5IYXC

Crystal structure of the arabidopsis receptor kinase haesa in complex with the peptide hormone ida and the co-receptor serk1
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
186
structure length
186
Chain Sequence
ANLEGDALHTLRVTLVDPNNVLQSWDPTLVNPCTWFHVTCNNENSVIRVDLGNAELSGHLVPELGVLKNLQYLELYSNNITGPIPSNLGDLTNLVSLDLYLNSFSGPIPESLGKLSKLRFLRLNNNSLTGSIPMSLTQITTLQVLDLSNNRLSGSVPDNGSFSLFTPISFANNLDLCGPVTSHPCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Receptor-like protein kinase 5
publication title Mechanistic insight into a peptide hormone signaling complex mediating floral organ abscission.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
total genus 60
structure length 186
sequence length 186
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08263 LRRNT_2 Leucine rich repeat N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5iyxC00
4FHOA 2V70A 3REZA 3OJAB 1DS9A 3E2JA 4R07A 1FO1A 3BZ5A 2V9SA 4M7EA 4BSSA 3SB4A 3WPEA 4CC4A 4CNCA 4P8SA 4UFRA 2Q4GW 1OTOA 2UZYA 5IJCA 4MQWX 1KOOA 2O6QA 1IO0A 4R58A 3E3ZA 5IJBA 4Z61C 4AY9X 4CNMA 4U08A 4R09A 4G8AA 2R9UA 4MN8B 1ZIWA 4J4LA 1KOHA 2Y5QA 4FCGA 3RIZA 3GOZA 3C6NB 4QXEA 3ULUA 3C6PB 1QYYA 5CMPA 2OMVA 4U7LA 2IFGA 2Z81A 3OGKB 3RGZA 2BEXA 5HDHA 2UZXA 3ZYNA 1A4YA 2ASSB 5AZ5A 5GS0A 2CA6A 1XWDC 1PGVA 3FXIA 4IM6A 4M7EC 4P91A 1DFJI 3ZYJA 5A5CA 3CIYA 3C6OB 4XSQA 1P9AG 2WQXA 4BV4R 4ARRA 1XECA 4Z94G 4Q3IA 4NKHA 1OTMA 1FQVA 4WP6A 4OQTA 4BSRA 1XKUA 2Z63A 2OMWA 3RW7A 4H09A 4LSXA 4KXFB 3G39A 3M19A 4FS7A 2P1OB 4FMZA 2O6RA 2V9TB 1XEUA 4PEQB 3RW6A 3G3BA 3UL7A 3RGXA 3E4GA 4NKGA 4V2EA 4Z64C 5AWDA 4U09A 4LSCA 3OJAA 2P1NB 1H6TA 1FS2A 2ID5A 3OGLB 1P8TA 4CILA 3WPBA 1M9LA 4R5DA 4FD0A 1M9SA 1OZNA 1LTXA 4PQ8A 2ELLA 1SQ0B 1D0BA 2Z62A 4LI2A 3M18A 4Q62A 4KT1A 5GMHA 3G04C 4R6AA 4C2BB 2WQVA 4WYKA 3CVRA 4LSXC 3DZEA 5B0TA 2RA8A 4V2DA 3W3GA 3JB9j 4RCAB 4J0MA 4AW4A 3G06A 3WPCA 4Z8GA 1GWBA 3UN9A 2OMXA 4L3AA 2OMTA 1JL5A 1OGQA 5FTTB 1FT8A 2FT3A 4R6FA 5GMGA 3WPFA 4RWTC 4CP6A 3WN4A 3O6NA 5CMNA 4R0AA 4R5CA 4KNGA 1G9UA 2WQWA 3UL9A 2Z82A 3G3AA 5LFNA 1K5DC 5D3IA 4C2AB 1W8AA 4V2CA 3W3NA 5IJDA 3RFJA 4FDWA 3TSRE 2Z66A 2Z64A 1O6VA 1WWLA 4K17A 3RJ0A 5GQRK 2OMZA 4Q3GA 3W3KA 4XOSA 2BNHA 3WPIA 4ARNA 2OMYA 1K5GC 4R6GA 3RFEA 4R08A 1A9NA 2O6SA 4Z79A 3P72A 4ECOA 4HQ1A 3PMHG 1DCEA 4LI1A 4XGOA 4L3FA 3W3JA 3WPHA 5AWCA 4LSAA 5B4PA 3ZYOA 4PKIG 3ULAA 4ECNA 1P8VA 2WFHA 5AWAA 4RCWA 2XWTC 3ULVA 5GS2B 3A79B 1OTNA 3VQ2A 1XCDA 2P1QB 2Z7XB 3O53A 4QC0A 4EZGA 4PSJA 3KJ4A 2JE1A 3UL8A 2JQDA 2Z65A 3E6JA 4R6JA 3ZYIA 1OOKG 3RFSA 5B0NA 3VQ1A 4QBZA 2P1PB 4PERA 4U06A 5HZLB 1U0ND 2Z7XA 4TZHA 2OMUA 4GT6A 3WPDA 4LXRA 5IYXC 2A0ZA 2JE0A 2RR6A 2ASTB 2WQUA 4B8CD 4BSUA 4CC4C 4YEBB 3W3MA 2P1MB 3WPGA 2XOTA 3CIGA 3OGMB 3W3LA 4I6JB 4Y61B 5GMFA 5AWBA 1O6TA 1M0ZA 1Z7XW 1M10B 1YRGA 1O6SA 4GLPA 1H6UA 4LXSA
chains in the Genus database with same CATH superfamily
4FHOA 2V70A 3REZA 3OJAB 1DS9A 3E2JA 4R07A 1FO1A 3BZ5A 2V9SA 4M7EA 4BSSA 3SB4A 3WPEA 4CC4A 4CNCA 4P8SA 4UFRA 2Q4GW 1OTOA 2UZYA 5IJCA 4MQWX 1KOOA 2O6QA 1IO0A 4R58A 3E3ZA 5IJBA 4Z61C 4AY9X 4CNMA 4U08A 4R09A 4G8AA 2R9UA 4MN8B 1ZIWA 4J4LA 1KOHA 2Y5QA 4FCGA 4NZTM 3RIZA 3GOZA 3C6NB 4QXEA 3ULUA 3C6PB 1QYYA 5CMPA 2OMVA 4U7LA 2IFGA 2Z81A 3OGKB 3RGZA 2BEXA 5HDHA 2UZXA 3ZYNA 1A4YA 2ASSB 5AZ5A 5GS0A 2CA6A 1XWDC 1PGVA 3FXIA 4IM6A 4M7EC 4P91A 1DFJI 3ZYJA 5A5CA 3CIYA 3C6OB 4XSQA 1P9AG 2WQXA 4BV4R 4ARRA 1XECA 4Z94G 4Q3IA 4NKHA 1OTMA 1FQVA 4WP6A 4OQTA 4BSRA 1XKUA 2Z63A 2OMWA 3RW7A 4H09A 4LSXA 4KXFB 3G39A 3M19A 4FS7A 2P1OB 4FMZA 2O6RA 2V9TB 1XEUA 4PEQB 3RW6A 3G3BA 3UL7A 3RGXA 3E4GA 4NKGA 4V2EA 4Z64C 5AWDA 4U09A 4LSCA 3OJAA 2P1NB 1H6TA 1FS2A 2ID5A 3OGLB 1P8TA 4CILA 3WPBA 1M9LA 4R5DA 4FD0A 1M9SA 1OZNA 4NZRM 1LTXA 4PQ8A 2ELLA 1SQ0B 1D0BA 2Z62A 4LI2A 3M18A 4Q62A 4KT1A 5GMHA 3G04C 4R6AA 4C2BB 2WQVA 4WYKA 3CVRA 4LSXC 3DZEA 5B0TA 2RA8A 4V2DA 3W3GA 3JB9j 4RCAB 4J0MA 4AW4A 3G06A 3WPCA 4Z8GA 1GWBA 3UN9A 2OMXA 4L3AA 2OMTA 1JL5A 1OGQA 5FTTB 1FT8A 2FT3A 4R6FA 5GMGA 3WPFA 4RWTC 4CP6A 3WN4A 3O6NA 5CMNA 4R0AA 4R5CA 4KNGA 1G9UA 2WQWA 3UL9A 2Z82A 3G3AA 5LFNA 1K5DC 5D3IA 4C2AB 1W8AA 4V2CA 3W3NA 5IJDA 3RFJA 4FDWA 3TSRE 2Z66A 2Z64A 1O6VA 1WWLA 4K17A 3RJ0A 5GQRK 2OMZA 4Q3GA 3W3KA 4XOSA 2BNHA 3WPIA 4ARNA 2OMYA 1K5GC 4R6GA 3RFEA 4R08A 1A9NA 2O6SA 4Z79A 3P72A 4ECOA 4HQ1A 3PMHG 1DCEA 4LI1A 4XGOA 4L3FA 3W3JA 3WPHA 5AWCA 4LSAA 5B4PA 3ZYOA 4PKIG 3ULAA 4ECNA 1P8VA 2WFHA 5AWAA 4RCWA 2XWTC 3ULVA 5GS2B 3A79B 1OTNA 3VQ2A 1XCDA 2P1QB 2Z7XB 3O53A 4QC0A 4EZGA 4PSJA 3KJ4A 2JE1A 3UL8A 2JQDA 2Z65A 3E6JA 4R6JA 3ZYIA 1OOKG 3RFSA 5B0NA 3VQ1A 4QBZA 2P1PB 4PERA 4U06A 5HZLB 1U0ND 2Z7XA 4TZHA 2OMUA 4GT6A 3WPDA 4LXRA 5IYXC 2A0ZA 2JE0A 2RR6A 2ASTB 2WQUA 4B8CD 4BSUA 4CC4C 4YEBB 3W3MA 2P1MB 3WPGA 2XOTA 3CIGA 3OGMB 3W3LA 4I6JB 4Y61B 5GMFA 5AWBA 1O6TA 1M0ZA 1Z7XW 1M10B 1YRGA 1O6SA 4GLPA 1H6UA 4LXSA
chains in the Genus database with same CATH topology
4FHOA 2V70A 3REZA 3OJAB 1DS9A 3E2JA 4R07A 1FO1A 3BZ5A 2V9SA 4M7EA 4BSSA 3SB4A 3WPEA 4CC4A 4CNCA 4P8SA 4UFRA 2Q4GW 1OTOA 2UZYA 5IJCA 4MQWX 1KOOA 2O6QA 1IO0A 4R58A 3E3ZA 5IJBA 4Z61C 4AY9X 4CNMA 4U08A 4R09A 4G8AA 2R9UA 4MN8B 1ZIWA 4J4LA 1KOHA 2Y5QA 4FCGA 3RIZA 3GOZA 3C6NB 4QXEA 3ULUA 3C6PB 1QYYA 5CMPA 2OMVA 4U7LA 2IFGA 2Z81A 3OGKB 3RGZA 2BEXA 5HDHA 2UZXA 3ZYNA 1A4YA 2ASSB 5AZ5A 5GS0A 2CA6A 1XWDC 1PGVA 3FXIA 4IM6A 4M7EC 4P91A 1DFJI 3ZYJA 5A5CA 3CIYA 3C6OB 4XSQA 1P9AG 2WQXA 4BV4R 4ARRA 1XECA 4Z94G 4Q3IA 4NKHA 1OTMA 1FQVA 4WP6A 4OQTA 4BSRA 1XKUA 2Z63A 2OMWA 3RW7A 4H09A 4LSXA 4KXFB 3G39A 3M19A 4FS7A 2P1OB 4FMZA 2O6RA 2V9TB 1XEUA 4PEQB 3RW6A 3G3BA 3UL7A 3RGXA 3E4GA 4NKGA 4V2EA 4Z64C 5AWDA 4U09A 4LSCA 3OJAA 2P1NB 1H6TA 1FS2A 2ID5A 3OGLB 1P8TA 4CILA 3WPBA 1M9LA 4R5DA 4FD0A 1M9SA 1OZNA 1LTXA 4PQ8A 2ELLA 1SQ0B 1D0BA 2Z62A 4LI2A 3M18A 4Q62A 4KT1A 5GMHA 3G04C 4R6AA 4C2BB 2WQVA 4WYKA 3CVRA 4LSXC 3DZEA 5B0TA 2RA8A 4V2DA 3W3GA 3JB9j 4RCAB 4J0MA 4AW4A 3G06A 3WPCA 4Z8GA 1GWBA 3UN9A 2OMXA 4L3AA 2OMTA 1JL5A 1OGQA 5FTTB 1FT8A 2FT3A 4R6FA 5GMGA 3WPFA 4RWTC 4CP6A 3WN4A 3O6NA 5CMNA 4R0AA 4R5CA 4KNGA 1G9UA 2WQWA 3UL9A 2Z82A 3G3AA 5LFNA 1K5DC 5D3IA 4C2AB 1W8AA 4V2CA 3W3NA 5IJDA 3RFJA 4FDWA 3TSRE 2Z66A 2Z64A 1O6VA 1WWLA 4K17A 3RJ0A 5GQRK 2OMZA 4Q3GA 3W3KA 4XOSA 2BNHA 3WPIA 4ARNA 2OMYA 1K5GC 4R6GA 3RFEA 4R08A 1A9NA 2O6SA 4Z79A 3P72A 4ECOA 4HQ1A 3PMHG 1DCEA 4LI1A 4XGOA 4L3FA 3W3JA 3WPHA 5AWCA 4LSAA 5B4PA 3ZYOA 4PKIG 3ULAA 4ECNA 1P8VA 2WFHA 5AWAA 4RCWA 2XWTC 3ULVA 5GS2B 3A79B 1OTNA 3VQ2A 1XCDA 2P1QB 2Z7XB 3O53A 4QC0A 4EZGA 4PSJA 3KJ4A 2JE1A 3UL8A 2JQDA 2Z65A 3E6JA 4R6JA 3ZYIA 1OOKG 3RFSA 5B0NA 3VQ1A 4QBZA 2P1PB 4PERA 4U06A 5HZLB 1U0ND 2Z7XA 4TZHA 2OMUA 4GT6A 3WPDA 4LXRA 5IYXC 2A0ZA 2JE0A 2RR6A 2ASTB 2WQUA 4B8CD 4BSUA 4CC4C 4YEBB 3W3MA 2P1MB 3WPGA 2XOTA 3CIGA 3OGMB 3W3LA 4I6JB 4Y61B 5GMFA 5AWBA 1O6TA 1M0ZA 1Z7XW 1M10B 1YRGA 1O6SA 4GLPA 1H6UA 4LXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FHO A;  2V70 A;  3REZ A;  3OJA B;  1DS9 A;  3E2J A;  4R07 A;  1FO1 A;  3BZ5 A;  2V9S A;  4M7E A;  4BSS A;  3SB4 A;  3WPE A;  4CC4 A;  4CNC A;  4P8S A;  4UFR A;  2Q4G W;  1OTO A;  2UZY A;  5IJC A;  4MQW X;  1KOO A;  2O6Q A;  1IO0 A;  4R58 A;  3E3Z A;  5IJB A;  4Z61 C;  4AY9 X;  4CNM A;  4U08 A;  4R09 A;  4G8A A;  2R9U A;  4MN8 B;  1ZIW A;  4J4L A;  1KOH A;  2Y5Q A;  4FCG A;  3RIZ A;  3GOZ A;  3C6N B;  4QXE A;  3ULU A;  3C6P B;  1QYY A;  5CMP A;  2OMV A;  4U7L A;  2IFG A;  2Z81 A;  3OGK B;  3RGZ A;  2BEX A;  5HDH A;  2UZX A;  3ZYN A;  1A4Y A;  2ASS B;  5AZ5 A;  5GS0 A;  2CA6 A;  1XWD C;  1PGV A;  3FXI A;  4IM6 A;  4M7E C;  4P91 A;  1DFJ I;  3ZYJ A;  5A5C A;  3CIY A;  3C6O B;  4XSQ A;  1P9A G;  2WQX A;  4BV4 R;  4ARR A;  1XEC A;  4Z94 G;  4Q3I A;  4NKH A;  1OTM A;  1FQV A;  4WP6 A;  4OQT A;  4BSR A;  1XKU A;  2Z63 A;  2OMW A;  3RW7 A;  4H09 A;  4LSX A;  4KXF B;  3G39 A;  3M19 A;  4FS7 A;  2P1O B;  4FMZ A;  2O6R A;  2V9T B;  1XEU A;  4PEQ B;  3RW6 A;  3G3B A;  3UL7 A;  3RGX A;  3E4G A;  4NKG A;  4V2E A;  4Z64 C;  5AWD A;  4U09 A;  4LSC A;  3OJA A;  2P1N B;  1H6T A;  1FS2 A;  2ID5 A;  3OGL B;  1P8T A;  4CIL A;  3WPB A;  1M9L A;  4R5D A;  4FD0 A;  1M9S A;  1OZN A;  1LTX A;  4PQ8 A;  2ELL A;  1SQ0 B;  1D0B A;  2Z62 A;  4LI2 A;  3M18 A;  4Q62 A;  4KT1 A;  5GMH A;  3G04 C;  4R6A A;  4C2B B;  2WQV A;  4WYK A;  3CVR A;  4LSX C;  3DZE A;  5B0T A;  2RA8 A;  4V2D A;  3W3G A;  3JB9 j;  4RCA B;  4J0M A;  4AW4 A;  3G06 A;  3WPC A;  4Z8G A;  1GWB A;  3UN9 A;  2OMX A;  4L3A A;  2OMT A;  1JL5 A;  1OGQ A;  5FTT B;  1FT8 A;  2FT3 A;  4R6F A;  5GMG A;  3WPF A;  4RWT C;  4CP6 A;  3WN4 A;  3O6N A;  5CMN A;  4R0A A;  4R5C A;  4KNG A;  1G9U A;  2WQW A;  3UL9 A;  2Z82 A;  3G3A A;  5LFN A;  1K5D C;  5D3I A;  4C2A B;  1W8A A;  4V2C A;  3W3N A;  5IJD A;  3RFJ A;  4FDW A;  3TSR E;  2Z66 A;  2Z64 A;  1O6V A;  1WWL A;  4K17 A;  3RJ0 A;  5GQR K;  2OMZ A;  4Q3G A;  3W3K A;  4XOS A;  2BNH A;  3WPI A;  4ARN A;  2OMY A;  1K5G C;  4R6G A;  3RFE A;  4R08 A;  1A9N A;  2O6S A;  4Z79 A;  3P72 A;  4ECO A;  4HQ1 A;  3PMH G;  1DCE A;  4LI1 A;  4XGO A;  4L3F A;  3W3J A;  3WPH A;  5AWC A;  4LSA A;  5B4P A;  3ZYO A;  4PKI G;  3ULA A;  4ECN A;  1P8V A;  2WFH A;  5AWA A;  4RCW A;  2XWT C;  3ULV A;  5GS2 B;  3A79 B;  1OTN A;  3VQ2 A;  1XCD A;  2P1Q B;  2Z7X B;  3O53 A;  4QC0 A;  4EZG A;  4PSJ A;  3KJ4 A;  2JE1 A;  3UL8 A;  2JQD A;  2Z65 A;  3E6J A;  4R6J A;  3ZYI A;  1OOK G;  3RFS A;  5B0N A;  3VQ1 A;  4QBZ A;  2P1P B;  4PER A;  4U06 A;  5HZL B;  1U0N D;  2Z7X A;  4TZH A;  2OMU A;  4GT6 A;  3WPD A;  4LXR A;  5IYX C;  2A0Z A;  2JE0 A;  2RR6 A;  2AST B;  2WQU A;  4B8C D;  4BSU A;  4CC4 C;  4YEB B;  3W3M A;  2P1M B;  3WPG A;  2XOT A;  3CIG A;  3OGM B;  3W3L A;  4I6J B;  4Y61 B;  5GMF A;  5AWB A;  1O6T A;  1M0Z A;  1Z7X W;  1M10 B;  1YRG A;  1O6S A;  4GLP A;  1H6U A;  4LXS A; 
#chains in the Genus database with same CATH topology
 4FHO A;  2V70 A;  3REZ A;  3OJA B;  1DS9 A;  3E2J A;  4R07 A;  1FO1 A;  3BZ5 A;  2V9S A;  4M7E A;  4BSS A;  3SB4 A;  3WPE A;  4CC4 A;  4CNC A;  4P8S A;  4UFR A;  2Q4G W;  1OTO A;  2UZY A;  5IJC A;  4MQW X;  1KOO A;  2O6Q A;  1IO0 A;  4R58 A;  3E3Z A;  5IJB A;  4Z61 C;  4AY9 X;  4CNM A;  4U08 A;  4R09 A;  4G8A A;  2R9U A;  4MN8 B;  1ZIW A;  4J4L A;  1KOH A;  2Y5Q A;  4FCG A;  4NZT M;  3RIZ A;  3GOZ A;  3C6N B;  4QXE A;  3ULU A;  3C6P B;  1QYY A;  5CMP A;  2OMV A;  4U7L A;  2IFG A;  2Z81 A;  3OGK B;  3RGZ A;  2BEX A;  5HDH A;  2UZX A;  3ZYN A;  1A4Y A;  2ASS B;  5AZ5 A;  5GS0 A;  2CA6 A;  1XWD C;  1PGV A;  3FXI A;  4IM6 A;  4M7E C;  4P91 A;  1DFJ I;  3ZYJ A;  5A5C A;  3CIY A;  3C6O B;  4XSQ A;  1P9A G;  2WQX A;  4BV4 R;  4ARR A;  1XEC A;  4Z94 G;  4Q3I A;  4NKH A;  1OTM A;  1FQV A;  4WP6 A;  4OQT A;  4BSR A;  1XKU A;  2Z63 A;  2OMW A;  3RW7 A;  4H09 A;  4LSX A;  4KXF B;  3G39 A;  3M19 A;  4FS7 A;  2P1O B;  4FMZ A;  2O6R A;  2V9T B;  1XEU A;  4PEQ B;  3RW6 A;  3G3B A;  3UL7 A;  3RGX A;  3E4G A;  4NKG A;  4V2E A;  4Z64 C;  5AWD A;  4U09 A;  4LSC A;  3OJA A;  2P1N B;  1H6T A;  1FS2 A;  2ID5 A;  3OGL B;  1P8T A;  4CIL A;  3WPB A;  1M9L A;  4R5D A;  4FD0 A;  1M9S A;  1OZN A;  4NZR M;  1LTX A;  4PQ8 A;  2ELL A;  1SQ0 B;  1D0B A;  2Z62 A;  4LI2 A;  3M18 A;  4Q62 A;  4KT1 A;  5GMH A;  3G04 C;  4R6A A;  4C2B B;  2WQV A;  4WYK A;  3CVR A;  4LSX C;  3DZE A;  5B0T A;  2RA8 A;  4V2D A;  3W3G A;  3JB9 j;  4RCA B;  4J0M A;  4AW4 A;  3G06 A;  3WPC A;  4Z8G A;  1GWB A;  3UN9 A;  2OMX A;  4L3A A;  2OMT A;  1JL5 A;  1OGQ A;  5FTT B;  1FT8 A;  2FT3 A;  4R6F A;  5GMG A;  3WPF A;  4RWT C;  4CP6 A;  3WN4 A;  3O6N A;  5CMN A;  4R0A A;  4R5C A;  4KNG A;  1G9U A;  2WQW A;  3UL9 A;  2Z82 A;  3G3A A;  5LFN A;  1K5D C;  5D3I A;  4C2A B;  1W8A A;  4V2C A;  3W3N A;  5IJD A;  3RFJ A;  4FDW A;  3TSR E;  2Z66 A;  2Z64 A;  1O6V A;  1WWL A;  4K17 A;  3RJ0 A;  5GQR K;  2OMZ A;  4Q3G A;  3W3K A;  4XOS A;  2BNH A;  3WPI A;  4ARN A;  2OMY A;  1K5G C;  4R6G A;  3RFE A;  4R08 A;  1A9N A;  2O6S A;  4Z79 A;  3P72 A;  4ECO A;  4HQ1 A;  3PMH G;  1DCE A;  4LI1 A;  4XGO A;  4L3F A;  3W3J A;  3WPH A;  5AWC A;  4LSA A;  5B4P A;  3ZYO A;  4PKI G;  3ULA A;  4ECN A;  1P8V A;  2WFH A;  5AWA A;  4RCW A;  2XWT C;  3ULV A;  5GS2 B;  3A79 B;  1OTN A;  3VQ2 A;  1XCD A;  2P1Q B;  2Z7X B;  3O53 A;  4QC0 A;  4EZG A;  4PSJ A;  3KJ4 A;  2JE1 A;  3UL8 A;  2JQD A;  2Z65 A;  3E6J A;  4R6J A;  3ZYI A;  1OOK G;  3RFS A;  5B0N A;  3VQ1 A;  4QBZ A;  2P1P B;  4PER A;  4U06 A;  5HZL B;  1U0N D;  2Z7X A;  4TZH A;  2OMU A;  4GT6 A;  3WPD A;  4LXR A;  5IYX C;  2A0Z A;  2JE0 A;  2RR6 A;  2AST B;  2WQU A;  4B8C D;  4BSU A;  4CC4 C;  4YEB B;  3W3M A;  2P1M B;  3WPG A;  2XOT A;  3CIG A;  3OGM B;  3W3L A;  4I6J B;  4Y61 B;  5GMF A;  5AWB A;  1O6T A;  1M0Z A;  1Z7X W;  1M10 B;  1YRG A;  1O6S A;  4GLP A;  1H6U A;  4LXS A; 
#chains in the Genus database with same CATH homology
 4FHO A;  2V70 A;  3REZ A;  3OJA B;  1DS9 A;  3E2J A;  4R07 A;  1FO1 A;  3BZ5 A;  2V9S A;  4M7E A;  4BSS A;  3SB4 A;  3WPE A;  4CC4 A;  4CNC A;  4P8S A;  4UFR A;  2Q4G W;  1OTO A;  2UZY A;  5IJC A;  4MQW X;  1KOO A;  2O6Q A;  1IO0 A;  4R58 A;  3E3Z A;  5IJB A;  4Z61 C;  4AY9 X;  4CNM A;  4U08 A;  4R09 A;  4G8A A;  2R9U A;  4MN8 B;  1ZIW A;  4J4L A;  1KOH A;  2Y5Q A;  4FCG A;  3RIZ A;  3GOZ A;  3C6N B;  4QXE A;  3ULU A;  3C6P B;  1QYY A;  5CMP A;  2OMV A;  4U7L A;  2IFG A;  2Z81 A;  3OGK B;  3RGZ A;  2BEX A;  5HDH A;  2UZX A;  3ZYN A;  1A4Y A;  2ASS B;  5AZ5 A;  5GS0 A;  2CA6 A;  1XWD C;  1PGV A;  3FXI A;  4IM6 A;  4M7E C;  4P91 A;  1DFJ I;  3ZYJ A;  5A5C A;  3CIY A;  3C6O B;  4XSQ A;  1P9A G;  2WQX A;  4BV4 R;  4ARR A;  1XEC A;  4Z94 G;  4Q3I A;  4NKH A;  1OTM A;  1FQV A;  4WP6 A;  4OQT A;  4BSR A;  1XKU A;  2Z63 A;  2OMW A;  3RW7 A;  4H09 A;  4LSX A;  4KXF B;  3G39 A;  3M19 A;  4FS7 A;  2P1O B;  4FMZ A;  2O6R A;  2V9T B;  1XEU A;  4PEQ B;  3RW6 A;  3G3B A;  3UL7 A;  3RGX A;  3E4G A;  4NKG A;  4V2E A;  4Z64 C;  5AWD A;  4U09 A;  4LSC A;  3OJA A;  2P1N B;  1H6T A;  1FS2 A;  2ID5 A;  3OGL B;  1P8T A;  4CIL A;  3WPB A;  1M9L A;  4R5D A;  4FD0 A;  1M9S A;  1OZN A;  1LTX A;  4PQ8 A;  2ELL A;  1SQ0 B;  1D0B A;  2Z62 A;  4LI2 A;  3M18 A;  4Q62 A;  4KT1 A;  5GMH A;  3G04 C;  4R6A A;  4C2B B;  2WQV A;  4WYK A;  3CVR A;  4LSX C;  3DZE A;  5B0T A;  2RA8 A;  4V2D A;  3W3G A;  3JB9 j;  4RCA B;  4J0M A;  4AW4 A;  3G06 A;  3WPC A;  4Z8G A;  1GWB A;  3UN9 A;  2OMX A;  4L3A A;  2OMT A;  1JL5 A;  1OGQ A;  5FTT B;  1FT8 A;  2FT3 A;  4R6F A;  5GMG A;  3WPF A;  4RWT C;  4CP6 A;  3WN4 A;  3O6N A;  5CMN A;  4R0A A;  4R5C A;  4KNG A;  1G9U A;  2WQW A;  3UL9 A;  2Z82 A;  3G3A A;  5LFN A;  1K5D C;  5D3I A;  4C2A B;  1W8A A;  4V2C A;  3W3N A;  5IJD A;  3RFJ A;  4FDW A;  3TSR E;  2Z66 A;  2Z64 A;  1O6V A;  1WWL A;  4K17 A;  3RJ0 A;  5GQR K;  2OMZ A;  4Q3G A;  3W3K A;  4XOS A;  2BNH A;  3WPI A;  4ARN A;  2OMY A;  1K5G C;  4R6G A;  3RFE A;  4R08 A;  1A9N A;  2O6S A;  4Z79 A;  3P72 A;  4ECO A;  4HQ1 A;  3PMH G;  1DCE A;  4LI1 A;  4XGO A;  4L3F A;  3W3J A;  3WPH A;  5AWC A;  4LSA A;  5B4P A;  3ZYO A;  4PKI G;  3ULA A;  4ECN A;  1P8V A;  2WFH A;  5AWA A;  4RCW A;  2XWT C;  3ULV A;  5GS2 B;  3A79 B;  1OTN A;  3VQ2 A;  1XCD A;  2P1Q B;  2Z7X B;  3O53 A;  4QC0 A;  4EZG A;  4PSJ A;  3KJ4 A;  2JE1 A;  3UL8 A;  2JQD A;  2Z65 A;  3E6J A;  4R6J A;  3ZYI A;  1OOK G;  3RFS A;  5B0N A;  3VQ1 A;  4QBZ A;  2P1P B;  4PER A;  4U06 A;  5HZL B;  1U0N D;  2Z7X A;  4TZH A;  2OMU A;  4GT6 A;  3WPD A;  4LXR A;  5IYX C;  2A0Z A;  2JE0 A;  2RR6 A;  2AST B;  2WQU A;  4B8C D;  4BSU A;  4CC4 C;  4YEB B;  3W3M A;  2P1M B;  3WPG A;  2XOT A;  3CIG A;  3OGM B;  3W3L A;  4I6J B;  4Y61 B;  5GMF A;  5AWB A;  1O6T A;  1M0Z A;  1Z7X W;  1M10 B;  1YRG A;  1O6S A;  4GLP A;  1H6U A;  4LXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...