5IYXC

Crystal structure of the arabidopsis receptor kinase haesa in complex with the peptide hormone ida and the co-receptor serk1
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
186
structure length
186
Chain Sequence
ANLEGDALHTLRVTLVDPNNVLQSWDPTLVNPCTWFHVTCNNENSVIRVDLGNAELSGHLVPELGVLKNLQYLELYSNNITGPIPSNLGDLTNLVSLDLYLNSFSGPIPESLGKLSKLRFLRLNNNSLTGSIPMSLTQITTLQVLDLSNNRLSGSVPDNGSFSLFTPISFANNLDLCGPVTSHPCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Receptor-like protein kinase 5
publication title Mechanistic insight into a peptide hormone signaling complex mediating floral organ abscission.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
total genus 60
structure length 186
sequence length 186
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08263 LRRNT_2 Leucine rich repeat N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5iyxC00
3VQ1A 1XECA 2OMXA 4CNCA 1M0ZA 3G39A 4Y61B 1XWDC 3WPIA 1FQVA 5IJCA 2Z81A 3OGLB 3RIZA 1U0ND 4U08A 5B0TA 4FCGA 4C2BB 4V2CA 3WPGA 2Z63A 3ZYNA 5HZLB 4C2AB 4XOSA 4P8SA 1P9AG 4LXSA 2Z7XB 1IO0A 4U7LA 4PEQB 4V2DA 4R6JA 5B0NA 4RCAB 3C6OB 4R6FA 2IFGA 3ZYIA 3W3KA 4CILA 2R9UA 3OGMB 2OMVA 1DS9A 4J4LA 4P91A 3FXIA 3C6PB 1XCDA 4J0MA 4LI1A 2ASSB 3RJ0A 2CA6A 2Z82A 4MQWX 3DZEA 4L3FA 2OMYA 5AWBA 3ULVA 4FDWA 3REZA 5HDHA 2Z66A 1LTXA 4M7EC 3W3NA 4GT6A 4MN8B 4R5DA 4IM6A 4CNMA 3WPCA 4CC4A 5AWCA 3A79B 4KT1A 3TSRE 2UZYA 3ZYJA 3G06A 3RFJA 2Z65A 2O6RA 4ECOA 4R5CA 1WWLA 1DCEA 4FD0A 1M10B 2WQWA 4B8CD 4OQTA 4R6GA 2A0ZA 2XOTA 3GOZA 4Q3IA 4AY9X 4ARNA 2P1NB 2Z64A 1H6TA 5IJDA 3G3AA 4ECNA 4U06A 4XSQA 4R6AA 4NKGA 4PKIG 1O6SA 1FT8A 1P8TA 1YRGA 2RA8A 5GS0A 1KOHA 4M7EA 3E4GA 5IYXC 2RR6A 4LXRA 3W3LA 3WN4A 2ASTB 1XEUA 2OMZA 4CC4C 3M19A 1H6UA 3P72A 5AWDA 4HQ1A 3ULUA 4Q62A 1OTMA 3UN9A 4KXFB 4BV4R 4LSAA 5CMNA 5LFNA 4RCWA 4AW4A 4U09A 4FMZA 5GMHA 4FHOA 1QYYA 3WPDA 3WPFA 4Z8GA 2P1PB 5FTTB 1FO1A 4TZHA 4LSCA 3G3BA 1OGQA 4FS7A 1K5GC 1W8AA 1SQ0B 5A5CA 2Y5QA 2XWTC 4XGOA 3UL8A 4QC0A 2WQVA 1GWBA 3RW7A 4G8AA 5CMPA 3RFSA 2P1MB 4I6JB 3O53A 4PQ8A 1M9LA 3UL7A 1OOKG 5AZ5A 1OTNA 4ARRA 5GS2B 4WYKA 2JE1A 5GMGA 3OJAA 1PGVA 5D3IA 1K5DC 4R58A 2P1QB 4BSSA 5GQRK 2OMUA 3ZYOA 4R07A 1M9SA 4LI2A 2WQUA 1O6TA 4EZGA 4KNGA 1A9NA 3CIGA 2BNHA 3PMHG 3W3GA 5IJBA 2ELLA 3RGZA 1P8VA 3KJ4A 3WPHA 4K17A 1XKUA 4CP6A 4H09A 3E3ZA 2OMWA 3M18A 4R08A 1JL5A 2P1OB 3RW6A 2V9TB 5B4PA 2O6SA 3BZ5A 2Z7XA 2OMTA 4PSJA 4QBZA 3ULAA 3RFEA 3JB9j 4BSUA 2JQDA 3E6JA 3OGKB 4R09A 4PERA 4UFRA 3SB4A 4WP6A 2WFHA 4GLPA 5AWAA 1O6VA 4LSXA 2FT3A 1FS2A 3CVRA 4QXEA 1OTOA 2V9SA 2O6QA 1OZNA 5GMFA 3G04C 4L3AA 2JE0A 4Z94G 4Z64C 3UL9A 3C6NB 2V70A 1Z7XW 3VQ2A 4NKHA 3E2JA 4R0AA 3W3MA 4BSRA 3RGXA 1KOOA 3CIYA 3WPEA 2Q4GW 3WPBA 3W3JA 1G9UA 2ID5A 3OJAB 4Z61C 1D0BA 4Z79A 1ZIWA 4V2EA 1DFJI 4Q3GA 4YEBB 2WQXA 3O6NA 4RWTC 4LSXC 2UZXA 2Z62A 1A4YA 2BEXA
chains in the Genus database with same CATH superfamily
3VQ1A 1XECA 2OMXA 4CNCA 1M0ZA 3G39A 4Y61B 1XWDC 3WPIA 1FQVA 5IJCA 2Z81A 3OGLB 3RIZA 1U0ND 4U08A 5B0TA 4FCGA 4C2BB 4V2CA 3WPGA 2Z63A 3ZYNA 5HZLB 4C2AB 4XOSA 4P8SA 1P9AG 4LXSA 2Z7XB 1IO0A 4U7LA 4PEQB 4V2DA 4R6JA 5B0NA 4RCAB 3C6OB 4R6FA 2IFGA 3ZYIA 3W3KA 4CILA 2R9UA 3OGMB 2OMVA 1DS9A 4J4LA 4P91A 3FXIA 3C6PB 1XCDA 4J0MA 4LI1A 2ASSB 3RJ0A 2CA6A 2Z82A 4MQWX 3DZEA 4L3FA 2OMYA 5AWBA 3ULVA 4FDWA 3REZA 5HDHA 2Z66A 1LTXA 4M7EC 3W3NA 4GT6A 4MN8B 4R5DA 4IM6A 4CNMA 3WPCA 4CC4A 5AWCA 3A79B 4KT1A 3TSRE 2UZYA 3ZYJA 3G06A 3RFJA 2Z65A 2O6RA 4ECOA 4R5CA 1WWLA 1DCEA 4FD0A 1M10B 2WQWA 4B8CD 4OQTA 4R6GA 2A0ZA 2XOTA 3GOZA 4Q3IA 4AY9X 4ARNA 2P1NB 2Z64A 1H6TA 5IJDA 3G3AA 4ECNA 4U06A 4XSQA 4R6AA 4NKGA 4PKIG 1O6SA 1FT8A 1P8TA 1YRGA 2RA8A 5GS0A 1KOHA 4M7EA 3E4GA 5IYXC 2RR6A 4LXRA 3W3LA 3WN4A 2ASTB 1XEUA 2OMZA 4CC4C 3M19A 1H6UA 3P72A 4NZRM 5AWDA 4HQ1A 3ULUA 4Q62A 1OTMA 3UN9A 4KXFB 4BV4R 4LSAA 5CMNA 5LFNA 4RCWA 4AW4A 4U09A 4FMZA 5GMHA 4FHOA 1QYYA 3WPDA 3WPFA 4Z8GA 2P1PB 5FTTB 1FO1A 4TZHA 4LSCA 3G3BA 1OGQA 4FS7A 1K5GC 1W8AA 1SQ0B 5A5CA 4NZTM 2Y5QA 2XWTC 4XGOA 3UL8A 4QC0A 2WQVA 1GWBA 3RW7A 4G8AA 5CMPA 3RFSA 2P1MB 4I6JB 3O53A 4PQ8A 1M9LA 3UL7A 1OOKG 5AZ5A 1OTNA 4ARRA 5GS2B 4WYKA 2JE1A 5GMGA 3OJAA 1PGVA 5D3IA 1K5DC 4R58A 2P1QB 4BSSA 5GQRK 2OMUA 3ZYOA 4R07A 1M9SA 4LI2A 2WQUA 1O6TA 4EZGA 4KNGA 1A9NA 3CIGA 2BNHA 3PMHG 3W3GA 5IJBA 2ELLA 3RGZA 1P8VA 3KJ4A 3WPHA 4K17A 1XKUA 4CP6A 4H09A 3E3ZA 2OMWA 3M18A 4R08A 1JL5A 2P1OB 3RW6A 2V9TB 5B4PA 2O6SA 3BZ5A 2Z7XA 2OMTA 4PSJA 4QBZA 3ULAA 3RFEA 3JB9j 4BSUA 2JQDA 3E6JA 3OGKB 4R09A 4PERA 4UFRA 3SB4A 4WP6A 2WFHA 4GLPA 5AWAA 1O6VA 4LSXA 2FT3A 1FS2A 3CVRA 4QXEA 1OTOA 2V9SA 2O6QA 1OZNA 5GMFA 3G04C 4L3AA 2JE0A 4Z94G 4Z64C 3UL9A 3C6NB 2V70A 1Z7XW 3VQ2A 4NKHA 3E2JA 4R0AA 3W3MA 4BSRA 3RGXA 1KOOA 3CIYA 3WPEA 2Q4GW 3WPBA 3W3JA 1G9UA 2ID5A 3OJAB 4Z61C 1D0BA 4Z79A 1ZIWA 4V2EA 1DFJI 4Q3GA 4YEBB 2WQXA 3O6NA 4RWTC 4LSXC 2UZXA 2Z62A 1A4YA 2BEXA
chains in the Genus database with same CATH topology
3VQ1A 1XECA 2OMXA 4CNCA 1M0ZA 3G39A 4Y61B 1XWDC 3WPIA 1FQVA 5IJCA 2Z81A 3OGLB 3RIZA 1U0ND 4U08A 5B0TA 4FCGA 4C2BB 4V2CA 3WPGA 2Z63A 3ZYNA 5HZLB 4C2AB 4XOSA 4P8SA 1P9AG 4LXSA 2Z7XB 1IO0A 4U7LA 4PEQB 4V2DA 4R6JA 5B0NA 4RCAB 3C6OB 4R6FA 2IFGA 3ZYIA 3W3KA 4CILA 2R9UA 3OGMB 2OMVA 1DS9A 4J4LA 4P91A 3FXIA 3C6PB 1XCDA 4J0MA 4LI1A 2ASSB 3RJ0A 2CA6A 2Z82A 4MQWX 3DZEA 4L3FA 2OMYA 5AWBA 3ULVA 4FDWA 3REZA 5HDHA 2Z66A 1LTXA 4M7EC 3W3NA 4GT6A 4MN8B 4R5DA 4IM6A 4CNMA 3WPCA 4CC4A 5AWCA 3A79B 4KT1A 3TSRE 2UZYA 3ZYJA 3G06A 3RFJA 2Z65A 2O6RA 4ECOA 4R5CA 1WWLA 1DCEA 4FD0A 1M10B 2WQWA 4B8CD 4OQTA 4R6GA 2A0ZA 2XOTA 3GOZA 4Q3IA 4AY9X 4ARNA 2P1NB 2Z64A 1H6TA 5IJDA 3G3AA 4ECNA 4U06A 4XSQA 4R6AA 4NKGA 4PKIG 1O6SA 1FT8A 1P8TA 1YRGA 2RA8A 5GS0A 1KOHA 4M7EA 3E4GA 5IYXC 2RR6A 4LXRA 3W3LA 3WN4A 2ASTB 1XEUA 2OMZA 4CC4C 3M19A 1H6UA 3P72A 5AWDA 4HQ1A 3ULUA 4Q62A 1OTMA 3UN9A 4KXFB 4BV4R 4LSAA 5CMNA 5LFNA 4RCWA 4AW4A 4U09A 4FMZA 5GMHA 4FHOA 1QYYA 3WPDA 3WPFA 4Z8GA 2P1PB 5FTTB 1FO1A 4TZHA 4LSCA 3G3BA 1OGQA 4FS7A 1K5GC 1W8AA 1SQ0B 5A5CA 2Y5QA 2XWTC 4XGOA 3UL8A 4QC0A 2WQVA 1GWBA 3RW7A 4G8AA 5CMPA 3RFSA 2P1MB 4I6JB 3O53A 4PQ8A 1M9LA 3UL7A 1OOKG 5AZ5A 1OTNA 4ARRA 5GS2B 4WYKA 2JE1A 5GMGA 3OJAA 1PGVA 5D3IA 1K5DC 4R58A 2P1QB 4BSSA 5GQRK 2OMUA 3ZYOA 4R07A 1M9SA 4LI2A 2WQUA 1O6TA 4EZGA 4KNGA 1A9NA 3CIGA 2BNHA 3PMHG 3W3GA 5IJBA 2ELLA 3RGZA 1P8VA 3KJ4A 3WPHA 4K17A 1XKUA 4CP6A 4H09A 3E3ZA 2OMWA 3M18A 4R08A 1JL5A 2P1OB 3RW6A 2V9TB 5B4PA 2O6SA 3BZ5A 2Z7XA 2OMTA 4PSJA 4QBZA 3ULAA 3RFEA 3JB9j 4BSUA 2JQDA 3E6JA 3OGKB 4R09A 4PERA 4UFRA 3SB4A 4WP6A 2WFHA 4GLPA 5AWAA 1O6VA 4LSXA 2FT3A 1FS2A 3CVRA 4QXEA 1OTOA 2V9SA 2O6QA 1OZNA 5GMFA 3G04C 4L3AA 2JE0A 4Z94G 4Z64C 3UL9A 3C6NB 2V70A 1Z7XW 3VQ2A 4NKHA 3E2JA 4R0AA 3W3MA 4BSRA 3RGXA 1KOOA 3CIYA 3WPEA 2Q4GW 3WPBA 3W3JA 1G9UA 2ID5A 3OJAB 4Z61C 1D0BA 4Z79A 1ZIWA 4V2EA 1DFJI 4Q3GA 4YEBB 2WQXA 3O6NA 4RWTC 4LSXC 2UZXA 2Z62A 1A4YA 2BEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VQ1 A;  1XEC A;  2OMX A;  4CNC A;  1M0Z A;  3G39 A;  4Y61 B;  1XWD C;  3WPI A;  1FQV A;  5IJC A;  2Z81 A;  3OGL B;  3RIZ A;  1U0N D;  4U08 A;  5B0T A;  4FCG A;  4C2B B;  4V2C A;  3WPG A;  2Z63 A;  3ZYN A;  5HZL B;  4C2A B;  4XOS A;  4P8S A;  1P9A G;  4LXS A;  2Z7X B;  1IO0 A;  4U7L A;  4PEQ B;  4V2D A;  4R6J A;  5B0N A;  4RCA B;  3C6O B;  4R6F A;  2IFG A;  3ZYI A;  3W3K A;  4CIL A;  2R9U A;  3OGM B;  2OMV A;  1DS9 A;  4J4L A;  4P91 A;  3FXI A;  3C6P B;  1XCD A;  4J0M A;  4LI1 A;  2ASS B;  3RJ0 A;  2CA6 A;  2Z82 A;  4MQW X;  3DZE A;  4L3F A;  2OMY A;  5AWB A;  3ULV A;  4FDW A;  3REZ A;  5HDH A;  2Z66 A;  1LTX A;  4M7E C;  3W3N A;  4GT6 A;  4MN8 B;  4R5D A;  4IM6 A;  4CNM A;  3WPC A;  4CC4 A;  5AWC A;  3A79 B;  4KT1 A;  3TSR E;  2UZY A;  3ZYJ A;  3G06 A;  3RFJ A;  2Z65 A;  2O6R A;  4ECO A;  4R5C A;  1WWL A;  1DCE A;  4FD0 A;  1M10 B;  2WQW A;  4B8C D;  4OQT A;  4R6G A;  2A0Z A;  2XOT A;  3GOZ A;  4Q3I A;  4AY9 X;  4ARN A;  2P1N B;  2Z64 A;  1H6T A;  5IJD A;  3G3A A;  4ECN A;  4U06 A;  4XSQ A;  4R6A A;  4NKG A;  4PKI G;  1O6S A;  1FT8 A;  1P8T A;  1YRG A;  2RA8 A;  5GS0 A;  1KOH A;  4M7E A;  3E4G A;  5IYX C;  2RR6 A;  4LXR A;  3W3L A;  3WN4 A;  2AST B;  1XEU A;  2OMZ A;  4CC4 C;  3M19 A;  1H6U A;  3P72 A;  5AWD A;  4HQ1 A;  3ULU A;  4Q62 A;  1OTM A;  3UN9 A;  4KXF B;  4BV4 R;  4LSA A;  5CMN A;  5LFN A;  4RCW A;  4AW4 A;  4U09 A;  4FMZ A;  5GMH A;  4FHO A;  1QYY A;  3WPD A;  3WPF A;  4Z8G A;  2P1P B;  5FTT B;  1FO1 A;  4TZH A;  4LSC A;  3G3B A;  1OGQ A;  4FS7 A;  1K5G C;  1W8A A;  1SQ0 B;  5A5C A;  2Y5Q A;  2XWT C;  4XGO A;  3UL8 A;  4QC0 A;  2WQV A;  1GWB A;  3RW7 A;  4G8A A;  5CMP A;  3RFS A;  2P1M B;  4I6J B;  3O53 A;  4PQ8 A;  1M9L A;  3UL7 A;  1OOK G;  5AZ5 A;  1OTN A;  4ARR A;  5GS2 B;  4WYK A;  2JE1 A;  5GMG A;  3OJA A;  1PGV A;  5D3I A;  1K5D C;  4R58 A;  2P1Q B;  4BSS A;  5GQR K;  2OMU A;  3ZYO A;  4R07 A;  1M9S A;  4LI2 A;  2WQU A;  1O6T A;  4EZG A;  4KNG A;  1A9N A;  3CIG A;  2BNH A;  3PMH G;  3W3G A;  5IJB A;  2ELL A;  3RGZ A;  1P8V A;  3KJ4 A;  3WPH A;  4K17 A;  1XKU A;  4CP6 A;  4H09 A;  3E3Z A;  2OMW A;  3M18 A;  4R08 A;  1JL5 A;  2P1O B;  3RW6 A;  2V9T B;  5B4P A;  2O6S A;  3BZ5 A;  2Z7X A;  2OMT A;  4PSJ A;  4QBZ A;  3ULA A;  3RFE A;  3JB9 j;  4BSU A;  2JQD A;  3E6J A;  3OGK B;  4R09 A;  4PER A;  4UFR A;  3SB4 A;  4WP6 A;  2WFH A;  4GLP A;  5AWA A;  1O6V A;  4LSX A;  2FT3 A;  1FS2 A;  3CVR A;  4QXE A;  1OTO A;  2V9S A;  2O6Q A;  1OZN A;  5GMF A;  3G04 C;  4L3A A;  2JE0 A;  4Z94 G;  4Z64 C;  3UL9 A;  3C6N B;  2V70 A;  1Z7X W;  3VQ2 A;  4NKH A;  3E2J A;  4R0A A;  3W3M A;  4BSR A;  3RGX A;  1KOO A;  3CIY A;  3WPE A;  2Q4G W;  3WPB A;  3W3J A;  1G9U A;  2ID5 A;  3OJA B;  4Z61 C;  1D0B A;  4Z79 A;  1ZIW A;  4V2E A;  1DFJ I;  4Q3G A;  4YEB B;  2WQX A;  3O6N A;  4RWT C;  4LSX C;  2UZX A;  2Z62 A;  1A4Y A;  2BEX A; 
#chains in the Genus database with same CATH topology
 3VQ1 A;  1XEC A;  2OMX A;  4CNC A;  1M0Z A;  3G39 A;  4Y61 B;  1XWD C;  3WPI A;  1FQV A;  5IJC A;  2Z81 A;  3OGL B;  3RIZ A;  1U0N D;  4U08 A;  5B0T A;  4FCG A;  4C2B B;  4V2C A;  3WPG A;  2Z63 A;  3ZYN A;  5HZL B;  4C2A B;  4XOS A;  4P8S A;  1P9A G;  4LXS A;  2Z7X B;  1IO0 A;  4U7L A;  4PEQ B;  4V2D A;  4R6J A;  5B0N A;  4RCA B;  3C6O B;  4R6F A;  2IFG A;  3ZYI A;  3W3K A;  4CIL A;  2R9U A;  3OGM B;  2OMV A;  1DS9 A;  4J4L A;  4P91 A;  3FXI A;  3C6P B;  1XCD A;  4J0M A;  4LI1 A;  2ASS B;  3RJ0 A;  2CA6 A;  2Z82 A;  4MQW X;  3DZE A;  4L3F A;  2OMY A;  5AWB A;  3ULV A;  4FDW A;  3REZ A;  5HDH A;  2Z66 A;  1LTX A;  4M7E C;  3W3N A;  4GT6 A;  4MN8 B;  4R5D A;  4IM6 A;  4CNM A;  3WPC A;  4CC4 A;  5AWC A;  3A79 B;  4KT1 A;  3TSR E;  2UZY A;  3ZYJ A;  3G06 A;  3RFJ A;  2Z65 A;  2O6R A;  4ECO A;  4R5C A;  1WWL A;  1DCE A;  4FD0 A;  1M10 B;  2WQW A;  4B8C D;  4OQT A;  4R6G A;  2A0Z A;  2XOT A;  3GOZ A;  4Q3I A;  4AY9 X;  4ARN A;  2P1N B;  2Z64 A;  1H6T A;  5IJD A;  3G3A A;  4ECN A;  4U06 A;  4XSQ A;  4R6A A;  4NKG A;  4PKI G;  1O6S A;  1FT8 A;  1P8T A;  1YRG A;  2RA8 A;  5GS0 A;  1KOH A;  4M7E A;  3E4G A;  5IYX C;  2RR6 A;  4LXR A;  3W3L A;  3WN4 A;  2AST B;  1XEU A;  2OMZ A;  4CC4 C;  3M19 A;  1H6U A;  3P72 A;  4NZR M;  5AWD A;  4HQ1 A;  3ULU A;  4Q62 A;  1OTM A;  3UN9 A;  4KXF B;  4BV4 R;  4LSA A;  5CMN A;  5LFN A;  4RCW A;  4AW4 A;  4U09 A;  4FMZ A;  5GMH A;  4FHO A;  1QYY A;  3WPD A;  3WPF A;  4Z8G A;  2P1P B;  5FTT B;  1FO1 A;  4TZH A;  4LSC A;  3G3B A;  1OGQ A;  4FS7 A;  1K5G C;  1W8A A;  1SQ0 B;  5A5C A;  4NZT M;  2Y5Q A;  2XWT C;  4XGO A;  3UL8 A;  4QC0 A;  2WQV A;  1GWB A;  3RW7 A;  4G8A A;  5CMP A;  3RFS A;  2P1M B;  4I6J B;  3O53 A;  4PQ8 A;  1M9L A;  3UL7 A;  1OOK G;  5AZ5 A;  1OTN A;  4ARR A;  5GS2 B;  4WYK A;  2JE1 A;  5GMG A;  3OJA A;  1PGV A;  5D3I A;  1K5D C;  4R58 A;  2P1Q B;  4BSS A;  5GQR K;  2OMU A;  3ZYO A;  4R07 A;  1M9S A;  4LI2 A;  2WQU A;  1O6T A;  4EZG A;  4KNG A;  1A9N A;  3CIG A;  2BNH A;  3PMH G;  3W3G A;  5IJB A;  2ELL A;  3RGZ A;  1P8V A;  3KJ4 A;  3WPH A;  4K17 A;  1XKU A;  4CP6 A;  4H09 A;  3E3Z A;  2OMW A;  3M18 A;  4R08 A;  1JL5 A;  2P1O B;  3RW6 A;  2V9T B;  5B4P A;  2O6S A;  3BZ5 A;  2Z7X A;  2OMT A;  4PSJ A;  4QBZ A;  3ULA A;  3RFE A;  3JB9 j;  4BSU A;  2JQD A;  3E6J A;  3OGK B;  4R09 A;  4PER A;  4UFR A;  3SB4 A;  4WP6 A;  2WFH A;  4GLP A;  5AWA A;  1O6V A;  4LSX A;  2FT3 A;  1FS2 A;  3CVR A;  4QXE A;  1OTO A;  2V9S A;  2O6Q A;  1OZN A;  5GMF A;  3G04 C;  4L3A A;  2JE0 A;  4Z94 G;  4Z64 C;  3UL9 A;  3C6N B;  2V70 A;  1Z7X W;  3VQ2 A;  4NKH A;  3E2J A;  4R0A A;  3W3M A;  4BSR A;  3RGX A;  1KOO A;  3CIY A;  3WPE A;  2Q4G W;  3WPB A;  3W3J A;  1G9U A;  2ID5 A;  3OJA B;  4Z61 C;  1D0B A;  4Z79 A;  1ZIW A;  4V2E A;  1DFJ I;  4Q3G A;  4YEB B;  2WQX A;  3O6N A;  4RWT C;  4LSX C;  2UZX A;  2Z62 A;  1A4Y A;  2BEX A; 
#chains in the Genus database with same CATH homology
 3VQ1 A;  1XEC A;  2OMX A;  4CNC A;  1M0Z A;  3G39 A;  4Y61 B;  1XWD C;  3WPI A;  1FQV A;  5IJC A;  2Z81 A;  3OGL B;  3RIZ A;  1U0N D;  4U08 A;  5B0T A;  4FCG A;  4C2B B;  4V2C A;  3WPG A;  2Z63 A;  3ZYN A;  5HZL B;  4C2A B;  4XOS A;  4P8S A;  1P9A G;  4LXS A;  2Z7X B;  1IO0 A;  4U7L A;  4PEQ B;  4V2D A;  4R6J A;  5B0N A;  4RCA B;  3C6O B;  4R6F A;  2IFG A;  3ZYI A;  3W3K A;  4CIL A;  2R9U A;  3OGM B;  2OMV A;  1DS9 A;  4J4L A;  4P91 A;  3FXI A;  3C6P B;  1XCD A;  4J0M A;  4LI1 A;  2ASS B;  3RJ0 A;  2CA6 A;  2Z82 A;  4MQW X;  3DZE A;  4L3F A;  2OMY A;  5AWB A;  3ULV A;  4FDW A;  3REZ A;  5HDH A;  2Z66 A;  1LTX A;  4M7E C;  3W3N A;  4GT6 A;  4MN8 B;  4R5D A;  4IM6 A;  4CNM A;  3WPC A;  4CC4 A;  5AWC A;  3A79 B;  4KT1 A;  3TSR E;  2UZY A;  3ZYJ A;  3G06 A;  3RFJ A;  2Z65 A;  2O6R A;  4ECO A;  4R5C A;  1WWL A;  1DCE A;  4FD0 A;  1M10 B;  2WQW A;  4B8C D;  4OQT A;  4R6G A;  2A0Z A;  2XOT A;  3GOZ A;  4Q3I A;  4AY9 X;  4ARN A;  2P1N B;  2Z64 A;  1H6T A;  5IJD A;  3G3A A;  4ECN A;  4U06 A;  4XSQ A;  4R6A A;  4NKG A;  4PKI G;  1O6S A;  1FT8 A;  1P8T A;  1YRG A;  2RA8 A;  5GS0 A;  1KOH A;  4M7E A;  3E4G A;  5IYX C;  2RR6 A;  4LXR A;  3W3L A;  3WN4 A;  2AST B;  1XEU A;  2OMZ A;  4CC4 C;  3M19 A;  1H6U A;  3P72 A;  5AWD A;  4HQ1 A;  3ULU A;  4Q62 A;  1OTM A;  3UN9 A;  4KXF B;  4BV4 R;  4LSA A;  5CMN A;  5LFN A;  4RCW A;  4AW4 A;  4U09 A;  4FMZ A;  5GMH A;  4FHO A;  1QYY A;  3WPD A;  3WPF A;  4Z8G A;  2P1P B;  5FTT B;  1FO1 A;  4TZH A;  4LSC A;  3G3B A;  1OGQ A;  4FS7 A;  1K5G C;  1W8A A;  1SQ0 B;  5A5C A;  2Y5Q A;  2XWT C;  4XGO A;  3UL8 A;  4QC0 A;  2WQV A;  1GWB A;  3RW7 A;  4G8A A;  5CMP A;  3RFS A;  2P1M B;  4I6J B;  3O53 A;  4PQ8 A;  1M9L A;  3UL7 A;  1OOK G;  5AZ5 A;  1OTN A;  4ARR A;  5GS2 B;  4WYK A;  2JE1 A;  5GMG A;  3OJA A;  1PGV A;  5D3I A;  1K5D C;  4R58 A;  2P1Q B;  4BSS A;  5GQR K;  2OMU A;  3ZYO A;  4R07 A;  1M9S A;  4LI2 A;  2WQU A;  1O6T A;  4EZG A;  4KNG A;  1A9N A;  3CIG A;  2BNH A;  3PMH G;  3W3G A;  5IJB A;  2ELL A;  3RGZ A;  1P8V A;  3KJ4 A;  3WPH A;  4K17 A;  1XKU A;  4CP6 A;  4H09 A;  3E3Z A;  2OMW A;  3M18 A;  4R08 A;  1JL5 A;  2P1O B;  3RW6 A;  2V9T B;  5B4P A;  2O6S A;  3BZ5 A;  2Z7X A;  2OMT A;  4PSJ A;  4QBZ A;  3ULA A;  3RFE A;  3JB9 j;  4BSU A;  2JQD A;  3E6J A;  3OGK B;  4R09 A;  4PER A;  4UFR A;  3SB4 A;  4WP6 A;  2WFH A;  4GLP A;  5AWA A;  1O6V A;  4LSX A;  2FT3 A;  1FS2 A;  3CVR A;  4QXE A;  1OTO A;  2V9S A;  2O6Q A;  1OZN A;  5GMF A;  3G04 C;  4L3A A;  2JE0 A;  4Z94 G;  4Z64 C;  3UL9 A;  3C6N B;  2V70 A;  1Z7X W;  3VQ2 A;  4NKH A;  3E2J A;  4R0A A;  3W3M A;  4BSR A;  3RGX A;  1KOO A;  3CIY A;  3WPE A;  2Q4G W;  3WPB A;  3W3J A;  1G9U A;  2ID5 A;  3OJA B;  4Z61 C;  1D0B A;  4Z79 A;  1ZIW A;  4V2E A;  1DFJ I;  4Q3G A;  4YEB B;  2WQX A;  3O6N A;  4RWT C;  4LSX C;  2UZX A;  2Z62 A;  1A4Y A;  2BEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...