5J06A

Structure of the immune receptor cd33 in complex with 3'-sialyllactose
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
213
structure length
213
Chain Sequence
b'GFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myeloid cell surface antigen CD33
publication title STRUCTURE OF LIGAND BOUND CD33 RECEPTOR ASSOCIATED WITH ALZHEIMER'S DISEASE
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 48
structure length 213
sequence length 213
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j06A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j06A02
1QSFE 5IMOA 3IDUA 3KJ6H 4KJQC 5F7KC 5AUMB 3WXVL 4XBPA 3WN5C 3TBWA 2FR4B 1CI5A 1A6WH 3R1GL 4N0FB 1FVCA 4BQ6A 2EIZB 2VXTL 1FL5B 3MRHA 1WCBB 4TUJA 3AU1B 1GHFH 1WK0A 3OKDB 5GHWL 4U6HA 3Q48A 4GKNB 3QCTH 1I4FA 2X4RA 1VADA 1U8QA 5E4IA 2R0KL 1QQDB 3RL2B 4XPBL 4LEXL 1I3RA 2VLLA 4KQ4L 5DF0A 5ESAA 4TNWF 4YNYA 1ZE3C 1NEZB 4M61B 3M1BA 3KPMA 4HK0A 2YPLD 3IFNL 5DUPH 5CSGA 2UYLA 2HLAA 2ICCA 3OB0H 5C0CB 3SDDC 1Q0XH 4WY7H 2MOVA 3HNSH 3RX8A 4LAQH 4MDJA 4HJJH 4LNRB 3SDCA 4L4TB 1CQYA 5INCA 2VKWA 4OCLC 3X17A 3LN9A 3GJEB 3QUYD 5EC2B 5FM5M 1J7VR 1CXEA 2D4DA 1CDJA 2X89D 5BVPH 2YXMA 2FWOB 4FQQA 2P43B 1PZUB 2P5WD 3H9SA 4ZPVA 1JMXA 2DJUA 4ONFL 5EFIA 5GJTH 1TTUA 5IMKA 5JW5B 3HN3A 4O2EA 4V1DE 3QO0A 2E8YA 3BPCA 1INDH 3FB6A 4NZTL 3G5YB 1ZEAH 1NSNH 3REVA 1JPFA 1HH9B 3ZYZA 3VXMD 1RUML 1ULVA 5E6ZA 2YKLL 1FNLA 1WZKA 2NY3C 3NA4A 3ULUE 2FBOJ 2N7AA 4L1HA 1I1CA 1EEZA 2IG2L 2K1MA 5BCAA 4OI9A 4X80H 4HS6B 2ZKHL 4XNZC 4FNLH 1T22B 3EOAB 4L4VA 4Z7WA 1KYOJ 1FZOB 2ATKA 2JJWA 3FFDA 2YK1L 3SDAA 4NN5B 4RAHA 4NBXB 5I18H 1YEDB 3SKJL 5ICYA 5GRVK 2ESVD 1LDPH 4HUUA 3TPKA 5HGAB 2AEPH 2OR7A 2AJXL 1WBXB 4KK6C 4XI5D 1G9ML 3ELAT 4PB9H 3LB6C 3PWJB 3L7EB 3DUSA 2HT4C 2QQLH 3QIWB 3VFRA 1QOKA 4JKKA 4PJAF 3L3IB 4OGXL 3SN6N 1U8JB 3UAJD 4Y2DB 1QFOA 1MLCA 2E6JA 3GRWL 4QRRD 3W2DL 5MHSD 2I27N 3GJFK 1WFNA 3QUXA 1V05A 3HNTL 4NQDB 1LWRA 1QFHA 3ZYJA 5KSUB 4LCCA 3RIFF 2PO6B 1KTDB 4JFEA 2G9HA 5E6IB 3I50L 2XQYK 1SJHA 3MRNA 3QDAA 4KVCH 3CIQA 4ZOBA 5DJYB 1RHHA 3L95B 1K85A 3VXUE 3EBAA 5KOMC 3T65A 4G8EB 3FCTB 1ONQA 3MR9A 2FCBA 2DKUA 3H9SD 4V2BA 4OKDA 4JN1H 5HYSA 5DK3A 5IJKA 3BHBB 1I9RH 2OMBA 3G5ZB 3D25A 4GRLB 4D0DB 3PWNA 5C9KA 5AZEL 4YHIA 2Q7YA 3GKWH 4BFIB 4GAYB 2R1XB 3U1SL 4NGHH 4CMHC 2C3VB 2PW2A 3PV6A 3JUYA 5EA0H 4Z7QF 1DBBH 5BMFH 1YQ2A 5GRJH 5L0QB 1IVLA 3QDHA 1IM3B 3JWOC 2IBZX 5CJXA 4X6BA 3VRLF 1GZQA 4F7PA 3JTSA 4ZFOB 3CVHA 3KPRB 2VLKE 3QQ4A 4NQEB 5C92A 3BIKA 3V6BR 2M1KA 5GGVL 3MLTA 4J3TA 3SDAD 4JJ5B 2OI9B 5ISZD 1SYVA 1X44A 2Z8WC 2GHWB 4FS0A 4MA3A 2UWEF 1C5DA 1EXUB 1BOGB 1JZ6A 4X4XA 5CGYD 5DRXB 1C5BL 5FGSA 5FEBA 1T2QL 1U3YA 2BMKB 4OKVB 2FSEB 5HD8D 2BFVL 2PTTB 2WIIB 4DVBB 5FCUH 5C08A 4IOFD 2HJFB 4BUHA 4PLOB 4J3OC 3VFWB 4HX1A 1MCLA 2XZQH 3QUXD 2I07B 3CK0H 2VDOH 5CBEB 1CK0H 5E08L 2JB5H 1IT9H 4L8DB 5HHPB 4JFED 1EEYB 3GSRB 5ALBH 3HRZA 4J4PD 5DRWB 5KVDH 4PJDE 4MQSB 5DT1L 4OZHE 2IAMA 5E5MB 4KMLB 3GI9H 3TYFB 1MHEB 5GRUL 1F4AA 4BSWA 5E8EB 3SPVB 4AENA 2JTDA 4GG6A 4UT7H 3SDDD 1RIHL 4YBQD 4PREA 3EYSL 1YDPA 1EHNA 2YD4A 2HKHL 2RGSA 3L9RB 1UKSA 5JQ6L 3V52L 1VHPA 5I1DB 3D0LB 4KTDH 5B3NA 1XGRA 2VUYA 3MJ6A 1FFPA 5D7LE 4OT1L 1RHFA 4HLZG 3LQMA 4I0CC 5IGXH 2LVCA 3O2DL 4P3CL 3RWJA 1NAMA 4D3CH 3A6BH 2V5RA 4YHNB 2BVUA 1FPTL 1CLZL 1PVHA 2VDRL 3BUYA 4R90L 5GISH 2AK4D 4PJBF 5JUEH 3CVIL 3BKML 1I9JH 1UJTA 5JW3H 4PJFE 2AQ1A 5IB5A 5C0ND 1IAII 3HE6D 1NL0L 1JF6A 4HKBB 4P4RB 3KJ4B 1PGRB 3AAZA 3P11H 1H9VA 3EZJB 4RNRB 3KVQA 1NFDE 5FGRA 1TETL 1M4KA 4MNQA 4EDWH 3AREA 5ADPL 3MOBH 5F9OL 3QEQB 1RZGB 4UDTA 2DQIL 2YPVH 5HHME 5IB4B 3SDXE 3IDIA 4HAFA 1S7XB 5C08D 4Z7UF 2J88H 2HFFA 2QQNH 4WWKA 5MEPB 1MAML 3WFBH 3NMEA 1BJ1H 5F1OB 4KK6D 4LBEB 1SEQL 2FEDC 1HCFX 4JHWL 3LB6D 3BZ4A 4X7TB 1NCCL 2HT4D 4FFZL 4ERSL 5D2LA 3P73B 3VFSA 4YO0B 3B5TA 2IAMD 4M8QA 2EXWC 1F6AA 2NY1D 1Q9LB 1V7MH 5FM5O 1RUPH 2DI8A 5IR1B 1K6QH 2VZ1A 1XH3B 2DKMA 4WFFE 2MQCA 3ARUA 4JO4H 4M7LL 3BP4B 4BZ1H 1IEBA 4X6DB 4OCMC 1E4WL 1KB5A 1BX2A 2IFFL 1WBZB 3T4YB 2WQ8A 3JWDH 4POZC 1SM3L 4QNPF 4H20H 3IAGC 5C0BB 1FSKB 2SEBB 3MRIA 1RU9L 4ZPTA 3VWJA 4MD4B 3VI3E 3PP3H 4G9FE 4PRHB 3DMMD 1PZ5A 5CZXC 5FGBA 1WJ3A 1UVQB 2BJMH 1Q9OA 2EKJA 2OZ4H 5F3HB 5L6YL 3VGBA 3O3UN 4NFDA 1A2YA 4OFYA 5I9QC 3IKCB 4ODUA 1DEDA 3O6KL 1UJ3C 1NC2D 3OMZA 1NGPH 5C0JB 4WO4C 3U4AA 3WJJA 1DQQA 3MRRA 2R0KH 3GMNA 5D4QA 4MNQD 1KLGB 4JRXB 2YWYA 4UV4L 3VRJA 3ZKMC 1T4KB 5D7KD 1AGFA 1D7FA 5CEZL 4WI6A 4WEMB 2EDEA 3CH1B 4X5XB 4D8PB 4YDIL 3TCLB 2EYRA 4HIIA 2O61A 1LP9B 4KRMB 3RA7H 3BH8B 4J3WA 1F8TH 2F58L 5ADOH 4RQQB 2KZWA 1S7UB 3QFJE 1AY1H 1A7OL 1AJ7L 3CLFL 4OZGE 1MJ7L 5SV4A 5HTSA 5L2KB 1TQBB 1RURH 2RCSH 4HT1H 1IAIH 1UWGL 5AAWA 4HXAL 1VFBA 3MRDA 2DIBA 4Y8AA 3CJJA 4HBQA 3WD5L 3UPAA 3QWOB 1N0LA 1KCRL 5ERWA 4ONFH 4ZDHB 1R5IA 1W2KT 1ORSA 4P2OB 4K2UL 2WBKA 1BZ7A 1ZK9A 3ECBB 2E9IA 4HWZA 2MWCA 5I1AB 3Q1SL 3QDGB 3RVXC 1CLYL 1NDGA 4HFWA 3EO0A 3DYOA 2XXCB 3FQNB 5F89B 2YKLH 3LQZA 5IIEA 1LNUB 5CWSB 4HKZA 3VWJD 4DKDC 2V9TA 5AYQA 1D3CA 1RIVH 4PJ8B 1T7XA 1IGYB 2ZKHH 4LSPL 4CMMB 3DX6B 4DN4H 4M6NL 1PG7L 5BRZB 4ONHA 4M03A 3OAYH 3GMMB 4HWEH 1BD2E 1B0WA 3UDWA 1MVUA 3BZFA 3RL1B 2D7MA 5F7EH 3VFNA 3WNNA 3IDJA 4P4KA 1Z9MA 2X4TB 4M1DH 1DUYA 2AJXH 3WEXB 3LDBB 4ZUTA 1R5VB 3JV4B 1A5FL 4BH8A 1XIWD 3T2QA 2JCCE 3KPSA 3IVKB 4O58H 2I9LA 3MLXL 1WC7B 3A6OA 4IRSC 4EI5C 2AXGB 5JXEA 3QQ9C 1KXVC 4OJFL 1JK8B 5LBSL 4PJGE 1JWMB 4QO1A 3VFPB 4JG0H 3QYCA 2HJKA 3RVTD 3IXAA 3H3PL 5D70H 1A21A 4F3FB 4U7KA 4JREC 4PJ5E 5TPWL 4XH2B 5I1CL 1U3HA 3EDFA 3QI9C 4P2QA 4IIQA 5DJAA 3P4NB 3S3PA 2NPLX 2A6DA 5JZ7C 5K9OA 2Y5TB 1DUZA 5DK2A 4UQ2A 3RZCC 3MPCA 5AZEH 4WW1A 5JOEA 3BDXA 3CPLA 1OSPL 4N0UA 4MZ2A 4HZLA 2Z35A 1ROWA 3ILQC 3D6GA 3T3MF 3P9MB 5H37G 2IADB 5FO9B 2VNCA 2WWKT 3V5DB 5F7WC 4JHAL 2IAND 2NYYD 5L7XL 1UEYA 4WV1B 1WFOA 1YMMA 4HSQA 1A6UH 1WWCA 4WFHE 5C0RH 3G6JE 3FO0H 4BFGA 3B9VA 2ITDB 1JFQL 4PTUB 4XX1G 4P4KD 4O2FA 4W81A 1OQOA 2QKIA 3QRFM 1G9EA 3VXOA 1D5XA 1G7IB 1C5BH 2EDNA 1IAMA 1T2QH 1ZA6B 2X4SB 5D7JA 4A6YB 1OTUD 4YBHA 2ZUQC 3V4UL 2BFVH 1J8HA 4IOIA 2GT9A 2Z91A 4OAWA 1I8MA 4Q9RL 4L29A 3CLEH 4HC1A 3O6FA 3B5GA 5FHBH 1ZANH 5JDSA 3WSQL 3SKMB 5CD3A 1ZLUH 3H6JA 4WI2A 2HN7B 1HDMA 4WDIA 2F8OA 3BO8B 3KYNB 4CN6A 3NIGE 4JDZB 2LAAA 5DT1H 4KQ3H 1QSFA 4YEEA 4QEGA 1YEHL 2NX5D 4Y2OA 3FQTB 4OFIA 5IK3A 4YHZH 3NIFE 1U3HD 4KK5C 4OIIL 4P2QD 4JN2B 1IJ9A 2IBGA 2CDFB 3MX0A 5EPMB 5HYJB 4N8PA 5C2BH 5DVKA 4N9OB 3IFOA 2LE9A 3MUZ1 1MHHA 4XNMB 5J12C 2J8UF 5D1ZC 5JQ6H 4NQXB 3V52H 3LRSB 1XGQB 1ZSDA 2AK1H 1BJ1J 4Z7NE 4KMTH 3WLBA 1FH5L 1N7ML 5A16A 4RX4A 3QDME 3MJ8A 2PYFA 1VESA 2DLHA 3RJDA 2FDBP 4HG4K 1TVHB 1P4LB 2J3SA 2VDRH 1CLZH 4FFYH 3NAAL 3MJ9L 3TA3B 5C8JB 3I84A 4JFOA 2NY6C 3SDYL 4C54A 2Q6WA 3BKMH 3WNPA 3T1FB 1KEMH 2VUOA 1BEYL 1J1PL 3BD4A 3S5LG 5HYQB 4N1HB 4J7RA 4P5TA 5I0DA 4D0BA 2DWEA 1KTRL 1XAUA 1C5CL 1QR4A 1JYXA 2BY2A 4B0MM 3QH3B 3BPOB 3C8HA 1OCWL 5FA4B 2BOCA 1TETH 3DV6A 4XNUL 1OWWA 5J11B 1D9KA 5EWIL 3C8KA 4HIEB 5C6TL 1RZFL 4ZSOE 2GY5A 5D7JD 4LQFL 2DQIH 4PV8A 4RZCB 5DD1H 4JM2D 4QTIH 4GFTB 4DVRH 2R0ZL 4M6OL 3ZKQD 2ZUSA 5JPNB 2FJGA 3U36A 5H8DA 3QJHA 4V1DA 2VO5A 1CBVL 1MAMH 1S5HB 3MOAL 3O6FD 5FHAL 3FJTA 3H3BC 4Z0XA 5EIVA 1XCQB 4M02A 3NIDE 2XFXB 4ODWB 1JL8A 3IJYB 3SOBL 2D9QB 3P4MB 2HFEB 5CP3H 1NCCH 4KRPB 1CFBA 1TQCC 4ERSH 1KPVB 3AS1A 5B8CA 5C0AB 2DQGH 3MROB 3V0VB 4A6YH 1QSFD 4CNIA 4DCQB 1AE6L 3WIIH 4JO1H 4MNGA 5DUBA 1IC1A 2FBJL 3TJEL 4YIQA 3QQ9D 3PGDB 3QEHA 3GMPA 1EVTC 4I77H 1AR1D 3RWIB 4ZXBA 3LPGA 3C5JA 4M7LH 1KELH 1II4E 5J1TC 2MCPL 3RWGA 2AJ3B 4RGNE 1E4WH 3TBTB 5TE6H 1DQDL 5DI8B 2F53D 2OJZL 2CDEB 2VWEC 4N5UA 3KGRA 3HI1A 1SM3H 3TEUA 3QI9D 2NY2C 4JQIL 3LKPB 3MV9B 1HWGB 2FATH 1B4JH 3PE9A 4KZDL 3RTQD 1RU9H 3RFZC 2VDLL 1IGML 4EQ3A 1F13A 2R9HD 3OKLB 3S7GA 1G6RA 2NY5L 5TFSL 2YA1A 3OAUH 1HE7A 5D1XD 4L4JA 5DRZB 2O93L 3RZCD 5L6YH 4WHDA 1FNAA 4I0PA 1URLA 3MACL 2OTUA 1QBML 4G3YH 4UINL 4GXVH 4P5TD 1IFHH 4J2XA 2V2WA 1KLUB 1QTYT 3MYZA 3TT3L 1B0RB 1HQRA 3EJJX 5HJ3A 1GC1H 2XG4A 3O41A 4M7LT 3VXUA 3T09A 3IFPA 3QSKB 1CU4L 4UT9L 3VXRA 2MHAB 1A14H 5CLTA 4JM4L 1D9KD 1S9XA 4OCXH 2F19H 3STZA 1J11A 1SJXA 3CC5A 1KIRB 3OGOE 3VE0A 2DLFH 4OZIB 4K9EL 1NLDL 4V1DD 5HVHB 1WWWX 2C1OB 2X1PA 3MGTA 1AR2A 5CZKA 2FEEL 5A40E 3EGSA 3FTGB 4Y4KC 1JGDB 5EU3A 4MXQC 4HQQL 1INEL 3ULUD 1QPXA 5DD5H 1AJ7H 3CLFH 1DL7H 4AM0A 1K4DA 1EFQA 1CD1A 2VLKA 4LVHB 4O51A 4HIHB 5I74C 3UJJL 1UWGH 1D5BB 1IKNC 3T8XA 2QHLA 4ZXBD 1JN6A 4CJ1A 5AYUL 4YX2L 1U8HB 1AGEA 3SKUD 1VB9A 3IFLL 3BX7C 2QSQA 3BZDA 4FZEL 4OQTL 4ODBD 1BJ8A 3ARTA 3W9EB 5CJQH 5HVFB 3TFKD 3WFCH 2G5RA 4PYGA 1CLYH 4AH2B 4J3XA 4JAMB 3I2CL 3RKPA 3TVMB 2FHBA 2VDML 1RZ8B 4G8IA 4HGWA 4OLVL 3QHZL 3MNZA 4Z5RB 1RUQL 4M93C 5IMLA 3WJLC 1KPRB 5MEQA 2APXA 5D1ZD 4LCUA 2ZSVA 4LSPH 4R97C 4DGIH 3O9WB 1HHGA 2HT3C 2XNAB 1PG7H 4LFHG 1ZVYA 4X6CE 4I0PD 3F8UB 4KTEL 3DTXB 4M3KB 2QR0B 4HAGA 2XKNA 5I30H 4PJDA 3KLSA 2CR3A 4OZHA 1F90L 3UPCA 4HS8H 1JZ2A 3X14A 4X6FA 3VXUD 1QBLH 4PJ7B 3ES6A 4CVXA 4MDIB 1IL1B 2GSIA 5C07E 4ELMB 4MQ7B 5EBWB 4YAQB 4CU8A 4GW5B 1FO0B 3BDBA 4R4NC 1DZBA 5IHZA 1G7HB 5JO5B 1GPOH 1N2RA 4CVWA 1MI5B 1OHQA 1S7QB 1N8ZA 5FYLL 3ARFB 2C3HA 1Q72L 3CGTA 4HK3N 4NJ9L 1OARH 5FOBB 3HA0A 3OKNA 3BKYL 3C5ZD 3VGDA 1R3JA 4LOUD 3TJHC 5TPWH 3SGKA 5I1CH 1TJIL 3HG1B 1LEIA 2DMCA 2VLKD 1AD0B 3DOSA 4PRPA 4KZEL 2XTLA 1F42A 5J0BA 4E41B 3AXLB 4PJFA 3EO1A 5CILL 1I7UA 1OW0A 2Z8SA 2P24A 5EBMB 2R29L 3LKRB 3N1PC 1RMFH 1U95A 1PJ9A 2CXKA 1AQDB 3X3GL 1NFDA 3V4PH 4YEFA 5LQBL 43CAA 4K3HA 3D0VB 4YC2B 2H6PB 5DUML 5BS0B 3IRZA 4P46A 1IC5L 4NRXA 25C8H 1KENL 1TNNA 3V8CA 4A2LA 2DMKA 3ZHKA 2F5AH 5J6GA 2VAAB 4NP4L 1H3XA 2BVEA 5JPMB 4DKEL 1U6AH 5L7XH 2BVPB 3ARDD 4NPYA 4RWYL 3ULSB 1ZOXA 1NMAL 1ZT4A 4WHTB 1BWWA 2Y7QB 1FBIL 1HHIB 3D48R 3RWCB 2AERT 1AC6A 2E9WA 3O2VL 1Y0LB 2V9RA 2ATPB 4U1JA 5ACZA 1DSFL 3R06B 2X4PA 2EYSB 3ARBB 1XF2A 3DX8A 4U6XA 3MLZL 2OS7A 3MRMB 1NCDL 3VCLA 2ENSA 1NUGA 3DO7A 3ARZA 5D7LD 3KPNA 5HGDB 5IB3A 1UM5H 3VW3L 2C5DC 4HEPG 2DLTA 2EYTB 4UBDC 3HC4H 4G9FA 4M48H 1R5WA 1G7PB 1TZGL 4LQ1A 1YEEL 3O3AB 1FO0H 5I1EL 1CFTA 1BQHG 3V6ZA 2ZNWA 1IZJA 2DYPB 3PWVA 3SDCC 2JIXA 3B6SA 3FO9B 3LV3B 4NHCH 3G9VA 4MVBD 5B3JF 3EIFA 1JGEA 4I48A 1AFVL 5EC1A 1DQLH 1FH5H 5KSVB 3BQUA 5KVFH 2C7UA 3VG0L 3MLUH 4G8GE 4LHUB 5HHMD 2QADC 4P46D 5FKAB 3TC9A 3DI2B 1P84K 5FOJA 5A3IC 3MJ9H 4NN7B 1J0YA 5K59E 4H1LB 3QXWA 4XPAL 3I02A 4F2MA 4WI7A 3IDGB 2O5YL 4C83B 1WTGT 4PJ9C 1T3FB 2FIKB 4KKAC 2WWMC 2IMMA 5BO1L 2WV3A 4OD2B 4JPWH 1AO7A 2GK2A 3QFJA 4K55A 1UYWH 1AI1L 3EFDL 1TCRB 4XHJD 4XNUH 4KDTA 3VFVA 2QSCL 1MRFH 2COQA 15C8L 3OR6B 4WFFD 4NKOB 2X7LB 4XP6L 3TO4C 1S7VB 1IBGL 1GAFL 3O8XA 3TT1L 1CBVH 3UYPA 2BHUA 3OG6B 2FZ3A 3UTZB 2VL4A 1T0NB 2ZCLL 1MFBH 2C3XA 3SOBH 4Z7OE 5E95B 8FABA 4K7PY 3F7VB 4ZNEE 3HMXL 5IFAL 4FQIL 1SJEB 5IMMA 1JYNA 3G6DH 2X2YA 4G9FD 4PJEA 5KVMC 2CDGB 1LK3L 2Q8BL 2VDKL 1HH6B 3RNQB 4MWFB 1S7SA 4BH7B 4HUVA 4JQVC 4LCCC 3NFSL 2VDQL 2K9UA 2FBJH 2XACC 3FB8B 3QDJB 1NUNB 4PG9B 2A77H 3HR6A 4L5FH 2VISA 1BD2A 1MEXL 2YD6A 4ELKA 3QXDB 2GSGB 4UU9B 3S4SB 2A6JB 2OJZH 1CZ8H 2ADJA 3HZKA 4DN3L 4X6DF 2V2XA 3PL6B 3AB0C 2JCCA 3BQUD 2ZUQB 3STLB 1CFNA 3QEUA 2FD6H 4GG8A 3ARSA 4H25B 1JF5A 4APQA 1A0QH 4BSVB 1IGMH 2RJMA 5TFSH 2NXZC 1L4IA 4JLRA 5KANI 2R0WH 2VJXA 2NXYC 2ADGB 1IC7H 5CD5C 4MJ5A 4E5XA 1QBMH 2Q8AH 4XTRC 2UWEE 1U8IB 5JHLL 3MRJB 4PBXA 5DYOB 1CXHA 1Q0YH 3QFJD 1MCJA 3NCYS 4KAQH 5J89A 2FO4A 3TCXA 4PJ5A 1EIBA 4ZFGH 4UT9H 1P7QA 5ID1B 4G8FA 3KPOB 2F54E 4EVNB 2ADFL 3DUUA 4K71C 1RIUL 4QRQA 4Y19B 3X11B 5HSFA 3P4OA 2P5EE 4FTVB 3WFZA 4IRZL 1QKZH 1NLDH 3AROA 5B21A 4RWHA 1GIGH 1OGAE 2IH3B 3LEXB 4K3GA 5T1KB 5AEAA 2AGJL 1K8DA 4HJ0C 1LP9F 3WFHA 1J1OH 1PDKA 3EOBB 2NY6B 5J13C 4QRSA 1CDHA 1L0XA 1PQZA 3B9KB 5D1QA 3HAEB 4JDTL 2VC2H 1NBZB 3G6JA 3O4LE 4M5ZL 1BD2D 4C4KO 2J6EL 5EU4A 3LPFA 4FZEH 1XGUB 4PLKC 3T1WA 1A9BB 5BXFB 3U7AA 2AEQL 5T1LB 1U92A 1ZHBA 1A7QL 3QISA 4TQEH 1RJLA 3I2CH 4Z0BL 2XPGA 1UWXH 3U2SA 1S5IL 2ICWA 2VDMH 3U0PA 1JYVA 5CP7A 4RMUA 3KG5A 1M6OA 4KUCD 2C26A 3FB5A 3M45A 4V2CB 3M8OL 3BWAA 4N5ED 5C9JA 1KFAH 1K4CB 3MBXL 3EFFB 4UB0L 3FT4B 5DFWH 1BBDH 4U1HA 5FYKL 3BXNA 4XZUA 5GS1B 5DDHA 2BC4B 5C0GA 1QYGH 1X5GA 2QADD 4OV6F 5IESH 1YEKH 2H32B 4PJ5D 1XR8B 2EDTA 3LKOA 1MY7A 5CMAB 1NGQL 1P7QD 2H9GA 4JGMA 1U36A 5FGCE 3VXSB 3F58L 5AUMA 2D7TL 5I1GL 2IH1B 4N0FA 2RFXA 2GTZA 4Y5YA 4MXWH 2EIZA 5DEGA 1FL5A 2APFA 2A9ML 1PX4A 2OTWA 3TWCH 4PJ9D 4ZS6D 3U6RB 3RWHB 5IJVA 1HHKB 3AREC 4PJCB 4NO5B 4BQCA 2B5IC 1FNGB 2CXGA 4HCRA 4D0CB 1GZPA 4ETQA 1QQDA 3RNKB 3V7AE 5KS9B 2CUIA 2NW2B 1HQ4B 2XA3A 3BKYH 4LSQH 1XF5A 1HKLH 2NY0C 4NO0A 4WWKC 1S7WA 2XTJC 1IAOA 3SJVE 4B7IA 3LMJL 4KK9C 4HH9A 4LARH 3L3KB 4KZEH 4CJ0A 5C09A 5CEZE 3QHFL 1DBML 4XWOD 4WFHD 5CILH 5GSVB 4Y16A 2VXVL 3OKOA 3TBSA 2R29H 3INUH 3RIAF 4LLMB 1ITCA 5FO8B 2DD8L 4MS8C 2LU4A 3GJEA 1WEJL 1JHTB 1CL7L 2NY7L 1SYSB 1U8LA 5CUSH 4PR5B 5D2NB 3SE4A 5C2UB 5LQBH 1ZV5A 4ZSOA 2OJEA 5EZJA 3UJIL 4WNQB 1QG3A 1T1ZB 3CSYB 3IU4H 3HAEH 2FB4L 3RVVC 3LS5L 5I1HL 1W0WA 2VLJE 3CX2A 3SKNB 4EI6B 4HS3A 4NP4H 2YUZA 3MYJA 5GSRB 1S9WB 1GGCH 3ZE2F 4L3EE 4FQPA 4UNTA 3G5YA 1NMAH 5HI3C 3ZKXB 3ZHLA 1HH9A 1FBIH 7FABH 5FGBC 1AQKL 1IGTA 3BKCL 1L6ZA 3U9PL 3EYVB 5HHQB 1AGBB 3W5MA 1GH7A 1DSFH 5HY9B 2VR5A 3E6HB 4Q9QH 2WNGA 2Z31A 4YFEA 3QUMB 4LLYB 1T22A 2WAHA 2AI0L 3GSWA 4L8SB 3S96B 3GSVA 3VFOA 5C7XH 2PW1B 3MLZH 3ZE1F 3WHE1 3JV6A 4WW2A 3T2NH 2XWTA 5I8OL 2FX8H 2GJ6E 3K4ZA 4EJ1C 2L7UA 4OFDA 1JWUB 2HTKD 4YHOL 2DJSA 3S5LA 3QDMD 1MJJB 4OD1H 5H94B 1YNKH 1KN4H 1VFOA 5DC0A 4DZ8A 4U1LA 1T20B 1YPZE 1U8JA 2GAZA 1XR9B 4Y2DA 4R97B 1IEAB 1OAKL 1E4KC 1A7NL 2ITCB 3RDTB 3D85B 2YD3A 4HW6A 5D5MB 2VLME 3TGXA 3GI8L 1GSMA 3BRDA 1QVOB 3LSOB 1BFVL 2NTFB 3MRBB 1D6EA 4Y16D 3GM8A 3BP7B 5DJ0A 1H5BC 3PHQB 1MCOL 3QAZB 4P99A 4CDHA 5DRNA 1I1YA 4N0RA 4MA1C 1T04A 3U0WL 3OXRB 4I1NB 1RJZB 2WIMA 3MJ7A 1KB9K 1FV1A 4G8EA 3FCTA 5I19L 4HV8B 5DJ2A 4MXVF 4Y4FC 3TZVD 2JJSA 2BDNL 1KXQE 3K8MA 4XPAH 4YWGL 4D0DA 2CLRB 4HG4J 4C58B 4LSDA 2LU3A 4PB0L 2V5TA 3G08B 3DIFB 4R3SB 2HJLB 3QZWB 4NQTA 1GJIA 1T66C 2Z8VC 2MCG1 3QQNA 2Q1EA 1F58L 4X4MA 3HS0B 3LH2H 3EFDH 3HPJA 2GTWB 2QSCH 2Z31D 3OHXB 1UACL 2VL5B 3QUYB 4NQEA 1E27A 3SQBA 1EEQA 5ACMA 5IVZA 1TZHA 3FAXA 2OR9H 4D94A 3HI5L 2JK5B 4RGND 2OSLB 1DQMH 3L5XL 4ENEC 3U30B 1FGNH 1RVFL 3V7MA 4EIZC 1OF2B 4HKJB 4N0YH 3PNWB 5FECB 5JXEC 1EH9A 2DB8A 4M43L 3GSXA 3RVWC 1EGJA 4OKVA 4TVPE 4FQIH 4IDJH 3L3JB 3QUMH 4HIXL 3NPSC 4JZJB 1LK3H 2Q8BH 1E4JA 5DMYA 1BREA 2EDDA 4KROD 1A6AB 1MCKA 3ULVC 2VDQH 3GIZH 5IQ7L 4Q7DA 2P46B 3VFWA 5IMOB 2W07A 2J5LC 4XBPB 4L8DA 1MEXH 3MV7A 2VXUH 4IRJA 5E8PB 3TBWB 3NBNA 5HHVL 1FVCB 3GSRA 9CGTA 4I3RH 1P5UA 3BYTA 3MRHB 4O2CA 4TUJB 4NNPL 2CUMA 4X7SL 4U6HB 2D7NA 4DN3H 3T0EA 1I4FB 1VSCA 2X4RB 1VADB 2ESVB 4TSCL 1L7TH 3LN4A 5I6XB 3T3ME 5HHOE 1PKQE 1TIUA 2G60L 5D7SL 1U8QB 1RJYB 4OZ4B 4LF3A 1FNEA 3RZWA 2A74A 3BESR 1VFMA 2OMNA 4U6VH 2VLLB 3NH7L 5ESAB 1WQVT 1JGVH 2LQRA 4QCIA 5I1DA 5DHXB 4YNYB 4MLSA 1U3ZA 1J0JA 4UTAH 1X5YA 3M1BB 1SQ2N 2EE9A 4J6RH 4HK0B 4P2YA 4QRRB 1A1MA 2UYLB 2HLAB 4P57A 5JHLH 4EBQL 1OAXL 1KT2A 3B4NA 5D93C 4GQ9L 2GEEA 1TDQA 2ZOKB 4MDJB 3JWOL 4QRPA 3SDCB 4HWNA 3FMGL 4XVJL 3BE1L 5INCB 3FQWA 4U6YA 4Y88A 5B4MC 5HHNA 4YHLL 5GS0C 3MNVB 4XNQA 4P4RA 5HI3D 3ESUF 2NW3A 1I1AC 1DVFC 3H9SB 5LCVL 4ZPVB 4RNRA 3ROOA 5L88L 5EFIB 5B22A 5IMKB 3OXSA 4BA8A 4OZIF 2VDPH 1G0DA 4O2EB 3QO0B 3SQOL 3IDXH 4UMGA 3VFGL 1RZGA 3BPCB 3FB6B 3REVB 4B7LA 5IB4A 1JPFB 3PGFL 5F9JA 5MEPA 2A0LC 1HINH 1EEZB 1FYTE 2F9BT 4DAGL 3SE8L 3V6OE 4LBEA 1TMCB 4P2RE 4L4VB 4OB5L 4Z7WB 2ATKB 3FFDB 3SDAB 4OV5A 3NCCB 4PRNA 5K33A 1QACA 5ICYB 5C07D 1Q38A 1S3KL 4C56E 5EBLB 4LRIA 2JB6A 1DLHA 1S5IH 4AEHH 5ECJE 3DUSB 1JTOA 1R3IL 4XC3H 2UVFA 3RPKA 1ODAA 3VFRB 1LEKB 1S78D 2FLRT 3TN0A 3PDOA 4HF5L 5EIIA 4ODHH 3ROLA 1MLCB 3X3FH 1A7RL 5C0BA 3QUXB 1XFPA 3LEYH 5I76A 4Y4FD 4JFEB 1EFXA 2G9HB 4K94C 4OLYH 3ZKNC 3UZQA 1IGFH 1MCCA 2Y07H 1LK2A 1SJHB 3MRNB 4OIAA 2XOTA 5E8DH 1YY9D 1RHHB 1EMTH 4PJ7F 4KHTL 3GRWA 5TF1H 4ELMF 3L1OH 3T65B 5DEFA 1OM3L 4KWUA 1ONQB 2PR4H 4HBCL 4U1GC 4WHCA 4X6EA 5F7YC 5HYSB 3ETBF 3V0AC 3I6GA 2EXYD 4LFHD 1G7MA 5IVXA 3D25B 2HTLD 5K9JL 3PWNB 4YHIB 5F71A 2Q7YB 1MREH 4RFNB 4S10A 5BOPA 2Y36L 4X5XA 2PW2B 4RDQG 4XP1L 3PV6B 1QFWM 3VJ6B 3HE7D 3LMJH 1DDHA 3DJ9A 1EHLH 4ENED 1DANU 3D39E 4ZQKB 3GSQA 2I5YH 2YOCA 3BH8A 4X6BB 1GZQB 5B8CC 1KC5L 4F7PB 3JTSB 3CVHB 3QQ4B 5GZOC 4PBWD 3BIKB 2HG5A 3QULA 3VD7A 4M5YL 3MLTB 4FFWD 5E5RB 4QOKE 4JKMA 1SYVB 4U7SA 4M7KL 2WBJD 4MA3B 4PJXA 1C5DB 3UJIH 2LU7A 4YHML 3V0WL 5C70A 4X4XB 5I75C 4PRIE 4YDVA 3F7YA 5EZOL 1AC0A 2R0LH 1UCBH 2E8ZA 3TN0D 1BAFL 1BQHA 1QSEE 3BN9D 5C08B 4UOW0 2HFGL 3D87B 3ZL4L 1LO0L 4KKLC 5J13B 1V5JA 2CLZB 5EU5A 2FYYA 5EZIL 3WUZA 4ZNEA 5D6CA 4KRLB 1FIEA 4UV7L 1AQKH 4XCCL 3AM8A 4GQPH 4KKCD 3U9PH 4MJIE 4PJ8A 1EFXD 2IBZY 1IGYA 4G80A 3HRZB 1IQWH 5DK0A 4L3CA 4WGVB 2IAMB 3MRFA 2NY1B 2D4FA 2W65A 3ZDYE 5E2TH 4BSWB 4AENB 4GG6B 4XCEA 4GW4A 4WI5A 1QRNE 4PREB 2IGFL 1YDPB 4GBXA 1A4KA 3ET9F 3DBXA 4YHOH 2E6PA 3MA9L 1ES0A 1EA9C 4AJ0A 3LZFL 4G8GD 1FFPB 2P4AB 4J8RA 3UYRL 3RKDD 3O3DA 5LWYL 3FRUA 1A7NH 4JPVL 4TTGA 1RFDL 1NAMB 3K8KA 3RWJB 3THML 4GRWB 5T33L 3BUYB 4AQ1B 4FQ2H 1JWMA 4FQXD 4DWHA 1MCOH 1J10A 3BJLA 5IB5B 5FYLE 2HA1A 3BGFB 3U0WH 3O2DA 3AAZB 3VI4E 2F54A 2GK0A 3RIFK 4EN3C 4K3JL 1MCQA 3R4DA 4MNQB 3TBVA 2D31A 1QBBA 4K7PL 4UDTB 2BDNH 1YA5A 4YWGH 3CVHH 4RGOH 3IDIB 4U1MB 5IROA 2W9LA 3QXVA 3MRKA 1P84J 3W82A 1EUUA 1RV6X 1YJDC 2VZ3A 2Z4QA 5GS3A 4ZYKA 5TQ2L 3CDGA 2HFFB 4WWKB 1JI2A 5CHNA 3LVEA 4K3EH 2VTFA 3RY6A 2VMFA 3HR5A 3BZ4B 2EO9A 5J3HD 2X4NA 5D96B 1T03H 3E3QC 2DQFA 1JPSL 3VFSB 2LVEA 2V7NA 3LAFA 5IBUB 1RULL 4M8QB 3MCLL 4UIKL 4JZOA 2Z8RA 3O4LA 3W11D 1YQVH 3MJGX 4RMWA 2XN9D 3L5XH 3BSZL 3AUVA 1T1XA 4PTUA 5EO9B 4P49A 1GCFA 3CMGA 4JO3L 4OGAD 4GBXD 1TLKA 1JGLH 1IEBB 3MODH 2G2RA 5I73C 5KTEL 1F4WL 1N6VA 1KB5B 3B9DA 2GJJA 1DLFL 1BX2B 2OTPA 4MAUH 3I3DA 1UT9A 4JPKL 4FXKA 4F58H 4HIXH 1WZ1H 5L9DH 4LLWA 1FL6A 4AQOA 3MRIB 1WV7T 1LO3L 4ZPTB 3VWJB 2UUDK 2C1PB 5KN5A 1RZKC 1PZ5B 2LAGB 2E7LC 1MJUL 1Q9OB 3DVFA 4NJAL 4QRTB 1K2DA 5JTWA 4NNPH 2APBA 3UBXG 3KR3L 1A2YB 4X7SH 1NCTA 3FQTA 1OW0C 4JQXA 2F54D 4LKXB 4JN2A 1NAMH 3IJSB 1CS6A 4S1SL 1YN7A 3MRRB 2CDFA 4GRWH 3GMNB 1XIWB 3G9AB 2W0FA 3VRJB 2P5ED 4FQHA 3B5HA 1AGFB 4RMTA 1L9NA 1MOEA 3P9LA 1HK6A 3BN3B 1OT1A 3RU8L 3C2AL 1OGAD 3LRSA 1VGEL 2YN3A 3C60C 4CU7A 5JDJA 2CRIA 2EYRB 4HIIB 4NCDA 2O61B 3LRHA 4JFFD 4FQLL 5ICZA 1OAXH 5IW3A 1P4LA 2D03H 3SJVA 5B39G 1H15A 3TA3A 4Q2ZB 2DIAA 2Y5EA 3GUTA 3FMGH 4XVJH 1TXKA 4ODVL 3T1FA 3P3YA 5HYQA 4MGXA 3UTOA 3MLVH 2BVOA 4Y4HA 4QTHA 4MJ6B 4MA1B 1VFBB 3MRDB 1B3JA 3CSPA 4LIQE 2CKBA 3ABZA 4UAOC 2ZG3A 5IF0A 5ERWB 5SWSE 4ZTPL 12E8H 3QPQC 4ONGL 1R5IB 2M2DA 1ORSB 4DK3A 3MLWL 1BZ7B 1R3HA 2FECI 1RUKL 4N90E 4HWZB 5IBLC 3ULUL 1PSKL 5H2BA 4RZCA 1P4BH 2WLYA 1NDGB 4HFWB 4ZOEA 5T5NG 3EO0B 1ZKAA 2VLJA 3HMWH 4L9DA 4W68A 4KI1A 2DQUL 3LQZB 1QUNA 5KVGL 1GGUA 1NLBL 2MKLC 4HKZB 4WHYG 4L8BA 1FNHA 3MUY1 4L3EA 5FM4A 3U7WH 4DAGH 3BEVA 3QRGL 4ODWA 4KPHH 1J86A 1AGDA 2V17L 2XWBA 1KB5H 2A1WL 4ONHB 2BERA 1BHGA 3CFCL 3T08A 5DMGC 3W9DA 5GZNC 4F9LA 2R8SL 4TYUA 3FN0L 2R1WB 5I8EA 1MVUB 3BZFB 5I1KL 3IDJB 4K3DH 4P4KB 5JW4M 1DUYB 5BQ7B 3F12A 4Z18A 4ZUTB 2ADIA 3MFFB 4BH8B 4S0SD 1R3IH 5E7FA 5FCSH 3WYRA 2VH5L 1OTSD 3OQ3B 2DL9A 5FYJE 5DI8A 1TPXB 4Z7VF 1MJ8L 5DMJB 5EO1A 4IS6A 1Q9KA 3BGAA 1A7RH 1NBVL 3NPSB 4HUXA 3BPLB 1YPZA 4NFBA 1AP2B 1A1NA 4RMSA 2PUQT 2X5PA 4GXUN 5DFVC 4X8JA 4LSUH 2HJKB 2KPNA 3MSPA 4N8VG 3IXAB 3QUZA 2MFNA 1A3LL 1P7KB 1CGSL 2NY4D 4HUWA 3L3DA 1U3HB 3DURA 4P2QB 4IIQB 3SO5A 4KHTH 2B20A 4OZFG 5DJAB 3VD5A 4G7YL 1OM3H 3HCVA 3MLRH 1BBJA 3CXDL 1B0RA 3CFEA 2A6DB 3CMOL 4UQ3A 4G9DB 1XGYL 4NQCE 2DDQL 5K9OB 1DUZB 5DK2B 1SMAA 5JXAL 1ORQB 2NR6C 4UQ2B 3MXWL 5TJWK 1VFAB 1IKFL 3CSBA 4OLXH 4PJCF 4WW1B 2PYEA 3W0WD 1CLCA 2IQAA 1HSBA 3CPLB 3O8XC 2CR6A 1KEGL 4XP1H 4WFED 4HZLB 1CVRA 2Z35B 2VLJD 5KS9F 4QXUL 1QSZA 5FO7A 5HDBE 1WAAA 4TOYL 5KSAD 1PG7X 5DHYA 1Y6NR 3T04D 1KC5H 4BQ9A 1KSRA 4LU5L 2UY6A 5MERA 5D93B 3EJZC 2YPLE 1CXKA 3FFCE 2X10A 4M5YH 1YMMB 1ZXQA 2AJYL 3S98A 4IM8A 1LE9A 5FUCC 5GGQH 1N6UA 4M7KH 4F9PA 1YC7A 4O2FB 2ZZUT 4G5ZH 3GHBH 4LVNB 2QKIB 3DGGA 2BNQE 1SVZA 3VXOB 1D5XB 5GGRB 2W9DL 3VU2A 2ORBL 1YY8A 5A2IH 5D7JB 1E6OH 2GJ6D 3W39B 1BAFH 4LSVL 3MUGA 4IOIB 2Z91B 2P5WE 4OAWB 3WXWL 4APQC 1MRCL 2E7CA 1I8MB 4L29B 3QXUA 4WRLA 3SO3C 4U0RC 1LO0H 3O6FB 1KUMA 5EZIH 5B38G 1JRHL 4UV7H 5JDSB 1OP5K 1BQUA 5JW4N 5EOCH 2YC1B 5E7BA 4I2XE 1HDMB 4WDIB 4YE4H 4Z5RA 1KPRA 2VLMD 2MJWA 2XQYG 3EDDA 1UFUA 1QSFB 3G04A 4YXLL 2JELL 1FFQA 5IK3B 4LKCA 1CF8L 1MWAL 5DMKA 4RBPH 4NC1E 2IGFH 3IFOB 1HYRC 1MHHB 2EE2A 3MA9H 5FYKE 5HHOA 5DHVA 1PKQA 4MDIA 2E6QA 3RUGE 4RCAA 5E2UL 4PV9A 5EBWA 1ZSDB 4E0RA 2PN5A 1MUJA 5A16B 4GW5A 4C55A 1UKQA 3DROA 3MJ8B 5LWYH 2PYFB 2KBGA 4W4OC 3SEPA 1RFDH 1G7HA 3CZFA 5IFHL 5T33H 1S7QA 2FNBA 5L2KE 1CIUA 3PQYE 4JFOB 3MBEC 3AS0A 5DZNA 3RPIA 5D5MF 2Q6WB 2HYMA 1GGYA 1FZJA 5IBLD 2APVA 5D1QC 4P5TB 2ARJA 3QIUA 1OB1A 2DWEB 3HG1A 1LO4H 3SBWC 3S88L 1LO2H 3AXLA 3MJ9A 3NGBC 4EUPG 4MQXD 2BOCB 3DV6B 3KYKH 1D9KB 3C8KB 1S9VB 2OP4H 4FP8H 1A22B 4GSDL 1BGXH 3RI5F 1KB9J 4PUBL 2NTSP 2W9EL 3VGFA 5J6HA 1YEIL 3U36B 3QJHB 4ZAKA 3TNMA 4V1DB 1CE1H 4XNYL 1H8NA 1VPOH 2B4CH 4XPFH 3IDYB 3D0VA 4TVPD 2H6PA 2X42A 1UQSA 1JGUH 3DSFH 3S3JA 4S2SA 3C6LA 2B1AL 1FYTA 3MCLH 4CNIB 1W0YT 3ULSA 4MNGB 3OJDA 2GIYA 2R69H 5DUBB 2AXFA 1YYMH 3TIDA 5DQDL 1T83A 4JKPL 3GMPB 5ICXA 4HC1H 4ZXBB 4HWBL 3GGWA 4EXKA 2ERJC 2ICEB 3RWGB 4C56A 1U9KA 5HHOD 1CYGA 3CCHA 5I75B 3REWA 4GAJL 3ARBA 5LGHL 3CD4A 2VABA 3S34H 4JPKH 1RAMA 3ARGD 3HI1B 2Y4SA 5I1IL 2NQCA 3SKOA 1QHPA 4YBLC 5IFJA 4PRDA 1G6RB 4JFHE 3N1QC 1FCGA 4CAGA 2CIIA 1AD9A 2YZ8A 2YMXH 4NJAH 3RY4A 3LQAH 2BNRE 4I0PB 4FMFA 2OTUB 3QXAA 3KR3H 1FZKA 2V2WB 1JBJA 4C4KT 2D7QA 1ZLVK 5HJ3B 2XRAL 4S1SH 2N4IA 3VXUB 3OAZH 3IFPB 2EE6A 1A6PA 3IDNA 3PGCB 2X40A 4XMKL 3U4BH 3FOLB 1S9XB 1ZWIB 3SE4C 3MREA 3VE0B 3CC5B 5LXGL 4WUKL 4G6AC 2BK8A 4Y5VA 3MGTB 1CDGA 3EGSB 3SE9L 5EU3B 3O6LL 1MLBA 3FQRA 2QSTA 3GBNL 2WUCH 1E6JH 3D39A 4JKWA 3WS6A 3ZE1E 1FYTD 1LE5B 2EH8L 1DE4A 1TFHA 2JJVA 3CFBA 1PFCA 4AM0B 1K4DB 4IDLA 1NQBA 2VLKB 5KAQF 4P2RD 4O51B 5HDLA 2FIKA 1C08A 3O6ML 3MO1A 3T8XB 3OF6A 2YA0A 3S35L 1JN6B 4QOKA 4PTTA 2IALA 1FNSH 5SWZA 1CN4A 4ZTPH 3NCJL 3JXAA 2VLRE 4ONGH 1MCNA 4C56D 4U7MA 1CGXA 4WW2C 2NZ9D 4MAYA 3QJFA 1YEFL 4NN5C 3V4VH 3ULUH 4PRIA 3I9GH 3BP6A 4BSJA 2DQUH 5CGMA 1DBKL 4G8IB 4HGWB 1QSEA 3OB0K 1YMHA 2DM3A 4LHQB 3MNZB 3QIWC 3E2HB 2X09A 5MEQB 4JFPA 3QRGH 2ZSVB 1FLRH 4Y2DC 2NZIA 4X9HA 4OQTA 3NPZB 4K23L 6FABH 1CGUA 1HHGB 3F7VA 3PHOB 3ARDB 1S7TA 3CFCH 1FAIL 3B2UC 4MJIA 3FN0H 2XKNB 2CDGA 4ORGA 1EO8H 1FFOA 4PJDB 3EO9H 4OZHB 4MWFA 4Z7WF 2OYPA 5I1KH 4MA8L 8CGTA 1JNNL 3DGCR 2PO6C 1CFVL 4MXVE 4LAJH 4PG2A 3QDJA 4R8WL 2MNUA 3X14B 4OSUH 4X6FB 4GUPA 4KKBC 2BVTA 3ES6B 3MBED 5E6IC 4JG1L 4CVXB 2GSIB 1RZJH 1G6RH 3LOWA 1N5AA 1QRNA 2GQHA 2VH5H 4L9LA 4JRYD 3DETC 3QXDA 4MD5A 4UU9A 5IHZB 4R7DB 1MJ8H 3ZHDA 4ZD3H 1N2RB 3K1KC 3RX5A 2AJSL 3PL6A 5CJBA 1NBVH 5D7LB 4BK4A 2JJSC 1N8ZB 3OV6A 5E2WL 4H88L 5DQ9A 4GRLC 3LS4L 4Q6IA 3BT2L 3OKNB 5IEHA 2IPTH 2AJUL 3MV8A 5ANME 3D39D 1A3LH 1Q9WA 5KSBE 1LEIB 4OFVA 4G7YH 4PJFB 2HLFD 2HRLA 3EO1B 2H8PA 5DYOA 2WZPD 3F7QA 1I7UB 3OF6D 3ZO0A 4TTDC 3CMOH 3B3IA 2VQ1A 3EYOA 1XGYH 2MQ3A 4KXZH 2DDQH 3VFMA 3V6FA 5GPRA 1PBYA 1B6DA 4P23A 1EX0A 3KPOA 1IKFH 1F45A 5DJCA 1NFDB 4PRID 1T5WA 1GGBL 1KEGH 43CAB 2KZ1B 4OCYH 3A0OA 5EOCJ 5C0AE 3HB3C 5HHMB 3ARWA 1J1XL 3LKQA 4P46B 2G75A 4NRXB 1QSED 4FZ8H 3QHTC 2H1PL 2IH3A 2E9JA 3LEXA 3VH8G 5J6GB 1T0PB 3D2UA 1CG9A 4MJID 4XP5H 3VXQA 3GO1H 4X5LA 3G5XA 3WUWG 3B9KA 4IRJC 5AZ2H 4Z8FL 2RR3A 4FHBD 4U1JB 4X0KB 2WMPA 5ACZB 1K8IB 2A6KA 2HAZA 5FA3A 3JWDC 1KBGH 1RK1A 1UXWA 2H41A 2X4PB 2EZ0D 3T0EC 1XF2B 1JZ8A 5GRWA 3DX8B 4U6XB 3IS1X 3GK8L 1VACA 3WXWH 3O4OB 3VWKA 3HFMH 3VCLB 1YEGL 2DQDL 1BM3L 5T1LA 3DO7B 1I85A 3TESA 4XP4H 4R2GD 4QGTA 4R4FL 4FN0A 1JRHH 3KPNB 4M1GH 2VZUA 4ALAH 3MGOA 2DQJL 1D5MA 3NCYP 3WS3A 2X9XA 2ZJSH 4G9FB 4OGYL 1R5WB 1CICA 4KJYA 1N5YL 2JELH 1F6LL 5E1HB 1CFTB 5MP6L 3D3VE 5F7DB 3EFFA 2WW8A 2Q3ZA 3V6ZB 1CF8H 5GRZA 3PWVB 2JIXB 1NFKA 5J4MA 2NNAA 4O9HL 3ZE0F 4GG6F 2J4WH 5CMAA 1JGEB 4Q9CA 4P23D 2CH8A 5E2UH 1NMBH 1RZKH 2IH1A 3KJ4C 5EC1B 3BQUB 4NQSA 5FV2A 5LAXA 3GIVA 3V5HA 2C7UB 1TJHH 1YNLL 4HUNB 5IT2L 5IFHH 4P9MH 3BMVA 3NZ8B 35C8H 4G6JH 3PIQB 1FNGA 4ZTOL 3RNKA 2I9TA 1WSST 1EJ6A 2V6HA 3I02B 4GRWF 5L8JB 1HIMH 1OPGH 3NCFB 4OCNC 1HQ4A 3KAAA 4QF1A 5MI0C 1S9KC 3VGEA 4UT6H 3AY4C 1IMHC 1QR1A 2YD7A 1BPVA 2FH6A 4LPVA 3QFJB 4WEBL 3S88H 1ZGLA 2ZUWA 2IJ0C 3RVUC 1U58A 1UA6L 1OAQL 2EIEA 3CFKA 3VFVB 3BP5A 5C0FA 2N56A 1I8KA 3ESVF 4M7ZB 2CK0L 4ZMAT 1VEOA 4LRIC 3RGVA 1TZIA 1YEIH 2APTA 5SWSA 3VWKD 4MD0A 5MENE 2A2QT 2ZCHL 1OP3H 4XNYH 1OAYL 3I6LD 2DLEA 5T3XL 2FZ3B 3DYPA 4KJPC 3C08H 2XG5A 2BNUA 3CSYA 4LCIL 3NFNA 4KKBD 2ARJQ 3UBXA 8FABB 2YD2A 1IGIH 1QFWL 5IMMB 1FSKC 1S9WA 1SBBA 3E1F1 4C59B 1S7SB 1GGIH 4HUVB 2Q3AA 4PJIE 4DFHA 5FF6A 3FKUS 1J8KA 3BGMA 1UZ6E 1ZAGA 5DQDH 1HYSC 1P2CA 2IANE 3R8BB 1BD2B 3CFIC 3EYVA 5HHQA 2WUBH 1BLNA 4ELKB 3HMXA 1ETZA 4GAJH 5LGHH 3HZKB 2ADJB 1JPGA 4L8SA 2V2XB 2JCCB 3WKMH 5I1IH 2V2TA 1CFNB 3QPXL 3QEUB 5ENWA 2WBWB 3TYGL 1U2HA 5B39A 1NCWH 2A9NL 3MXVL 4OCSH 1F4XH 4NYLA 3VG9C 3EJYD 2VE6A 4TTDD 3KYOA 5C0DB 2QHRL 4CDGC 2BSED 4Y5XB 1AHWA 4JLRB 3MRQA 4OIBA 2VSCA 4J12A 2P8MA 3CXHK 5F7UA 4E5XB 1XR9A 4JR9L 3D85A 3L6FA 4NZJA 2XRAH 1W8NA 1NCBL 2FO4B 4PJ5B 1QVOA 1P7QB 2NX5E 2AJZA 4DJMA 4G8FB 1F6FB 3DUUB 1T89C 1P9MA 3HZYB 1TQBC 3C9NB 3D18A 3PHQA 4QRQB 2BY0A 2R4RL 3FT2A 4NQCA 4RAVA 3FOMA 3IYLW 4WUKH 2F8XC 2P49B 5SWSD 3P4OB 3L3GB 3OKMA 3WIHL 5HDQL 3MLSL 3DX9B 4LRNL 1OD7A 3JV5A 3SE9H 2EECA 1IC4L 4P2OC 1QFUL 1K8DB 4M1CC 3U7YL 3WFHB 4NO2A 5I1LB 3O6LH 4N1EA 4KU1A 2XA8H 4KJWC 4NWUH 3GBNH 4QRSB 4WENB 2XWJA 2RAMA 3QNXA 4I18B 4N8CH 2FGZA 3AM8C 1PQZB 1BFOA 2ICWI 2YPLA 2W92A 4R3SA 2XY2A 3FFCA 5D1QB 1X6LA 4PJ8C 3GFUA 3MRGA 3K74B 5DD3L 3G6JB 1F4YL 2E27L 3QIBA 3JBG7 3ZKSD 2X05A 5T3ZE 3ARVA 4P3DA 5E2VL 4DEPC 5EU4B 2YXFA 3QUYA 2BNQA 3U4EA 1U92B 3QG7H 1ZHBB 2X89A 1RJLB 2XPGB 3QCVL 3U2SB 1FFRA 2ICWB 3U0PB 4FG6D 4XNXH 5FYJD 4LSRL 2DWDA 2P5WA 2ZPKL 1JZ4A 1M6OB 1TNMA 1G1CA 3FB5B 2J6EA 1BF2A 4OLUL 1H3TA 4OZFA 3ARQA 4JFZL 3BWAB 3UYOD 5C9JB 2BCKA 4OLWL 4U1HB 3BXNB 1X5KA 3VXMA 5DDHB 5C0GB 3GM0A 1I75A 4MA8H 1KCLA 3X13A 5AAMA 2B7DT 1A3RL 1D5ZA 4O5LL 4TUKL 3LKOB 3T0WA 2H9GB 5JQHC 3NZHL 4NKIH 1MFDH 1FL3A 3SHSA 5E8PA 1QFPA 2ERJB 2RFXB 2GTZB 4Y5YB 4YGVA 5DEGB 4XVUC 4NQCD 2OTWB 4UDUA 1I3GL 4JGJA 4MA7L 1RK0A 5IJVB 3B2VL 3RUGA 2A73A 2ESVA 3IDMA 2F53E 4ETQB 1RJYA 1GZPB 3QDMB 1UH4A 4OZ4A 4YBLB 5IROC 3LKNA 4R26H 1M7DA 3BT2H 3K8LA 1XF5B 4NO0B 1S7WB 4XMPH 3PQYA 4Z6AT 4K8RD 2DQEL 3ULVF 1IAOB 4I3SH 4KY1L 4R0LA 4HH9B 3OAYK 1QLEH 3PF2A 2ZOLB 4QRRA 5C09B 3BOVA 3FFCD 2RBLA 3KLHC 5E9DE 2KH2B 2P8LA 4Y16B 1JHLL 3QIBD 3KS0H 5MEOB 3G6AA 2ZOKA 4UNUA 3SCMA 3OKOB 3L7FA 4KVNL 3TBSB 3AGVA 4S1DC 4UTBH 4WV1C 2FECL 3WO4B 3O81A 5B38A 3H42H 1KIPA 2BNQD 2EKSB 2XZAL 1OTTD 3BVNA 1U8LB 1JNLH 4ZSOB 3MNVA 2PXYD 2UVEA 2OJEB 5EZJB 1E4XH 4HMDA 3KNBA 3ILPB 2PCPA 4OCWH 4ODXA 5FK9A 4HDIB 2XI9A 2GFBA 1DANT 1W0WB 2R2EA 4HS3B 5KW9L 5BVJA 2P45B 3QUKB 4F7CA 3MYJB 1NGWA 2FGWH 2PETA 4IHOA 4PLJC 4EXPX 2R56L 1GVIA 5K93A 4JFDE 3TH2T 3HI6H 5BV7B 3HUJE 1N64H 1QO3A 1IGTB 4GT7A 2IQ9L 3BISA 4QRUB 4DQOL 2OXHA 4NO3A 4QXGL 2Z31B 1D5IH 3MA7A 2APWA 1VENA 3GSWB 1N6QL 3GSVB 5GGUA 3VFOB 3GK8H 3JV6B 1C16A 1QPPA 4WW2B 5FYKD 2XWTB 5ISZA 1PLGL 1YEGH 4XPGH 5F9AC 5ABDE 5EBLA 2H2SD 4R4FH 3S5LB 4JPIA 3ZSSA 1G9NL 1ZGLM 3WN5A 1U91A 4DZ8B 1LEKA 4U1LB 2GAZB 5L2KD 3PQYD 4XPTL 1GC1C 1N5YH 2FHFA 4EUPA 3PWPE 3IXTA 5MP6H 5H37H 2BNRA 3TA3C 4I4WA 3KLDA 1RZ7L 4DUWA 1D6EB 1PX3A 1J5OL 4O9HH 4HCRH 4OD3L 5DJ0B 3SCMD 5K9QI 1X4XA 4J4PA 2BRRH 2V9QA 4N0CD 4PP1D 4Y4HC 5DFTA 1IRAY 1I1YB 1UXSA 5DRNB 2X9WA 1T04B 1G7LA 4Y7MA 3NFPA 2F74A 4M3JA 3UTSE 1YNLH 3MJ7B 5JOPE 1T1WA 1FV1B 2E9BA 3BPOC 4ETYA 3UP1A 3SDDA 5DJ2B 3PABA 5J11C 3NTCL 1MCDA 2HMIC 1YN6A 3FONA 4HPOL 1ZLUK 4PY7A 5C1MB 4YHYB 2YD9A 1MCWM 2C3WA 5F21B 3GNML 4AL8H 3RAJH 3A67H 2W59A 4XVTL 2YPKA 4KHXL 1MIEH 3VJ6A 2CQVA 1DFBH 1H8OA 3GZKA 3FB7A 4KRPC 4NZRL 1XGTA 1JPTH 4ZQKA 1UA6H 3HPJB 4OM1H 4WCYL 4FFVC 2AK4A 1OAQH 4F9LC 1E27B 2CK0H 4Z7VE 3WMSA 1F2XK 5IVZB 4DGYL 3HE6A 5HGBA 1TZHB 5IHUH 5EG6C 2VLRA 2B1HH 2ZCHH 3F6LA 3RQ3A 3A6CH 5GRYA 4ZUWA 5BV7H 2VXSL 1NCAL 2ENYA 3GHEH 1YYLL 2D0HA 3CDCA 4KI5C 5J8OA 4LCIH 2J7LA 3RIAK 1ZTXH 4KJQD 3EAKA 3GSXB 3ALPA 1QFWH 1MCFA 1QBAA 2LTQB 2KL6A 4JFHD 3BH9B 3VXSE 2C4XA 1KJVA 1AXSA 3ULUF 5TQ0L 2CLZA 2BNRD 2P48B 4X6CB 3K0WA 3PP4L 2FIRT 4NUGL 3QUZC 2VWEE 4LCWE 3MV7B 4IRJB 5ALCL 3NVQA 4K94L 1Q94A 4O2CB 1IGJA 3Q5YA 3T0EB 1IARB 1KCUL 1FAKT 1N59A 4P59L 5C07B 3LN4B 2VKXA 4GS7B 2OL3L 1SJVA 3OGCA 4HGKC 4LF3B 1FNEB 2A74B 3KLHD 4MB3A 2ED8A 4FXGA 4QCIB 1JUFA 3BFOA 2BSTA 3CAFA 1FE8H 3SE3A 5CZVH 5JHDE 5HVHC 1A1MB 3Q6GL 4IJ3C 4P57B 5A2LH 4LSTH 2FX7H 4JR9H 5ANMA 1KT2B 3SGDI 1FGVL 5IEKA 4OI8A 4P9HH 5KSBA 3DMMA 4QRPB 4PRBA 2CO6B 1W8OA 3FQWB 4U6YB 4BQBA 3P77A 5HHNB 1N0XH 2GI7A 4PGDA 4LVHC 4GMSH 1BJMA 1CR9L 4LASH 3DXAE 4XNQB 2CIKA 3UO1L 2VLRD 2NW3B 1MCHA 3WIHH 1NC2A 1EUTA 3C8DA 3MRPA 5HDQH 3I6KA 3ROOB 2NY3D 1EHAA 5TE4L 1QFUH 3OXSB 3U7YH 1GOHA 4RISH 3EYQC 4OCRL 3IF1A 2I60L 3KHQA 4XAKE 2YD8A 5GRXG 4U1MA 1F3DH 5DZLA 3TVMC 4RIRA 4BKLA 4LLUA 4XBEL 2BXYA 3UJTH 3L5WA 5MI0B 5HYJD 5F9JB 1JCKA 4YZFE 1FDLL 3HZMA 5EUOE 3RHWK 4R7NA 3JTTB 3BPNB 3O0RH 3O9WC 1U8NA 4GMTH 5E2VH 2R2CA 4YR6B 1JI1A 1MHPL 1EGJH 4OV5B 4PRNB 1DBAL 1MQKL 2EH7L 5FUOL 2JB6B 3I85A 3EHBC 5ITBL 1DLHB 4JEGB 5EO9A 3MLYH 2ZPKH 3UEZA 1D6VH 5TE7L 5D7IE 3EYFA 3TN0B 4PGBA 3PDOB 4Z95L 1YC8A 4RRPA 5EIIB 4OLWH 3ROLB 3DX7B 5TDNA 1H0DA 4XPHL 3U0TA 5KVEH 3ARFC 1IM9D 4GRMA 1BFTA 5E00B 5ID0A 1JIBA 1CE6A 2C1PA 3JWNC 4JANA 1MQ8A 4O5LH 4CRPA 3EYUL 5I76B 1EFXB 3IETA 2YA2A 3LKSA 1HOCB 4PJDF 2HMID 4OZHF 3WXVH 1LK2B 2GITA 4QRTA 3R1GH 1U0QA 3QO1A 4ZO9A 4PGZA 2VXTH 2AP2A 5HVGB 5GS2D 2D0GA 4I3GA 4JFQA 2P42B 2ZSWA 1X6NA 4FRWA 5GHWH 4MA7H 5DEFB 1R24A 3VH8A 3B2VH 3E6FA 3IGAA 1UB5A 4PGEA 4X6EB 4LKXA 1KJ2L 5I1JL 3QP3A 3IJSA 3I6GB 1G7MB 1OLLA 5IVXB 5C0AD 3VG9B 1XIWA 4FFVD 2QJDA 1IQDA 3PDDA 4LEXH 4XPBH 4EQ2A 4KQ4H 4ZAKC 2P1YA 3WUWA 2MPAL 2DQEH 3HRPA 3BEWA 4YC2C 1O7VA 2ICWJ 1UM6L 1YJDL 1DDHB 3AVEA 3B9EA 3IFNH 4HEME 5DLML 3GSQB 3CDFA 3C6LC 4Y0GA 4AZ8A 2CKBL 1Q1JL 4W6YB 4KVNH 3SGDH 2HG5B 4PJFF 4Q2ZA 3QULB 1UEMA 4PRAA 5CINL 4B50A 1HSAA 2Z93A 3AMKA 4BFEA 3MV9D 4PJXB 4NRYA 1W72L 4MJ6A 1NFDF 5TDOA 5BW7A 4YDVB 5MENA 3F7YB 3GSNL 3ARBC 2B2XL 3EW3B 1HHJB 4QHNA 3QEGL 1BQHB 1NAKL 4PJHE 4LHJB 4XVSL 4ODSL 1BQLL 4NZTH 1DQTA 1EV2E 4CW1A 5EUKA 3TBYA 5EU5B 2FYYB 1RUMH 5D6CB 2QEJA 5F97E 3BAEL 2IG2H 5DO2C 3D3VD 4G80B 4PJIA 4X4YA 5DK0B 1L9MA 4L3CB 4W70A 4OF8A 4YHPA 2AVGA 4JJHA 3KPLA 3MRFB 5ILTL 1N6QH 2IANA 4DEPB 4DTGL 2W65B 2YK1H 4NDMB 5E8OB 2NY5C 4XCEB 4GW4B 3SKJH 2R1WA 3OKEA 3NABL 4GBXB 1A4KB 3PUCA 3DBXB 5BQ7A 1G9MH 1ES0B 5CEXA 3MFFA 1G9NH 3OJ2C 2B0SL 4XHQA 3OZ9L 4Y5VC 4J8RB 2DBLL 4OGXH 3O3DB 5JOFA 3FRUB 3UC0L 1CT8A 32C2A 3TLRA 5GJSL 3GRWH 1UJ3A 4XC1L 3W2DH 4NN7C 3WFEL 4NNXA 2HRPL 4WO4A 5F1IA 3HNTH 1AP2A 1J5OH 2UWEB 1AIFB 3MC0A 4YQXL 3WLWC 1L7IL 1X4YA 3I50H 1P7KA 4PP2A 5FYKU 2NX5A 3D1MC 4HXBL 4MLIA 5HI5C 2F54B 1XF3A 5I66A 2EDOA 2GK0B 5E94B 1MIML 4MAYC 1NBYA 3TBVB 5MEND 1T21A 2EDQA 2FEDD 2P5EB 2D31B 2YRPA 4G9DA 2HT2C 1G84A 4I9WD 2C4FT 3MQIA 1ORQA 4Y1AE 1VFAA 1S7RA 4AIZA 1J0KA 5E99L 3MRKB 4ODTL 2EXWD 2Z4QB 2BXZA 4L4VE 4ZYKB 3U1SH 2Q87A 3CDGB 4LDOB 1J0ZA 1SMOA 3ZSTA 5CHNB 1ZT7A 2ZCKL 4MMZC 2HFTA 1AGCA 3HR5B 1EK3A 2X4NB 4H26A 4XCFL 2DQFB 4WCYH 5GGVY 2V7NB 3U83A 4XMLL 1A8JH 1ZS8B 4XT1C 2XXMB 4KV5E 5E24E 3MZTA 4JZOB 3MOQA 3O4LB 1F2QA 4PG2C 5GGVH 5L8KB 4POZD 4WTZG 4YHKL 2VXSH 1T1XB 4TVPL 5EN2A 3TO2A 3K3QA 2G2RB 4QWWC 1T7VA 3L3OA 1K5NA 1CLOL 5CZXD 5GGRA 5HPOA 3PHSA 1M05A 3PL6C 3PXJA 3W39A 4FXKB 4JM2A 3AFLA 1ACYL 1NFIA 4LLWB 1FL6B 5JLZA 5KN5B 5TQ0H 2YSSA 3U46B 1KCSL 1TJGL 4PJEF 4RMRA 4WO4D 3PP4H 3O3EA 5E08H 1OGTA 2EDHA 1R6VA 2YC1A 5ALCH 3ZKMD 3VGAB 1K2DB 5EO0A 4YGAB 1SBSL 2EC9U 4IRSA 1FHGA 3NA9L 5FGCB 4P59H 4GKOA 5GRUH 5JNYA 1EZVX 1P1ZA 4GW1A 4K7PX 4HHAB 1YN7B 1RIHH 1U2CA 4S1RL 2I26N 3EYSH 4OM0L 2JCCF 2W0FB 2HKHH 1F3DJ 4FQHB 2IPUG 2V5SA 4TPRL 3WHXA 3P9LB 2BVQA 2P8PA 2M8XA 2F53A 4OT1H 4E42B 1ED3A 3QR2A 4NWTL 4H0IA 5FKPA 3Q6GH 3QI9A 3O2DH 4P3CH 1QA9A 5HI4C 5ICZB 3RTQA 5JA9A 4X8XA 1FGVH 1FPTH 3SJVB 3CXHJ 1H15B 2R4SL 4R90H 3GUTB 3N1GC 5EU7C 5D1XA 3CVIH 1JNJA 3KPPA 3RZCA 1EBAA 2NY4B 3B9KC 4LNVA 5K9KA 1CR9H 1MCIA 1NL0H 2BVOB 4Y4HB 5T3ZD 3RVXD 3UO1H 4QTHB 1WWBX 3HHRB 1KJMB 3H3KA 1XF4A 3VXTB 1OOAA 2CKBB 1MNUL 2ID5A 5IF0B 3S37L 5I17A 2YD1A 5DD0L 3S9DB 1AXIB 5ADPH 1R3HB 1S9VA 5F9OH 3S6CA 1QD0A 5H2BB 4PY8I 2VLJB 1W72B 2DYPD 4XBEH 5KSAB 1V8HA 4L8BB 2AV7A 4MHHI 3GSNB 1FDLH 4JFDA 4L3EB 2C3GA 1SEQH 3BEVB 4U2ZA 4JHWH 3HUJA 4AG4L 5IV2B 1CICC 1AGDB 1I1FA 5CGTA 1GHFL 3CNKA 1EAJA 5M95B 2XWBB 5T3XE 4FFZH 3QCTL 3W9DB 3G6JF 5GS1C 2BY1A 4IRSD 4EI5D 4I8DA 4LHUD 5I8EB 1LGVA 3J8F7 4WFGE 1N4XL 4JRWA 3F12B 5ITBH 3L5IA 2ADIB 4YXKL 2GJ6B 4F7TB 2ICEA 5F8RC 5DUPL 1OSZA 1NCUA 4JDVA 2IFFH 1Q0XL 5EO1B 2EEDA 4IS6B 4WY7L 1Q9KB 2IC2A 5HI5D 4HMEA 4RAUA 2IEPA 4EOWL 4HUXB 1NMCB 4LK4A 4LAQL 1YPZB 1WBYA 4HJJL 2W0LA 1A1NB 5F7HA 3EYUH 2FJHA 4JCLA 4QYOA 1WLHA 4X8JB 3NIGF 5D1ZA 5D6DA 5JZ7D 4B53A 2W38A 5ITFB 3QUZB 1KIQA 5E9DD 4HUWB 3L3DB 3NIFF 5F1NA 3DURB 4G6FD 5F72S 4DUXA 3ZTJG 5DURD 5GGSA 1JV5A 4FQJL 3HCVB 1BBJB 3ILQD 3O6KH 5DC4B 3CFEB 5GJTL 3N1MC 1GOFA 1UWXK 4UQ3B 5DJ6A 4GO6B 3KLAA 5TDPA 2XTJE 3C2SA 3H7BA 3PGCA 3RGVC 1I9IL 2LV4A 4UV4H 3FOLA 4Z7NF 3KWWA 1ZWIA 2PYEB 4BZ2L 1KF9B 5CEZH 2A6IA 2IQAB 5D2NC 1HSBB 1KCKA 4OUUA 1CGTA 4YDIH 5D2LE 4LPTA 5FO7B 2WP3O 2XZCL 3GMLA 2C9AA 4IJ3B 4FNLL 4JFDD 2ZUVA 4U05A 5DHYB 1ZLSL 43C9A 2PKDA 5MERB 2F58H 3UTTE 2CKBH 4URTB 1Q1JH 3JSSA 2EDKA 3C5ZA 4NOFA 3WNLA 3ZKXC 1LDPL 2AEPL 1LE5A 1A7OH 2FX9L 3WHE0 1LE9B 1MJ7H 2VITA 4PB9L 4JFXB 1ZA3A 1W72H 1KCVL 2Z92A 1NUDA 2QQLL 3DGGB 4HXAH 3T77A 3GSNH 4A2MA 3WD5H 1YY8B 2CLVA 4HPYL 2DI9A 1KCRH 4L8SC 3QEGH 2OCFD 4K2UH 4PFEA 3MUGB 1FG2A 4ODSH 4L3AA 1HI6A 3Q1SH 3KXFE 2UZYB 4KK5D 1VA9A 1MCRA 3NIDF 5HYIA 2ZP0T 1U41A 3MRCB 3PWPD 2AKRA 1T80A 3DPBA 1F5WA 3G04B 4M6NH 5DA4A 5F6HI 5ILTH 5JORB 3RDTC 3PHOA 3ARDA 4DTGH 1TENA 2BHZA 4LKCB 4JN1L 5DMKB 1CWVA 4JY4B 3V9FA 1I9RL 1YECL 4WW2F 3GKWL 3QAZC 3VGHA 2NY6D 5DHVB 1A5FH 1PKQB 1ZHLA 5CKGA 3UTSD 5HHOB 2B0SH 5JOPD 4E0RB 4PV9B 3OZ9H 3WKNA 5CBAA 1NC4A 5EA0L 1MUJB 3AC0A 3ARGB 3MLXH 4P5MA 5BMFL 3DROB 1QLRA 4TRPL 1MWAA 3D69A 1FFNB 4R7DA 3CZFB 1JJUA 2D9CA 1DP0A 2EIDA 3WL9A 5D7LA 4OJFH 2HRPH 3FQXA 5LBSH 2Z0BA 4QHMB 3RPIB 5DJDA 2FRGP 1FZJB 2OM5A 4YXHL 3H3PH 2ARJB 1U8OA 3QIUB 4HXBH 1OB1B 4AEFA 4LCYA 1SY6L 4TSBL 1ZVSA 1DBJL 4LGRB 3DXAA 1MIMH 5IW1A 3QUYC 4Y4KA 5FCUL 1A1OB 2AV1A 3ZDXF 3O2WL 2CK2A 5E99H 5J6HB 2MTPA 4ODTH 4PYHA 1FN4B 5D71L 4ZAKB 3TNMB 3U30C 1DTUA 1OSPH 2XZQL 5IQ9B 3HPLA 3CK0L 5CIPA 1IT9L 1I9EA 1UQSB 3SDXA 1XCTA 2CRMA 4N68A 5ALBL 5KVDL 3VXSD 4S2SB 3GDBA 3ORJA 3C6LB 3GI9L 2YBRA 4H5SA 4XMLH 4JZJC 1FYTB 5EUOA 5INDB 3D9AL 1LILA 4JHAH 3KPSE 3AMLA 1ZHKA 2CRYA 4XXCC 4P2RB 4LCWD 3OJDB 2KKQA 2AXFB 4JHBA 5ELIA 4YHKH 5GIRA 3TIDB 2NY2D 3DHJA 5ICXB 1J05A 4YFLI 1JFQH 4LP5A 4TVPH 3GGWB 5DXWA 5JIKA 4KTDL 1H3VA 4X0KA 1K8IA 1NGXA 4C56B 2DBJA 3WJLA 1CLOH 4HWUA 3CCHB 2X44D 4R6UA 3REWB 1T7WA 2Z9TA 2R1YA 5F9DC 1NC4D 2VABB 5IGXL 3R0MA 3ULVE 3QWRA 4DGVL 1QZ1A 3V4UH 5I6XC 3A6BL 5D7IA 5IW6A 4XI5C 3SKOB 1O0VA 4Q9RH 3IB4A 5IFJB 5JUEL 4HWBA 5SX4H 4PRDB 4KFZC 4ZUSA 4H8WL 3WSQH 4YDLB 5JHDD 5JW3L 3UAJC 2CIIB 4FQCL 1AD9B 3TPUA 4R0LC 5DHVH 4HZAA 5DS8A 3P11L 3QXAB 4ORZC 3HKFA 4QY8A 3NA9H 1FZKB 1YEHH 4NQVA 5F7DA 4OIIH 4X9IA 1U3JA 4N0UE 3MOBL 4S1RH 3DXAD 3IDNB 4ZFOL 4F8QA 1NJ9A 4Y4KD 4QT5B 1W0VA 2BVYA 1PAMA 4TPRH 3T0BA 3MREB 4TN9A 4MXQD 1DCLA 2J88L 4NFCA 4PGCA 2QQNL 1Z9SA 4D9RE 3WFBL 4Y5VB 5F88A 1N7MH 5CAYB 3QNZA 2FEEI 5DD6A 3STBA 4XAKD 3N06B 3RBGA 2R4SH 3NAAH 1GRWA 3NZ8A 1F11A 3PIQA 1MLBB 3FQRB 3SDYH 1H3PL 3D39B 1V7ML 1DE4B 1K6QL 1BEYH 3CFBB 5J56B 4BJLA 1J1PH 4LIQL 3SGJA 3ZMRA 4I0KA 4Q0XL 1C08B 1J8HE 3MO1B 1C5CH 4QOKB 1DEEA 4PTTB 2IALB 4OZGA 5SWZB 1MNUH 3OL2A 1OCWH 4PJAE 3JWDL 4MAYB 3QJFB 3C6SB 5EWIH 1X5AA 5C6TH 4H20L 3SDAC 1RZFH 3VXPA 1N3NB 4ZO7A 4LQFH 3QWRD 4PRIB 2HT3D 3K4DA 5JA8B 1Z9OA 2VR9A 2R0ZH 4M6OH 4YFDB 3BP6B 1KG0A 3F65A 5EOTA 5CGYC 1QSEB 3CFJB 4PJHA 1Y18A 1YMHB 2DKSA 3MOAH 5FHAH 3BI9X 2BJML 1PY4A 2OZ4L 5IOPA 4YUEL 5HD8C 4JFPB 4LLQB 4AG4H 4F80A 4D9QE 3RI5K 2XV6B 2DTSA 1T2XA 1CFSA 2DQHL 4IOFC 1S7TB 1NGPL 4MJIB 4ORGB 5FIEA 4R4ND 1FFOB 1AE6H 3QUXC 1WUNT 3QT2A 4WJ5A 1NGYA 4F8TA 4KDWA 4MNHB 1N4XH 1HCVA 2VQUA 3TJEH 4J4PC 4Q74A 5FYJL 2QTEA 4GUPB 5EDXA 3U48A 4YXKH 4G42A 5D9SA 1AKJA 1A4JA 3K81A 1N5AB 1QRNB 1LMKA 2MCPH 2BSSA 3TM6A 4TNVK 4L9LB 2XN9E 1DQDH 1JF1A 4MD5B 3RA7L 4YBQC 3TJHD 3GMQA 1TITA 1UG9A 1JWSA 1F8TL 4Z7QE 2Q76A 4R2GB 4JVWA 5ADOL 4EOWH 5AD0A 4JQIH 5IJKC 4KZDH 4WI4A 1KGCD 2VDLH 3VRLE 5DQ9B 4EEEA 4Q6IB 4UUJA 2X6MA 1AY1L 5C0DA 2NY5H 4RFNC 3Q5TA 5IEHB 4Y5XA 3MV8B 1TVDA 3ARRA 1RURL 2RCSL 4HT1L 4B5EA 1BOYA 4PJGA 1Q9WB 3S35X 1IAIL 3ARPA 3MACH 4UIMA 1X5XA 4UINH 1CTNA 4ONOA 4FQJH 5CJXC 4F37F 3EKCA 3TT3H 2H8PB 3VMOA 3ZDZF 5C0IA 3B3IB 2VQ1B 3DHMA 3EYOB 1HN1A 3VFMB 3V6FB 1CU4H 5C0NC 2JJTA 3HE6C 1I9IH 4P23B 5DWUL 4JM4H 5DJCB 4BZ2H 4NT6A 5KJRL 5EZLA 3HZYA 3C9NA 1T5WB 4K8RL 4PY8J 3S36L 5IVXF 4PJ9A 1RIVL 3L3GA 3LKQB 4Y1AA 2G75B 3JZ7A 4K9EH 2XZCH 3DX9A 1ZLSH 4MNGE 4DN4L 1CGWA 5K59F 1HXMA 3FN9A 2QLVB 5I1LA 1MSPA 5FUZL 4JFFE 4HQQH 4HWEL 1INEH 1CG9B 3D2UB 4KH2A 5F7EL 3VXQB 4I18A 4M1DL 2FX9H 2L0DA 3TO4A 3G5XB 4MYWB 1FVEA 2VB5A 1KCVH 3UJJH 1R3KB 4O58L 2Q20A 2A6KB 3V7AG 5FA3B 3VDCA 1RK1B 2IAMC 5AYUH 1AKJD 1UXWB 4PJXF 4HPYH 4YX2H 2NY1C 5F1KC 1JZ3A 4HUKB 3IFLH 4OQTH 1VACB 4NIKB 4Z77A 3MCG1 4UBDD 3VWKB 3DWTA 1HEZA 3VDAA 1INQA 5A2FA 4JQVA 5E70A 4JG0L 5HDOA 4OLVH 3MGOB 3SDCD 4Z7OF 3QHZH 2OR8A 1P53A 4PJBE 4D2NA 1D5MB 1RUQH 3WS3B 3HNVL 3SE3C 5D70L 3P0VL 5J1AA 5E4EB 2VOTA 3VMPA 3VXRE 4DUVA 1CICB 4KJYB 1CD8A 4KTEH 1X4ZA 4KK8C 4TULL 4AIXA 3DMMC 4X7DC 4MJ4A 1F90H 2VXQL 3VGGA 1YECH 4WU5A 1TCMA 2NNAB 4KKNA 3IAPA 4JFYA 5A3ID 3B43A 4EZMA 2P47B 3BGFC 5GRVL 4C57C 3LN5B 1V3KA 1NDMA 5A1AA 4NQSB 1JNHB 2DI7A 4Z7UE 5LAXB 3UTQA 2J8OA 4TRPH 3GIVB 3V5HB 3IRPX 4KKAD 4Y1AD 2WWMD 1C1EL 5FYLH 4L4VD 1Q72H 3QDMA 4JGUA 5E1AA 4NJ9H 2I9TB 2EEAA 5C0RL 1A6UL 4HIJA 5I15L 4WTZA 3FO0L 5DJZA 2N7BA 4QF1B 4YXHH 3FHQA 4RA3A 4Z78A 1EJOL 1QR1B 3TO4D 1PG7W 1TJIH 4YDKL 3B8SA 3WE6A 3B9AA 2ZOLA 3F5WB 1ZGLB 5D96C 4DOHE 1SY6H 2KQMA 4TSBH 2ZWLT 3UBXI 1DBJH 1FLTX 1U58B 5EU6E 5SWQA 3O11A 3FQUA 2CO7B 3CFKB 4HJGA 3BP5B 4QGYA 1KV3A 5MEOA 1S8DB 5C0FB 1I8KB 1B0GA 1A6ZB 3O2WH 3IAQA 1T7YA 3CLEL 4U2YA 3RGVB 3X3GH 1TZIB 5SWSB 4QNPE 4MD0B 5FHBL 1ZLWH 5F96L 2EKSA 1ZANL 3H9HA 5D71H 3E3QE 1Z2KA 4YDJA 1P69B 2KQNA 5IG7A 5DUMH 3ILPA 4FQ1L 2BNUB 3PDGA 1IC5H 3CUPA 3NFNB 3W0WE 3UBXB 1KENH 3EDJA 4HDIA 4KQ3L 4WFEE 3QG6A 3TZVA 5F3BA 2DM2A 2YR3A 3G5VB 1O5DT 4R9HA 1A9EA 4YHZL 5F6HJ 3QUKA 4DKEH 3D9AH 5IHBA 2EDRA 5DVNA 4RWYH 4U3XA 1BECA 1OY3B 3VWJC 5H35A 5FF6B 3BGMB 5C2BL 3BZEA 3BMWA 3PWLA 1P2CB 3O2VH 3WV0A 2BP3A 4QRUA 5F6IC 1HILA 1BLNB 2AK1L 1FC2D 4KMTL 2W60A 5DMIL 2NXZD 5F7MC 1ETZB 3LEVL 4JO2L 4NNYA 5IUSA 1JPGB 4DGVH 3GB7A 2NXYD 2V2TB 5CD5D 4ISVA 1NCDH 4LP4A 5ENWB 2X4UB 4FFYL 3WJJC 5B39B 3RWEA 4XTRD 1U42A 2O5XL 4LVOB 4NYLB 1XIWC 2W0PA 2VE6B 3KYOB 4PRPE 1KEML 5FAAA 4H8WH 4YPGA 1C12A 4FQCH 3VW3H 1AHWB 3MRQB 3P4LA 1M7IB 5TGBA 2P8MB 5DZOA 2BOBB 3PJSA 5JMRA 3CDYA 1TZGH 2M26A 1YEEH 5I1EH 3L6FB 2YZ1A 4AEEA 3LD8C 2X4QB 3RVTC 2AJZB 4WEUD 3HTLX 5DD1L 1V7NL 4QTIL 4DVRL 4HJ0D 3ARYA 1J9CT 4HKXA 5C3LD 3D18B 3FT2B 4NQCB 1AFVH 4RAVB 3FOMB 1CD9B 1H3UA 5BW7C 3OKMB 2XYCA 5DQJB 3VG0H 3CSGA 1LVEA 2GCYA 1RZIB 4ZOAA 3C87A 4RA0C 2DQGL 1G7QA 4NO2B 4A6YL 3RHWF 3WIIL 1H3PH 4JO1L 2XWJB 3QNXB 5F8QC 4PLKD 4LIQH 2O5YH 3CU7A 2DM4A 3UTTA 1BFOB 3WDHA 2YPLB 3QQ3A 4I77L 3WIHA 4Q0XH 4WUUE 2EDWA 3FFCB 1DQJA 2D0FA 5T3XD 1KELL 3RY5A 2HVKA 3MRGB 5BO1H 4EDXA 3QIBB 1AI1H 5TE6L 2NYYC 4P3DB 5D72L 3LHPL 3NN8A 5LKNA 3BW9A 4WFGD 15C8H 2BNQB 3U4EB 2FATL 3UDWC 1B4JL 1JZ5A 4U1KA 4P4KC 2PXYB 4XP6H 1ADQL 1MAKA 4KK8D 2GYSA 1PYWA 1IBGH 1GAFH 3OAUL 3TT1H 2DWDB 2P5WB 3OKKB 4N8VB 1X7QB 2ZCLH 1OTUC 4YUEH 3KXFA 3GSUA 3VXNA 4OZFB 4UI2A 4G3YL 1TPXC 4GXVL 1IFHL 3QWQB 3HMXH 2BCKB 2DQHH 5IFAH 2CMRL 4I2XB 2ZG2A 2VDKH 1GC1L 3BH9A 4TVSa 3VXMB 3BPLC 3GMOB 1ACZA 3DECA 3X13B 2DMBA 3NFSH 1A14L 3ARED 1D5ZB 1L6XA 4OCXL 4X6CA 2F19L 5FYJH 3MUHL 3FO1A 4O4YL 1R3LA 1FL3B 2DLFL 4YGVB 1U3HC 4IIQC 2NY0D 5J9PA 2CD0A 4UDUB 4WWKD 1CXIA 1IILE 1XZ0A 1RK0B 2XTJD 1E4KA 5C07A 2A73B 1G0YR 4KI5F 3RUGB 4KK9D 2EDXA 3IDMB 2R2HA 4QXTA 4KGLA 3KDMA 2CKNA 3LKNB 2Y6SC 1AO7E 1M7DB 3UZEA 3MMEA 5DD5L 1DL7L 1YPZF 1H5BA 3PQYB 4MS8D 1HWHB 4R0LB</