYA 4WZLA 4B4DA 4B43A 3G4SB 3Q3AA 3V76A 3OZUA 4M1KA 1FNMA 4HE6A 4KKSA 4PGOA 2DERA 4RD6A 4N3NA 3PA1A 2GJRA 5L46A 2BF4A 4NCNA 2BMWA 3U6BA 2BVNA 4P6VF 2J7KA 2OBTA 1GR1A 3CCEB 2XOKA 3FPKA 1NB9A 2ZXIA 5FA6A 3P27A 1WTHD 1FNCA 4ZV4A 3AVXA 2DY1A 1UD2A 2PE3A 3W5UA 1N07A 1JNYA 2M5SA 4B44A 1IB0A 1COWA
chains in the Genus database with same CATH topology
3RY8A 3Q6RA 4QV2A 4OPVA 4OPOA 3BQJA 2ZL6A 4RDKA 4X0CA 4OP7A 5J35A 3SJPA 4X06A 4OOVA 3SKBA 4Z4YA 4P26A 3PA2A 4P12A 4WZEA 3R6JA 3SLDA 4Z4ZA 4QVAA 3LQEA 3R6KA 4Z4TA 4P2NA 4OOSA 5IYQA 3Q6QA 4ROXA 4RPDA 5F4OA 3Q39A 4X7FA 3SLNA 5IYWA 4RM0A 5J3OA 2OBSA 5IYRA 5KW9A 4OPSA 4RDJA 4QVJA 5BSXA 2ZL7A 4QUZA 2OBRA 4Z4WA 1IHMA 4P25A 3PUMA 3PUNA 4P1VA 5BSYA 3PVDA 3BY2A 3ONYA 3ASPA 4X05A 5HZBA 4Z4UA 3ASTA 4X7EA 4X7DA 5IYNA 4Z4RA 4WZKA 3SEJA 2ZL5A 4Z4VA 3Q38A 5IYPA 4OOXA 4RDLA 4RPBA 3ASSA 4X07A 4WZTA 3ASRA 3D26A 3LQ6A 4Z4SA 5E6TA 4P3IA 4WZLA 3Q3AA 3PA1A 5HZAA 2OBTA 4X7CA 3ASQA 3BY1A 5F4JA 4RLZA 3ONUA 3V7AA 5F4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RY8 A;  3Q6R A;  4QV2 A;  4OPV A;  4OPO A;  3BQJ A;  2ZL6 A;  4RDK A;  4X0C A;  4OP7 A;  5J35 A;  3SJP A;  4X06 A;  4OOV A;  3SKB A;  4Z4Y A;  4P26 A;  3PA2 A;  4P12 A;  4WZE A;  3R6J A;  3SLD A;  4Z4Z A;  4QVA A;  3LQE A;  3R6K A;  4Z4T A;  4P2N A;  4OOS A;  5IYQ A;  3Q6Q A;  4ROX A;  4RPD A;  5F4O A;  3Q39 A;  4X7F A;  3SLN A;  5IYW A;  4RM0 A;  5J3O A;  2OBS A;  5IYR A;  5KW9 A;  4OPS A;  4RDJ A;  4QVJ A;  5BSX A;  2ZL7 A;  4QUZ A;  2OBR A;  4Z4W A;  1IHM A;  4P25 A;  3PUM A;  3PUN A;  4P1V A;  5BSY A;  3PVD A;  3BY2 A;  3ONY A;  3ASP A;  4X05 A;  5HZB A;  4Z4U A;  3AST A;  4X7E A;  4X7D A;  5IYN A;  4Z4R A;  4WZK A;  3SEJ A;  2ZL5 A;  4Z4V A;  3Q38 A;  5IYP A;  4OOX A;  4RDL A;  4RPB A;  3ASS A;  4X07 A;  4WZT A;  3ASR A;  3D26 A;  3LQ6 A;  4Z4S A;  5E6T A;  4P3I A;  4WZL A;  3Q3A A;  3PA1 A;  5HZA A;  2OBT A;  4X7C A;  3ASQ A;  3BY1 A;  5F4J A;  4RLZ A;  3ONU A;  3V7A A;  5F4M A; 
#chains in the Genus database with same CATH topology
 3RY8 A;  1E79 A;  3QFR A;  3OAA A;  4QV2 A;  3OEH A;  1JB9 A;  1CNF A;  2CBX A;  4HIZ A;  4HE5 A;  1FND A;  4YAF A;  1E63 A;  4YEL A;  2ZL6 A;  4RDK A;  5A8A A;  2BSA A;  3G05 A;  1BJK A;  2C77 A;  4YAL A;  2NV4 A;  1EXM A;  2QGG A;  3AVW A;  3H9N A;  2HDN B;  2F4N A;  1HA3 A;  4G1B A;  2GQF A;  1I7P A;  3E20 A;  4OOV A;  5A88 A;  1D8T A;  3ZC3 A;  3B78 A;  1Y0R A;  1YJN B;  1UMK A;  2GJP A;  2JJ2 A;  3WBJ A;  3B8H A;  5FNZ A;  3SLD A;  2ZZQ A;  1WOP A;  4XLF A;  4R71 A;  1VHO A;  2LZJ A;  1YHQ B;  4QVA A;  3LQE A;  1WOO A;  4Z4T A;  4LBW A;  4P2N A;  4OOS A;  2GPJ A;  5IYQ A;  2BPO A;  4XLE A;  2BGI A;  5IYW A;  3T56 B;  3WXM A;  2XZP A;  1QGY A;  4EH1 A;  4PC3 A;  4XN3 A;  2HCJ B;  5IYR A;  3VO2 A;  2VBU A;  4P3Y A;  4C0S A;  3CRZ A;  2OTL B;  1ZM2 A;  2QE7 A;  1T6Z A;  2C4T A;  3KEW A;  2RC5 A;  2ZL7 A;  4TMZ A;  3W2E A;  3CCQ B;  4P25 A;  3PUM A;  2CND A;  1NJI D;  3P26 A;  4JMQ A;  2DYI A;  4TMT A;  1OB2 A;  2CF4 A;  4YHB A;  3CCJ B;  4DQK A;  3NE5 B;  3WQZ A;  2OTJ B;  2D3L A;  1EFT A;  3OPO A;  4M0L A;  3QFC A;  4M2L A;  4K1X A;  3T53 B;  5HZB A;  1VQO B;  1KTV A;  1E62 A;  1GJR A;  2BN4 A;  2VNI A;  3AST A;  4NBS A;  2VJI A;  3GQB A;  1VLY A;  2C78 A;  4ACB A;  2WZP P;  1D1N A;  1EFC A;  1E43 A;  3CC4 B;  3SEJ A;  1XQB A;  3OEE A;  4RCY A;  1QGA A;  2ZL5 A;  3JQR A;  2X85 A;  5IYP A;  5KSW B;  2CK3 A;  2BV3 A;  1W34 A;  1E1Q A;  1QH0 A;  2X6X A;  3A3G A;  3CTA A;  2WSS A;  3CP8 A;  5E6T A;  4WWV A;  2B5O A;  2WR8 A;  3CCS B;  1VF7 A;  3LO8 A;  1N06 A;  3MMP A;  4LBY A;  3BCD A;  3E1Y E;  4UAJ A;  2E1R A;  2GJK A;  1P4M A;  1PKV A;  4X7C A;  2YWE A;  1JJ2 B;  2AHO A;  2CRV A;  1UD8 A;  2QTL A;  1OB5 A;  4L8J A;  5KNL A;  4U9U A;  1W2B B;  4ACA A;  3CME B;  1JA0 A;  3BCF A;  1CQX A;  1KK3 A;  1KMH A;  2HMA A;  2V7Q A;  2VBS A;  2X6W A;  1QFJ A;  3V7A A;  4AF6 A;  5F4M A;  2XZO A;  3A8J A;  3JQP A;  1QGZ A;  1UD3 A;  1ZM9 A;  3CW2 A;  4TN1 A;  1ELO A;  3GIR A;  3ZZT A;  5IK2 A;  1QVF B;  4X0C A;  4OP7 A;  3SJP A;  2Z6B D;  4X06 A;  1BLI A;  2CW5 A;  4DK1 A;  3HAG A;  4ASU A;  2Q6L A;  4RJL A;  3GSI A;  3G71 B;  2VNJ A;  1JA1 A;  1D2E A;  5DSZ A;  1GAQ A;  4P26 A;  1RQP A;  3KL9 A;  1Q82 D;  1KC8 D;  3PA2 A;  2EIX A;  3R6J A;  4Y9R A;  4TMW A;  5HXB A;  1GVH A;  1S4M A;  3VR6 A;  1V0E A;  3ZIA A;  1NDH A;  2VJJ A;  4BPR A;  3CMA B;  3AVT A;  4H9G A;  4PAA A;  3CPW B;  4ROX A;  4LC0 A;  4RPD A;  4YEJ A;  5F4O A;  4F7D A;  2I1L A;  4FK8 A;  4C43 A;  2WZN A;  3SLN A;  4E0F A;  1N8R D;  2OBS A;  4FN5 A;  3QFT A;  2FVG A;  5TRD A;  1QVG B;  2VBT A;  4OPS A;  4KKU A;  3OOC A;  1K73 D;  1HZE A;  2KVO A;  4QVJ A;  4PC1 A;  4YAO A;  3H94 A;  1KJZ A;  5BSX A;  4XD7 A;  1VQ9 B;  3J81 k;  4QUZ A;  2BGJ A;  2VNK A;  2OYN A;  1HVX A;  1DDI A;  1GAW A;  4XON A;  4XOP A;  5H5J A;  1K9M D;  4YAU A;  2XEX A;  1KD1 D;  3DDY A;  4YXW A;  1VJS A;  5BSY A;  2X0K A;  4XN0 A;  3ZBU A;  2ZXH A;  1PJ7 A;  1A8P A;  1YJW B;  2ZZF A;  3ZPN A;  3BY2 A;  4UZU A;  3OW7 A;  1U2R A;  3QFS A;  4X05 A;  1VQ5 B;  2XZL A;  4Z4U A;  4P6Y A;  5AN9 A;  4X7E A;  2X53 S;  1BMF A;  2W6I A;  3CCM B;  2ZZE A;  4IW3 B;  2V7T A;  1V0F A;  1R5O A;  1NBM A;  4G1V A;  3Q38 A;  2GK6 A;  4OOX A;  5THX A;  2WPD A;  2JN9 A;  3OFN A;  3VNU A;  4XQF A;  1KRH A;  4TMV A;  1M1K D;  2YWH A;  1BQE A;  1FRQ A;  4TT3 A;  4Z4S A;  2ZTN A;  1WOS A;  1FNB A;  2X3U A;  1KK1 A;  3OW2 B;  1QG0 A;  3QSY A;  1F20 A;  2QEX B;  4PAB A;  2BM0 A;  2QN6 A;  3CB4 A;  1NRK A;  4RD1 A;  5TR9 A;  1MAB A;  4XR6 A;  3AVU A;  1I8D A;  2VBV A;  3A35 A;  4XKW A;  1ZM3 A;  1WP6 A;  3ASQ A;  1OHH A;  4YAW A;  5H59 A;  1VHE A;  3VO1 A;  1T5E A;  1Y0Y A;  4NNJ A;  1WPC A;  4RLZ A;  1KQS B;  2X8K A;  1KK0 A;  2QTZ A;  3ONU A;  1EP1 B;  4PC7 A;  5DN6 A;  4P9S A;  3ISX A;  4G7W A;  1KK2 A;  4M53 A;  3Q6R A;  1QFZ A;  5TY0 A;  3G6E B;  4AC9 A;  1FX0 A;  4OPV A;  3ZZ0 A;  4XOR A;  1DDG A;  1UD4 A;  2X6Y A;  3BQJ A;  2ZZG A;  4AVZ A;  2C5H A;  1E3Z A;  5J35 A;  1W0J A;  3CC7 B;  1IJE A;  1VQL B;  1G7S A;  2QA4 B;  5FO1 A;  4B3X A;  2V4D A;  2V7X A;  4CQJ A;  3B82 A;  4XOT A;  3WBK A;  1VQK B;  1W9X A;  2VZL A;  3JQQ A;  4ZCM A;  4X8I A;  3SKB A;  1VQN B;  1K8A D;  2D9R A;  3BH4 A;  4P12 A;  4WZE A;  1N0U A;  1H85 A;  4DNR B;  3A1P A;  3MCA A;  4M4S A;  3CCR B;  3FKS A;  5CDF A;  2PMD A;  1FRN A;  4Z4Z A;  2C5B A;  5FIU A;  3WY9 A;  4Y7C A;  3WNB A;  1VQM B;  3OZV A;  2WYR A;  4DQL A;  2XNC A;  1S0U A;  2YWF A;  1PJ6 A;  1Q81 D;  1H8E A;  1G7C A;  1UD5 A;  2ZBU A;  3Q39 A;  1H42 A;  4RM0 A;  4UZE A;  4X7F A;  2EFG A;  4XM3 A;  2V7W A;  5KW9 A;  2VNH A;  3WYA A;  4ZGQ B;  1S72 B;  4FXU A;  3MHP A;  3ZUG A;  4G6I A;  2D74 A;  2OK7 A;  1EP3 B;  4XLA A;  2BM1 A;  5GV8 A;  1EFR A;  1DAR A;  2QMU A;  5HKK A;  3U6K A;  2ZIT A;  2OBR A;  4Z4W A;  2B7B A;  2DCU A;  1YX2 A;  4FWT A;  1BPL A;  5FL7 A;  4P1V A;  1KZL A;  2B7C A;  2FX3 A;  1I18 A;  5DS0 A;  3AVV A;  1E3X A;  1CNE A;  1UD6 A;  3A3B A;  3CD6 B;  3PVD A;  1WSR A;  3A8I A;  1ZUN B;  3I56 B;  1N0V C;  2R6H A;  3CCV B;  1SKQ A;  2CC2 A;  1W35 A;  4ZCL A;  2GK7 A;  3PEN A;  1PJ5 A;  2C4U A;  4X7D A;  5IYN A;  2JJ1 A;  2ZBV A;  4Z4R A;  3U2Q A;  5A89 A;  5LMZ A;  3W2I A;  2DEU A;  4XL9 A;  2E1B A;  2W6J A;  1XFO A;  1TTT A;  3WND A;  1Q7Y D;  1G7R A;  1NB0 A;  4XMY A;  4B48 A;  2V31 A;  1RQR A;  1BX1 A;  2NPF A;  1WDT A;  3AVY A;  1W0K A;  1QUE A;  2DET A;  4RPB A;  3ASS A;  4WQM A;  5GV7 A;  4DNT B;  4B47 A;  1T6X A;  2JDI A;  2PIA A;  3D26 A;  3LQ6 A;  3CMM A;  1YJ9 B;  4P3I A;  3BC9 A;  1YIT B;  3W5H A;  1OGJ A;  4RD0 A;  5HZA A;  1YI2 B;  2PLF A;  4RCZ A;  1WSV A;  2GRE A;  1V5V A;  4G7X A;  3CP2 A;  4QFM A;  4Q7J B;  4LBZ A;  3GVJ A;  2XND A;  3BY1 A;  3GVK A;  3GVL A;  1DG1 G;  5F4J A;  1QUF A;  1QX4 A;  4P22 A;  1WU8 A;  2WJY A;  1R5B A;  4UZF A;  3FJO A;  1VQP B;  3ZZU A;  3SJZ A;  1J9Z A;  1WOR A;  4OPO A;  3VMF A;  1Q9S A;  3LVB A;  2F43 A;  1EWY A;  3ZBT A;  2F1L A;  3W2H A;  1IJF A;  1TUI A;  4G5G A;  1G7T A;  2P3M A;  1MRZ A;  4AF7 A;  1W87 A;  1YIJ B;  1H8H A;  3ES9 A;  5FO0 A;  3I1F A;  2XGJ A;  1T6Y A;  2HLD A;  4Z1M A;  4Z4Y A;  3A8K A;  2DOG A;  1AIP A;  4TSF A;  3T51 B;  1M90 D;  4B3G A;  2Q6O A;  4TKO B;  1E64 A;  2V7U A;  3CXC B;  1ZM4 A;  3OJX A;  3R6K A;  5EMN A;  4II3 A;  4PC2 A;  1YLO A;  3CCL B;  1XB2 A;  3FPP A;  3Q6Q A;  3OP1 A;  4GQN A;  3OJW A;  1E1R A;  2JIZ A;  5J3O A;  3W5V A;  1TLL A;  1XE1 A;  3BNW A;  4PC6 A;  4MYT A;  5JBQ A;  4RDJ A;  3W2F A;  1K28 D;  4TMX A;  3OE7 A;  3I55 B;  3VNV A;  4XLC A;  1N05 A;  4XNF A;  1OGI A;  1F60 A;  1QFY A;  4J0Q A;  2D3N A;  2V7V A;  1AMO A;  1IHM A;  1B2R A;  1VLO A;  5TV2 A;  1VQ4 B;  3PUN A;  3AGP A;  4RD2 A;  3JU4 A;  3OKX A;  4XLH A;  1FDR A;  4KKT A;  3OZW A;  2C2W A;  2XNJ A;  3ONY A;  4Y9U A;  3ASP A;  2OK8 A;  4RD4 A;  2WJV A;  1EFU A;  1OB0 A;  3W2G A;  2YWG A;  4RD3 A;  1SM4 A;  3CCU B;  4B3F X;  1BX0 A;  1GO2 A;  4ZCI A;  2QDX A;  1TVC A;  1VQ7 B;  1B23 P;  4WZK A;  5B6I A;  2Q6K A;  4LBV A;  2VYQ A;  4MYU A;  4DK0 A;  4ZGN B;  2DIE A;  2Q6I A;  2RC6 A;  3LNN A;  1VQ8 B;  4Z4V A;  3CC2 B;  3AGQ A;  3QE2 A;  4RDL A;  1Q86 D;  1VQ6 B;  1EP2 B;  1SKY B;  4X07 A;  4WZT A;  2F1M A;  2R9V A;  3WNC A;  4II2 A;  4XKV A;  4N3G A;  3ASR A;  3CES A;  3CPX A;  1N08 A;  1R5N A;  2ZTG A;  4QHY A;  4WZL A;  4B4D A;  4B43 A;  3G4S B;  3Q3A A;  3V76 A;  3OZU A;  4M1K A;  1FNM A;  4HE6 A;  4KKS A;  4PGO A;  2DER A;  4RD6 A;  4N3N A;  3PA1 A;  2GJR A;  5L46 A;  2BF4 A;  4NCN A;  2BMW A;  3U6B A;  2BVN A;  4P6V F;  2J7K A;  2OBT A;  1GR1 A;  3CCE B;  2XOK A;  3FPK A;  1NB9 A;  2ZXI A;  5FA6 A;  3P27 A;  1WTH D;  1FNC A;  4ZV4 A;  3AVX A;  2DY1 A;  1UD2 A;  2PE3 A;  3W5U A;  1N07 A;  1JNY A;  2M5S A;  4B44 A;  1IB0 A;  1COW A; 
#chains in the Genus database with same CATH homology
 3RY8 A;  3Q6R A;  4QV2 A;  4OPV A;  4OPO A;  3BQJ A;  2ZL6 A;  4RDK A;  4X0C A;  4OP7 A;  5J35 A;  3SJP A;  4X06 A;  4OOV A;  3SKB A;  4Z4Y A;  4P26 A;  3PA2 A;  4P12 A;  4WZE A;  3R6J A;  3SLD A;  4Z4Z A;  4QVA A;  3LQE A;  3R6K A;  4Z4T A;  4P2N A;  4OOS A;  5IYQ A;  3Q6Q A;  4ROX A;  4RPD A;  5F4O A;  3Q39 A;  4X7F A;  3SLN A;  5IYW A;  4RM0 A;  5J3O A;  2OBS A;  5IYR A;  5KW9 A;  4OPS A;  4RDJ A;  4QVJ A;  5BSX A;  2ZL7 A;  4QUZ A;  2OBR A;  4Z4W A;  1IHM A;  4P25 A;  3PUM A;  3PUN A;  4P1V A;  5BSY A;  3PVD A;  3BY2 A;  3ONY A;  3ASP A;  4X05 A;  5HZB A;  4Z4U A;  3AST A;  4X7E A;  4X7D A;  5IYN A;  4Z4R A;  4WZK A;  3SEJ A;  2ZL5 A;  4Z4V A;  3Q38 A;  5IYP A;  4OOX A;  4RDL A;  4RPB A;  3ASS A;  4X07 A;  4WZT A;  3ASR A;  3D26 A;  3LQ6 A;  4Z4S A;  5E6T A;  4P3I A;  4WZL A;  3Q3A A;  3PA1 A;  5HZA A;  2OBT A;  4X7C A;  3ASQ A;  3BY1 A;  5F4J A;  4RLZ A;  3ONU A;  3V7A A;  5F4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...