5J06A

Structure of the immune receptor cd33 in complex with 3'-sialyllactose
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
213
structure length
213
Chain Sequence
GFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title STRUCTURE OF LIGAND BOUND CD33 RECEPTOR ASSOCIATED WITH ALZHEIMER'S DISEASE
rcsb
molecule keywords Myeloid cell surface antigen CD33
molecule tags Immune system
source organism Homo sapiens
total genus 48
structure length 213
sequence length 213
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j06A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j06A02
4K71C 3ZKNC 5F7WC 3ZL4H 1I1AC 1FZOB 3ARXA 2IANE 4NRYA 3QAZC 3U79A 2EDQA 5IM7A 3QUML 1AIFA 2DKUA 1HHJB 3LDBB 4S1RL 5DJ8B 4IRSC 1RJLA 2BC4A 4NQXB 3ROLA 2NY1B 3MRMA 2EDXA 3LKNA 4JHAH 1VESA 3MJ9H 4F7MA 3QH3A 1OF2B 5B39B 1VACA 3D18B 1H3PH 2ICEB 1N5AA 3E2HC 4JRXD 4XPHH 2DLFH 3VXMA 2I5YH 1EFXB 3PHOB 4URTB 1DL7L 1HSAB 5GZNC 3NZHH 1ZSDB 3T65A 2XYCA 2V7NA 4MA1C 5C8JB 3HMXH 3VXMD 4KZEH 1N2RB 1I7UB 1FE8L 3GRWA 5JR1L 1XF1A 5DJ6B 4OCWL 5JA8B 2G9HA 1G0XA 3SKOB 5F1KC 4DVBA 4LCIL 2JJTA 1CFTA 4FQQA 2VLRB 2GSGA 1UJ3C 2NY6C 4YE4H 4OTXL 1NJ9B 3FRUB 1MWAA 1PQZB 2XFXA 2ZCKH 4BZYA 1MQ8A 2EXYC 2JCCA 2B1AH 2X4TB 5F7EH 1QHOA 2CJUL 3VU2A 3PDGA 1BGXL 2DM2A 3IFLH 3WXVH 5EUKA 5J12B 3LQZA 1J86A 2PN5A 1T22A 4W4NA 3TJHC 1EVUA 1Z2KA 2NY2C 4Y5YB 2CLRB 3RX8A 4YWGH 5ACMA 1K85A 1SJHB 5GHWL 1TVBB 3KYMA 4K7PH 5AG9A 5GGVH 2NY5H 4M6MH 3MV7B 3BEVA 5AZ2L 2DQGH 2ERJB 1PSKH 1OP9A 3GI9L 1W0WB 3AB0C 3DUUB 5IW1A 4WNQA 1KIQB 3MCKB 4LCYB 4WFEE 2CK0L 3EFDH 1QVOB 5HYFA 1I7ZB 2NZ9C 3ROOA 1OQXA 3OKMA 4YUEH 3ARQA 3WLWD 1F2XK 3AMKA 2EDWA 4JZJC 4LSTL 4YXLL 5T1LB 5IMOA 3WXWH 1KCLA 2VXVH 1LE9B 1QSVA 2XZAH 4JVUA 3VRIA 4XVTL 1GOHA 4APQD 2CKBA 1G7MA 5I16B 3ULUH 3GGWA 4Z76B 2IG2H 3UPRB 3WNPA 4NC0B 3BWAA 5EOTB 1SEQH 4K9EL 1J0YA 4XH2A 2VNCA 4ZYKA 3HFMH 3WSQH 2J8UA 3QJFB 3V5DB 4E9LA 2FYYA 1MIMH 2KPNA 2VXSH 5DUPL 4YHIA 3VFMA 1MFDH 2LTQB 3S37L 3CU1A 1Q9KB 3QO0A 3TESA 2DLHA 2YWYA 3OAUH 4W70A 4KKNA 3RVXD 4OQTL 1MI5A 1C5BL 5K9JL 2BSRB 3MRCB 2MHAB 5CJXA 2XQBH 4U1IB 2VTFA 2HVJA 1MQKH 3QIUC 4NKQB 4ZXBC 1ZEAH 1HKLL 5AAMA 4XCYA 5L7XH 4LDOB 5GRUL 3VRJB 3MLSL 1GSMA 1S5IH 4OV5A 4KC3B 2ZCHH 5GRJH 4I48A 3V6FB 4WI8A 4OLXL 5KJRH 1IM9A 4L4VB 4I4WB 5TE4H 4BQCA 3ZYIA 1E4XH 4ZSOB 4ODWB 4XP9H 3TN0D 5F3BA 5JUEH 3VGBA 3MRIB 4OCNC 1Q9WA 4ONHA 1NBZB 4JCMA 5GGQH 4KFZC 1BAFH 4KRMB 1BOGB 1CGWA 5IB1A 1TQBC 2Z91A 3U9PH 2OJEA 1AXSB 3MLRL 3QFJB 1NBQA 4TTDD 1BP3B 2B2XL 5EZOH 3T2NH 1BFVH 2VIRB 1LK3H 3EDDA 4XNUH 5IHZB 4D0DA 2QSTA 2DJSA 3P4LA 5GJTH 2K3TA 5KTEH 1BVKA 1FL6B 5J6HB 2GK0B 3QUXC 2VERN 3DX9B 2XWBB 3WFEH 5C92A 1OSZB 3DBXA 3EOTH 3ULVC 3MV8E 1WCBB 3LQAC 3CCHB 3WFHA 1RZ7H 1QSED 2RR3A 5D9SB 1TCMA 3PV6A 4K3JH 4LNRB 4TSCL 1BEYL 3MUY1 4JM4L 1U2CA 3VDCA 1NC2A 5B38B 5EO9B 2OK0L 4G8IB 1CYGA 4P9HL 2Y25A 4JZNA 3F6LA 2H8PA 1KEGL 3JSSA 2MCG1 4RSVA 4PRHE 4FQXB 4RMUA 4I9WD 1NCTA 4Z5RB 3JWDL 4HMCA 5CSGA 4EOWH 4RMSA 4EI6B 1S3KH 4YXKH 4UQ2B 3EO9H 5IHBA 2A77L 4NQEA 2APVA 2F53A 2H2PD 4BZ2L 4JFDE 4N5ED 3TBTB 2DI7A 4RAUA 5J1AA 1HH9A 2NQCA 4OCYL 1F4XL 2MQ0A 5CSZB 4NQED 4IDJL 1I3GH 2FJGA 3ARYA 3FN0H 1FRGH 4YGVB 1EBAA 1CFVH 2F5BL 2PXYD 5K59E 5K9QI 4P2OB 5DC9B 3VGFA 1EEYA 1QKZH 2GAZB 5ERWB 2AJZA 5FOBB 5FHBL 5C0RH 2GTWB 3WFCL 4RGNC 4UT6L 2FWOA 5FUCC 3QUMA 4X4XA 1BFOB 1BBJB 5C08B 4WU7B 2EH8H 2IPTH 5F9JA 2VQ1A 4B41A 1H3VA 1Y18A 5HBBA 4JO3H 1VFUA 4CVXB 5IHUL 3RIAK 2VH5H 3NABL 1W0VB 2X1QA 1MEXH 2Z92B 4PJ7B 15C8H 1QA9A 4FZEL 5GGTH 1MY7A 5GZOD 3PL6C 1C7TA 3CFBB 1YUHB 1KT2A 1KJMB 3NA9H 4NT6A 3S36H 4DKFH 1ITBB 3DYPA 1IEAA 3VXPA 4QHLB 4DVRL 1FIGL 2CXGA 1WIUA 4MAUL 3T3ME 2D7TH 1D6VH 3T1FA 4PY7B 4ESKA 1V7NH 4JFQA 2ADFH 2R8SL 5E6IA 1KCRH 3TIEB 2I5YL 3P4NB 4LASH 4K7FA 3MCLH 1Q94A 3HA0A 3L3GA 1KENH 1K4DB 3WL9B 3M8OL 2VXQL 4M7LT 4OIBA 5E6ID 3FKUS 3PNWA 4PPTA 4AG4H 3VFVB 4DZBB 3RWEB 5IQ7H 1ZLUK 5A2FA 4GLRH 1S5HB 5C0FB 2HH0L 1CICB 1RMFL 3KWWA 5C1MB 1A7OH 2DI9A 1WVZA 3BIBX 5FYJE 1NC4D 5LGKA 1K3IA 1CLOL 3KPOA 4HIEB 3X11B 1NFDE 3LEVH 3Q1SH 5J6GA 2WBJD 5E2UL 4UV7L 3O9WC 3QNXB 2DYPD 1DUZB 2WQRA 1C12A 4UNTA 3RHWK 3WXVL 4M5ZL 1QQDA 4N1EA 1RIUH 4L3AA 4YWGL 5GGRA 4KMTH 4XNZC 3HUJE 1E4JA 5FDYA 5SWSB 2MCPL 2VXUH 5GGVL 4KV5E 3ARBA 4GRLA 4M6ML 3O45A 5I18L 4DN4L 3X13A 2DQGL 1RJZB 1B0GB 1U95B 5F89B 2VLKA 1NCBL 4MJID 4R4BB 2UWEE 3GM0A 4QF1A 1CDHA 1AO7D 2A6KB 4GRLD 4KK8D 4F15C 1YEGH 2X1WL 3QYCA 1TPXC 4AT6B 4ZS6D 2VLKD 4PR5A 3CVHB 4I2XE 5DVKA 4O5LL 5EWIH 4R90L 4LCUA 1EJOH 1OVZA 5E94A 5TF0A 1ZT4A 5FA4B 2H1PH 4H26A 4QXUL 2GITB 5SX5K 1AR1D 4OQTA 5F9WB 3RWDB 1R3HB 3KHQA 3ULUL 3C6LB 2BSSA 2IG2L 1KJVB 1T2XA 2ESVB 4G6FB 2CD0A 4WTXA 5D6DA 4MXWH 2YC1A 1D3CA 3HRZA 4GKNA 4X6BA 5FF6A 4POZD 3IDNB 3LIZH 3I02B 5DHXB 3HFML 2ADIB 1N64L 5CGYD 1KTDA 4G8GA 3U1SH 4ORGA 1NLDH 1YEHL 2X7LA 1IJ9A 1NUNB 4HJJL 2VR5A 5HHVH 1MFDL 3KYNB 4IOFD 4XMKH 2WINA 3EKCA 4OLWH 4OCRH 1ZT7A 5DGRA 4PGCB 4DGIH 3LS5L 3T2QA 1EEQA 3AS2A 3GHEH 4OV6F 5I1EH 2F54E 3VFTB 3IFPB 3VGAB 4HS3B 2R1WB 1FVCB 4Q9RH 2XQBL 1EMTH 1UWGH 5ID0B 3ET9F 4I0PD 5B39G 1QRNE 2NX5E 4OZFA 3DYMA 2VC2H 2CMRL 1QLFB 4KRPB 3MA7A 4G9DA 4U1HA 5ESVA 5L7XL 4FZ8L 4OFYD 3BN9D 4WHCA 5I1CH 1S5IL 2HYMA 3WHXA 1M7DA 3ARFB 1OY3B 3KPSB 2APFA 2ITCA 3OGOE 4P4KB 4JKMA 3BAEL 3ETBF 4NKIL 5I8KL 1XT5A 2DQHH 5TE4L 5FK9A 1OP3H 3GMRA 3OBAA 5B8CB 3LZFH 1LO4H 3QCVH 4YDLB 4XP9L 4HHAB 4X99B 5HHOB 5IT2H 3CFKA 1CL7I 5I1DA 3B9KB 3Q6FA 5GGQL 4CN1A 4QOKA 1T4KA 2Q8BH 5HYJE 1BAFL 3VMOA 1R3IH 3WHE0 4OT1L 2N56A 1S7SA 5DRWA 3EZJB 4QOKD 5C0IA 2GEEA 3O6FB 3F7YA 2B8OT 1BFVL 3SN6N 2RCSH 1UJTA 3P40A 3IVKB 3TP4A 4HUWB 4PLOB 3EJYD 5INDA 4R2GB 5GJTL 2PCPB 5JHDE 4MNQD 4JG1L 3OKLB 3LV3B 2G5BB 4F3FA 1ADQH 4GAYB 1BJMA 3SQBA 2H2SD 4N5UA 2Y06L 3D2UA 3IDYC 2GTZA 3HI6L 1B6DA 4OAWB 5IF0A 1BD2A 2QSCH 5KSAB 3HLAB 3T3MF 5MENB 3W39B 4Q7DA 2DBJA 1KG0A 4K3JL 3AM8C 2C1OB 2YBRB 1MOEA 2EXWD 5L88L 2ARJB 4BQ9A 4U6HA 4LARH 1ZLSL 2VDML 4JO2H 4NIKB 3RVWD 1YPZE 2B20A 3QEQE 2XA8H 5FCUH 3NIFF 3BKCL 1JFQL 4Y4KA 1FVDA 4XP6H 3TH4T 5JW3L 1A6PA 2NXZB 1MAMH 4QXWA 3VH8B 4PP1C 4TUJA 3PWUA 1SJEB 2HN7A 2I9TB 5HGDA 5MERB 4Y2DC 1ETZA 2VLME 4RMVA 1S8DB 5E2JA 5EZLA 3RZCD 3EOAA 1FG9C 5DQDH 4P2YA 1A1MA 1D6EB 5DURB 5CUSH 1CDYA 1D7FA 4R0LC 4Y4FD 1IBGL 3PDOB 1AE6H 4O58L 4LKXA 1JYVA 3PWPB 4NJ9L 3I50L 2FECI 3BJ91 3T0AA 3FN0L 1C08B 2UZXB 2Q3AA 1E6JH 1CFVL 5HVHC 5C6TL 4N0FB 2L4OA 3BSZH 1QKZL 4O2FB 5E08H 4RFNB 4JY5L 1OD9A 4QY8B 1R24B 1WZ1L 4NQVB 3KXFB 1DQLH 4NKMB 3F6IA 5KG9A 4XWGL 1QBAA 1YDPA 4K7PY 3KPNB 4PJ9B 5I1GH 2EH8L 1EXUA 4PGDB 1DDHB 5MEQB 2R56L 2QQQA 5IB5B 2HJFB 4X83A 5ALBL 3KPRA 5ANMB 2F5AL 1NPUA 5E9DB 4BK4A 1MRFL 4QRSA 5KS9A 3FHAA 5TJWK 4Q2ZB 3FQWA 3L3IA 3F7RA 3WUWB 3JTSA 1P69B 2C4FT 5K9KB 3NA9L 1PFCA 4NN6B 4F7EB 4ZUTB 2NYYC 4OFIA 4Y19B 1S7VB 1S7RB 3C5JA 4O9HH 5I8EB 3FB8A 3M07A 2C3XA 1KJ2A 2D7TL 3VFSB 5HPOA 1X5YA 5D2LE 2ADFL 4HPOH 3NAAH 4LASL 4O51A 2JTDA 3MCLL 2FRGP 3OF6D 2JIXD 4F7TA 1AGBB 4NO0D 4D0BB 4LPWA 1SEBB 2APTA 4HIHA 4I5BA 3VXUD 3AS0A 1OSPH 4M1DH 3G6DH 5HDBF 1REIA 2I9LB 3MLUH 3NPSC 5H2BB 4KJYA 4N8CL 5IQ7L 3BIKA 1FORH 2I24N 1H15B 3K80A 4GKZB 1CXHA 2FJFA 3GO1H 3DO7B 5KOVC 1CZ8H 1N3NA 2VDNH 1C5DB 5JZ7D 1J0JA 4M7ZC 3NPZB 2NY0C 3QSKB 3TA3D 2VYRE 5EU6B 3RDTC 2APXA 3G6AA 4XPGH 2XZCH 3WV0A 1DZBA 3VD9A 2AJ3A 4UNVA 3BUYA 2NY4D 4KMTL 1AXTH 4LAQH 3MV9E 3RJQB 3AREA 2VLJE 1WBZA 2VXUL 1MAKA 5DO2C 2I60H 4EDWH 4JZOB 4PJEA 4R7DA 1DFBH 1FO0L 2O5XL 2OQJA 3PV7A 5BS0A 4YIQB 4PP2B 4IM8A 4Y4HC 4FTVB 2VSDA 3EYOA 3FO1A 4MAYD 5AUMB 5GS1C 1MVUA 4J2XA 4K3EL 2BVOB 2X89D 4GAJL 4HK0A 5HGGS 2AK4D 4LCCA 3ULUD 3BGFB 3D0LA 3S5LA 5EU7C 4EKXA 4J4PA 4YEEA 5C0ND 2WWKO 1PG7H 3EOYG 2H1PL 4JY6B 1O7SA 2F8XC 1JHLH 4J4PD 5IR1B 4XBPA 4TNVF 4OZIF 3TBYA 3X12B 4TOYL 3H42H 1WUNT 1AKJB 1A5FH 2RHEA 2AVGA 4GG6E 3QEUB 2OP4H 4MB3A 3CH1B 3B3IB 1J9CT 3J8F7 4MXWL 4NNYA 5DEGA 3TBSA 3LIZL 3VDAA 1CFQA 3M1BB 1ZA3B 2CLZB 4KUZH 1JRHI 2P8MA 2APBA 3B8YA 3W82A 4ZTPL 5T3ZH 5JMRA 5HHVL 2DM7A 4XWOC 3ARGD 4WHYH 1EZVX 1YEEL 1YPZF 3K1KC 1WJ3A 4S1QH 3T4YB 1I1CA 1P53A 4DGIL 5I1EL 1KCKA 3GMOA 1IARB 4LCWD 2NW3A 2XKNB 4XTRC 2AK1H 1EMTL 1U6AL 3HCVB 3BPOB 2BOBA 2Z8WC 1X4XA 1A6TB 1LD9A 5LG1A 3ESVF 4JLRA 3MRRA 4RCAA 2VISB 3VXTB 3WDHA 3GSWB 1U8NB 3IDXL 5CJ8A 5C0AA 2DIJA 1KB5H 4NDMA 4LLVB 4KAQL 4ODBD 5AZEH 1YECH 2DJ4A 2QTEA 1N59B 5IT2L 1CXLA 4IMKC 1UB6A 3RHWF 1CGSH 4IIQC 3T3PE 4BFGA 4EI5C 1ODAA 1TQCC 3WJJC 2BNQA 1AD0B 2IAMC 3FFCA 2NXYD 4AMKL 1P1ZB 2P4AB 2WK2A 5DYOB 1LO5B 1YMHB 4Z95L 3RTQD 5E56A 1C8PA 1HYSD 2B1HH 1QFWM 2FLRT 1J87A 4H20H 1KNOA 1FNEB 3U30C 5C0EB 3LKPA 4GH7B 3QULB 2OI9C 4OZGE 4C58B 2DMBA 2WBKA 5C0BA 1J1PL 3SGKA 2V17L 1I7RA 3O3AB 3B83A 4F2MB 1HHKA 3TFKD 3L7FB 2IGFL 2GJ6B 3GSVB 5TQ0H 4JPIA 3FQRA 5C0BD 4XVJL 1PW3A 4QCIB 5DVNA 4UQ3A 1GGCH 3E1F1 4MJ6A 4P59H 2J88L 4UILH 5CJQH 5D2LF 4RGMC 4YC2B 4LARL 2Q8AH 3MACH 4JO2L 2AS5M 5FCUL 5GJSL 4GRMB 1BIIB 2W59A 1OTTD 3WJLC 4Q0XH 1RUML 3O4OC 5JW4Q 5DHYB 3SDAA 1NGPL 3MRNA 4ZUWB 4YDJA 2BZDA 1A4KA 1JYNA 4HGWB 5I74C 1J88A 1T7VA 3NFPA 3I3BA 3QQ3B 3OR6B 5LAXB 5MEOB 4X6EA 5D7JA 1QNZL 1XH3B 5F21B 4EN3C 3U0WH 1AE6L 2X05A 2R2BA 1HINH 3VJ6A 4HKXB 5A2JH 2NW2A 5D8JH 2D31A 3TVMA 5HI3D 4P46B 1JZ5A 5DC4B 1E6JL 2XKSA 1PY4A 3AU1B 2X4UB 3MOQA 1N5YH 5DVOA 4WI9A 2BSTA 4HUNB 5DDHA 3T0EA 1I3UA 4AM0A 5L2JB 1G7QA 3U7YH 5I1GL 1DJSA 5D93B 1CE1L 3V6OA 4QRRB 5T5NG 4NKOA 1XF2B 3RIFK 2BP3A 1SYVB 2BY3A 4V1DD 3F8UB 3QXTA 1CFNA 4GXVH 1YQVH 2BFVH 4WU5B 2EEDA 1KIPA 4UTAH 5EU4B 5I15H 4M43H 2ZUUA 1EH9A 3RBSA 3FO0H 3EYVA 4RFEB 4RDQF 2C4XA 3L95A 2BHZA 1HH6A 2ZUYA 3FZUD 3ULVH 1P7QA 2HFEB 3LQAH 1FYTA 5E8EA 5DRNB 3PHQA 1J8HE 5BZWB 5E6YA 3O4LA 3CFIC 3ZE0E 1XR9B 5LBSH 3U82B 4PRPD 4RQQA 1FYTD 2G2RA 2AKRB 5DJZA 4HPOL 1K8DA 3NAAL 4LP5A 4X0KB 4OD3H 4GG6F 4WUKH 5AEAA 5CZKA 3QIBB 4PRIA 3DMMD 4TSBL 3QA3A 5IVZA 4K3DH 4Y1AE 1D5MA 4M48L 2J7LA 3DV4B 5KVGL 1JCKA 4KDVA 4QRTA 3G6DL 2ZJSL 3SE8H 4AENB 4KTEL 3QZWG 5F1IA 5T5FL 3RUGE 2A6JB 1FFNB 4NPYB 5E0QA 2EYTA 3GJFK 4RRPG 3UO1H 3I84A 2PETA 4XXCC 1FO0A 1F4YL 2DRUA 1LEKA 3QI9A 4KK5C 5GGSY 3G5XB 4WO4C 3U4AA 1IGFH 1K2DA 1M6OB 3UBXI 3VMPA 4XCNB 4F57L 4XPGL 5L0QB 5EIIA 1SBSL 1G0YR 3HI1B 4KXZH 4L8SB 5CEXB 1MRCL 2EYRB 3MYJA 3DXAB 1R3LB 1F13A 4XNYH 4LAQL 4XCCL 3U7WL 4QYOB 5E00B 3VXRB 1BZ9B 1AI1H 1SM3H 3MTRA 2DL2A 3N1FC 2I60L 4Y7MA 4EDWL 1OAUL 1Y0LA 1LO3H 1DFBL 1NDGB 3WN5B 4B50A 2DQFB 3QCUL 3QUZC 3RWFB 3S7GA 3UZQA 1QLEL 1PKQA 1EGJL 3WEXB 5E1AB 3DRTB 4H5SB 5CIPH 1U8OA 1Y6MR 1YYML 3BD4A 4G42A 3LN5B 4X6CA 5C07A 2UV3A 1FCCA 3UTSD 1PG7L 3IKCA 3NIDF 4K8RL 4P99A 3S37X 4BUHA 1FNGA 2OL3B 1OM3L 1VFBA 2DS4A 2KZWA 4M8QA 4JANA 1GGBH 1NBYA 4G9FD 4I77L 5F7DB 1S9YA 4ODHH 4QXGH 4OIAA 1MCWW 5E8PB 1NCCL 4QRPA 1DUYA 3CLEH 4PREB 2R1YB 2H32B 4PJ8C 1DQQA 2FH6A 1ES0A 2X4RB 5D1XB 4ZQKB 2GUOA 1AGCA 4HG4K 3SO3C 1QFHA 2EDRA 1B0RB 2QJDA 3QUYB 4I18A 4QRPD 1A7QH 1EEZA 5JOFA 3OQ3B 5C9JB 4X6DB 1GPOL 3T2PA 4NQDD 1SY6H 4G8EA 4U1KB 3FCTB 3QDJE 4P2CG 3UTQA 3I75B 3OGCA 5A1AA 3WS6A 4ODXA 4OLZH 4AQOA 5KSBE 1F8TH 3FMGH 3SGJA 2AK1L 2ADJA 4BELD 3BO8A 3QG7H 5CJOH 5CHNA 2QR0B 5TGBB 5KOMC 3FT2B 4J6RH 4BKLA 4ODTH 4PJIF 4UTBH 2C26A 3QPQC 2VZVA 1HOCA 5F7NC 4ELMF 4G6MH 5E2TL 2NX5B 3MGTA 3ARDB 4NFCA 4JGJA 1GZPB 2XN9D 5A16A 2HTKC 1S9XA 4DK3A 4MXVF 4HV8B 1FJ1A 4LMQI 5AZEL 1Q0YH 4S2SA 3L3JB 2F74B 3K3QA 4GJTB 1CGSL 1J05A 2PYED 2HFFA 1T21A 1NGYA 3HG1A 5IMLA 1RK0B 3ZDZE 3GBML 5F1NA 5IFJB 3ZMRA 3VFRA 5F3HA 1YN7A 4Y5VB 4H20L 1T1YA 2Y5TB 3BP6A 4R97C 5ESAA 2K9UA 3DVGA 3REVA 3VG9C 4WWKB 3K7UA 4JAMB 1JZ6A 1CCZA 2QL1A 2BCKB 2YD8A 5ICZB 3B43A 1T03L 4YHLH 3VFGH 1KTLA 1YNTB 1RUQH 1E0OB 5GSRB 1P9MA 1OL0A 4OZIB 4Z7VA 5HGHA 3C5ZD 1KFAH 2QADC 2WLZA 3ZE0F 1XGTB 4TUKL 5I1AB 4XP1L 4NRZB 1F42A 3V2AR 3THMH 1YNLH 3OKKB 4CBPA 3AAZA 1OHQA 3SCMC 4Z0BH 4WI6A 4PY8J 1M05B 5T1DH 4GXUN 4Z7UB 2DICA 2J6EL 1ZLVH 3W11C 2UYLA 2XI9A 3OKNA 4OQ1A 3TO2A 4UUJA 3O8XB 1EHLH 3V9FA 1YPZB 5I1JL 1W8NA 1S7XA 1U2HA 1LP9E 3RUGF 4JM2D 5EC1B 5IMMA 2FZ3B 3KPMB 4LP4A 1DQJA 5EZJB 1YY9D 3QIWC 1FN4A 3KJ4B 1CXFA 3BPLB 1UWXK 5D8JL 1AC6A 3OKOB 1BWWA 1RZJC 3MMEB 1WZKA 1DBKH 5DFWH 3LN9A 3FB6A 1ULVA 4YFLI 3PGDA 5D72H 3W0WE 5I1LB 4PJXE 4JHZA 1F00I 1G9NC 1TJGL 3QUKA 1FZKA 4QHMA 4LSQH 4Q6IA 5I76A 2BXZA 2Z31D 1JZ7A 1TTFA 3STZB 3RPKA 4DFIA 2P43B 1X5FA 3FQUA 2DWEA 2VN7A 5FO8B 1IE5A 2L0DA 1CN4A 4LQFH 1OAYH 3QRGL 2YPVL 3AC0A 2AXJA 3PGFH 3MOAH 2BVQB 5D96C 1OGAE 1F2QA 1D9KD 1F6FB 1Z9LA 3QO1B 4HGKC 5I15L 3DETD 5HPMA 4FABL 3FO0L 2WQ8A 1FC1A 3O6KH 4XB8A 5E4IA 4FFWD 3SJVD 1IL1B 1E27B 1T83C 1BM3L 3N1QC 4JN2A 4X7SH 3VFUA 2YSSA 5JTWA 2GT9B 3LQAL 2V5MA 2X4SB 5IK3A 4BQ6A 2WAHA 4NWUH 1B6UA 4ENED 5LBSL 4XMPH 2R0WH 3MNWB 1BFTA 3U6RA 3QDMD 3H9HA 2ITDA 4C56E 4OD3L 5JDSB 2MJWA 1INDH 1HHGB 2VO5A 3BYTA 2V5TA 4R3SA 3D39D 5BV7C 4U33A 2GFBB 5KAQF 5DJAB 3B6SA 2W92A 3W81A 3SE8L 5IOPB 3ARVA 4PJHB 5I17B 4KHXL 5SWZA 1G6RB 4LGPB 4LSPL 4OGYH 3A6CL 3FFDB 1I8KA 5LXGL 4KROB 5D7IA 5DD0H 1FG2A 3OHXA 2YPLD 5KSBF 3DWTA 1EGJA 1UH3A 1F4HA 1NBVH 5FKAA 1FNSH 4POYA 5KANG 1TZGH 1F5WA 4P57B 3GMQA 2A1WH 5JLZA 2NY3C 4M5YL 5I75C 3MODH 1DLFL 4PLJC 5CZVH 4PRNB 5FHAH 2X70B 2KH2B 3B9EA 4PJFE 1FZOA 2FEEI 1NMBL 4LF3B 3FHQA 5CP7A 5F9DC 3ZKND 5IROA 5K93A 5F71A 1I1AD 4X9IA 4M93B 1HHJA 1SM3L 3MYZA 1RJYB 4OI8A 5DJ8A 4NQXA 4LSSL 4K8RD 4IRSD 1OF2A 1OTSC 5B39A 3D18A 2ICEA 3EFFB 1EFXA 3PHOA 4WV1A 2JB6B 1HSAA 1ZSDA 2W9EH 3HE6C 3MJ7B 4OKVB 3RGVC 5C8JA 3EO1B 5IV2B 4OCSH 5GZND 4WGWB 4FQXC 4JFHE 4RWYH 1N2RA 1I7UA 2J8HA 1ND0B 4LAJH 4EZMA 5DJ6A 3BQUB 4LGSB 1ZE3C 1WZLA 3SKOA 1GGBL 4LNVA 5T3ZD 3CMOH 1H3XA 1NSNH 5DF0A 1CE6B 5ITBL 1NJ9A 3EO0B 4GOSA 3FRUA 1PQZA 2NY6D 2EDEA 2X4TA 2YHGA 5C0CB 2PO6C 2C5DC 3D25B 4W6XB 2EXYD 4XBEL 4GG6B 5F6HJ 5J11B 1EVTC 4WW2F 2P8LB 3H3PL 4Y5YA 3KLSA 1EUUA 1SJHA 5TF1H 3UJTH 3TJHD 4XMLH 1AQDB 1CLCA 2XZQL 1TVBA 4X4ME 2NY2D 4RX4D 4KGJA 5L8KB 1N8ZB 3SDDB 5AD0A 5J3HC 2ARWA 3MV7A 3PP4H 4JO1H 4YHZH 5HYIA 1W0WA 1F8TL 4LLMB 3WNKA 5EOQH 4C83B 1INEL 1KIQA 3QG7L 3MCKA 1LP9F 4LCYA 1CVRA 1A0QH 1QVOA 4NQCD 2AQ1A 4QEGA 1I7ZA 4JFOB 1X5KA 1HXYB 5A2IH 5GGUB 2D4DA 5GGRY 3SDCC 5T1LA 2NZ9D 3R8BB 1YNKH 3D3VD 5L9DL 1UYWH 4ZAKB 1LE9A 4CJ1A 2HFGH 3FONB 1KIRB 3JUYA 1GRWA 4MD5B 2P5WB 1OAKH 5I16A 3N1GC 2V2WB 3UPRA 3RRQA 5EOTA 1MCOL 3H9SB 2E7BA 3S88H 4UT9L 3P4MB 3CVHL 3MPCA 1LDPH 3OXRB 1IC5L 5D7LB 3HPLB 3MLTB 3OXSA 5E2VL 3QJFA 4IBLT 3V5DA 2ZWLT 5DMGC 5IEHB 1MIEL 2VABB 1Q9KA 2WP3O 2XQYK 1BLNB 2J6EA 3RY6A 4OZHF 2CO7B 2QSQA 3I2CH 3TBWB 4YHLL 5MP6L 4ZXBA 3A6BL 4DWHA 4U1IA 4LVEA 4D9LH 4PJGE 5FOJA 4KKCC 1WIOA 2F19H 4O4YH 5I71C 3QIUD 4ZXBD 4QWWC 1F02I 4N0UB 3VRJA 4ZFGH 1C7SA 2IH1B 3FAXA 4JRXB 4AIXA 1JIBA 3V6FA 3VXUE 2BC4B 4ONOA 4L4VA 5T1DL 3BPCB 4F58H 1LEIB 1EHLL 4ZSOA 4NNXB 5CILH 4ODWA 3C9NB 3K2UL 2DTSA 3MRIA 4UDTB 4L4VD 4D9QE 1K9TA 1NBZA 3Q2CA 1F6AA 1BZQK 1GC1H 4EEEA 1KULA 2O5YL 1KF9B 1BOGA 2DQIH 2EEAA 4P2QE 1LQSR 4KVNH 4HCRH 1BJ8A 4XNXH 1CK0H 4PJIB 1C5CL 3WFZA 1AXSA 3VWKC 3QFJA 5L6YL 4ELMB 1HQRB 1FZMB 2VIRA 4DVBB 4NJAL 2BDNH 5IHZA 3NTCH 2GSGB 2HAZA 4F80A 3PWJB 5JXAH 4HXBH 4R26L 1FL6A 5J6HA 2GK0A 4Q6YA 3DX9A 4PJAF 4TNWK 2XWBA 3HC4H 5J1SC 1OSZA 3NMEA 4YHOH 5EDXA 1WCBA 3CCHA 3TPKA 5D9SA 3ULVD 5JW5A 4LQFL 4LNRA 1CIUA 3KYMB 2NY7L 1IAII 3FRPG 5HD8C 5B38A 5EO9A 4AEEA 5FYKE 4G8IA 4LDLB 3MRQA 4TVPL 3S34H 4Q9BA 3UTPD 3BRDA 1XF4B 3I6LD 3S3SA 1XGQB 4Z5RA 4J1UB 3N06B 1RVFH 3TZVC 4EI6A 2ARJQ 4I8DA 3RNKB 4OM0L 4B7IA 1A3RH 1FGNH 4N1HB 1J8HB 3QPXL 4F9LA 5IMOB 3TBTA 4APQB 2QV2A 4MB5A 2E6JA 4HK3J 5CSZA 4KDWA 5H94B 3Q6GL 5FAAA 3JV0A 1T0PB 2JJSA 5IJVB 4CMHB 4YGVA 4P2OA 1YMMD 3P77B 3WKMH 2GAZA 5ERWA 5FOBA 3B2VL 5F6IC 2A6IA 2GTWA 1EEUA 3W9DB 3F5WB 2J8UB 4JKPH 1BFOA 1BBJA 2DL9A 3DURB 1EDQA 1U3HC 2ZKHH 1DBAL 4RGND 4WU7A 5FYLE 3IRZA 2BSED 1N4XL 3HZYA 2G60H 1FVEB 1PD6A 1CR9H 3P0YL 1K6QL 3RU8H 4U6XA 1A7NL 2M2DA 4WCYH 4CVXA 2VDQH 4L4TE 1NBVL 3OL2A 1W0VA 1FNSL 3IFOB 1TZGL 2Z92A 4PJ7A 2A1WL 4ZUVB 3UMTA 2FGWL 3MODL 1AD9B 3CFBA 1YUHA 2C4FU 2CK2A 1KJMA 4HJGB 4MQTB 3WDIA 1GH7A 3BD5A 4NUJB 3PL6D 4KKLC 2DQCH 3DO3A 4QHLA 1E6OL 2E27L 3MOBH 5FYKU 4FFYH 3UAJC 3UC0L 3RWCB 2MNUA 3LB6C 4PY7A 4OV5B 2Q76B 2J8OA 3TN0B 3IDJB 3S35H 4POUB 5D5MF 3TIEA 4NN7C 3P4NA 5IFAL 1QZ1A 2E7HA 2OR8A 1K4DA 3WL9A 5DA0B 3O41B 4XPTL 1KBGL 2OBGA 2R2EB 1IGMH 4KQ3L 3VFVA 4DZBA 2J1KA 4JFYB 4RWYL 2APWA 3RWEA 3NGBC 5ALCH 2XG4A 3IRPX 5J13B 2YUZA 1S5HA 1TVHB 5C0FA 1CICA 5L8LB 3ULSB 4PLNC 4HEME 4HIEA 3MSPA 4YK4C 2YN5A 2R39A 1DBBH 4TRPL 1S9KC 5DD1H 3QNXA 5A3IC 1DUZA 1XIWC 2FBJH 1Q1JH 3MGOB 3O9WD 4GW5B 1J18A 1QSEB 2LU7A 2ZUQC 5DRZB 3SE9L 1EERB 4Z7WA 5CZXC 1TJHL 1A6UH 3QEGH 5HHQB 5F72S 5IKCB 3UJTL 1AH1A 5MI0B 5SWSA 1JBJA 1OP3K 3ZDYF 3PV6B 5C7XH 3BWUC 1AHWB 4MGXA 3AS1A 1RJZA 1B0GA 1U95A 5F89A 1DQDL 4R4BA 5LCVH 4FQIH 3LD8C 4M62H 2A6KA 2H8PB 5FYJH 1JF1B 4AT6A 3SE4A 4NZUH 1BIHA 3CVHA 3QQ9C 3IB4A 3VI4E 5BVJB 5BO1H 3MRPB 4QO1A 3UTTE 5ICYB 1RULH 5FA4A 1RFDH 4Z6AT 1RZ8B 1QYGL 5DJ0B 1SYSB 4FXLA 4NQEB 2HFGL 2GITA 3L3OB 3MRFB 5GS3A 5EOCJ 1H9VA 2Y23A 3SDXE 2PXYB 3RWDA 1D5IH 3SQOL 1QLRB 3O2VH 3ZE1F 3C6LA 3EHBC 1KJVA 3BMWA 2ESVA 3WIHL 5K9QG 1X4ZA 1GGYA 2P42B 5CINH 3IDNA 5TE7L 4JHWL 1WAAA 1NANI 3I02A 4V1DE 2ADIA 5HDLA 5ADOH 1LDPL 4ZODA 5DJ2B 3CSYB 3VWJC 1HCVA 4X4XB 1RIHH 2F58H 5KVDH 3KYNA 4NC1E 4XX1E 3RBGA 5E6ZA 5F9JB 5H35B 2DD8H 4PGCA 1FBIL 4WFHE 2FB4L 2IF7A 3I2CL 1ZGLB 3VFTA 3IFPA 4QLRA 2CDFB 5C6PB 4HS3A 3SKNB 3DGGB 4NWTH 2R1WA 1FVCA 3PHSA 1A3LH 5ID0A 2FH8A 4WUUE 4D9LL 5J1TC 1FSKB 2F19L 3WE6B 3MLYL 4JFED 5L2KD 1QLFA 2RQ8A 1BPVA 1OTUC 1MPAH 4CVZB 3ARFA 4WW2B 3KPSA 3UJJH 4X9GA 4P4KA 3UCRA 1KELL 1JWMB 3QDGE 4RDQG 1BHGA 2VL4A 4UIKH 5ELIA 5B8CA 5E6IB 3ZKQD 1A14L 4HHAA 4X99A 5HHOA 1M71B 2PR4H 1U91B 1R0AH 3B9KA 2L7UA 4TQEL 1HNGA 4JB9L 4V2BA 1GC1L 1FNAA 4PB0L 1F6LL 4NZTH 4OF3A 1NC4B 1LP9B 1T89C 2BNRD 4KVNL 1CU4H 3B9KD 2WBJB 5ID1B 1RAMA 3GKZA 4Z0XB 2DYPB 3O6FA 3GJFB 4DKEH 4EUPB 4YAQB 1ERNA 3IVKA 4WI4A 5J6GB 4HUWA 2WANA 1MFEL 3O6FD 4I1NB 3LV3A 2G5BA 3TYGH 1C12B 1L9NA 2NCMA 4H8WL 4GAYA 3ZHKA 4PJDF 1NCAH 1H3GA 3MBEC 4OAWA 5KSAA 5DHVH 2D7PA 3HLAA 2YZ1A 2R2CA 1I8LA 5MENA 32C2A 3W39A 4K2UH 4MJIB 2C1OA 2YBRA 1NGWB 3P4OB 1AO7B 2ARJA 2WUBL 3BZFB 2VZTA 1S9WA 4K3GA 3UTSE 5FO9B 3KR3L 4MXQC 4YX2L 4E42B 1JV5B 1GIGH 5GRVL 3VH8A 4OZHB 1LDSA 1SJEA 3MLXH 4TPRH 4KUCD 1X5IA 2I9TA 5MERA 4OM1H 1RVFL 2NXZD 1HNFA 2YA1A 1S8DA 4WHDA 3O3DB 3BPOC 4JKLA 4GRWE 4MVBC 5MHSE 2Y72A 3EJZC 1D6EA 1FGNL 3CX5K 2P5ED 2IBZX 4YHML 3KHOA 3PDOA 4HFUH 2V6HA 4Q9QH 3PWPA 2HT2C 2VWEE 2X40A 1C08A 3V6ZB 3NIGE 4JRYD 2R1XB 2XV6B 4N0FA 1VSCA 5I19H 4M6OH 4O2FA 1AY1H 3PWPD 4QY8A 1R24A 4FFZH 4HDIB 3KXFA 4NQVA 4DGYH 2NR6C 4NKMA 1AQKH 4JKPL 1KTDB 4PJ9A 35C8H 1QBMH 4KKAD 2X1PA 4PGDA 1DDHA 5MEQA 1UM5H 1CR9L 1A7RH 4NUGL 2HJFA 5IB5A 4M61A 5C09D 3TO4C 2AI0L 4IS6B 1S7WB 5ANMA 1ZLUH 4NN5B 1RZJH 4I0PB 4PRAA 3O6MH 5E9DA 2VUOA 3GI8L 4MJ4A 4XC3L 3VFNB 3DARA 3DOSA 3HNVL 4Q2ZA 1G9NH 4P5KB 3WUWA 2KL6A 1U3YA 5E99L 1QRKA 5K9KA 2EYSA 4ZUTA 4Y19A 1S7VA 4LRIC 1S7RA 4U1HB 5I8EA 3RY5A 1FDLL 2NYYD 4PJAB 1CLYH 3VFSA 3VI3E 4RNRB 1PYWB 5F96H 4LVNB 2OJZH 5E8DH 1L0XA 2IAND 4JQXC 1AGBA 4D0BA 3CX5J 1SEBA 1IGML 3C2SA 1JNLH 4L8DB 4Y2OA 5I8OH 3MRBB 2H6PB 4L3EE 3TM6A 3Q6FB 5D1ZC 2I9LA 5ALCL 2DWDA 4G7VH 4FQHB 1EO8L 1OW0A 4W6YB 5FFLA 1H15A 3RWJB 1JHKH 4GKZA 4H0HB 2KKQA 5ACLA 4LLDB 5CLWA 3GKWL 4LSDA 5DRWB 3DO7A 5IQ9B 1KJ3L 1WBYB 1C5DA 4MNQB 4J3VA 4CNIB 3SY0A 2XIDA 5DD1L 3L3KB 2JCCE 5EU6A 3ZKXB 1LWRA 1Q1JL 2BRQA 5BV7H 4NBYB 4XBGA 2NY0D 5SX5H 6FABL 3RDTD 2N7BA 2ZSWA 4LVHC 3QEGL 2F8OA 3NN8B 5SWQB 1KXVC 5IF0B 1K3ZA 2F9BT 4KDTC 3DSFL 4HBQA 3SEPA 4M4PA 1JN6B 1G84A 3I6KB 4JZOA 4BYHA 1OPGH 4YIQA 2OR7A 4PP2A 3SKJL 3WIHA 1P84K 4FQIL 4FTVA 2DIBA 5AUMA 2BVOA 2XY2A 1KOAA 1NAMH 4Y4HD 3RZCB 5DFTA 2KBGA 4MMXC 4Z7QF 2R0LL 4YBLC 4Y4FB 3MRKB 1X5XA 5EUOE 2W07A 2PW1B 5DTFA 1NEZB 2QQLH 3T09A 4JY6A 2CGRL 4L5FL 1W72H 4M7JL 5IR1A 4WFED 3QR2A 1MHPH 3X17A 3X12A 4N0YH 3P3YA 2DQUL 1AKJA 1WWBX 3LN4A 5LKNA 3QEUA 3PXHA 1MCSA 3S98A 3CH1A 3B3IA 4J12A 5CINL 3ZE2F 3JUZA 5D5MB 3E0GA 1T5XB 1UM4H 4YQXL 4AEFA 1JE6A 2DJUA 3M1BA 3ELAT 3KPTA 1ZA3A 2CLZA 3LS4L 2W65B 1MFBL 1LO2H 1YDPB 1ZAGA 2HKHL 3T4YA 5C86A 4MX7B 4P3CH 4XWOD 3DX8B 1MI5E 3ILPB 4LEXH 3IAQA 1ZT1B 5DGQA 3SGEH 4E5XB 3HCVA 3QDME 2PYFB 4XTRD 1A6TA 5HGBB 4YDVB 2E5EA 2VISA 5E4EC 3VXTA 2O5ZL 3GSWA 1U8NA 3UJJL 5B4MC 4PV8B 2JIXB 3BP7B 4NO0B 4LLVA 4PG2C 2Y9RT 4U1LB 4GAGL 3VXUB 4D3CL 1N59A 1WSST 3T04D 2VZSA 2PR4L 4OCXL 3MJ8B 1NLBH 4HUMB 1AD0A 1P1ZA 2YPLE 2DQEH 4NM4L 2XRAL 4GQPH 1LO5A 4EI5D 1YMHA 2IAMD 4OF7A 1CU4L 4KJYB 3O11B 5I1HH 1FNEA 1B4RA 5GS0C 4DKEL 5C0EA 2FJFB 3QXDB 3TA3B 5C0GA 4XVSH 1N0XL 3QULA 2N7AA 4RFOL 5HHME 1DSFH 3O3AA 3F12B 1FLRL 1KV3A 3HZVB 4XPBH 4F2MA 3HC3H 3OB0K 2XICA 3L7FA 1D5ZB 2GJ6A 2NY4B 3GSVA 3TYGL 1SMOA 1MCHA 4A6YH 4HWZB 1QSZA 4MA7H 3DVNA 1ZTXH 4QCIA 2XZZA 1WFTA 4NP4L 2AJ3B 2G75A 4KTDH 3BUYB 5CP3H 4K2UL 4DQOL 2B39A 1MCKA 3MV01 1YA5A 4MAYB 2MOVA 2AK4B 3CVIL 4GRMA 1BIIA 3DECA 3MV8D 2BY1A 2FX7L 2IQ9L 3CLFH 3FQXB 4TN9A 1U8IA 3SPVB 5DHYA 4ZUWA 3MLXL 1MVUB 2B4CC 1LO0L 3AFLA 3ZYJA 4JREC 4FRWA 4HGWA 2R9HC 3LMJH 3QQ3A 1QACA 5DK0B 1I85C 4GMSH 3OR6A 5LAXA 2F53E 4J3XA 5MEOA 1SJVA 4PRHD 1XH3A 3LHPH 3BEWB 3HS0B 5KBNC 2BX5A 3ARDC 3D6GA 1KN2H 4EN3D 3MLVL 1KCUH 4P46A 4YH6A 4RMQA 1P5VA 4Z7OE 3IGAB 4U0RC 2QSVA 3AU1A 2X4UA 3G6JE 3TT1H 5I19L 1UXSB 5D2NC 4JO4H 4JFDD 4FFZL 5DEGB 4DGYL 3UZVB 3ARGB 5L2JA 3OV6A 2H9GB 1LNUB 5IBUG 1ZXQA 1FGVH 1J8KA 4QRRA 3EBAA 3QHFH 4OBRA 4LCWB 3ARPA 1XF2A 4JM2F 4NQCE 1SYVA 2BVEA 2I07B 1ZA6B 3J7HA 4RAVB 1CL7H 4WU5A 4G6JL 1JNHB 3FB5B 4J3OC 4LU5H 5EU4A 3AMLA 3S97C 1KXQE 4HXAH 4RFEA 3RY4A 4KQ4L 3D3VE 5DUML 2A83B 5EUOF 1VFOA 2NLJA 2HFEA 1ZHKB 4ONGL 5DRNA 5BZWA 2JELH 4LFHG 4R8WL 1XR9A 4HMDA 3CFCH 2YRPA 1CLYL 4PJDB 4FA8A 1IGCH 4HUUB 2AKRA 2RB8A 1A6VH 4KI1A 4MQSB 1TITA 4J3SA 5F96L 3DRQB 3PABB 2NXYB 3QIBA 3HMWL 4EUPG 1WT5C 1R5IB 2FEEL 4X6FB 4AIZB 2VMFA 3G08B 3RTQB 1JNLL 3DV4A 2D0FA 2Y36L 3MLZL 1IGTB 5DK2B 4AENA 5CCKH 4G7VL 2A6JA 1FFNA 4JJ5B 4NPYA 4P23C 2ENYA 3U9UB 1I8MB 4BSJA 4UAOB 5BW7C 4FQLH 1JGEB 1YEFH 3V0AC 1NMAH 4PFEA 2R69H 4R4FH 4MA3B 3O0RH 4X8JB 4XHQA 1B2WL 3G5XA 4JFZH 4L9LB 2O61B 1OLLA 1YEKH 4R4NC 1M6OA 5C0BB 1X6NA 4XCNA 1ZLWK 4KK5D 3BPNC 4WO4D 2NTSP 5DC0A 4PGZA 5CFHA 3CC5B 1IGIH 1WBXB 1HHKB 3HI1A 1Z9SA 3D1MC 3VCLB 4L8SA 5CEXA 5FYJD 2EYRA 3DXAA 4HFWB 1R3LA 1E4WL 2HG5B 5BRZD 4QYOA 5HHXL 1IVLA 5E00A 3VXRA 1BZ9A 3WFBL 2DTMH 5IWLA 1G6RL 4EBQH 4TULH 3ARRA 1OPGL 1NDGA 3WN5A 3A0OA 2VAAB 2DQFA 4JQVC 3RWFA 1IT9H 3RL2B 3MRHB 3IJHB 1QR1B 2HLAB 5D1QC 3WEXA 4TVSa 1PLGH 3QUZD 2AJYL 5E1AA 1V3LA 3DRTA 4H5SA 4KZDH 4I3RL 3QQNA 3LN5A 2AGJL 1QHPA 3C60C 4WFFE 5I73C 1ZANH 2ADGB 4NC2B 3QWRD 2OL3A 4C4KT 2A9NH 3AVEA 5HYQB 4JGUA 1TETH 3RVUC 3S4SG 2BVTA 2Y07H 5F7DA 2VL5B 1MFCL 2R2BB 1Q72L 3RA7L 2IBGA 5I8CB 3F7VB 2D31B 3ULVE 5E8PA 4PREA 5ADPH 2R1YA 4HT1L 2H32A 4X7FC 1UM4L 4BSWB 2X4RA 4ZQKA 4U1GB 5M95B 4LLYB 4G8GE 4PJ8D 4RMRA 5IVXE 1B0RA 3QUYA 4U49A 1LO2L 1QSFE 4DOHB 4V1DB 2P45B 3MO1A 2ZNWA 3UTPE 2R0KL 4G43B 4IRJC 1PEZA 4X6DA 3I6LE 2VKXA 1L7TH 4U1KA 3FCTA 4MJ2A 3I75A 4P5TC 2D7QA 2P49B 4NC1C 2YPKB 2QR0A 2BY2A 5TGBA 3FT2A 1XEDA 4NM8H 1DBJL 3LH2L 4P3DA 2Z9TA 4PRPB 3LSOA 4WUUB 3U4EB 3FRPA 4V2CB 2OCFD 3TLRA 2UUDK 1FYTB 3RWHB 2F54D 2CO6B 2NX5A 3PHQB 3GBNH 4L1HA 5JQ6H 3QPQD 1T7WA 4QTHB 5C2BH 3V6BR 8FABA 2VB5A 3HE7C 1GZPA 3DMMB 1QRND 2YA2A 3F7PC 4RQQB 4XCFH 2W0PA 4Z7OF 5CJ5A 3L3JA 2F74A 4D8PB 3D5OF 3G6JF 1CTNA 4JKWA 4X8XA 5FUCE 5CAYB 1KN4H 2EH7H 1XCTB 5CLTA 3RQ3A 2DQEL 4F8QA 1RK0A 3ALPA 2VZUA 3SBWC 1OT2A 5IFJA 1QBBA 4N8VB 5FUZH 2EYTB 4Y5VA 5ESQB 2Y5TA 4P48A 4WWKA 4JAMA 1X5LA 4W4OA 4B7LA 2BCKA 5HYJD 5ICZA 4XPBL 1YNTA 2A9ML 1K2DB 3O6LH 3GM8A 3BH9A 4HBCH 5GSRA 2UVEA 3VW3L 4OZIA 1S7QB 3BKMH 4MA7L 4K3HA 1ZTXL 4Z77A 4FP8H 1LILA 4KTDL 1BD2E 5TE6H 4FNLH 4KK9C 1TJIH 1XGTA 3IJSB 5I1AA 2QQNH 3TIDB 4NRZA 4AEHH 1NL0L 3OKKA 2HMIC 5JHDD 1T80A 3NBNA 1NEZG 1I4FB 4XPAH 5IJKA 1M05A 4QHUB 3DX7B 5JLZB 3K8KA 2MKWA 4GLRI 2AJVH 3SCMD 3CLFL 2IALB 3WO4C 3O8XA 2HFTA 1YPZA 3ARSA 1G7LB 3W11D 4HS8H 3UTSB 2EICA 3NA4A 5LWYH 1CXEA 3E3QC 4K23H 4GBXC 4G42B 5EC1A 3QEQD 2IFFH 1INQB 3W2DL 4GMSL 2FZ3A 2GY5A 5DJXB 3KPMA 3MBXL 3GK8L 2EE2A 4G9FB 4ZO6A 3MA9H 4ISVB 4YJZL 5EZJA 4YDKH 3LHPL 3O81A 3RWIB 4NNPL 4YO0B 4M8QB 5EBWB 4XAWL 3QIWD 2VLMD 5F9OH 3MMEA 2CRIA 1QR4A 4I3SH 4IJ3B 4XVUC 5I1LA 2FATH 4UB0H 5JOPD 2HLFC 2DQDH 3BGMB 4JO4L 4M6NH 4OF8A 1DUYB 4KHTL 2VWEC 1Z0NA 1F58H 2CIKB 4OD1L 3STZA 4BZ1H 1IC4L 4OFPA 4NQDB 3AGVA 4XC1H 2AEWA 3LY6A 4YGAB 1YJDL 5TDPB 3A67H 2Z0BA 2AJXH 3KPRE 4F37K 2BVQA 1X4YA 3MLWH 4X80H 3S6CA 3QO1A 3MUZ1 5DJDA 3WNOA 1RQ5A 3LKQB 3QNYB 4JDTH 4ONFL 1RZKL 4CMMB 4JFFE 1IL1A 2R0ZH 5TH2B 1E27A 1CD9B 1U36A 3ESUF 1QFUL 2GT9A 5JDJA 2X4SA 1BF8A 1WISA 2BERA 3RWGB 2X4OB 2XN9B 1MF2H 3CFCL 1CFBA 1VB9A 3MNWA 1HXMA 1A6VL 4G7YH 2PYEB 3ULVF 2VQTA 1CF8H 1HHGA 4S2SB 1LEGB 3WFDH 4IMLB 1PG7W 2GFBA 2ATPB 1MFAL 5DJAA 5H37G 1NMCB 5CCKL 2JJWA 2H3NB 1BECA 4WI3A 5IVXF 5IOPA 5IMLB 4PJHA 5I17A 1GGIL 1JNNL 2ICES 4S1DC 1G6RA 1EFQA 3FFDA 1J5OH 5J56B 1U8LB 3FO2B 3EYSH 4JFZL 1YEKL 4M02A 1NCDL 3SDYL 5ISZD 4YBHA 3C5ZB 4HQQH 3U46B 2A2QT 4P57A 1ZHNB 2J4WH 2JJTC 4UINL 5JXEA 4PRNA 1J1OL 4YPGA 2X70A 1T3FB 2NY3D 4ELKB 2FIKB 4LF3A 5EZIH 4PLJD 3HI5H 3OR7B 4NOBA 1RJYA 4EBQL 1ED3B 3VXSE 4N9GB 1T2QH 1P4IL 4HULB 1SQ2N 2VDRH 3BT2L 3E8UH 3AAZB 1TNNA 4YDIH 5BS0E 1IT9L 3GMNB 3C8KB 4M3KB 3BZDA 3EFFA 1DP0A 5DZOA 1OTSD 3PXJA 2JB6A 3MV9D 4JM2B 2ZG3A 2VLJD 4NKDA 5CMAB 3MJ7A 1MVFA 3EO1A 5IV2A 5DWUH 5GRWA 5JW4R 3HE6D 4K94L 3WIIH 1UZ8B 3OTTA 4XZUB 3RGVD 4EQ3A 1IKFH 1ZANL 1G0DA 1ND0A 2IJ0C 1DEDA 4DGVH 2QQKL 3BQUA 1MCLA 4FFVC 3GSNH 1A6ZB 2A9NL 5EUOB 4AYFA 2Q86B 4OGXH 2Y07L 4ZS7H 1CE6A 5CEYB 4YPJA 3EO0A 3MNZB 3DUSA 4UV4L 1UACL 4LLWB 4NZRH 3BGAA 2Z31B 3D25A 1YY8B 3PGDB 4OZ4B 1ROWA 3MZTA 3QHZH 4OIIH 4GG6A 2PO6D 2E6PA 3BRFA 2QHRL 1MFNA 2YWZA 1AQDA 3B5HA 4HAGA 4LHUD 2DWEB 3VGGA 1N8ZA 3SDDA 1D9KB 3KYOB 1L7TL 5DD5H 4CL7A 5J3HD 3TBVB 5HYEA 3SJVB 5LGHL 3RVTC 4LLMA 3OX8B 5DRXB 3RAJH 4C83A 3KNBA 1LE5B 5IP4A 1NAKL 4S0TD 1KCSL 2BJMH 5I6XB 4EDXB 2ZUSA 4JFOA 1Q9LB 2X4NB 2RAMA 1CS6A 1HXYA 3V52L 3QDMB 5CJXC 5GGUA 1F3JB 3CSGA 3GBNL 3HZKB 3UROR 5JQ6L 4Z8FL 4ZFOB 4JRYE 5E7FA 4CU8A 5KVEH 5C0AE 4ZAKA 1NH6A 5IGXL 4H1LH 3SDCD 3T0BA 3FONA 1BX2B 1KIRA 4RISL 5EULV 3BDBA 5F9AC 3VA6A 3U6RB 1T5WB 4UU9A 3D39B 4MD5A 4JN1L 2P5WA 4OFVA 4KY1H 4QTIH 2V2WA 4YEFA 4PGBB 3OJMB 1EX0A 3O2DH 3H9SA 4Y5XB 1H5BB 2BNQE 3FFCE 4HIXL 3TV3H 2EH7L 1HE7A 3WKNA 5CD3B 3P4MA 5C09E 3WD5H 5IEKB 4JR9L 2XQYG 2IMMA 5CP3A 3OXRA 3GHBH 5D7LA 3HPLA 3MLTA 3L1OL 2YPLB 5A43C 1UA6L 1A6WH 5IEHA 5F7YC 2VABA 4M8VA 1BLNA 5DMGD 5EIVA 4YXHH 2V9TA 3TBWA 3O6LL 3VD7A 4HBCL 2D0GA 1PEWA 5IFHH 5FKAB 5FM4A 4HWEL 3BKML 4K71B 5EA0L 3I6GA 3ZYZA 1I1AB 5T1MA 3K8MA 3QAZB 4FNLL 4KKCD 3SO5A 2WMPA 4N0UA 1WZMA 5CP7B 1CG9B 4IRSB 2IH1A 2HKFL 1IC7H 4JRXA 2QKIB 4QWWD 3PWVB 1HQ4B 4XPAL 1HHIB 3E2HB 3BPCA 1LEIA 1OARH 5DR5L 4NNXA 5IG7B 4NSKB 5DI8B 3C9NA 4HS8L 4LRNL 4LHJB 5HDQL 4WV1B 2CR6A 4UDTA 5E2WH 4MA1B 3BE1H 4UMGA 1VGEH 5HI5C 3QFDA 3CXDH 1PDKA 4ZDHB 1F90H 1MJJB 4FHBD 4HZAA 3MA9L 2YK1H 1MREL 5J57B 4PJIA 2ATKB 3MRLA 4NCDA 4ELMA 1HQRA 1UJ3B 2NY6B 1FZMA 3BYYA 4MA8H 2C7UB 4X9HA 4I3SL 3PWJA 3JWOL 4LSRL 4UB0L 5T5NF 4U3HA 1DLHB 3G9AB 1JK8B 4XX1G 4U05A 4IHOB 3T0EE 4WHTB 2NY2B 3G6JB 1Q0XH 1TENA 3WLBB 3BKJH 5JIPA 4U3CA 4PJCE 2AV7B 3PUCA 1A2YB 3V6OE 5KSVB 2X4PB 5GS0H 3CFDB 1KB5B 3LPFA 2AJXL 1N6VA 1DBMH 5AD0B 3KLHC 3NFSH 3MLWL 4Y8DC 1A9EB 3AB0B 3IFNH 4NQCB 5EU7E 3D85D 5H37H 1JF6A 2MPAL 1XF4A 3N9GH 1XGQA 5DD3H 1QTYT 4J1UA 4RGOH 2HWZH 4QRQB 8CGTA 4DEPC 3D3VB 3TF7C 3PWNB 4JPWH 2R23B 3O4LE 4JZJB 3RNKA 2Z8RA 3TZVD 2ZSVB 1J8HA 5DLML 4APQA 5T3XH 5IMKB 2B5IC 3UXFA 4N8VG 3SGDH 5H94A 3JV6B 4FN0A 1CF8L 3RZWA 1J8HD 5IJVA 1RU9H 3WFDL 3WYRA 3KYAA 4YHPB 3P30L 2B4CH 3P77A 1ZVSB 3LQMA 5BMFH 5FYKH 4ZD3H 1ZK9A 2QBWA 3W9DA 3F5WA 5D7SL 1NKOA 5E1HB 3DURA 3OXSB 4JPKH 3HZMB 4KUCF 2R2HB 5GPRA 4YZFE 1FVEA 4Y1AD 2DQJH 1U3HD 5T1KD 4OSUH 4XPFL 2V7HA 3P11L 4M7LL 4NGHL 3GSXB 4R7NB 4HQQL 25C8H 5GISH 3Q5TA 3HC0A 3IFOA 3VRLE 4ZUVA 1JI1A 3VD3A 3QIUB 4ZXBB 4FQ1H 1VENA 1AD9A 4HJGA 2ID5A 5CEZE 3CK0L 3PF2A 4NUJA 3UX9B 4Z7NF 3G5ZB 2AXFB 5EZIL 1NQBA 5SV4A 3HI5L 3VDBA 3RX5A 4KKLD 2LFGA 3RPIB 3RWCA 2ENSA 4XP5H 3V5KB 3E8UL 2Q76A 3RGHA 3TN0A 3IDJA 4F7CB 2GKIA 1JTOA 4U6VL 3LB6D 1PKQE 3L5JA 5FYLH 1G7JB 2P46B 3ARBC 4GRLC 1L7IH 4FXKB 4YHYC 4PUBH 4BFEA 3G04B 3TPUB 3O41A 3KS0H 3UYPA 5DWUL 2R2EA 3VG0H 4X6CE 5C07E 4JFYA 1F6AB 4K9EC 4J3UA 3WUZA 1I9IH 1TQBB 3GNMH 1PZ5B 1TVHA 3ULSA 4KRNA 1G1YA 4OGXL 4ZS7L 2ZPKL 5AWNL 2Q7YB 4JG0L 2EDKA 4FQJH 3D0VA 4WJ5B 3QUXB 3MGOA 4GW5A 5A3ID 1XIWD 2VAJA 1QSEA 1U8QB 4PJBE 3CDCA 2VJXA 5DRZA 5CGYC 3X14B 1W8OA 4MZ3A 5D6DC 3TJEH 5HHQA 1XMWA 5IKCA 2LU3A 1M4KA 5CZXD 1FAIH 5JW4N 1JGUH 5IVXB 5JW5B 2A38A 4LL9A 3QWOA 1AHWA 7FABL 2VDKH 4LQ1A 1CI5A 4DUVA 3MRQB 5TPWL 1JF1A 2DN7A 2WUCL 1BQLH 3DUHA 5KSBA 5FGBA 1JPTL 5BVJA 4M00A 3QDJD 1JMZA 2EECA 3MRPA 3QQ9D 5ICYA 3CFJA 5EBLB 5EO0B 1RZ8A 1NDMA 3IDUA 1SYSA 5DJ0A 4PG9B 4UT7H 4XP4H 3L3OA 3MRFA 3QNZA 2ICWB 2D7OA 2D03L 3SOBL 2VLLB 1OAZL 1S7UB 2PXYA 1QLRA 4OBSA 1YMMB 4KY1L 2EZ0C 1GZQB 4QTIL 5JA9A 2VR9A 5DSCB 2A74B 3IDIB 1S7TB 4WY7H 3EHBD 4OFDA 3HG1E 5HI4D 2VXTH 5JPNB 4RGNB 1XGRB 1FH5H 4MNGB 1H3UA 4PJCF 3CJJA 4U1MB 4K55A 5DJ2A 4HKBB 2A6IB 3CSYA 4JFXB 5C6WH 4L4JA 1A6WL 3HPJA 4MCZB 2AEQH 2OXHA 4LDEB 5H35A 3HZYB 4R96A 1JGLH 4WRLA 3GIZL 3UYRH 1ZGLA 4MMZC 4U6XB 3EZ8A 2CDFA 3AXLB 1QBLH 3ARUA 4GS7C 3SKNA 3DGGA 3G5YB 5CIPB 3PL6B 4P9HC 1CLZH 3WE6A 3LCYA 1UENA 1G9EA 1A6AB 3KPQB 3ZL4L 4HKZB 3BHBB 3JWDC 1KUMA 4CVZA 1IC7L 4WW2A 3PE9A 1OTUD 1BFSA 1XF3B 5LQBH 1BZ7B 1JWMA 3S8WA 1HIMH 4JHAL 3MJ9L 5DEFB 1H3PL 4XPHL 2DLFL 1A7PH 3T8XB 4PB9H 1M71A 4FMFA 5GIRB 1U91A 5HDOA 4CRPA 2ICWI 3NZHL 3FO9B 2VSCA 3CXDL 4Y4KC 3REWB 3RI5F 1TNMA 3BW9B 3CX2A 3HMXL 4KZEL 2XA3A 4ALAH 1NC4A 1LP9A 2EKSB 3C09C 1UZ6E 4LFHD 5KW9H 5E7BA 4YBQC 2WBJA 4YZFF 2D3VA 5ID1A 4Z0XA 2DYPA 3GJFA 4EUPA 4YAQA 2OZ4H 4Y8AA 3O9WB 4YE4L 5IIEB 5BRZE 4PGJA 1VKXB 5D71H 4O2CB 2ZCKL 3L5WB 4H25B 2B1AL 5F7EL 1RHHB 4PS4H 3WHE1 3IFLL 4GMTH 5DEZA 4XNZB 4ACPA 1MRDH 5CSBA 5CBEB 4Z7WB 3DV6B 5D7KE 2ZOKB 3MBED 3TYFB 5GS0L 2PTTB 4MJIA 3W0WD 1MCBA 1NGWA 3P4OA 4K7PL 1AO7A 1DBML 2LV4A 3BZFA 4BJLA 2NY5L 4GW4B 4O02H 1VGKB 4HC1H 5FO9A 3IFNL 1PSKL 5F88A 4F15B 1FCGA 1QO3B 3ALWA 1TPXB 4ODSH 4E42A 1JV5A 2YEZB 5EU3B 2OMBA 4OZHA 4G3YH 3H6JA 5DD3L 2JB5H 4MXQD 2HWZL 3JVGC 3EFDL 1H0DB 1F4WH 5B22A 4JPWL 2NTFB 3O3DA 1CBVH 4YUEL 1OGAD 1U8JB 3WXWL 4MVBD 2VXVL 3L3HB 3EJZD 3IU4H 2XZAL 3UJIH 4X5WB 4EXKA 2YZ8A 3I9GH 3TWCH 5ETUB 4H88H 2ZOLB 1GOFA 3V6ZA 1T04B 2R1XA 2HT2D 1NGZB 4PJBF 2EE9A 1N7MH 5FYKL 1SEQL 4RBPH 1X3DA 4JEGB 4JHBA 5FECB 4HDIA 3ZSSA 3WSQL 2BNUB 4C56D 1HDMB 1GHFH 5FYJU 4GG8B 5EOCH 4NQSA 2NR6D 5D7IE 1MIML 2VXSL 2DQJL 5AAWA 4OSUL 1MJUH 5HSFA 4GRWH 1S7WA 4IS6A 3OAUL 1T1WB 4I0PA 4NCC1 3FOLB 5DFVC 3TO4D 3VFNA 1JPST 4KK6C 5EC2B 4JFEB 5L2KB 4LIQE 1RUPH 2ZZUT 4WEBH 1QPPA 4P5KA 4OFYA 4N0CC 1MQKL 4G5ZH 1YEIH 4JRWA 1ZEAL 4DW2H 4LLAA 5JORB 3CU7A 5EORH 3P9WB 4PJAA 1ZV5A 2ZCHL 5GRJL 3Q48A 2H26B 3FJTA 1OCWH 3AREC 5KJRL 1RK1B 3VXSB 4RNRA 1IKNA 4WHYG 1PYWA 1X44A 1UB5B 1E4XL 4Q74A 5MEPB 5K59F 5JUEL 2BNRB 3VG0L 4L8DA 3MRBA 4BH8B 2H6PA 4JQIH 1KYOK 4HWBH 4FQHA 3GNML 1IAIH 4LCCC 5D1ZD 3RWJA 2LABA 4LLDA 3U9PL 2VDOH 4J4PC 4BFIA 5IQ9A 2VLRE 1WBYA 4MNQA 5EZOL 3T2NL 4CNIA 1LK3L 4JFHD 4XNUL 3L3KA 3M17B 3EYUH 3QZWB 5KTEL 2O26U 1U92B 2DF3A 3IDYB 3WFEL 3EOTL 3NN8A 1MCWM 5SWQA 1RZ7L 3BKYH 1FAIL 3T0VA 4P2RD 32C2B 1JN6A 4DFHA 1A9BB 3I6KA 3MV7E 1BVLB 3OKEB 5DD6B 3GRWH 4X4MA 4Y0GA 1U58B 1ZMYA 1XF5B 1S9WB 2C3WA 1BQLL 3L9RA 3RZCA 2RJMA 1MWAH 2P5EB 1OAQH 4Y4FA 3MRKA 4EOWL 3V0WH 2PW1A 1S3KL 2W60B 4YXKL 1NEZA 3EO9L 1XZ0B 4R0LB 4UT7L 1SVCP 2YMXH 5JOPE 5FGSA 5IB3A 1QFWH 5GSVB 3SE3A 4JRYB 4WTZA 1NFDF 4MDIB 4QXTB 3OSKA 2DI8A 1KYOJ 5HVHB 4L29B 1I3GL 2PTVA 2M8XA 1FRGL 3BXNB 3GMLB 2FD6H 5D5MA 4JKKA 2YOCA 2VXTL 1T5XA 4PJ5D 1CDGA 1FH5L 5C0RL 4IOSD 1ZS8B 3CDGB 3HUJF 2W65A 1ACYH 1UEYA 2VE6B 5C09B 2XNAB 1MJ8H 4KV5F 2AEQL 3MNVB 1PAMA 2IPTL 4OD2B 5JIKA 3FT4B 3MJ9A 4MX7A 4JO3L 1GCFA 4M61B 3DX8A 4R6UA 4DUWA 2YS4A 2UWEF 1QBLL 2VH5L 3ILPA 4PRAB 5BJTB 3TFKC 1ZT1A 1L0YA 2B7DT 1UKTA 1MEXL 2QHLA 4E5XA 15C8L 1E4KA 5DVMA 1CLZL 2D7NA 2X1XR 5GGTL 2PYFA 3SGKC 2CKBH 3HMXA 5HGBA 3HNSH 2CUMA 3IETB 2KUTA 5JNYB 1EIBA 2VZOA 4M7KH 2EYSB 3S36L 4YDVA 4D9RD 4DKFL 1VEMA 1OWWA 3VGDA 4RAHA 5E5UB 2V2TB 5I0DA 2OTWB 1D6VL 5LQBL 4PV8A 2IANB 3OF6A 2JIXA 1U8HA 3V95A 3BP7A 1V7NL 1WLHA 2IADB 4GAFB 1TTGA 4NO0A 4EIZC 5B4MD 4U1LA 1KCRL 3VXUA 3R1GH 1SVZA 4XRCB 1A7PL 3H7LA 5CBAB 4PB9L 4YR6B 3TT3H 2WIIB 2WBWB 3GSRB 2ZUXA 4XI5C 3MJ8A 1KENL 1DN0B 3TC9A 1EUTA 3NPSB 4AG4L 2P47B 3SDAC 5ISZE 2DWDB 1UWEH 5KW9L 4WW1B 1V5JA 4OFKA 1CT8A 3O11A 4I13B 3QFJE 2R4RH 4HW6A 1A7OL 3QXDA 3TA3A 2OZ4L 4D9QD 1IFHH 1JZ4A 2IPKB 4M7ZB 2E7LA 3OZ9H 5GS0D 3LEVL 2AQ2A 3GMPB 2NY0B 3Q1SL 4JVPA 5D7JC 3RDTB 3F12A 3SY0B 3HZVA 4P2QD 4DN3H 3QISA 1D5ZA 1UCBH 2HRLA 3IS0X 1T1ZA 4PRDB 4HWZA 4PS4L 3DGCR 4XBGB 3CZJA 4GMTL 3TVMC 3C87A 4J3WA 3D87B 1RIUL 3F58H 2ZSWB 4DTGH 2X4QB 3ZDXE 2Z8VC 5JHLH 3WNNA 2YXFA 4PJCB 3T0EC 2DLIA 3WCYA 4PTTB 4MAYA 4HF5H 2X89A 5TDNB 5EPMB 2AK4A 4Y4HB 5GS1B 3V6OC 3FQXA 3SPVA 5HGAB 4ODUB 1YEGL 1PX3A 1F4WL 5TFSH 5EWIL 4KI5E 3K0WA 5FYKD 1CBVL 1EJOL 5DK0A 4KJWC 3IS1X 2R9HD 5DTFB 2ZG2A 4KMQA 3BEWA 3IU4L 4U7KA 3WNLA 2E7CA 3HS0A 4E0RB 1JYWA 3HR5B 3I9GL 2JF1A 3RIAF 4X7DC 3N1PC 5CWSB 1WWWX 2PKDA 3IGAA 2GQHA 3LN4B 3RKDC 4WDIB 1N7ML 1UXSA 1BF2A 2Q6WB 1S78C 3CGTA 1IAIM 3ARGA 3GUTB 1Z3GH 2H9GA 1LNUA 5C08E 5EOCL 3U1SL 1NLDL 5DZNA 1WGOA 2KQMA 2UZIH 1P7HL 4LCWA 1UVQB 4ZO9A 5TQ2H 4XMKL 4B5EA 4OLWL 4OCRL 2I07A 1ZA6A 4RAVA 2FHFA 3MR9B 1JNHA 2FSEB 2XTJC 3GHEL 3FB5A 4Z78B 5E8OB 4WEBL 2J5LC 2FX8H 4W6WB 3QI9C 4L4TA 4Q9RL 1UWGL 5FYLD 4G5ZL 2A83A 4BSVB 1CXIA 1ZHKA 2VC2L 4DW2L 1UM6H 4UBDC 4L4TD 4MLIA 1OT1A 4PJDA 5I1CL 4F33B 4CN4A 4HUUA 4CU7A 3QUMH 4M9PA 4S1RH 2DQHL 1YEDB 3GIVB 2X6MA 4LEOB 3DRQA 3PABA 5I9QC 4IIQB 3TNMB 3LZFL 1LO4L 1R5IA 3QCVL 4EI5B 1TQCB 4X6FA 2IAMB 4L8BB 4AIZA 3G08A 3RTQA 3SHSA 2CSPA 1IGTA 5DK2A 3A6OA 2Q8BL 4MHHG 4JJ5A 1T0MB 2N4IA 3CAFA 4MDJA 2HTLC 3U9UA 1R3IL 4F7PB 1I8MA 1JGEA 3U30B 4P23D 1FE8H 1MUJB 4QHKI 2AQ3A 4MA3A 5JR1H 2OI9B 4X8JA 5FO7B 1CIDA 1EK3A 1TXKA 2RCSL 3PQYE 4L9LA 5C0GB 2O61A 1A22B 4LCIH 3LKRB 4NQUA 3EYUL 2EEBA 4R4ND 1FFPB 3CC5A 1WBXA 3VCLA 1I9RH 1ADQL 1JWSB 5BCAA 2CJUH 4HFWA 5SV3A 3DVNB 2HG5A 4PJBB 4IDLA 2G75B 2QSCL 5SWSE 4RGMB 3MV8B 4JQVA 3HB3C 4G6AC 5GHWH 3RVVC 4LVOC 2VAAA 4I18C 3CMGA 4LPCA 3RL2A 3MRHA 2XA8L 1IEBB 3IJHA 1QR1A 3O4OB 5I66B 2HLAA 4XP6L 3GI9H 1U8IB 4MS8C 3CZFA 1MAML 3DSNA 5D1QD 3L6FB 4RMWA 3WS6C 5I74B 5DJCB 1TCRB 3UTZB 3VFPB 5J8OA 3SGJC 4PRHB 3GMMB 5I2IA 1J12A 3MXVH 2ADGA 4EVNB 2LAAA 3C60D 4RWHA 5DQDL 5ITFB 4EN3B 2YMXL 2XPGB 4ZOCA 5CUSL 5HYQA 1K8IB 1QFWL 4LSTH 3NCJH 2VL5A 1R5WB 3BN3B 4L8CB 3RVUD 3U0PB 4LSUH 5I8CA 3F7VA 4JFDB 4XVTH 4ZNEE 3UTTD 2FD6L 5GGTA 4WI2A 5ACZB 3RNQB 3BSZL 3GBLA 2LVCA 4BSWA 1WAAE 5E08L 2FEDC 4LLYA 3HHRB 4K9EH 1A1NB 5JIIA 1DQLL 3ME0A 4UZGA 3EDJA 4V1DA 4OUUB 4G43A 5DMKB 1RZGA 2BK8A 2AEPH 1QFPA 4IRJD 2BHUA 5DUPH 1AGFB 4FXGA 5EG6C 3S37H 5EH1A 4HSQA 3V0VB 4OGZA 2D7MA 2EE3A 4P5TD 2YPKA 4OQTH 4E41D 1F4AA 1C5BH 5K9JH 2CKBL 2IH3B 1AGDB 2AEIT 5KANI 4Z9KB 1DVFA 4LLQB 4PRPA 4WUUA 3U4EA 1IZJA 2NLJB 4WFHD 3OB0H 5D6CB 3RWHA 1P9MC 1HKLH 4O9HL 4OLEA 4QTHA 3KPSE 1XGYH 5GRUH 5J89A 1DVFD 4HJ0C 3L3DA 3DMMA 4WUUD 5JMOC 4X98B 1AXIB 3MLSH 3R0NA 1DTUA 3BX7C 3HE7D 3RP1A 4OLXH 4D8PA 3JV4B 5I0ZA 2PNDA 1XCTA 1FNLA 5EBMB 1OD7A 4M1DL 1OSPL 3QDGD 3MLUL 4N8VA 1PKOA 5F1SA 4MYWB 5C0DB 1KLGB 5ESQA 1FORL 3H7BB 4ZFOL 1YY9C 3GO1L 1RSFA 4WO4B 1CZ8L 4ZFFB 3OZ9L 4WI5A 1EBPA 2VDNL 3MLRH 4Y16C 3ES6B 2YD9A 4TVPE 3KG5A 1XR8B 4HEPG 1NFDB 2XZCL 5J9PB 5BRZB 1S7QA 1OP5K 4N8PA 5MENE 3O3BB 1AXTL 3IJSA 4O2EB 3TIDA 4KK9D 1I9JH 4Q6IC 3JWNC 3HUJB 3QUZB 1I4FA 1HWGB 2HMID 2BRRH 4QHUA 3DX7A 1A8JH 1BEYH 2IALA 4JM4H 1GOGA 2OK0H 1G7LA 4MB4A 3T3PF 4P9HH 3K81A 3UTSA 2FNBA 4LLUB 3GSUB 2UWEB 5TFSL 1L4IA 1INQA 3JWDH 5DJXA 4G9FA 4J23A 4GBXD 1QP1A 4I2XB 4ISVA 1S9VB 1WCQA 3RWIA 2A77H 4X9FA 4YO0A 1JHLL 3JTTB 5EBWA 4OZGF 4HZLB 4BZ2H 4OCYH 1EV2E 3H42L 1A5FL 3AY4A 4IDJH 4PJ8B 1ORQB 2OP4L 5MHSD 3BGMA 4XVUD 3VXQB 3IU3B 3EDKA 2YD3A 1VFMA 2F5BH 3KXFE 3SO3B 2HLFD 4RA0C 2CIKA 3NCYS 5F8QC 4N1CA 1ONQB 2E6QA 4KUZL 1W2KT 4NQDA 1U93B 3WFCH 3FL7A 5T3ZL 4NHCH 3MO1B 5TDPA 1WV7T 5F1OB 4CW1B 4S1QL 3PP3K 2SEBB 3S96B 5E9DE 5GRVK 4MD4B 1V7MH 2FX8L 2J12B 2Z35B 3LKQA 1X5HA 3QNYA 5IHUH 4CMMA 3NABH 2F54B 5TH2A 4FZEH 1I3RB 4MQ7B 1ZLWH 1UM6L 4P3DB 1HSBB 2X4OA 3RWGA 3LSOB 1T66C 2XN9A 1GGUA 1QRNB 2VQUA 4K8RC 1TLKA 3DNKA 4WI7A 8FABB 2OMNA 4DVRH 1FIGH 1KB5L 4MAUH 5IROC 4LBEB 4PTUB 5CD5C 2XT1B 4BA8A 1WTLA 2PYEA 3LDBC 2HJLB 4U6YB 2R8SH 1X5JA 1LEGA 2NY1C 1YECL 1QPXA 4IMLA 1ADQA 5HVWA 4YFEA 4HH9A 4HX1B 1WAAF 3UDWA 2BHYA 2ATPA 4X5XB 2AW2A 2H3NA 4WIQA 4WV1C 5DHVB 3M8OH 2VXQH 3ZLQC 2AJSH 4L3EA 4F9PA 4R97B 2B1HL 5BOPA 5HYJB 1KACB 3VG9B 1U8LA 1NCUA 4S1DD 3FO2A 2HH0H 1RMFH 4L3ED 1KJ2H 4HG4J 5EU6E 1CLOH 1HEZB 3C5ZA 3U46A 5E2UH 3VFWB 1FZJB 5HYSB 1ZHNA 4UV7H 4PD4K 3BH9B 1I9RL 5TQ0L 1FV1B 2QADB 5FB8B 1T3FA 4ELKA 2GSIB 4Z77B 5JHDB 2FIKA 3ECBB 1HHHB 1IRAY 4LK4A 4M5ZH 4AL8H 2DDQH 5HVGB 1GGCL 3OR7A 3TEUA 5J12C 2EDDA 4P59L 1ED3A 3SCMB 3N50A 4N9GA 4KU1A 4UILL 5CJQL 3MROB 4Y5YC 2MCPH 2Q8AL 3MACL 2X9WA 5DT1H 3OAZH 3GMNA 1FFQA 3C8KA 5I18H 4FTVE 4DN4H 1EZVY 4Q0XL 4JM2A 2V5YA 1NCBH 5CMAA 3QEQB 2ERJC 3CD4A 4OLYH 1XGPB 1UZ8A 4XZUA 1CD8A 3MXVL 1RZFH 4O5LH 1V8HA 4R90H 3FTGB 1A6ZA 2KZ1B 3QIWB 5EUOA 1I3VA 1RY7B 2Q86A 3NCJL 3U0WL 4FFVD 1MCCA 5E5MB 1XCQB 2UUDH 4QXUH 1TZHB 5CEYA 2AAVA 1T1XB 1HINL 3MNZA 4NO5B 5J7CC 4LSUL 4X5LA 3CXHK 4WFGD 4QNPE 4LLWA 1SMAA 2Z31A 1YY8A 4OZ4A 1N5YL 1HYRC 3QQ4B 3VMNA 2BY0A 2F8VA 5A2KH 2ZUWA 5C3LD 1N64H 3U7YL 3CIQA 1D9KA 1MAJA 2AEPL 3BP4B 1YEHH 3KYOA 4PD4J 4HJJH 5D96B 2P24B 2YR3A 3TBVA 4GXVL 1YQVL 1NCWH 2BFVL 4X4ZA 3SJVA 4UTAL 1JPGB 2LTQC 3LS5H 3OX8A 5DRXA 5DJDB 1LE5A 4M43L 3V79C 3RY6C 3RVTD 3CPLB 1J0HA 4EDXA 1MJ7H 1XFPA 1Q9LA 2X4NA 3VGHA 3ULVL 3QDMA 1JUFB 1F3JA 1B88A 3HZKA 3BP5B 2CMRH 4LSVH 1MI5D 2CQVA 4ZFOA 3O2WH 3EW3B 1TIUA 1KSRA 1XGYL 3GZKA 3KAAA 4ZTOH 4FZ8H 4BK5A 2K7PA 1BX2A 2IBBA 1HXMB 1U8MA 1T5WA 2Z4QB 3MRDB 3D39A 3EDFA 3X3FH 3BAEH 4NKIH 5I8KH 4WUKL 5DK3A 1CWVA 5BV7B 2C1PB 4PGBA 5F7KC 5D2LB 5FV1L 4Y5XA 5HHPB 1H5BA 4K3DL 4QKXB 5CD3A 5IEKA 1IM9D 1AFVH 3MLPA 3QT2A 4K7PX 3CFEA 2YPLA 4HIJB 3CXHJ 3UO1L 2E9JA 5ISZB 43C9A 3NH7H 4OT1H 1FC2D 3C8HA 3EOBB 4WEUD 4RIRB 4XNQB 1IGFL 4KMLB 1M1SA 2GJ6E 4R9HA 2NY3B 1NAMB 4PRBB 5I75B 1SBBA 4NFBA 3W5NA 4JG1H 1I1AA 4WEMB 2A6DB 2V9QA 3EYFB 2O93L 4YPGB 4S1SH 4XNYL 5HHMD 1RIVH 2Y06H 1CG9A 2X2YA 4IRSA 3HI6H 1CTOA 1AI1L 1W72B 4AY0A 1I9JL 2QKIA 1D5BB 3LAFA 3GSOB 3HAEG 3TNNB 3PWVA 1HQ4A 1LO3L 1EAJA 3MV9B 1BQHB 2BRRL 1HHIA 2VLJB 5L88H 1WFNA 2VDMH 1ZLSH 4A2MA 5IG7A 4NFDA 1I75A 4NSKA 5DI8A 4BH7A 2DLTA 3HE6B 3R06B 3BKCH 1JFQH 3RGVB 5IB2B 4L3CB 5JW3H 3BDYH 4NKDB 5HJ3B 5B3NA 4ZDHA 3MRJB 3ZDZF 1NC2D 3IT8D 1OQOA 1MJJA 2I25N 5HI5D 5DMJB 2FO1A 1MLCB 2ATKA 1U8PB 3U36B 1UJ3A 4KI5C 3RIFF 2OS7A 5DA4A 2C7UA 5FA3B 1IBGH 5DJYB 4YHKH 1UQSB 4F9LC 2PO6B 4O58H 4ODHL 3DUSB 4NJ9H 4QXGL 2F53D 1DLHA 4P2RE 3I50H 4M1CC 1JK8A 3CLEL 4IHOA 5C6TH 4WHTA 3WLBA 3G6JA 3H2WA 4LHUB 4RX4A 2JJSC 1MLBB 2PW2B 4JY5H 2PF6A 2AV7A 1T20B 4P2OC 1WZ1H 1A2YA 1A7QL 5KSVA 4QRRE 4NHCL 3JXAA 1EPFA 2X4PA 4XWGH 3CFDA 1KB5A 1SY6L 2R56H 1A9EA 4NQCA 3KLHD 1V7ML 4OLZL 5ALBH 1F11B 1IAKB 2F5AH 3FMGL 4TNVK 5GRXG 3KNBB 1MRFH 5CJOL 7CGTA 4D0CA 2W91A 4QRQA 4C54A 4J6RL 4KTYA 4ODTL 4UTBL 4LOUC 3D3VA 3PWNA 2R23A 3SDCB 4JZJA 1A1OB 4G6ML 3KLAB 2QLVB 2ZSVA 1I7TB 3PJSB 4ZO7A 4Z18A 2ZG1A 3QXAB 4X7CC 5IMKA 2Y6SC 1GL4B 3HTLX 4PJ5E 3WO3B 2YD5A 1FNFA 4UU9B 3JV6A 4QNPF 3ZZ1A 2WM0A 3BJLA 1Q0YL 3LRSB 3CSPA 4PJXF 4YHPA 4A6YB 1IQDB 3BDXA 2Q87A 3NIFE 1ZVSA 4ZOBA 2V2XB 2DKMA 4CGTA 3LKSA 4ZPTA 2AJSL 3SGEI 2K1MA 3ZT7A 5GQBA 1BMGA 3HZMA 4N8CH 1U42A 2R2HA 2MKLC 1SJXA 1XGUA 1IAOB 2GHWB 2M1KA 2N1KA 1KJ2L 2NMSA 3GSXA 4JJHA 4D9RE 1CICC 4R7NA 2C3GA 3VFGL 1Z5LB 2DBLH 1RUQL 3PQYB 2C3VB 3OKYA 3QIUA 4OZGB 1OOAA 2BVPB 3DXAE 3I6GB 5I71B 5T1MB 3G5ZA 1KFAL 2AXFA 1URLA 3VXRE 4AL8L 2DDQL 3KS0J 1MCIA 2CLVA 3KPPB 3RPIA 3THML 1YNLL 3V5KA 1H8OA 5DT1L 4F7CA 4Z0BL 2FHBA 4CKVX 1P5UA 2YUXA 1FO0H 1G7JA 2O5XH 5BVPH 4FXKA 3LPGA 5F8RC 3G04A 3TPUA 4OLYL 3OJVC 3ARBD 1YC7A 4K3EH 1FIEA 4GAJH 3RL1B 1EJ6A 3QFDB 2HT3C 4LMQE 3NCYP 4CAGA 1RZFL 3EGSB 3SE4C 2FO4B 3T77B 3IXAB 1PZ5A 3VWKB 2P48B 3STLB 1B4JH 5CEZH 1CGXA 2HP4A 4GKOA 3MRLB 4CN6A 2Q7YA 1VPOH 4WFFD 1DBKL 4WJ5A 4A2LA 4TOYH 3QUXA 4HIIB 5D72L 5F9WC 1JVKA 3S36X 1U8QA 1KPUB 1OLZA 1QUNA 3C6LC 3X14A 4PJFF 3LEXB 4LSQL 5T3XE 3QUXD 4S11A 1JGVH 1HILB 5HDBE 4X6DE 5IVXA 2OTUB 1OAYL 4ZTPH 3ZT5A 1QSFA 3D85B 5HVFB 3PGFL 3MOAL 4P3WA 5FDWB 1NCWL 1YEEH 1X7QB 4G8G