5J06A

Structure of the immune receptor cd33 in complex with 3'-sialyllactose
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
213
structure length
213
Chain Sequence
GFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title STRUCTURE OF LIGAND BOUND CD33 RECEPTOR ASSOCIATED WITH ALZHEIMER'S DISEASE
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Myeloid cell surface antigen CD33
total genus 48
structure length 213
sequence length 213
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j06A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j06A02
5JNYB 1QZ1A 2X4QB 3O3AA 4MDIB 2VZ1A 4K9EL 3MXVH 1UWXH 4JREB 4P5TC 5E8PA 1U91A 2VXTH 3F58H 1CLOH 4J3VA 3KWWB 5IEHB 3KXFA 2AJXL 1LGVA 3U83A 5D2LE 1I8LC 2JTDA 4TVPD 4QTHB 3STZB 4UTAL 2FZ3B 4LCUA 1OWRM 2QQLL 1DUYB 2OR8A 2VDQH 2A6DA 4DVRL 5A16B 5CHNA 1MCNA 1CF8L 3TYGH 2OK0L 1OAUL 3MRBB 3VGDA 1B0RB 1Q1JL 3HMXL 4U1KB 2VUYA 5DZNA 1MCOH 2F54B 4OZGB 5LKNA 1KNOB 5I1DB 5E6IC 1L7TH 4Y5YC 1FFPA 5HI4C 5EO9B 4Y4FA 4RA0C 5C3TA 5IGXL 1GAFL 1RSFA 4KPHH 3UC0H 1OGAA 1N5YL 2ATKA 15C8L 4XNXL 4I0PB 2R1XA 3BSZL 2VLRA 2D9CA 3SBWA 3GI8L 1VFAA 3EO0B 1NCBH 2OJEA 4FTVE 4PJCF 5I75B 3CSPA 4LLWA 4X80H 5DGQA 4WY7L 3B2VH 2NY5H 1AD0A 5EU6A 1XIWD 1TPXC 3GJEB 1S3KL 2O5YL 4I3SL 4M5YH 2P5EE 1OAZH 3P30H 4NQCB 5F9JA 4N1CA 3GJFK 4IOFC 3RL2A 1D5ZB 3CFCH 4U6VL 5K9JL 4L4VA 2R56L 4JG0H 5T3XL 2IJ0C 4LVNB 3RGVC 2P47B 3FHAA 4LPUA 5ELIA 1IM9A 3NIDF 4K3DL 1PQZB 1I85A 4P2CG 5IW1A 3EO9H 4WWKD 1FVDA 3CFJA 2CR3A 3BPNB 5CBEB 4PJBA 3EDDA 1SEBA 5DQJB 2DTSA 1MFCH 5GJSH 3UTTD 4PJDA 2WBWB 5E1HB 3VWKD 4K8RC 3LPFA 4PRPE 3EOYG 3MNWB 5F6IB 1OHQA 3SGKA 5CD5D 3CH8A 1RHFA 5GISL 4QRTA 4U1NA 5IVXA 3C5JA 5ADPH 4IDJH 3EFDL 1K2DB 4M1GH 2KDGA 1Q9KA 4Y2DC 5L8JB 3DGGA 1K2DA 4ELMF 5IFAL 1KCLA 4U6HA 3X14B 4OGYH 2FYYA 1CN4A 1ZWIA 2GTWB 3OWEA 5I71C 5L9DL 1OAQH 4WU7B 1MFEH 3MROA 4GKZA 3BIBX 4NNPL 5EUOE 3Q1SL 1CU4L 2DQHL 4PV8A 4YEEA 3ULVF 2EXYC 1ZTXH 1SEBB 4JFDE 5FM5M 3WHE0 5E9DE 3ILQC 2H1PL 1NBYB 4YPJA 5ESQB 1I3RB 1KLUB 1A8JH 4YBLC 4YK4C 3MBXH 3NCJL 3B3IA 4KJPC 3RA7L 5BVJB 1XGQB 4JCLA 2NXYC 1U3ZA 1MIEH 4EN3D 2W65A 3S37H 4U6XA 5TQ2L 1JWUA 2OQJB 3D0LB 1WBZB 2X2YA 1G84A 2Y36L 3PHQB 4NP4L 1HHIB 5EUKA 2EIZA 4ZAKC 3RNQB 3Q6GH 1F3DH 2ZUSA 4M7ZC 4OCSL 3GGWA 3U7WH 3RHWK 2Q8BL 3MRHB 4JFOB 2XKUA 2Y5TA 1YEGH 1KYOJ 1YPZB 3QIBA 3B9VA 3HI1B 2R1XB 2VDOH 4M6ML 1G9NH 4FXKB 4ELMB 4H0IA 2ILLA 1HH6B 3LV3B 3KPQB 1KLGA 5IBTL 1B2WH 2O5ZH 4ZFFB 4OFYA 5HYQB 1V3MA 5I1DA 1BFOA 2M8XA 4FQ1L 3ULSB 4XNQA 4NQCA 3IGAB 5DQ9B 3TVMA 4XNYL 3WIHA 4PRNB 1N6QL 2I26N 1PBYA 4RMQA 4L8CB 5D7LB 1UZ6E 4G3YL 4Y4HC 3L9RB 1ZHBA 4L8DA 1U8HB 3GUTA 4KK8D 3WNMA 4NPYB 5DA0B 3I02A 5DURB 5EN2A 2G9HB 3CFKB 2XNAA 1XGPB 2V2TB 3S37L 3PQYB 3ZT6A 5FUCC 4O58L 2X4PA 1LE9A 4MGXA 1JHTB 2E3VA 5CAYB 5I16B 1ORQA 2BVYA 1AFVH 2DLGA 5I1JH 4AL8H 3MXWH 3C09B 3W9EB 3GBNH 3RJDA 5MEPA 2BC4A 4UV7H 1INDH 3VH8B 1IGIL 3B43A 5FO9B 1S78C 4JO1H 3FFCE 3I3DA 5I1LB 4XC1L 1F00I 5A43C 1U2CA 4E5XA 4YHYB 3MMEA 1Z9OA 4X4ZA 3O2WL 4YUEH 2GITB 1KCUL 1Q9LA 1CLCA 1G1CA 1YYLH 3QEUA 4LLMB 3QIWC 1H0DA 1MRCL 4OIIH 4QF1B 2P5WB 4P23A 3VG9B 5EOQL 5FGBA 3WS6A 4LEXL 1FBIL 3GBNL 2VZOA 5IP4A 5I73C 4PRDA 1ZK9A 3AAZA 1JNJA 5E8NB 4POYA 4POZC 1XIWA 4Z5RA 1MJ8L 2D03L 2NW3B 1UB5B 3A6CH 3NOIA 3MPCA 3S5LA 4K3DH 1T5XB 1KIRA 1X5FA 2VE6A 5J6HB 3UTSA 4NKOA 2UWEA 3HZMB 4GRWB 1JCKA 5IWLC 5KANI 2D0FA 4MCYA 4H88L 1FZJB 1CYGA 1IZKA 1FYTA 3TA3D 4F7PB 4XBPA 4LSPL 3QXAA 1QACA 4MD0B 4QHNB 4G9DB 2ADGA 4DK3A 5D72L 5DI8A 5FCSH 1KELH 1CTOA 1YYML 4S1RH 2MHAA 1OSPL 2WBJD 5BW7C 4XNMA 2FECL 4Q74A 5F1SA 5F7KC 4ZXBD 3VDBA 1ZLWK 5LGJB 3J7HA 3OJ2C 3X17A 4APQD 4ONOA 1I8MA 1LDSA 1MHHB 4BELD 5D71H 1EDQA 3EJYC 1JTOA 4JAMA 2OTWA 3NZHL 1AGBB 4LARL 2X9YA 3C8DA 1BHGA 1L7TL 1N59A 3HE7B 4IMLB 1NDMB 3H9HA 5D7SH 3O9WA 4JPVH 3MRLB 2JIXD 3BT2L 2GK2A 4PBVC 3DO7B 4S2SB 3MLRL 3RX5A 2P8MA 4S0SD 5D1XA 5EIIA 1JWSA 3RY5A 1EVUA 2A74A 2JELL 1YEDA 2MNUA 1UWEH 1JNHB 4A6YH 4YFLF 5T1LA 4QCIB 5BRZB 5H94A 3RL1A 4YIQA 5DJ2B 1A14H 2GK0A 3QUYB 5MEOA 5D1XC 4CBPA 5FHBL 4KUZL 3RY4A 4NKDA 2ATPA 3ILQD 2AK4B 3O9WC 2AJXH 5DA4A 1ZHNB 5E56A 2BVOA 3NZHH 1DL7L 1EVTC 1PLGL 2I9LA 1I1YA 4HUXA 4Y5VA 1BIHA 3QQ9C 4U05A 1CQYA 1S8DB 3CFIC 1OD7A 1U8QB 2WIIB 1QSFB 5KSVA 1KJ2B 1AJ7H 4BQBA 2Z31B 1MFNA 1F97A 5EORH 2XPGA 1X5GA 1PG7L 1GOHA 3EOAB 3S35X 4OD3H 3LKRB 1VADA 3PE9A 2N56A 1Z9SA 3O4OC 3O2DH 5D8JH 5CEZE 5C09A 2Y6SD 2DQEL 4I8DA 4PJEB 4R7NA 1CCZA 4XNMB 2R0KH 1BX2A 2P5WE 4N8VB 4HDIA 4MXQC 5TQ0H 4KHXL 1NSNL 3DURB 4PGEB 4NUGL 3CSYB 1LE5A 3D48R 1CD1B 3BEWA 2QHRH 2X4RA 3GSNA 1RJZB 4MCYB 5B39G 1IRAY 3FT3A 3NFPB 2OL3H 4EI6B 5C09D 3HZMA 2VAJA 4BM7A 3T1FA 1XGTB 3JTTA 1OW0A 4XPHL 5GSVB 5F1IB 4Y4HD 2XRAL 4JRYE 2DWDB 2MJWA 3NFNA 3BVNA 2EKJA 1UB5A 1CGUA 4U6TA 2DQFA 4UI2A 1IGFH 5FOBB 2IPKA 4XC1H 1UQSB 1T83A 1WQVT 5EO1B 3V4VL 4FXLA 4JPWH 2VL5A 1DLFL 1HI6A 2YSSB 5EZJB 5BQ7A 1I1AD 3QO0A 3P0VH 5FM5O 3V7MA 1UYWL 2BRRH 4PRIE 3BIAX 2F5BH 2VWEE 2QTEA 3MRIA 4I9WE 3P4LA 1CICC 3VFVA 3LRGA 1QLRA 2A73A 3AS1A 2BY1A 4XHJD 43C9B 3HPLA 4HPOH 4Z76B 1JYVA 3OTTA 1A1NA 2Q76B 4NUGH 5HVGB 2FR4A 2R0ZL 4KHXH 5JA8B 4X7TA 3GMNA 4FQPA 1BBDH 1HQ4A 2YKLH 2ZOLA 2X4PB 1ZLSL 1LE9B 3WO4C 2EDXA 1FE8L 5DD6A 3P4MA 2JK5A 3RU8H 2UUDK 1AGFA 4J6RL 5C08B 1ZT1B 4Z95H 3HAEG 4DWHA 3GZKA 4OIBA 2J88H 5DRZA 3UTZA 4O2EA 4KMTH 5HPMA 1FAIH 5JW5B 2DLIA 3V9FA 3SE8L 4BSVB 4S1DC 4L8DB 3CFEA 3HI6L 2YPVH 3JUYA 2HJLB 4ZUSA 1G9NL 4PP1D 3OKKA 3RVVC 1C16B 1J1XL 1EGJA 5DEFA 1G9EA 1IGYB 5ENWB 4DZBA 2YUVA 1BFOB 5ICYB 3GRWA 5IMLA 1WZMA 3CXDL 5MP6L 1J8HE 2XV6B 3FRPG 3FOLA 3T2NL 1I1FB 3RAJH 4TUJB 1W0WA 1ZV5A 1BGXL 4OQTA 3JWDL 5DR5L 1HHHA 5D7JB 1UEMA 2EDOA 1OP3H 5FCUH 5IVOA 4G5ZL 3BUYB 4Z7WE 4DCQB 2GAZA 2YK1L 1CGSH 3WLBA 2M1KA 1VDGA 2ADIB 2KKQA 4HLZG 1A7PH 3MGOB 2VC2H 4ELKB 5B3NA 1YDPB 2PYEE 4M7KL 4DGYL 1CICB 3MLRH 3KDMA 1F02I 4QRQB 2BMKA 3TNNA 3PL6A 4Q0XH 2LV4A 5EU6E 3RWJA 3SDAA 1V8HA 3IDJA 3GMMB 5C0GA 1S9VB 2OL3L 1MVUA 2K3TA 4LHUB 1MCJA 3BRGC 2YA1A 2VQUA 5FGCB 3VI3E 2VNCA 4PJGF 4X4XA 1IKFL 1DBAH 4XPFL 3OGCB 4EKXA 4X6DE 1ZLUK 4XB8A 1NLDL 3SGDI 4OZIF 4R26H 2GUOA 4M1GL 4LNVA 4BH7B 3UTPE 2CDGA 4MXVF 2AAVA 3SO3C 4CRPA 4PJFF 2BHZA 1U3JA 3LIZL 5IUSA 1GGIL 3MLTA 3P9MB 1Z0NA 2JKXA 3FB5A 3KPLA 4KQ3L 4L9LC 4HIJA 3OAUL 2IQAB 4OD3L 5T1MB 2GKIA 3ZL4L 2PO6B 2NY6C 3V2AR 4R26L 5CJBA 1PG7H 1MVUB 1UM4H 4DFHA 4LEOA 1GGBH 3SPVB 3TBVA 2EICA 5I74C 1FG9C 4X6DA 3ILPB 4KV5F 4OAWB 5IT2L 4X98A 4HKJB 4WWID 3D0VB 3DVNA 2FSEB 1R3IL 3ARDD 1A0QH 4X9FA 1S7WA 3G6JF 4Y16B 3O4OB 2AJ3B 1ADQA 4UINL 3EHBD 1WISA 2HFGH 4X6CF 2ZUVA 4I3SH 3GSRA 2NY5L 2E8YA 5E2JA 4FQXC 3QUXD 4JFDA 5IR1A 4HJJH 3ESUF 4DVBA 1AC6A 3EOBA 5I1EL 5EWIL 3QXTA 3TN0B 2H32H 3OB0H 4J7RA 3X3GH 1PX4A 2J7LA 1ACYL 1MUJA 3MV9B 3HMWL 4HK3N 1UWEL 4LGRB 5IMLB 1JHLH 1QOKA 3R06A 3TO2A 2NX5E 5IIEB 5SX5K 1P7QD 1BLNA 2YUWA 1Z0MA 4LVOB 5DUPH 5EU7E 3MRPB 1Y0LB 2XWBA 2AXFA 3QFDA 2W92A 2FHFA 1DCLA 3BPLB 3RNKA 3CFEB 5HYSA 4L3EA 4I0PA 5HPMB 3S35H 5DRZB 3ARYA 4C4KO 4EOWH 3HI6H 1INEL 2B5IC 4UB0L 1FN4A 3L5XL 3P9LB 5GRVL 4YR6A 1P69B 1F4WH 1A2YA 3K4AA 2YWZA 1AGEB 1HSAB 5C0FA 1A7RL 2I5YL 4GMSL 4LASL 2FDBP 2HTKC 5F9OH 1EAPA 1BBDL 4PJIF 4BUHA 3HPJB 1N6QH 1T7XA 3FN9A 2VAAA 2DMCA 1OSZA 5C0JA 5I1GL 3HC0A 3MC0A 1YEJL 3B8YA 4JANA 5FYLE 2LVCA 1W0VA 2DQIH 2C3HA 1WC7A 4QHMB 2CLVB 1PZUB 1RPQA 5T1KD 3PGDB 5CJXA 1A3LL 5FYKL 3MBXL 3A6CL 3KXFB 5IEHA 4UINH 4QY8A 5DJAB 4FABL 2H1PH 1EFQA 1QRNA 3D69B 3HCVB 5IMOB 1JHKH 4LHUG 3IETB 2IPUK 1P7QA 5EBWA 3DECA 4U31A 1GRWA 4YLQT 5GGRB 1B88A 1KGCD 1FLRH 4OCSH 3DROB 4RFOL 5IHUH 5JQ6H 3EDKA 2JB5L 4AIXA 4N9GA 5F1KC 5CEYB 1I3GL 4PJEF 3HAEB 3HMWH 3U2SA 3MRMB 2P48B 4HS8L 2BNUA 2Y36H 3LDBC 4NYLA 5ADPL 2YUZA 3LD8B 3FQNB 1KCVL 2WMPA 3MRQB 3V5HB 5C07A 3TBWB 1F2XK 1QO3B 3NCJH 3FB6A 5IQ9A 4Z7WF 3VG9C 4BFBD 4WUUE 1U3HD 4RZCA 5F8RC 3RWHA 2D7TL 2HJFA 4QWWC 1NLDH 2FHBA 1BX2B 4N8VA 3I6LD 3PWNB 5D1ZC 1IKFH 2Z92A 5F3BB 2OL3A 3QI9A 4GG8A 5D1QC 1I8KA 1J5OH 1CXHA 4PJFA 4MA3A 5HSFA 5DVLA 3OKOB 5CSZA 3VXMB 1D6EB 1Z9LA 3QIUB 4ODWB 1R3JB 1NDGB 2XA8H 4JGUA 1J86A 1AXSB 4DN3L 2EXWC 2C3XA 1I3VA 4JO2H 4IIQB 5HJ3B 3TH4T 2BCKA 3I50L 1SM3H 3IS0X 2ITDA 4X80L 5EC1B 1FYTE 5C9KA 4OF3A 1MRDH 2J8OA 3K2UH 2ENYA 1OARL 1QBMH 1CXKA 1RZIA 3IDXL 3VWJB 1L7IH 4F2MB 1UJ3C 1DBAL 3C6LB 1R5IB 5KOMC 4S1SH 2GJ6E 4LBEB 2IQ9H 1LO5B 1CXFA 1SY6L 4M6NH 3VMPA 2AK1L 4A6YB 4YK4B 2W59A 2PTTB 3GIZH 4G8GB 2R56H 4YHOH 4XVSH 5CEZH 3AU1A 5IJKA 4O4YL 3L6FB 2NY6D 1ZAGA 3SDCA 3DUUB 3U9UA 4FP8L 1QRNE 3RTQB 4L5FL 5DRXA 1OP5H 3WD5H 4K7PL 4YHIB 3WV0A 3HG1E 5IG7A 1LK3L 5EIVA 3Q0HA 1ONQA 5CJ8A 5IW3A 4K3JL 3MACL 4ZQKB 4A6YA 1RHHA 2EDRA 4MX7B 2NY4B 4HKZB 5EBMA 4JRYA 2X1WL 2BSTA 4JY4A 3KLDA 5K9KA 3F7VB 2OTPA 4FQXD 3TPUB 1H9VA 4LLUB 4HC1L 1TZGH 3MXVL 2YD2A 2DQJL 3U9PH 1WBYB 2BHYA 1OAUH 1Q0YH 2HAZA 2OK0H 1IC1A 3S36H 4S1RL 2ZSVA 1FC2D 4K7PY 2QQLH 1KXTB 2F5BL 1IGCL 1AR2A 4F37F 5F70A 3RZCD 2VKWA 3GHEH 2PYEB 4PGZA 2H6PB 3DUSB 5GIRA 4BH8B 4AK1A 4IOIB 4G8FB 3VE0B 4M3JA 1NFIA 4YO0B 2CUMA 1WIUA 1P4IL 2H41A 1ZANL 3V5KA 3QI9B 4NRZA 4GKSB 4KKAC 3GBMH 2BRQA 3UTSE 4KVNH 3IFOB 4NUJA 5T33H 2CXGA 3NCEB 2Z8RA 4OUUB 4X6CE 3REVB 4HZLA 4NUJB 5ERWA 1ACZA 5F7FA 5C07B 4D8PA 3U6RB 1BVLB 2HH0L 4MWFA 3K4ZA 3QUKB 5EULV 1A64A 4HUWB 1N4XL 3ELAT 2QADC 3T2OA 1YMME 4HK0A 2NW2A 5DYOA 3QNZA 4Y2DD 4KK5D 4PFEA 3P0VL 2EC9U 5AAMA 1MFAL 4MA7L 1IAIH 4ETQB 5IK3A 2J8UA 2NLJA 2VTFA 4YHNA 1C1EH 3JVGA 1BP3B 4P9HL 4V1DA 5I30H 2YZ8A 2JB5H 5D70H 1C12B 2DM7A 3N85H 1EHNA 5ITFB 4P2OB 3RWFB 4Y89A 3S4SG 4LKXB 3JV0A 4KZEH 2NY3D 3QDHA 5KTEH 1N0XH 3O3BB 1AFVL 2VN7A 1ETZB 1VERA 1TJGL 4HWEL 3CSBA 2RFXB 5IBLD 4F80A 5EU3B 5ID1B 4O58H 2RB8A 4CN4A 1DZBA 4Q6IA 3ARDB 2ED9A 2V9TA 1RJLB 4KWUA 1YEFL 3HC0B 4GSDL 3BP4A 5ILTL 2XN9B 3L3IA 3U79A 2DTMH 1AD9B 2H26B 1U3YA 3C08H 3TYGL 3QDGE 3OKEB 3VRIA 3VXQB 2AEIT 2A2QT 3ZHDA 3WFHA 4N68A 2E9WA 2R0WH 4HXBL 1ZHLA 4XRCA 3MJGX 3AU1B 1MEXL 2DDQL 1MIML 3CLFH 3BGMB 3MACH 1Q8MA 3KYKL 4ZYKA 1OOAA 1CZ8H 2ZNWA 5AZEL 5CINH 3L5XH 3NN8B 2XIDA 3DX7A 3VRLE 3ULVL 2EDFA 3VFRA 5B38B 2BVQA 2VITB 4KKBC 3T0VA 3WD5L 4CW1A 3GM8A 3W11D 1NLBL 4YWGH 2CO6B 1CR9H 3FQRA 4PGDA 1TQCC 1A9EA 2W1NA 4UUJA 4JQIH 2Q8BH 3GIZL 1AIFA 2R2HA 1EX0A 5FYJL 5KZCB 1OCWH 4LF3A 3RNQA 1JRHI 2AK1H 3T0EE 1KIPA 1I7TA 5I73B 4U0RC 1HKLL 2XG5A 4HS3A 3RWGA 4KK8C 5GSRA 1M1SA 5F7DA 3PWPA 3KPOA 1FFRA 2FLBT 4MQTB 4ELME 3GSWB 2ZUUA 3TM6A 1SYSB 3RKPA 2Z8WC 5CILL 4E41B 1MCFA 2VSCA 4YPGB 3FQXB 3MNVA 3PHOB 3VXRE 4K7PH 1DQDH 2VDPL 2ZCLL 1F11A 4MXVE 5C7XL 2HKFL 3CCHA 4KY1L 4M4PA 5B8CC 5F1NB 1A1OB 3X11B 3RKDD 4XP9H 4WI7A 4CVWA 4P23D 3C09C 5E00B 4HKBA 3INUL 1RIHH 2JJUA 3S3SA 1DE4B 5JR1L 5ICZA 3MUJA 4HFWA 1EMTL 5C0CA 5BO1H 1XGYH 3K46A 5D1ZB 2AVGA 4ZXBA 5EZLB 2NY1D 2ADFH 4KK6D 3QPXH 3EW3B 3MNWA 4G80B 1LEKB 4RGND 1G6RA 1FVEB 3LIZH 4XNZC 1BD2A 2HT2D 3GHBH 4PBWD 3I2CL 3WHXA 3H7BA 1SJEA 1Z2KA 1Z9MA 2XA8L 3B2UD 1CE1L 2AEPL 3EO9L 3VXSE 5TF1H 3OSKA 5JW4R 4KKLD 4LDEB 4TNVF 4LGSB 4C58B 1LEIA 3O8XD 2R2EA 3E6HB 4P49A 3QA3A 4Z77A 5T1DL 1CFNB 1DR9A 1MJ8H 3BHBA 5EO0A 5TF0A 3X3FH 1I75A 4GLRH 4AL8L 3MOQA 3NA9H 1JGVL 1NCNA 2F19L 5J7CC 5AYQA 3UBXA 3VH8G 4FA8A 4OZIA 5IESH 4PJXE 1FBIH 4KY1H 1EAPB 1LO4L 1MRCH 4OIIL 1DQDL 4J1UA 4EDWH 1NBZB 1GJIA 1DBBL 2ITCB 3KYOA 1G7IA 4RMRA 3E1F1 3WHXB 3EO1B 1W0WB 1FNEA 3VI4E 5IMKB 4APQC 5IMKA 3MRKA 3HNTL 3OR6B 2EKSA 1OAXH 3O41A 3SQOL 3VXTB 4HGMA 4WNQB 2VLRE 3SGEH 2H2PD 3FFDA 3QEQA 3AB0B 5F3HB 1QR4A 1ZVSA 4Z9KB 4F8TA 4OZGA 1QQDB 1FLRL 5FKAB 2VIRA 1PVHA 2VABB 4OB5L 1QRND 4XMLH 1HIML 4BFIB 5DFWH 9CGTA 5DJZA 1DE4A 1I9IL 3VDAA 2J6EH 5DJDB 3TBSA 1KXQE 5DMIH 3VXTA 3QPQD 4JJ5A 3LZFL 3N1MC 1CZ8L 1JPGB 1S7QA 1F11B 5H2BB 3TFKD 4ZG1A 1S7TA 3ARZA 4LPXA 1PG7X 4JFFD 4UOW0 4V2CB 5C92A 1QEWA 4XZUA 5C0EB 4YDKH 5HD8C 3Q6GL 4NQCD 4MNGA 1CGXA 2WM0A 4KI5F 3MLVL 1U6AL 4NQSB 4X0KA 4PRPA 2BOBA 5IEKB 3ZO0A 2H32A 3LS4L 2EZ0C 5BOPA 1I1RA 2W0KA 2Q7NA 5IMMB 5GPRA 4HPOL 4KJWC 3VJ6A 3PGCA 3E6HA 2EDNA 4Z77B 4GSDH 1XAUA 3DVNB 1YQVH 1KJMB 4HJJL 4FFWD 4JO3L 3SKNA 1H15B 3QWRA 5I9QB 4JJHA 4NQCE 4LSSL 4OCYL 1M7DB 1ZT7A 2JB6B 5JPMB 3L95A 5C6TL 3VWKB 5F1NA 1AXTL 3OX8A 2Y6SC 3MRGA 4XPBH 4TQEL 3T4YB 3U4BH 2AJSH 4ZMAT 3EBAA 1S9XB 2SEBA 3I6GB 5M7QA 2GHWB 4O51A 1IMHC 1IEBA 2D9QB 1T83C 2AV7A 3MRCA 2E9JA 2YA0A 3LRHA 1WWBX 1UM4L 3GSWA 1WVZA 3AREB 5AWNH 1JK8A 5GGUA 4WCYL 3M17B 1FO0H 3QZWG 5D1ZA 5EWIH 4LCYB 3P3YA 1KB5A 3ZYOA 1CD0A 4EI6A 4OUOA 2QSCL 1JWMB 4ODBD 4ODTL 1KSRA 1IC7H 2Y07H 1MAKA 2V7NB 2HH0H 2X4TA 2E27L 3RWJB 1VGEH 2V2WA 1J0KA 1NGPH 5CD3B 1RK1B 2I9TB 3SKUD 4FNLL 1CU4H 3D5OF 3EAKA 5TQ0L 1XEDA 4JFHD 4YHZL 1A4KA 3AREC 1B0GA 3VU2A 4L4TD 3T0DA 3G9VA 5HXMA 1PX3A 4XRCB 5FGBC 3WS6C 1BOGB 2C3VB 4FZ8L 5HGGS 5ISZE 4TTDD 3OF6D 4PJAA 1KIPB 4QGYA 3SDXA 4G8GE 2FWOB 1U58A 5CP3A 4P2OD 5BXFB 2BOCB 4XHJC 3ARXA 3U9PL 3IVKA 5DSCA 5C6PB 1OLZA 5INCB 4GAYB 2CLZA 3HI5H 3FHQA 4ZAKD 3VFGH 2IH1B 2ZUWA 1CFSA 1DQQB 5JW4N 1LWRA 3TV3L 1RIUH 2RFXA 3L3HB 3L7EB 2IADB 2B1AH 4Y8DC 2HLAB 1ZS8B 4WJ5B 1KB9K 3LPGA 3NPZB 3P4MB 1CXIA 4JB9H 2LVEA 1WEJL 3PABB 1U8JA 2P24B 1JF1B 1YEDB 3PWLA 2A74B 4YBHA 5L8LB 5IFJB 3QJHB 4DQOL 3MCKA 1TZHA 1FAIL 2NR6D 4GW5A 2A9MH 3LQZA 1A1NB 5DURD 4Y4KC 3E8UH 3O11A 3MLUL 1HHGA 2IMNA 2APBA 3GJFH 4HH9B 1H3XA 1SJHB 4WFFD 1J10A 1OPGH 4H26B 4JY5H 4PJ5B 1CLZH 3QUKA 1AR1C 3NCCB 4R0LB 4KFZC 1TVHA 3RFZC 4PJ9D 3CFDA 5C08E 2PXYD 3F58L 1Q9OA 2MMXA 3HR6A 1JI2A 3UJTL 2EEDA 2NTSP 4UIMA 1Q9WB 3EZJB 4YDVB 3PWJB 3D85B 4AIZB 4KDVA 2QKIB 2P5ED 4V1DB 3DETC 4XCEA 2NLJB 2VDQL 4N0CC 4X6CB 3I50H 1BM3L 2VLJD 3KPMA 4Z95L 3QNXB 3QNXA 3D3VD 3G5XA 3REWA 1JPSH 2EDKA 1B4JL 1URLA 3QIWA 3TZVD 4JE4B 4H1LB 3DXAE 4NKMA 2XZQH 5GJTL 1A6AA 2Q8AL 2F9BT 2YKLL 1VSCA 5E95B 5DTFA 3B5GA 2XZAH 5IFHL 1RZJL 1NKRA 2QKIA 5HHMB 1MQKL 2YHGA 1U8PB 1T21A 1EO8H 3EJJX 3WUWB 3QDGA 2YPLD 1XR9B 3UXFA 1JRHL 1UXSB 4OV6F 4GOSA 2M2DA 4X4YB 1HDMB 4XPGL 3CMOH 4XVUD 1RZFH 3GSNH 4JFPA 1BQLL 5ACMA 2NY0B 5C86A 4PR5B 3EYUL 4HT1L 3BZFB 3ZKNC 2MCG1 1FYHB 5JOFB 1NSNH 4G6JL 4AEHL 5FO9A 1G9MC 2IWGA 3MRFB 2B4CH 3MGTB 4APQB 3NA4A 3RUGB 3EOTL 4Y4HA 4WW1B 2HT3D 4YXKH 2HLAA 4WJ5A 3FN0H 1EHLL 4BSWA 4MD5B 3L7EA 3MODH 3V7AG 1JYXA 4BQ9A 3EHBC 4Y19D 1NUDA 4X5LA 4YBQC 4U2YA 3HZVB 4HKZA 5EBMB 1FZMB 4E0RA 5EN2B 5CLWA 5CD3A 1MRFL 1A02N 4JQXC 4NWTH 5I8EA 3TO4D 5MEOB 2FJGA 2GYSA 3KS0H 1S7VB 2WANA 4KK9D 5C0BD 3D39A 1UACH 5E8OB 1FGNH 4QHKJ 3BW9A 5DQ9A 4WW2B 3UTQB 1FNHA 3AMLA 3ULSA 3NAAL 1AGDB 1UA6L 4CMMB 2VB5A 1HXMB 1W8OA 2FJHA 3QZWB 3HHRB 4UU9A 5HHXL 4KUCF 4AM0B 1V05A 2AK4D 4PJ8C 1CGTA 2APVA 2FBJL 2Q87A 1JPTH 2XKSA 3F7RA 4NC2B 2HRLA 3V8OA 3QNYB 1AJ7L 1EH9A 1YPZA 1U9KA 4UV4L 1T0PB 5DJ6A 3BDYL 1I8KB 2CGRL 2BERA 1JGEA 3FOMA 1D9KA 4BQ8A 2EDJA 2OL3B 4HBQA 1I8MB 4BZ1L 1F4AA 2R69H 3MV9E 4ODXB 2UZIL 1RU9L 4JZJA 4ZPTA 4F9LA 1H15A 1GZQA 4CNIB 3HZKA 1HNGA 1QO3A 4GRLC 1C5DB 4ZODA 2DL2A 1JWUB 1A6AB 2PW2A 1FPTH 1CI5A 5J1AA 4PRPB 5IEKA 3BP6A 4HPYH 1MPAL 4I4WA 4WFEE 1PKOA 4HMDA 5JXAH 3G5VA 4R7DA 3UTSB 1NPUA 2X44D 3OXSA 2KL6A 3QHTC 3X12B 3OG4B 4K3EL 1OAKH 4X8JA 3ZTJH 1S7TB 2MFNA 1XGUB 4OZHB 2FD6H 2E9IA 4TUKL 2JIXA 5D7JC 4D9RE 5EBWB 1IGMH 4R90H 3EYOB 4ZFGL 3RUGF 1M7DA 2W9EH 4OFVA 2ORBH 4MZ3A 4XI5D 1BFVL 1QSED 3RZCB 1AY1H 4X83A 1NMCB 4ZFOB 4EBQH 3QB7C 4Y4KB 5SWSB 3VFMB 1B6DA 2CLVA 4GW1A 4LVEA 3V0WL 1TQCB 5DSCB 3V4PH 4K71B 4Z7VA 4Q9QL 3KR3L 4NN5B 2QBWA 2OP4H 3CAFA 4PY7A 5GQBA 3KJ6H 3C6SA 5F3HA 5GISH 1T1WA 4R2GB 4MNGB 2O5XL 3RPKA 1UKSA 5CUSL 4UT9H 1AGEA 1HSAA 1U3HC 1QLFB 1U8JB 1AGCB 3MO1A 2BXZA 3ZTJG 4Y1AA 4PJHF 4MA1B 1RUAL 4FQCL 3LEVL 3TN0C 1Q0XL 1IAIM 4P46D 1IGIH 5DZOA 3BH8A 4OZIE 3VW3L 3QCVL 2L7JA 5F9JB 4GRLB 2VKXA 4HW6A 5INCA 4LSQL 4I3RH 4X6FA 2EXWD 3THMH 1L9NA 2WNGA 3K1DA 4HSQA 4AT6A 4YDIH 3EKCA 4L8CA 3TZVC 2HTLC 4OF8A 1KTLA 3NZ8B 4UT7L 3WFBL 2FWOA 4R4FH 2I60H 4PGBB 1E4WH 5EFIB 2PO6A 2RCSH 2B0SL 4JFEE 1XF4A 1WZKA 1FNEB 3O3UN 5DO2C 3BJ91 4LK4A 1UM6L 5CZKA 4Z8FH 5KVDL 1GYAA 2IFGA 4PGCA 4L29A 3GI9L 4JZNB 3RIFK 3WNNA 5KG9B 4QXTB 4RX4A 3V6OA 4QEGA 5SWSE 5IB2B 4XBGB 4J3OC 2WBJB 2BNRA 4QRPA 4B50A 1FNAA 1X6NA 3WFCL 5JPMA 1RK0B 1RK1A 4MHHG 2I9TA 1J1XH 3FZUC 4LHUA 4J8RB 5BS0E 4YJZL 3P4NA 3V52L 1JZ6A 3G6DL 1RD6A 5ALCH 3PQYD 3QUYD 3P4NB 4OGXL 3VGAB 2BZDA 5GGSY 4F33A 4KVCH 3EFFB 4YHLH 4TTGA 2RBLA 4NM8L 1I8LA 3FB5B 3FAXA 1XGQA 4QNPF 4KROB 2BDNL 5C0RH 5JHLL 4W6YB 1HN1A 5ESQA 3PG2A 2SEBB 3I6GA 5HYEA 5KOVC 4DZ8B 2B1HL 5JNYA 3T4YA 5K9QI 1T1ZB 1I1FA 1HXYB 3UEZA 2NNAB 4TYUA 4ZOCA 3S34H 4KDTA 4H0HB 5D2LF 1HSBB 5IB3A 3ZDZE 1B2WL 4I0PD 3RPIB 2XACC 4FQIL 5JW3H 2HFEB 2I07B 1AIFB 5F97E 4QXGH 3MUY1 2QSVA 4Z0XA 3V6ZA 1LILA 3FO2B 6FABL 3PL6B 4D3CH 5HGHA 4BFIA 3EYQC 3SGEI 2YC1B 4GAJL 5DVNA 4GUPA 3VG0L 2IQAA 5HY9B 1E6JH 3FB7A 3L3JB 4I77H 4L1HA 2H32B 1FL3A 1QSFD 4U6YB 2C1PA 4JPWL 4DZ8A 3DX7B 1T22B 3RZWA 4ZYKB 5E2VL 3MRKB 4LPCA 1A22B 4WI2A 4CMHB 3UO1L 3X3GL 5E6YA 4JFDD 4JLRA 4JHWL 3GMNB 2XTJD 3D9AL 2N7AA 2R1YA 4JEGB 1I7TB 1UM5H 2Q6WA 2VR5A 4K8RL 3UBXB 4OZIB 3QDJE 4RGNE 3RVXD 4NJAH 4LCWA 4QRQA 3ARDA 2YRZA 4DGIH 2A73B 4U0QB 4ZUTA 2VSDA 4OI8A 3P9WB 1XCQA 1R3IH 2ZOKB 4NNPH 4NQDA 1KENL 1OAQL 2R0KL 5CBAB 1GGTA 3T0WA 5C2BH 1UKTA 2DQUL 1J87A 2VUOA 4HMEA 4QXTA 2VXVL 2OJEB 5CJQH 5CP7B 3UPRB 5GGQL 3OAYH 3ARDC 4L29B 3EYVB 3HRPA 3RVTD 2G75B 4LKXA 3ABZA 4RGMB 1HHJB 1SMOA 3S8WA 1BD2B 1G6RB 1OGAE 4Y4FB 2ZG3A 5F7EH 5J1SC 1U8IA 2QSTA 3IFPB 1LO3H 1Z5LA 1IM3A 1FGNL 5HYJE 1RMFL 1GHFL 1G7MA 2PYFB 4D9RD 1OF2B 3MBEB 1EO5A 1F90L 1NCBL 2F54D 4NQDE 3W81A 1H3GA 1LVEA 2H26A 2NY2B 4D2NA 3HPLB 5JHDB 4RA3A 4YNYB 4S0TD 3OKKB 1A9BA 1G6RH 4GO6B 4ZO9A 3BHBB 5J06A 5SWZE 4YGAB 2J4WH 2VDRH 5E6ZA 5KSBE 3VXNB 1ETZA 4O02L 3CFCL 4U6VH 5K9JH 4LCIH 2JK5B 5TE4H 1NANI 1IARB 4K7PX 2WLYA 4NN7C 2DYPA 1SJEB 2R4RH 1A14L 1A7PL 1JGUL 3JSSA 5JO5B 1G7PA 4RGOH 1TJHL 1X5JA 2Q20A 4PJXF 1HZHH 1RUKL 2Z35B 2B5IB 4G5ZH 2PW1A 4G8IA 3RX7A 4KDWA 3DO3A 3JWDH 5DR5H 3BGFB 3NACH 4MD4A 4K2UH 4MJIB 4KHTL 2F8XC 4KQ4H 5GGRY 1YMMB 2YEZA 4HH8A 5I0DA 5B3JF 1IQWL 4RQQA 1KOAA 1S7VA 2Z31C 1TLKA 4OBSA 4WTXA 2DM3A 2DN7A 2VL5B 4OI9A 1H8NA 5IFHH 2E6QA 2IPKB 2YPVL 1CK0H 1P2CA 1ZA3B 5EC2A 3RIAK 2F53D 1FG2B 4JKPL 2EXYD 4U4BA 1LD9A 5ANMB 5DJYA 2P8PA 3QCUH 5IF0B 1A7QL 4AM0A 4Y4HB 4OM1L 3P77A 5JUEL 3QULB 4Z78B 5FYLH 3BDBA 3ZDYF 3VGAC 4F7CA 1RUML 3U9UB 1BWWA 1H3VA 4KC3B 1FZOB 3QUYC 3QUZA 4MA8L 1S8DA 3FN3A 5LQBL 2D03H 4M3KB 3S4SA 4QRUB 4M1CD 4K9EH 4JZJB 4ZPTB 1J0HA 4ODXA 1F3DJ 4JDTL 2AS5M 1R24B 1AY1L 1J12A 5E4EB 2FB4H 4QOKA 2GEEA 3AC0A 2PXYA 4FS0A 4PJ9A 2GSGA 1QBBA 5LBSH 3FQWB 1F45A 4JDZA 2NZ9C 4R90L 4BSWB 1D5MA 3QCTL 3T0EC 1ZT4A 4QGTA 4HS6B 4WW2C 4DTGH 3QCUL 5DWUH 1CG9B 5KSUB 3E8UL 2R15A 1U8PA 2NY7L 5DJ2A 1VEPA 5D1QD 5IG7B 3DWTA 4FQ2H 3S7GA 4C83B 3VD7A 5I18L 3MQIA 3UTQA 1VA9A 1H3WM 2XXCB 3B6SB 3GSVB 3H8NA 2FL5B 1UFUA 4DUWA 4DN4H 3KPMB 2IC2A 4HUWA 4RAHA 5ABDE 1NDMA 3H9HB 3I75B 3CVIL 3NTCH 3GM0A 3BOVA 3ISWA 3R1GH 4JFED 2EH7H 4QT5A 3VRLF 3NFSL 3F6IA 5C09E 5ID1A 2E5EA 3AAZB 4L9DA 5I8KH 3O2VL 4YDVA 4BZ1H 2BY3A 3WUWA 5HYSG 1NCCL 5H94B 4TOYL 2H2PC 3TWCL 2X40A 1PZ5A 4MQ7A 2UUDH 1ITCA 2NY0C 5DQDL 5H35A 4MJIA 4QHNA 3BJLA 1FYTB 4Z7OE 4F9LC 2IAMD 3BZFA 3PQYE 4HK0B 1GCFA 1DN2A 3D25B 2JCCA 3AMKA 3MLPA 1KIRB 1JTPA 5L6YL 4PJFB 3ZKMD 4C55A 5JO5A 1QKZL 1QFWM 3S5LB 3QPQC 4DKEH 4GQ9H 4I48B 1WZ1L 5I8KL 3Q5OA 3TFKC 32C2A 2YD6A 4YXLH 2Q7YA 2LU4A 4LCWD 5BMFH 1LO3L 2P5WA 1AI1H 2E7MA 1J88A 2H9GB 2NZIA 1NMAL 1BZ9B 4U3HA 4JANB 4NRZB 1EHLH 4X6EB 1MWAB 4XX1G 2EYSB 3L7FB 1NFIB 4PJ5D 4YO0A 2YD4A 4PJHE 3EOTH 5CGYC 3PJSB 5TQ2H 1Y6KR 2YRPA 3I3BA 3ORJA 5AUMA 4FFWC 4GFTB 4MNQD 1AHWB 1G9MH 4AEHH 3HA0A 1JZ2A 5E94A 4KRPB 2Z93B 1MREL 5HYQA 3L3DA 4RFEB 2NYYC 2R23A 3T0EA 2LAAA 3KPRD 1U92A 3CPLA 1ZTXL 1DDHB 5FF6B 5FKPA 2IADA 4NM4H 3WIHH 1WSST 1MFDL 4Y5YB 4ZS6C 3DSFH 1ZEAH 4XPGH 4XP1H 4ALAH 4YX2H 5I17B 5I66B 4GRWE 2XNAB 2WUCL 2Y7QB 3FB8B 4HXAH 5CMAA 2HLFD 1RV6X 3VA2C 3R8BB 1MH5A 3CUPA 4DUXA 5DRWB 2EE3A 3R06B 5IIEA 2VXQL 4GMTL 4QRUA 1RUMH 2H3NA 4Y19E 3SY0A 4EXPX 2K7QA 1W72L 2DQTH 5I1KH 1FNGA 4L4VE 2L0DA 3QEGL 4XBEH 3HS0B 2DQDH 3IGAA 4JFZH 1A7QH 3QHZH 2ZCHL 4GXUN 4DVBB 2W65B 1MF2H 4JFDB 3SDCB 2N1KA 2AQ3A 4NCC2 1DFBH 2Y9RT 4XXDA 2IFFL 2AV7B 3MRCB 1RULH 4W6WB 2W60B 2F58H 5DD1L 4WFGD 3PQYA 4K94C 3CFKA 4WENB 1KACB 5T3XH 1LO5A 1QR1B 4U0RB 1Y6NR 2NX5B 2D7PA 2WUBL 5JZ7C 3BEVA 5IM7A 4OFPA 3MYJB 5DD0L 1CFBA 2DL9A 1N3NB 3BD4A 2V7NA 5I6XC 1OAZL 3P30L 1KEGL 4HCRH 3RWCB 4FMFA 4EIZC 1U58B 3B2VL 4NHCL 4PLJC 4L3AA 4OD2B 2DLFL 5HDLA 1IC4L 1HHIA 4KVCL 1ADQH 3WSQL 1VGKA 1JK8B 5GGUB 4HJ0C 1MI5E 4M1CC 3RIFF 3RY6C 1N2RB 4Z7VE 2EH8L 5A2LH 3FTGB 4OM0L 3GB7B 3SCMD 1J8HD 2MQ3A 4QYOA 4PJFE 3HC4H 4S1QL 2ZUQB 5GGRA 3W0WA 1NBYA 3BAEH 1HH9A 5EIQA 4NGHH 2Z8SA 3HCVA 4LQ1A 4BYHA 4OLVH 2ZUQC 2YD7A 1IGJA 1S9VA 5DK3A 5DEZA 4OLWH 3FO0L 3IDUA 4WW2F 1A7NH 1F42A 3W11C 3TBVB 2MOVA 3DGGB 4ONGH 4IMKA 2FH6A 2KZ1B 1J8KA 3FQNA 2E7LC 4LSRL 4Y1AD 3GMOB 2IG2H 2PTUA 5HI5D 4LVNC 2VABA 4XBEL 4PJGE 4NO0D 3VWKC 5M95B 4P57A 3QDJA 3P9MA 4PJ9C 3BKCL 3UTPD 4B0MM 3QDMB 1CLOL 3QPXL 3WLWC 1NCDH 3M8OL 1BFSA 4XCCH 5EFIA 5BO1L 1CDJA 3SGDH 3IF1B 1ND0B 3DETD 5DJDA 2VLLA 1KNOA 1RIHL 3Q6FA 4KZDH 1DBKH 1JYNA 4LSTL 1O7SA 4OV5B 2FIRT 3EYFA 2YR3A 3MJ7B 5CUSH 2W0LA 1QVOB 2QSCH 5T3ZD 3SO5A 1BFTA 1IKNC 1TZIB 4PJIA 4PB0L 1JFQH 2WQRA 4JHBA 4JZOA 2C1OA 2GW5A 3LEYL 4XP6L 4ZUWB 3QI9C 4P59L 4HQQH 2V5MA 5HHVH 4FTVB 3S9DB 4YR6B 2P7TB 4XP1L 2AJSL 2OX5A 1P5VA 5E70A 4TUOB 1WBXA 3F7YB 1RVFL 4NBXB 4LPWA 2DJUA 4Q7DA 1D5ZA 5F96H 1FFOA 4RBPH 1TQBB 3HR5B 3TGXA 3RNKB 1KLFA 3MUHL 1PSKH 1NH6A 3QFDB 4LIQH 4YWGL 5ACLA 1L0XA 4N0FA 1LEIB 4LSDA 4X98B 1QHOA 4RNRB 5SWSA 5C71A 1DEEB 2PTVA 5JXEA 1T04B 4BSVA 5GGSB 2VZSA 3RVVD 5BJTB 4XCCL 4CL7A 3IDYB 3U36A 1QFPA 1JN6B 4YHKL 3QG7H 5F8QC 2QQKH 1G7JB 1X3DA 4LLQB 2F5AL 5KW9L 5JDJA 1UJTA 3QUMH 3N1PC 1O7VA 5FUCE 2VZVA 4NQXB 5C0RL 3KLHC 3TWCH 3WNPA 4ZS6D 2X09A 5J12C 1NBZA 2MSPA 5I8CB 4YHLL 3HE6C 4G7YH 5CZXC 1MFCL 5HGAA 2Q76A 3K7UA 5E8PB 3TO4C 3U7AA 4ZXBB 1P6FA 4MDIA 1DVFB 3OGCA 1YY9D 5I74B 1B0RA 1T1YA 3ULVC 1UCBH 1MY7A 5CHNB 3ARTA 4GS7B 4Z7WB 1VFBA 1YNTA 3FT3B 1GGCH 3NFPA 3O6LL 1QP1A 4F33B 4U2ZA 2HMIC 3QA3B 4ENED 4OI7A 3RDTC 3VXUD 1F3RB 1KJVA 4WEBL 1IVLA 5F21B 1OTSD 5CD5C 2ZG2A 2BMKB 3TNNB 5B22A 3T04D 1E0OB 3TH3T 5KN5B 1JZ3A 1KIQA 1EFXA 5C8JA 1UA6H 2WQ8A 4NWUH 3SDYH 1WICA 3Q3GA 3FQXA 3MNVB 4M6AA 3SN6N 1T4KA 1P84K 4NQVA 5CGTA 2DIBA 1PKQB 3GKWH 3VFOA 3BSZH 3N9GL 4IIQC 3T4AA 5JZ7D 1ZMYA 1U2HA 4OZFH 4NKIH 3WEXB 4M48H 1BVKA 1HXMA 2IBZX 2QR0B 5GRUL 3CXHK 4I18B 2FRGP 5ETUB 4NZUL 3O2DA 3ZDYE 3NA9L 5E5RB 5F88A 2EDLA 2FCBA 4WFHE 1UVQA 2FJGB 4YDJB 1A4JA 5HHOD 5GRXG 1TNMA 3LEVH 2WLZA 3WMSA 4ELKA 2GQHA 3QP3A 3TIDB 2OZ4L 3MGOA 3UPAA 3GRWH 5HGBA 4OT1H 5C9JB 1DQMH 4GKNB 3SQBA 4C4KT 4R97C 1EGJH 2FEDD 2IBZY 1ZHLB 4WI4A 3O3BA 5DD6B 5E2WH 4Y7MA 3B8SA 4F15B 2C4FT 4ONFH 3TBTA 2YD5A 4QKXB 3VRJB 3SE9H 1F4HA 5D1XB 1YNKL 4KGJA 4P2RB 4YHNB 4HGWB 5DJ8B 4XP4L 2AV1A 4ZOAA 1Z3GL 1DVFC 5GHWH 1MHEA 4ZXBC 5DRNB 2D7MA 2DQJH 5T5FH 4DGVL 3CLEH 3MOAL 2XN9A 3L3IB 4GAGL 3KHOA 4F9PA 3BZ4A 5J6GB 2AJUL 3P4OA 1MH5B 2J5LC 3H42L 1ZEAL 1BIIA 3SE9L 3QUXB 1T1XB 2R8SH 5D7KD 4ZD3L 1QNZH 5D7LE 5AEAA 4BFEA 3FO1A 3A67L 4Q2ZB 1EGJL 4JQVC 1QFWI 1MCPH 3ZHKA 5C7XH 1XCTB 3CC5B 5BRZA 4K3EH 5EU5A 4G9FE 5DTFB 4XCYA 4OTXH 5GZND 3GJFB 5DD3H 1DBML 1NFDB 2EYRA 3AY4C 4J2XA 5ACZA 4GW4B 5H37H 4HUMB 1NGQH 5GIRB 3MJ9H 1QLEL 3SDCD 5KAQG 3G6JB 5FB8A 1RIUL 1AI1L 1SBBA 2P8LB 4X6EA 5MEQB 3F5WB 3VFGL 1CE6B 1QSEE 1QLRB 1C5DA 3VXUA 1GGYA 2GJZA 4P2OC 5EU7C 4ZAKA 4PJHB 5DLML 3PIQB 3WFEL 1UWGL 2V9RA 3RJQB 4KKCD 4Q58C 3TESA 5INDA 3SKJH 5IKCA 1BMGA 1T7ZA 4G6FB 3BPLC 5C1MB 5I71B 5HDBE 2PO6C 4UILL 2YSSA 4TNWF 1GC1C 4JM2B 1Q9LB 3VXPB 1TCRA 1E27B 3OXRA 5CINL 5E03A 4H26A 2IF7A 1FFNB 1WEJH 3MZGB 3OF6A 4LPYA 2A6JB 4HH9A 4XBPB 2BY2A 3DUSA 2WW8A 4KXZI 4L8BA 2ID5A 4U1JA 2NTFA 2DQUH 4QHLB 5MEQA 4MAYA 4QRRD 4WEBH 3S96A 5F7YC 3DIFB 1UCBL 1D6VL 2J8UE 3MFFA 4OKVA 2DTML 4HWZB 3WDIA 3BKML 3U6RA 1RJZA 4LAJH 5ICXB 4JCMA 3ZTNH 1PY4A 3TA3C 4EUPA 3WN5B 1ED3A 4WHYH 3ULUF 5BZDA 3TYFA 3HC4L 4S1QH 1ZHNA 1R0AH 1BEYL 5F7EL 1X6LA 3QR2A 3AXLA 2IALB 3D3VB 1UH4A 2YPKB 5FEBA 3CVHB 1FO0L 1S7SB 2GT9A 4MDJB 3IJHB 3IJSB 4IOIA 4WTZG 3MMEB 5D1ZD 1DLHA 1CQKA 3F12B 3PNWB 2NY1B 1A6PA 5KSBF 3LKOB 5DJ0A 4NHCH 5D7IF 4RFOH 4ENEC 5L2KB 1QFUH 4UIKH 1VACB 2P44B 5BRZE 1KEGH 1NCAH 3VXSB 2ZSWA 4HT1H 1OTTD 3L6FA 1AXSA 1LDPH 3LOWA 2CKBB 3BH9B 4Z7UF 2NY4C 3AM8C 4IEFB 2F53B 1EXUB 2AJYL 5A2IH 2D7OA 2ENSA 5EU4B 3TBTB 4UMGA 2EDEA 4FQIH 4WV1B 3ZT7A 2ICWB 5GGVY 1EERB 3D18A 1X5HA 3RVWD 1JTTA 2VLMD 5D9SA 3CGTA 4QNPE 3L1OL 1RZIB 3O8XB 3VWJA 3L3KA 1FO0A 1KN4L 4JN1L 4OGAD 3O3EB 1P5UA 4XWOD 1S5HA 3ULVE 4OCLC 3FT4A 1RIVL 4GXVL 3PUCA 1TFHA 2HKHL 1YEKL 4E42A 1K4CA 5JHLH 5F72S 3UPCA 4HUNB 4NC0B 2ADGB 3WS3B 1CFVL 4NO0A 4OFDA 1T0NA 3RTQA 4N0UE 4NQEE 1ZGLM 1I9JL 5I75C 2V2XA 2WP3O 4LLDA 3QIUA 3WL9B 4PTTA 3B4NA 1JUFB 2FO1A 4BZ2L 1I85C 5DD5L 2XZCL 5L8KB 3B9KA 3O45A 1ZA3A 3HNVH 1P2CB 3TJHD 3TPKA 4LQFL 1M7XA 1AKJB 1QRNB 3D69A 3CX2A 3DI3B 4YBLB 35C8L 4YC2C 1NCAL 3MV8B 3GIVB 5E2TH 5CKGA 1BJ8A 4WHDA 1NC2A 4NFCA 1KFAL 1EFXB 5LAXA 4YBQD 5C8JB 3S88L 1P4BH 1T0MB 1YEEL 4OFKA 3ZZ1A 3NPSC 3SQOH 3UYOD 4Y5XA 5T3XD 3MRMA 1NUNB 2I60L 1HHGB 4ISVB 1M7IA 1NEUA 2CRIA 4NKOB 1O0VA 4ODWA 1T1YB 2R4RL 5DQJA 3STLA 2Z4QB 1N64L 5C0EA 2J6EA 3LH2L 5IESL 1I3RA 3QQ3A 2LU3A 5SV3A 2UYLB 4AMKH 3L5HA 3OJDB 5T1DH 2PCPA 3IAGC 1ZS8A 1AHWC 2CJUL 5E8DL 3GI9H 2FECI 4P5TA 4QHMA 5J9PB 4NJ9H 1XGPA 4FZEH 3GK8H 1LQSR 4Z7QF 5BJTA 2ZCHH 1MJ7L 1N6VA 2R4SL 1IILE 4A2MA 2DQTL 3LSOB 3WE6B 2DBLH 1CICD 5E2TL 5DHVB 1IM3B 4WRLA 4M61B 3TVMB 3X13B 2B8OT 4M7LH 2QLVB 3IFPA 3KNBB 5EZIH 3HE7C 5I76A 1NKOA 3GMLA 2BX5A 5MEPB 4NFBA 3X3FL 3O2VH 1K3ZA 4H20L 3JVGC 5JXEC 5KBNC 3T8XB 1DQLL 1WFTA 4GBXB 3C9NB 3KPSD 2PO6D 2F58L 5DD1H 5C0CD 4FQJH 1IGTB 1MFDH 4PJDE 5AD0B 4Q0XL 3HUJB 4XP9L 5F96L 2CUHA 2ADJA 5SWZB 1BLNB 4FOMA 3MCLH 1ZLVH 4ODUB 3QEGH 2P46B 3KLAB 3BQUC 3KLAA 2AABL 3LSOA 4WI9A 4LMQE 5JIHA 4TULH 4HIHB 2HKHH 2X70A 2BVPA 3BE1H 3IJYB 4OAWA 2XWTA 4S1DD 4XNUL 3OKYA 4NO2A 1L4IA 1GC1H 2NY3B 2CUIA 1IT9H 3ZYZA 4NBYB 4WCYH 4ZFZA 4FQHB 4WVRA 2OQJA 5ISZD 3Q6FB 4P9ML 4G8EB 1F6FB 3A67H 3M17A 3TZVB 2AXGA 3MRJB 4GLRI 4TSCL 1W72B 1FVEA 5TGBB 4XVTH 5K93A 4G6AD 1KTKE 1FFPB 3K8KA 2AJYH 4X9HA 4UDTA 2WINA 2AJ3A 4R4BB 2C1PB 3IXAB 3TH2T 3FB7B 3L3JA 2UV3A 1CR9L 3QDMA 4NZTL 5LJYH 1T3FA 3QUMB 4H5SB 4MA8H 1YJDC 4UV4H 3C8KB 2A6DB 5H8DA 4AEIL 1T7WA 3ILPA 2OR9L 1G6VK 4U6HB 3TN0D 3GMOA 5ESAA 4M02A 2FBJH 1JGDA 3KPTA 3WIIL 3LS4H 3CDCA 5C2UB 2R2BA 5ITBL 4HXBH 4Y19B 4ACPA 3KLSA 4QRTB 3X11A 4D0DA 1JE6A 3CCHB 3K3QA 1HKLH 5E4EC 2PCPB 1QSZA 1VFUA 3OJDA 4KAQH 3QG6A 2X89A 4DCQA 3EGSB 4JQIL 4AENA 2VOTA 2CIIA 3ARFA 1NGZB 1QA9B 2NY2D 3HZYA 3ARGC 4JRXA 4NZRL 3BDYH 4PV8B 4ISVA 3V52H 2JJTC 4XWGL 3CVIH 2RIKA 3G9AB 4F7EA 3MRRB 3GO1L 5C3LD 3KYKH 4XMLL 3QQ4B 3ZDZF 3N9GH 2R2BB 3LKPA 4YXKL 5EOCL 4ZOEA 1BQSA 1J8HB 3GKWL 5B3JE 5K59E 5FYJU 5DQDH 4GS7C 5IVXB 1D9KD 1G7LA 1MLCA 2P5EB 4MZ2A 3OQ3B 3RWDA 1UACL 1S5HB 1NCCH 2VO5A 3ARQA 3BUYA 5AG8A 2DKUA 1YEIL 3SKJL 4KTDH 5KJRL 1SQ2N 3LKSB 3DV6A 4LSUL 2WINB 3I6KA 4F37K 3WFHB 4BKLA 1EEQA 2LTQC 5F9WB 3NZ8A 4HG4J 1TPXB 2R39A 4JFFB 5F7LB 4LSQH 4M8QB 5EOTA 4ZO6A 1AD9A 2K1MA 1T7YA 2W0FA 1FH5H 3DX6A 3MX0A 4OCWL 4P3DB 3QDGD 1V7ML 2ESVB 3FT4B 1I8IA 5CS7A 1I9RL 4HGKC 1B4JH 4YQXH 4KH2A 1F6AB 3VFSB 2DLEA 2ADJB 1MCPL 4U3XA 1UADC 4LSVL 4F3FB 1TJIH 4L9LA 1A5FL 2QADB 3D3VA 3DNKA 1MCSA 1MCQA 1T20B 2VLRB 3N1FC 1AO7B 4OF0A 1KCSL 2IANB 1D5BB 5J13C 3HTLX 5L0QC 1M4KA 4WWKC 3B5HA 5CWSA 2HLFC 2DQFB 4PJ7B 1LEKA 4HEPG 5E94B 3O0RH 4XCFL 4DZBB 1MQKH 4NQUA 3CNKA 3EUUA 4ALAL 2VXSH 2YBRA 2GTZB 5E1AA 5FYLL 1CLZL 3IU3A 3WIHL 2XZQL 4XVTL 1NC4A 2F74B 4QHKI 4EN3B 5GS1B 3AS0A 3ARBB 4KUZH 4FQQB 2A77L 1CBVH 2V5TA 1A6TA 4O9HH 1MWAA 1HEZB 4M4RA 3CVHA 3PDOB 2HKFH 1DTUA 2LAGB 2H9GA 3STZA 1LK3H 3IDIB 4CU7A 1TJHH 3E6FB 4PGEA 4OLZH 2YPLA 4WHTB 4P5TB 5J9PA 1OAKL 3O4LE 5IB4B 4ZPVA 5FDWA 3PHOA 4OJFL 4HPYL 4YPGA 1PAMA 5DK2B 1G0YR 1B3JA 3QQ3B 4HG4K 4R8WH 1ZVHA 3CDYA 4OBRA 1B6UA 4JZJC 3BGAA 5JW3L 5JLZA 1FIGL 1A3RL 2H2SC 3IXTB 2HFFB 4Y5VB 1J7VR 4LOUC 1MNUL 4Y5XB 2BY0A 43CAA 5HVFB 3OAZK 1T2XA 2KPNA 2QV2A 5BQ7B 2AEQH 4OSUL 1VCAA 2W91A 4G6KH 4GXUM 4NHUA 3SDYL 5KSBB 3BISA 4G6AC 4RRPG 3U7YL 3VD5A 4LAQL 2ATPB 4JB9L 1VADB 1IFHH 4OZGF 4G43B 3QWOA 1YPZE 4ZAKB 2BFVL 1FYTD 3TA3A 5HBBA 5E2UH 1Z6JT 5DDHA 3NFNB 2HWZL 4L4TA 1JUFA 1J9CT 4YHIA 3HI5L 2Z0BA 4NQEB 5JA9A 3DTXB 4OLWL 3C08L 3G5YB 5J6GA 3BW9B 4OLVL 5ACZB 3OKEA 3VRIB 3VXQA 1YEFH 2X4RB 3GSNB 5MERA 3B5TA 4OF5A 1U3HA 3WJLA 1GZPB 1I3UA 4MJ4A 2VN4A 3BGFC 5GS1C 3BKJL 3D9AH 1K4CB 1MELA 5BV7H 3T1WA 4NT6A 4OM0H 1CG9A 5C07D 1FL6B 4U1GB 3WNKA 3GDBA 1J05B 5D6DA 3ARFD 1XF2B 1IAKA 2RCSL 5KS9A 4YIQB 3BXNA 3D18B 2DI7A 4P3WA 4LMQI 4BK4A 4N0UB 3VFNA 43CAB 3IDMB 4K3HA 4I77L 3V0AC 4HHAA 2FJFA 1JVKA 4MD0A 1WZLA 5E08L 3THML 5MERB 3O9WB 5LBSL 2NW2B 1F8TL 3U1SL 2Y07L 1UM5L 3OV6A 1UZ8B 3PWPE 3GMPA 4WHYG 5DJ0B 4BZ2H 3DYOA 7FABL 2GIYA 1KCVH 4K71C 4GG8B 1V7NL 1T80A 5KVGL 4D8PB 5C9JA 5HYFA 1EO8L 5FDWB 5IB4A 3RGVA 4YZFE 4LLVB 5F9WC 2LTQB 3G04B 3BZEA 1KPUA 1QYGH 1JPSL 3PDOA 4OCRH 2NZ9D 2YD1A 1A6TB 4FFYH 5ETUA 2P8MB 3BWAB 5HHME 5KAQF 6FABH 4TN9A 3SKOA 2WUCH 6CGTA 5DMIL 5ANME 1FGVH 4IJ3C 1D5XA 1T6VN 4PB9H 2WWKT 4PG9B 2P42B 4ZTOH 3SJVD 5JOPD 4IS6B 3MREB 4NQVB 3MNZA 5D5MF 3ECBB 4QTIH 5IMOA 2ICES 4RRPA 1ORQB 3NH7H 1UGNA 4YXHH 1O5DT 2AI0H 4QF1A 2OSLA 1Y18A 5DHYB 1G9ML 2DYPB 4Q6YA 4RX4D 4PJAF 5DMKB 3BDXA 1WC7B 4NN5C 5JHDD 3P0YL 1HOCA 1FNSL 2EO9A 2D4FA 4D0BB 5ESAB 5FUZH 4KJYB 5GGSA 1I8IB 4HMCA 4EXKA 1NMAH 5D96C 4PP2A 4N9OB 5E1AB 1X44A 4TPRL 1IQDB 4PG2C 5TDPA 3IKCB 3RKDC 4JFFA 4LVOC 2DB8A 2ZZUT 4AQOA 2IAMC 5E8NA 2EDWA 3TT1L 4NNXA 1WIPA 3KGRA 5GS0L 1GOGA 2BSRA 4WI3A 4XCYB 3KPQA 1RUAH 4FXKA 5CP3H 1EEZA 4LLYB 5KVDH 3OKMA 4L3EB 1CE1H 3MUZ1 4HWUA 3IDXH 3U36B 2PR4H 2B0SH 2GITA 3MV7E 3ARBA 1MJUL 4HX1A 5DVMA 3O4LD 5IBLC 1GGIH 5JW4M 1OY3B 4FQXB 1T1XA 1YMMD 2XA3A 1FV1A 5B21A 4MQXC 4X5XB 1JI1A 4ZUTB 1F3JB 4MCZB 5DEGA 12E8L 1G7QB 3UTTA 2XKNB 2EECA 5GGQH 5EOTB 4DW2H 4ZFFA 4OIAA 4X6BA 1RUPL 5T3ZE 4KJQC 1T03L 2DMKA 1NDGA 4HWBA 3R1GL 3HZYB 1B0GB 1IM9D 2E7HA 1XIWC 4NRYB 3ES6A 4KMQA 3WFDH 2CXKA 4LFHG 2ARJB 5LGHL 4J4PD 2D7TH 1IGML 3MUGA 4M9OA 2BNRE 4QRPE 3KNBA 2V6HA 4RDQG 4Y16A 5FGSA 2E7CA 3HFMH 3R0NA 1U8HA 5I18H 4N8PA 4CVXA 1ZWIB 3B9KD 3SPVA 5JTWA 2FH8A 2NMSA 4JDVA 4JRXE 3FRUB 5EUOB 3ULUE 1DQTA 4YHPA 1BGXH 3GSOB 4O9HL 3OG6B 4XB7A 3NCFB 2VLRD 3NGBB 4JN2A 1EMTH 1GAFH 5SX5H 5FYJD 3CIQA 3B3IB 1BD2D 2IGFH 1U95A 1KLUA 3INUH 4Y4FD 2YXMA 2DIAA 3A6OA 1T1ZA 4LLAA 1FORH 3MRGB 2FEEL 3OX8B 4M93B 3T2QA 1TVBA 5C0BB 5T5FL 3HMXH 4JFXA 1ZGLB 3M07A 3VFUB 1XR8A 1Z3GH 1MLCB 1K4DB 2ICEB 1XF3B 4G8EA 3W39B 1LMKA 2XG4A 3SKNB 5EUOA 3DJ9A 5ALBH 3F7QA 3P11L 4X9GA 5I1GH 1FPTL 3KDMB 2ZCKH 1F3JA 1CDCA 2CRMA 3MRNA 2A0LD 4OQTH 2X1QA 3H9SE 4PLOB 3NAAH 2XWJA 4GRLD 5AAWA 1KN2L 4X0KB 1OSZB 1AKJD 1NMBL 1RK0A 2O93L 4PY8J 4MSWA 3TNMB 1V7MH 3JBG7 4JFXB 1SYVA 2FIKB 4WO4B 4MNGE 1K8IA 5E9DD 1LO2L 1TVBB 5C0BA 1YECL 4PB9L 2YD3A 3VFPA 5H2BA 3EZ8A 3T2PA 1FGVL 1ZHKA 3C60B 4JFEB 3IKKA 2YD9A 3TIEA 3MROB 5EO9A 2NQCA 2AXGB 3MRJA 5D7JD 2HT2C 5F6IC 3WFCH 1MIMH 4MCZA 1W0YT 5E99H 4NO0B 1DQJA 5DHVA 3X13A 1M05B 1FVCB 2OYPA 3VCLB 1ZXQA 3ARGA 4K9EC 1DUYA 4PP1C 4N0FB 4TOYH 1T3FB 1OWWA 4D0BA 3H2WA 1HE7A 3ULUH 2L7UA 4TNVK 4KGLA 3Q48A 3MLSH 3ZE0E 3MUGB 1CFTB 4C56A 3UYRL 4O02H 2GFBA 3QAZC 2V17L 4P4KA 3PP4H 2EYTB 2UYLA 1G6RL 2X6MA 1WIOA 4TVPE 2IPTL 3WLWD 3FO9B 5IROC 2X7LB 2C1OB 3Q1SH 1G7QA 1SEQH 2A83B 4MNQB 2J8HA 2B4CL 3BPOC 4R4ND 5L2KA 5A16A 4OZGE 3TJEL 4OGYL 5GS3A 1C1EL 3LKOA 5GS0D 4WV1C 3ARED 4L4TE 4HKJA 3BQUA 3DBXB 3LPWA 4M93C 3QUML 3DARA 2VLKA 3QO0B 1N4XH 5JDSA 4P4KD 3AXLB 1Y18B 5EORL 3ME0A 1NFKA 4UBDD 5T1MA 1LNUB 1S78D 2ATKB 5LGKA 4BK5A 1JPST 5FOBA 2HVKA 1ZGLA 4B53A 1HQRB 1PLGH 3UJTH 1XGUA 5I1IL 3MV11 1NGPL 4V2BA 1MCCA 2F8OA 3VGBA 5I2IA 4Y2DA 3BO8A 1AHWA 1N0LA 3WE6A 1Q94A 4MJ5A 1XGTA 1FL5B 4Y88A 4X4ME 3V5DB 1MAML 2R9HC 3UDWC 1VEMA 4XMPL 3U46B 3UP1A 5KSAB 1T0NB 5J1AB 3EJZC 4L8BB 3IDJB 3WJLC 5IB1A 1AE6H 3MLUH 4HKBB 4M7KH 3U7YH 1WAAE 1RJYA 2XN9D 2P4AB 1ZE3C 4Z7UE 5A2JH 4OZFB 5T1LD 1QBLH 1WFOA 3IB4A 4FP8H 4XPBL 3SBWC 1HILB 4U1SB 2ADIA 3I84A 2VQ1A 1OL0A 1ZLWH 5HHQA 3QEQE 1A7BA 1HH9B 1A3RH 3FFCA 3W0WB 4PJEE 2HYMA 4G42B 1GPOL 2VLJA 3F5WA 4AJ0A 1W8NA 4JM2C 2F53A 5MEND 5D2NC 2UZIH 3HE6D 3S37X 4NKQB 2R69L 1EBPA 1I1YB 4OLYL 4K3JH 4BA8A 3IDMA 2CGRH 5DS8A 5GRVK 3OJMB 4RGOL 5EU5B 1I9EA 4FQXA 4U1MA 2OJZL 3MV8A 3T77B 3BUTA 3RTQC 1EJ6A 1OTSC 2VERN 4HX1B 4LLVA 4PRBB 3R4DA 3MA9H 1ES0B 2RR3A 2F53E 5E5UB 1FE8H 3GK8L 3BGMA 1FZMA 1YNLL 1ZLSH 1TVDA 5FO7A 2VXSL 1XGRB 1QSVA 3SCMB 4PD4J 2FX8H 2EDYA 1G1YA 3WL9A 2VDKL 3SE4A 1QRKA 1UJ3B 2A9NH 3WCYA 4NWTL 1NEZA 2WSKA 1SJXA 3BH9A 3NPSB 3MV8E 4R0LC 4W81A 3BAEL 5L88H 2A0LC 4HHAB 2HTKD 4UNVA 1LP9E 2HT4C 1MCWM 5I1CL 4OCMC 8CGTA 3P77B 2NTFB 2DD8L 2R29L 4LRNL 4HS6A 1N0XL 2ZJSL 3F12A 3PNWA 1CXLA 1F4XH 4JDZB 4MNHB 4H88H 4KZEL 4JG1L 1IC4H 3WSQH 4XVJH 4P9HH 3QIUC 5C2BL 2K9UA 4M7LT 3S88H 4P2OA 3RWFA 2AJZA 2ZWLT 1INDL 1PYWA 2XY1A 1AXTH 1U3HB 4DGIL 2APTA 2E9BA 1NGXB 5C6TH 1YN7A 4MVBD 5C0DA 2FEDC 1KTRL 4I3RL 4NJAL 3NIFF 4R97B 3U46A 5KSAA 3DVFA 4LSSH 1YMMA 3QNZB 4LDLB 1UZ6F 3KPPA 3O4LA 4NKMB 4H1LA 4HD9A 3VXMD 3QIWB 4ODTH 3WUZA 4PIRF 5TF1L 5DDHB 3WBDA 3WDHA 1DLHB 2NW3A 1UH3A 1YC8A 1PKQA 4TRPH 3MOBL 1S5IL 4M9PA 3U0WL 2IAND 1BD2E 1U6AH 4MAYC 3REVA 1CFVH 4B5EA 3W82A 5GJTH 2Q8AH 5KSBA 1U8NB 4I18C 4LP4A 3TBYB 3MJ8A 4HIEA 5FGCE 4HWBL 5F9AC 5KN5A 2Q7YB 4ERSH 3VXRD 4K3GA 4RQQB 3FO1B 5I1JL 5EBGA 4XC3L 2OTUB 3T3PE 5FHAL 1I7ZA 3PIQA 1CDBA 1MHPL 1OAYL 1ZSDB 2CDFA 3V0WH 4R96A 4GG6E 3DXAB 3LN5B 4YX2L 1VFBB 1YNTB 5T3ZH 2JCCB 2B39A 4NOFA 2ESVA 5JOEA 4XTRC 3DSFL 5GS0C 2QQNH 1F6LL 1QSFA 2PW1B 2NY6B 5FB8B 1YC7A 4AQ1B 4PV9A 2B1HH 4MLIA 5IVZA 5DF0A 3CFBB 1DP0A 4P4KC 1KN2H 2PUQT 2YS4A 3SO3B 4NQXA 1T20A 1EUTA 3TPUA 1I7RB 1KBGH 3NIDE 4JY6B 5CILH 5KS9B 3IDIA 4XPAH 5TE6L 2V2TA 3ULUC 1X4XA 3VD9A 1KTDA 1RURL 3UPRA 2GJ6B 1V3JA 2OMBA 4NDMB 2R1WA 4LDOB 4HV8A 4L8SB 5E7FA 3I85A 5T5NF 2CLZB 3T77A 5DVKA 2AEWA 3S35L 1BEYH 1OGTA 1YQ2A 3QUXA 4EN3A 3FQTB 5IW6A 5B4MD 4NZTH 3QDJD 1MJJA 4I9WD 1CD8A 1FFOB 5JPNB 5DUPL 4UQ3A 1ORSA 1WZ1H 4WIQA 2JJWA 4I2XE 3SDXB 1SY6H 1TTFA 1KLGB 2IANA 4HBCH 1QA9A 4K7FB 3KPNB 4Q6IC 1QSEB 4CADA 4JZOB 2OTWB 1R5IA 4PJXB 1DBBH 4G9FD 4U1MB 2PXYB 5L2JB 1AQKH 1BIIB 2XWJB 1YZZA 3MRNB 3EYFB 1J8HA 2ITDB 3WKNA 4NFDA 3LKPB 3QEQD 4LCWB 1JGVH 1R3KB 3PHQA 3D0LA 2HFFA 5JMRA 3ZYIA 1HHKB 2BNQB 3S3JA 4HGWA 5DJ8A 1XF3A 2ICEA 1MHCB 1RUPH 4KI1A 4Z7WA 3RWIA 1K4DA 4JRXB 1HSBA 2BVTA 3KPSB 5GRWA 4H20H 2AEPH 4HWNA 3ALWA 3NCYS 4Y2DB 5IF0A 5A3ID 3IXAA 4TNWK 1RZ8B 3I2CH 1NGQL 2I24N 3PL6D 4R4BA 2CD0A 4PYGA 5M94B 3WO4B 1T22A 4KQ3H 4MMXC 3C2SA 4YE4L 2YA2A 4P46A 3Q3GB 1J1PL 5GJSL 5ESVB 1LO0L 5FK9B 1OM3H 4FQHA 4HS8H 1EEYB 4Z0XB 4OGAC 2R29H 4LRNH 1QBAA 4XWOC 4LRIA 5J13B 4NO5A 5FM4A 3RPIA 3HG1D 2NXZB 4AH2B 3IU3B 1BFVH 2DI8A 2NY0D 5HHNA 3RWEA 2PNDA 4PJCE 4ODUA 2C3GA 1WT5C 3VD4A 3MXWL 5AZ2L 2UWEF 5HVHC 4ZS7L 1JRHH 3ARVA 4P2QE 1X5ZA 1I7UB 1EUUA 3L5IA 1T4KB 3VXUE 5IW1B 4KVNL 2MKLC 4DVRH 3M1BB 3ROOA 3ARPA 1RZJH 1G7PB 3H9YA 4XXCC 1YNKH 1CGSL 4X9BA 1HNFA 1WJ3A 4ONFL 4WUUB 1TNNA 4IBLT 4N5ED 1TETH 4KTEL 2VXUL 1JNLH 2DM4A 4J3WA 2B20A 4N0YH 3VI3F 5E6ID 4GRWF 1P4BL 5F7UA 3L3OA 1B90A 1MCIA 4JM4L 1KTLB 3GUTB 3SHSA 3FFCD 1A7RH 1ZHBB 3L9RA 3TC9A 1RI8A 4MNQA 3VCLA 1KCKA 2BVEA 3CK0L 1VFAB 4G6FD 4ZTOL 3FO9A 1C7TA 4AG4L 1LP9F 4OD1L 2UZXB 5IHBA 1A2YB 1INEH 1EEZB 1IGTA 2Z91A 2Z9TA 2C7UB 1N5AB 1ND0A 4TUOA 1I9IH 4BKLB 2VDOL 4OQ1A 3V0VB 3VDCA 4KMTL 3I6KB 4EIGB 5IJKC 1HHJA 3NACL 1YEHH 1CFTA 3D87B 1P9MA 3CLFL 4LKCB 1JNLL 2ITCA 5EUOF 5FYKU 4ERSL 4PBXA 4M7JH 4WO4A 5HHXH 3T0XA 4LPVA 4PJIB 5D70L 3B9DA 3ARWA 4NO2B 1DN0B 5DJCB 1DEEA 3C6LC 4U33A 3ARGB 1MFBH 2Q86A 4V1DD 2CH8A 3JV4A 4XTRD 5HHPA 2ERJB 3HNTH 4GBXD 3FB8A 1KPVA 1NAKL 2W9DH 5ILTH 1BWMA 3BD3A 4X4MA 4EDWL 5J12B 3WNOA 1CGWA 3BP7A 4M5ZL 3E3QC 4EEEA 3L5WB 4Y1AB 1NUGA 4Z7NE 3EDEA 3W2DL 4XGZB 3DV4B 2OXHA 1UENA 3GSRB 5F7WC 5I1IH 4DKAA 4JR9L 2JJSC 3ULUD 1M6OA 1SYVB 2FIKA 2X4QA 5DO2D 5L9DH 4WU5A 5L2KD 3FTGA 1JMZA 2X1PA 1UEYA 4P57B 2CKBL 3HUJE 4FZ8H 1I4FB 4GG6F 2W9LA 2XTJB 3IRZA 1IGCH 3QXUA 2DRUA 3WS3A 3H9ZA 3ZE1E 5BV7L 4NN6B 3RZCA 4KJPD 3EDFA 3RWCA 3MLZL 1WAAF 4ORZC 2VWEC 3IF1A 1JBJA 3NMEA 3DVIA 4H5SA 2MQ0A 1E28B 2R2CA 1XR8B 2BXYA 3VWJC 2NNAA 2ADFL 1FO0B 2AKRB 4LIQL 2HJKA 4HC1H 4BH7A 1D6VH 3O45B 5D9SB 5T33L 1CVRA 2GUOB 1D5IH 4QHUA 4X8JB 1YN6A 4C57C 3MBED 1NBQA 2D0HA 4QO1A 5TGBA 3GB7A 4EQ2A 5GRZA 4QOKD 5J56B 3MA9L 4HQQL 5GSRB 5A2FA 3MLSL 1D7FA 2CIKB 4GJTB 5BZWA 5I9QC 2O26U 3IYLW 5CJXC 1VHPA 2CO7B 1CIUA 4OZFG 5T5NG 4WY7H 4D9LH 4KKLC 4HIHA 1OB1A 5D1QB 5K9OB 5EU6B 3D39B 3CUPB 4TQEH 5E9DA 3U4BL 1XF2A 1VPOH 1E6JL 4JR9H 4Z7UA 1JZ8A 4YHOL 5HI5C 15C8H 1JHKL 3T2NH 2WK2A 3OHXB 1HHHB 1OLLA 4Y5YA 3QO1B 5BZDB 2XQYK 4JY5L 3HRZA 5TE7L 2BSRB 3WYRA 4GBXA 5FV2A 2Q3AA 1H3TA 4XXDB 3BRFA 2XYCA 4OJFH 4RAUB 3FMGH 4HWZA 1UXWB 4HEME 4X7SL 3MGTA 5CIPA 5EB9A 1CF8H 5J57B 5ENWA 4X9IA 1C16A 4MLSA 1WUNT 2JELH 4JM4H 5IB5B 4Y8AA 4PRHE 1C5CH 2HRPL 3BT2H 3DI2B 3U4EB 1FFQA 1QSFE 1TETL 4KTEH 5IOPA 1BZ9A 4JHAH 3JWNC 2IALA 3QFJB 5HHOE 2FX9L 3MLYL 3DX8B 3UTSD 1J5OL 3ZSTA 5ISZA 3UX9B 2H8PB 3O0RL 4XCFH 3CH1B 2FX7L 2ZUYA 3QI9D 4XC3H 3RUGA 3RVTC 4OKVB 3QDGB 4KI5D 4DUVA 5TJWK 1L0YA 1C12A 3T0EB 2DKSA 4IS6A 5LXGH 3V6FA 5GZOD 2X4OA 2DOCA 1CE6A 1DSFH 1U8MA 3QULA 4Z78A 2P8LA 5F7NC 1PW3A 1GSMA 1WGOA 5JIPA 1ZSDA 2CDFB 2A6IB 2WWMD 3MOBH 4PR5A 1HINH 3AY4A 1OTUD 3BWAA 3GKZA 4KJWD 4XAWL 4MDJA 3L7FA 1I9RH 2EE6A 3N85L 2VZ3A 2X4NA 1S7UB 4EI5B 2J8UF 4YE4H 4TSAH 4KTYA 4RFNC 1IEHA 1J0JA 1KC5H 4F15C 1EPFA 3WN5A 4J4PC 2AGJH 3LQAH 4OZHE 3ECBA 2WUBH 3BP5A 3K8MA 5C0AE 3W2DH 4M7ZB 4GKSA 3HG1A 4G9FA 3KVQA 1G9NC 3SGJC 3DIFA 4G8FA 3OMZA 1KUMA 2DQCH 1UZ8A 3D25A 3P40A 5HYJB 1P7KB 3PJSA 3S3PA 2HVJB 1T66C 4HIXH 4P5TD 4Z7NF 3C5ZB 4I5BA 4X6CA 1NFDA 2EYRB 4GW5B 4RBPK 3BEWB 2ZSVB 4PRAA 1FFNA 4ZNEE 3ARRA 1TCRB 1FDLL 1JIBA 1TMCB 4XNYH 5D7IA 32C2B 4JFYB 4R7NB 1D5MB 2PR4L 4PJ7F 3ZYJA 5ISZB 1RUQH 4HBCL 2VR4A 4L3CB 5DJ6B 3VXUB 4EOWL 3MV01 1YPZF 5JR1H 3ZE1F 1A9BB 3BZ4B 3LRSA 4PLNC 3QJFB 4YNYA 5IB5A 1YEGL 3PF2A 4NO3A 3GSUB 4WEMB 4G3YH 5H35B 4A2LA 4QRRE 3IFNL 3SDDB 4IRZH 1CD9B 5KZCD 4JKKA 4MS8D 3PV6A 5T1KA 5JQHC 3P0YH 5CGYD 1BVZA 5FO8A 5I8OL 2C5DC 4QLRA 5EC2B 2CSPA 4NQED 3MRDA 4LBEA 1CDHA 3G6JE 3SKMB 1A7OL 3VXRA 1J1OH 5BXFA 3C87A 3KPSE 2YEZB 3MRRA 4OB5H 2DQHH 3B9EA 3IDYC 4KRPD 4V1DE 3VFWA 4NQEA 4OFYD 1JHLL 1PDKA 5MI0C 4OF7A 5L6YH 1YY8A 5DMYA 3SE8H 2X1OA 4WGWB 2XI9A 2CIIB 3ARFB 5FA4B 4IDJL 4PB0H 5HHQB 4JFPB 2VQ1B 3OAYK 2V5SA 5SWZD 3VGGA 3VXPA 1FNLA 3CZFB 2PXYC 2MHAB 1U36A 3IS1X 4GUPB 5INDB 2VZTA 1V7NH 5IB1B 5D5MB 3QT2A 3ARFC 3ZDXF 4PJHA 1BOYA 3RRQA 4ODHL 4WWKA 3P73B 4YFDB 3C8KA 5IB3B 1KJMA 3ZT5A 2YBRB 5EOCJ 4DW2L 1EO7A 3O6KH 5FHAH 1OP5K 1U8KA 3FQUA 3MODL 4TVSa 12E8H 1UYWH 2BRRL 1NCUA 3G5XB 3REWB 3SDAD 4UQ2A 2KZWA 4GW4A 4DGYH 5BS0B 5D7KE 3HB3D 1T2JA 4PRDB 1C08B 4JFQB 1OT1A 1EHXA 1M6OB 5HI3C 2R4SH 2O61A 4KU1A 3U82B 3LY6A 2B4CC 1IGFL 3E6FA 1UB6A 1SEQL 1L6ZA 1K6QL 3G08A 3LQMA 4ZUWA 4FZEL 4U1IB 4OLXL 4ZFZB 3UJJL 5DMGC 4XPFH 4DTGL 1A7NL 1NGYB 1N26A 3VXNA 1CT8B 1NC4B 2F74A 3LEXB 5I1AA 1MI5A 5SV4A 2FB4L 4KROC 2R9HD 3MJ7A 4Y16C 2GJJA 5TDOA 1MVFA 5GGVH 3HR5A 2Y5EA 5C0JB 5DRNA 3WXVL 2IPUG 1RZGB 5C70A 2AV1B 4Q9CA 1B9ZA 3QBTB 5DT1H 5IFJA 4JLRB 4CJ1A 3T8XA 1RURH 4LNRA 3KYNA 4D0CA 1KXVC 3HE6A 3WJJA 4L9LB 3DV6B 1BPVA 3K2MC 2ZJSH 3GHEL 3EYVA 4M61A 1KPRB 1S7RA 1CLYH 1UC6A 2BSED 2UZYB 1ZKAA 5DJZB 4AT6B 5EU6D 3RDTA 5HY9A 1CVSC 4X7DC 1CWVA 2XQYG 3MRPA 1Q0YL 4JVUA 4P3DA 4DOHB 5I1HH 1XZ0A 3K80A 2ZNXA 1UVQB 3CSGA 1A6ZB 1LO2H 3CK0H 5EZOH 5SWQB 4PREA 2R2EB 1DL7H 2PYFA 2VYRE 1ZVSB 3PWPD 5T3ZL 3ESVF 2XQBH 2DJ4A 4PRHD 2Q6WB 3TIEB 2R1YB 2FX9H 3ULVH 2QR0A 3L5JA 3TCLB 2P7TA 4ORGA 2G5BB 1KV3A 4W6XB 2YOCA 4I2XB 3HI1A 3P11H 3ZKXC 5CEXA 1HZHL 1RUKH 3OKLB 4J1UB 3QHFH 1NJ9B 2A9ML 1I7UA 3DUHA 4IMKC 3TNMA 3ET9F 5CBAA 4NQDB 4RMSA 4U7KA 4EI5C 1N2RA 3D2UA 1R6VA 3FMGL 1H8SA 3FJTA 3OKNB 3HUJF 5MENA 7FABH 1CBVL 1MI5B 2QL1A 2IEPA 5HGHB 3RGHA 3QFJD 4F7EB 2FGWL 4NO5B 4XPHH 1ZGLP 4J8RA 3GIVA 4ZO8A 5E00A 2CDEA 3O81A 4HWEH 4LARH 3CX5K 3JZ7A 2CK2A 1HKFA 2EZ0D 3UMTA 4QXUH 1KIUA 2O61B 3AREA 1OM3L 1C08A 2ICWJ 2OI9C 3B9KB 5IT2H 1MY5A 1P6AB 5FFLA 2DIJA 3QFJE 5HHOA 3V4VH 1DBJL 2V7HB 5HHOB 1RZ7L 4PGCB 4XVJL 1U93A 3SCMC 1SYSA 3LKNB 4D0DB 3WO3B 2BNQE 4Y19A 5B39B 2DD8H 3F7PC 1U0QA 2LABA 3HS0A 4YQXL 1Q9KB 1KF9B 1FNGB 4KRPC 5C0GB 2MTPA 1CDUA 3BN9C 5ID0A 5JORB 1GXEA 3KJ4B 4YXLL 3B9KC 1F58L 2YMXH 1FH5L 4I1NB 3S36X 1BAFH 1NEZG 1QR1A 3J8F7 4NCC1 3EJYD 4U1LB 4HKXB 4LEXH 3P2TA 3ES6B 5CEZD 5AD0A 4OZ4A 2FGWH 4JZNA 1EXUA 4DOHE 4J12A 5K9QG 1OD9A 5D6CA 1DDHA 5FKPB 5FF6A 5D7JA 2CKBA 1V5JA 5EA0L 1YEIH 4TUJA 3V6OC 2C9AA 2VDML 1CL7L 4OD2A