5J0UA

Binary complex crystal structure of dna polymerase beta with g:g mismatch at the primer terminus
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
330
structure length
326
Chain Sequence
APQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of DNA Polymerase Mispaired DNA Termini Transitioning to Pre-catalytic Complexes Support an Induced-Fit Fidelity Mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 107
structure length 326
sequence length 330
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5j0uA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5j0uA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5j0uA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5j0uA03
4Q8EA 3WFPA 3OSNA 8ICLA 3M8RA 3OJSA 2ATLA 4ED8A 1PZNA 3HPOA 3LWLA 2UVWA 9ICEA 4NLNA 4UAWA 1MIWA 5IIMA 4BDPA 8ICRA 1ZQMA 3AU6A 4GXIA 5DB6A 2WTFA 4JUZA 5KFSA 1NK5A 2IHMA 4Z6FA 3KTQA 3C66A 3TFRA 2XO7A 3UPQA 4ED3A 4O3OA 3E2EA 4IQTA 1NK4A 2BCSA 4F5RA 1ZQJA 4RWOA 4C8LA 1VFGA 4I2FA 3QEAZ 4KLOA 3GV8B 4QZCA 3SV4A 4X4OA 3TANA 4FHPA 3WFRE 1MQ2A 1BNOA 2V4QA 4R8UB 3RJHA 4WC1A 3RH5A 5TZVA 1JIHA 4F4XA 4WBZA 5L1JA 4X4QA 5J0PA 3M9OB 5J2KA 4ECRA 3TAQA 7ICSA 4I2BA 2RFFA 3K4GA 5KFLA 4DLGA 4EYHB 1HUZA 9ICFA 4ECVA 4PHPA 4IRCA 4EBJA 8ICJA 2PFNA 3OUYB 1D9FA 4ED1A 5KFJA 1TFWA 5DG9A 4WC5A 2BPCA 4O3QA 4DQSA 4DLEA 5HC9A 4X4PA 1JN3A 5HRLA 2FLLA 2A1JB 4C8NA 4DS4A 1QSLA 2XY5A 4YQWA 3JPQA 2HHQA 4LT6A 2DRBA 3HJ4A 4F5OA 4DWIA 5HHHA 5J2HA 2IMWP 2C28A 4IQWA 3B0XA 5HRIA 1U4BA 9ICTA 3V72A 4NKTA 3OV7A 3BDPA 3MBYA 3OVSA 1ZQVA 1UA0A 4I2JA 3H8WA 2XGPA 4F93B 1TAUA 4LVSA 4MFCA 3GIKA 4S3NA 4DL4A 1ZQYA 5DDYA 5KFHA 3T5KA 4YVZA 3RH4A 2IA6A 3C23A 4KLMA 4HYKA 4F2RA 8ICUA 4ZH4A 2C2DA 4MFFA 8ICSA 4K4IA 4IRDA 2NRZA 4J9LA 2J6SA 4O0IA 2NRXA 5L9XA 4DFKA 4I2HA 1ZQLA 4DO9A 5IINA 4M9LA 4YR0A 1KSPA 2VANA 4FBTA 1UETA 4RQ5A 2VA2A 4I29A 3KHLA 4IR1A 2HVHA 3PNCA 1BPEA 5IIJA 9ICXA 4F4YA 1TV9A 5KFGA 1BPDA 3TQ1A 3G6XA 1RPLA 4DSFA 3MR2A 4J9KA 4ECTA 4ED2A 3BQTA 4YD1A 5KG3A 3TARA 4NLGA 8ICAA 2BGWA 5F2VO 3C5GA 4E7XA 4IQVA 3MR5A 4ED7A 4ELUA 2ZJAA 3H4BA 9ICRA 2ZTDA 4RWQA 2DR8A 4EP7A 4XRHA 3N97B 2UVRA 1UEUA 4MEYA 3V7KA 1UA1A 4QZHA 4MFAA 4R64A 3ISDA 1S10A 5KFTA 3AQNA 4RQ4A 4I2GA 3JYYA 4R8UA 1Z00A 4UD4A 2XY7A 5KFCA 2O5AA 2J6TA 4F8RA 3Q8PB 4M9HA 2W9CA 4FO6A 5KFDA 2HW3A 4NKUA 4F92B 3C2LA 1SL1A 4DF4A 1S0OA 5KTQA 2ZUBA 7ICIA 2ZHBA 2AGOA 3WFSC 9ICAA 4Q43A 1KFSA 4R65A 3H8SA 3QZ7A 4BWJA 3KHGA 5KG5A 5L1LA 1U47A 2KFZA 1BPBA 3V6JA 4DSEA 9ICQA 5DQIA 2ID1A 4I27A 4GXJA 3FDSA 4WCWA 5J0OA 5BPCA 1H38A 1MIYA 5KFAA 2C2EA 3PW7A 4KLJA 2R8JA 2C22A 1KLNA 2BKEA 3PY8A 1ZQHA 3M9MB 2F1IA 3MDAA 3RAXA 3PW5A 2P6UA 2R8GA 4KLGA 5KT3A 4DL7A 1MIVA 1ZQIA 3OUYA 2XCPA 3H39A 4J9NA 1L5UA 4FHYA 4WC4A 1V9PA 4YXMA 4YP3A 5DECA 4ATBB 3L9DA 4RQ0A 1ZQSA 9ICBA 3MFIA 2R8HA 4GLXA 2P6RA 5J2CA 5JUMA 4P4PA 3PX4A 1SL2A 4KLQA 4RNNA 1SKRA 4QZAA 1BNPA 2AQ4A 5KG6A 3M8SA 3RBDA 4J9OA 8ICPA 8ICEA 4DL2A 3BQ2A 4ELTA 3BQ1A 4UB1A 4UBBA 1MSWD 2ZH3A 4M04A 4TUPA 1SKWA 4KN7A 3PX0A 1CUKA 4DQRA 1ZQAA 2H5XA 5J2JA 5DKWA 5HHIA 1ZQKA 5HRBA 1YLQA 1ZQNA 2M2TA 4EBCA 3ISBA 4F50A 5J2IA 5EWFA 3B0YA 4PHDA 1KDHA 5KFBA 1S76D 5KFMA 3KHHA 1TK5A 3ZDAA 4F4KA 1COOA 4X4SA 1EXNA 4P4MA 3OHAA 2AGQA 2W9CB 4NLKA 3EZ5A 5EWGA 3ZD8A 4QZ9A 4YMMA 1IXRA 3Q8RB 2FPKA 1KFTA 5F9NA 5J2GA 3ZDBA 2B21A 2ZH5A 1HUOA 2FMSA 4RQ7A 5KFRA 1C7YA 5DQHA 5HNKA 2W9BA 3RR8A 4DQIA 5DQGA 2XCAA 5KFWA 4QZFA 8ICZA 7ICHA 8ICBA 4PGQA 1CEZA 2DFLA 3HWTA 1NJXA 3RB0A 1ZQXA 2PI4A 1WCLA 5CHGA 1S0NA 4JV1A 2BE3A 2KFNA 3BQ0A 3Q8QB 4X0AA 4MEXA 5DB9A 3WFOA 3HP6A 4DL5A 4DSIA 2FPLA 9ICPA 2JEFA 1KTQA 2UVVA 2ZHAA 4DOAA 1X2IA 2JZBA 4FHXA 4Q44A 3UPSA 3UXPA 4ATBA 4DSKA 5J0TA 1L3TA 4QW8A 4FH5A 2MUTA 4QWBA 2FLNA 4NXZA 4QW9A 3GIIA 5CJ7A 3RTVA 2DPJA 2R8IA 3OVBA 4J9PA 4X4UA 3UXOA 1Q78A 5KG0A 3AQKA 1DOQA 4DQPA 4F2SA 2HHVA 2ZH8A 8ICTA 4O5CA 2NRTA 2V4RA 1TFRA 4P4OA 5BOLA 2FMPA 4F4ZA 4XA5A 9ICOA 2F1JA 1L3SA 3AQLA 4WC2A 5CR0A 4O3PA 3OVAA 3EPIA 2DRAA 1NK0A 4C8KA 4KLHA 4FH3A 4RT3A 2ISOA 8ICOA 1ZETA 4LZDA 2UVUA 2KTQA 4RPZA 3QZ8A 3TFSA 5DG7A 1K1SA 5HP4A 4PGYA 4ECWA 3T5HA 4RPYA 3OSPA 4FHWA 2BQ3A 3NYBA 4UB2A 9ICHA 4ED0A 4RUAA 3GV5B 2ASLA 1UEVA 4QZDA 4QZGA 3MR3A 1KRPA 3NTUA 5EOZA 5KT5A 4KMUA 3RB3A 4I2AA 7ICJA 1ZYQA 1R8CA 5HR9A 1U48A 2W8LA 7ICPA 2AJQA 3G6VA 1SL0A 4J9RA 4NM1A 1OU5A 4UAYA 5KG7A 4RU9A 3JPOA 2KZ3A 9ICKA 4DEZA 1BGXT 5KG1A 4F91B 3SI8A 1BPYA 3ZDCA 3JPPA 2NRWA 3UXNA 4P2HA 2ZH9A 5HMLA 4EZ9A 4R66A 5L1KA 4KLTA 4DFMA 1B43A 1T4GA 2AGPA 4F5NA 1JMSA 1ZJMA 5KFOA 8ICVA 4TQRA 2BCQA 5KFIA 4KLLA 1XO1A 1SKSA 4DOCA 2BHNA 5D4BA 4X5VA 4X4TA 3V6KA 2ZH7A 5HMMA 5J0UA 4M2YA 7ICQA 5DLGA 4JV0A 3RAQA 3RJJA 3GILA 2JEGA 4MF2A 1Y88A 5J2EA 1WOTA 4E8FA 2KZZA 2VA8A 4YMOA 5KT7A 2BCRA 2ZJ8A 4BGDA 3OGUA 5D46A 3K75D 3MDCA 4ED6A 8ICNA 5DGAA 1UT5A 1ZQWA 4K4HA 1XC9A 3HX0A 4KLIA 3H37A 4RQ1A 4QZIA 4UB5A 1NJYA 5KFZA 5KT4A 7ICFA 2HHPA 4I2CA 4F5QA 4TURA 1N56A 1D8YA 9ICLA 1ZJNA 4RQ6A 4B9VA 5KFFA 1X9SA 4F4WA 2FMQA 2A1JA 4O9MA 1R89A 4UQGA 4DS5A 4J9MA 2KN7A 5EWEA 3QEBZ 4EEYA 1BPXA 2JEJA 2Y1JA 3RRGA 4LZGA 4YXJA 2C2RA 1L3VA 2BCVA 4DFPA 2F1HA 7ICOA 3PVXA 4IRKA 3Q8MA 1DK3A 4TQSA 4DF8A 4YN4A 1QSYA 1ZQCA 3PW4A 3JZ0A 4J9QA 2BCUA 1XU4A 2XGQA 1QSSA 3Q8KA 4AT7B 5J2AA 2ZUCA 3H38A 1S0VA 2DR9A 1D8LA 3ETLA 3WFQE 4RUCA 4ECQA 1QLNA 5DLFA 2M2VA 4GC7A 5CP2A 4E0DA 1B22A 2HHXA 3RRHA 3KHRA 2HHWA 5DB7A 3MGHA 4KLSA 1KNYA 5KT6A 3C21A 3C5FA 3RJGA 4PH5A 1LV5A 4GC6A 3LQCB 1LB2B 3JPRA 3GDXA 9ICUA 1DGSA 3C1ZA 7ICLA 4JV2A 4O5EA 4YCXA 3H7IA 4JK1A 1MQ3A 3OHBA 1UT8A 3ZDDA 4AT8B 4EBKA 2JEIA 3LWMA 4PHEA 4TUSA 1XSPA 4FBUA 2M2UA 2MUTB 1RXWA 2HHUA 2ASDA 5HRDA 3MR6A 4X4VA 5CB1A 1JXEA 3AUOA 1XSNA 1S0MA 5KG4A 4F3OA 3GIJA 1NOMA 8ICXA 3RR7A 5DBBA 1NJZA 1RYSA 1T3NA 2R8KA 3SYZA 1ZQFA 2ZTCA 2M9NA 4GXKA 4RWNA 3V7JA 4NM2A 1A77A 2ZUDA 2XC9A 1U49A 8ICCA 4NLZA 4ECYA 4DOBA 3TAPA 4WC3A 3Q8LA 4YMNA 1S97A 2ZH2A 4KN4A 5IIIA 1QTMA 4EYIB 2FPMA 1ZQZA 4C8MA 2NRKA 3PR5B 3PW0A 4AT7A 4Z6CA 3BJYA 9ICSA 1Z3EB 1U9LA 4BXOB 5DBAA 1S9FA 4KITB 2ZH4A 4FS1A 8ICQA 9ICMA 3C18A 4YG2A 1RZTA 1BVSA 1NO5A 4B9MA 1JXLA 4MF8A 7ICGA 2BR0A 5KFKA 4B9UA 3H8JA 4FHVA 1TVAA 5J0QA 5KFNA 4UD5A 4RQ8A 2Y1IA 2PFQA 1NK6A 5HRKA 1MC8A 4FS2A 3PX6A 4Q45A 4RNOA 4TUQA 5IILA 3RB4A 1RXVA 4G3IA 4B9SA 9ICWA 1X9MA 4CCHA 2XY6A 1V4AA 9ICNA 4X4NA 5DDMA 1ZQDA 4DQQA 4AT8A 4EBDA 7ICNA 3ISCA 8ICIA 4X0BA 3EPGA 3FYHA 5DG8A 2ZH6A 1XSLA 3PMNA 2BPFA 1XWLA 3PMLA 4I28A 2W9MA 4Q8FA 4M6WA 1ZQPA 3IM1A 4RPXA 4YR2A 1KFDA 1ZQQA 2P66A 2O1PA 4WC6A 3SZ2A 4IQUA 9ICVA 4J9SA 7ICMA 2BDPA 4KLEA 4RZRA 3ZDEA 4UB3A 2ISPA 1HJPA 3RBEA 4KLUA 4WC7A 3PV8A 1ZQEA 4AT9A 3RB6A 4ELVA 3PR4A 3H4DA 3C1YA 2RDJA 3V6HA 4BWMA 4M9NA 4XQ7A 1SZPA 5HRFA 4AT9B 2I1QA 2HHSA 4QZEA 2DVIA 1XS9D 4UAZA 1RYRA 1F5AA 4O3SA 5KFQA 2FLPA 3T3FA 3HIYA 1TAQA 3PO4A 4ECXA 3NGDA 2NRVA 3GQCA 2BQRA 1TK8A 2AU0A 3QE9Y 8ICKA 3EW9A 9ICGA 3MABA 1L3UA 4JWMA 4I2IA 2RDIA 3V7LA 2I9GA 4F5PA 7ICVA 2PI5A 3JPTA 3UQ0A 5CWRA 5C5JA 3C2KA 4NY8A 1ZQRA 2V9WA 1N48A 3Q8SB 2ASJA 1X9WA 2KP7A 5HRHA 2PBEA 3T5JA 3C2MA 1Z00B 4O3NA 4B9TA 2Q66A 1NJWA 4C8OA 3H40A 2DPIA 2KZMA 1R8AA 5KFXA 5L1IA 4DSJA 5J0YA 1R8BA 4QZ8A 4ECZA 1TK0A 3JPNA 3OJUA 4DFJA 4ECUA 2BQUA 2LYHA 1NK7A 1NKCA 4M9JA 1WCNA 3RJFA 4O5KA 2HHTA 5DEDA 4E80A 5J0XA 3EWAA 3GIMA 4X4RA 3LK9A 4WBYA 5CA7A 5J0RA 5J0SA 3EYZA 4KLDA 4O3RA 3AQMA 5HRGA 5DB8A 4BXOA 8ICYA 2DR7A 4I2DA 3M9NB 2ZJ5A 2AQ0A 3UQ2A 1ZQBA 1JQRA 1NK8A 4R63A 8ICWA 1S77D 4QWDA 1BPZA 8ICMA 8ICFA 2JZBB 4PGXA 4B9LA 4RT2A 2M2WA 4XQ8A 1JAJA 5KFUA 1T8EA 2MAXA 1NKBA 5IIKA 3ORYA 4KLFA 1AROP 4JWNA 1A76A 5F9LA 5KT2A 2ZH1A 3LDAA 5D49A 2PFOA 5DBCA 2PXIA 4RNMA 2VA3A 4DSLA 5KG2A 8ICHA 5J2DA 1TFYA 1TKDA 4I2EA 7ICUA 4M5DA 3ZD9A 4YFKA 5J2BA 2W9BB 4DL6A 4M6WB 1ZQOA 2W8KA 9ICJA 1Q79A 3JPSA 5KFEA 5KFYA 4YR3A 2J6UA 5J29A 4KTQA 2HVIA 7ICEA 3HJ1A 4QZBA 4IG8A 4PPXA 4RQ3A 3THVA 7ICKA 3RJEA 9ICIA 2GWSA 1K1QA 9ICCA 7ICRA 1FA0A 4ECSA 4EBEA 3SV3A 4XUSA 3N4MB 1PX5A 4M0AA 4WC0A 1ZQTA 5DGBA 3HW8A 4PHAA 5KFVA 3RJKA 1NKEA 2Q0ZX 5IIOA 3MFHA 2ZTEA 1JX4A 5J2FA 1ZQUA 4RQ2A 1T7PA 5BOMA 2PFPA 8ICGA 4UBCA 1NZPA 4RWPA 3G6YA 4M9GA 5HREA 4M47A 4IR9A 3MGIA 3RJIA 4Z6EA 1KEJA 3PW2A 2BPGA 7ICTA 4B9NA 3HT3A 4YD2A 4UB4A 3GV7B 1D9DA 1NK9A 4EZ6A 1DK2A 1IM4A 4DL3A 2IHNA 3T5LA 2OWOA 1VJ7A 3PO5A 3RH6A 1ZQGA 4QWCA 2ALZA 2W9AA 4K4GA 4Z6DA 5KFPA 4QWAA 4QWEA 1U45A 2IBKA 3AU2A 2DR5A 3H3AA 5J0WA 3GFKB 3TI0A 3IHQB
chains in the Genus database with same CATH superfamily
4Q8EA 3WFPA 2WB1C 1MIWA 3LWLA 2UVWA 9ICEA 2JXJA 5IIMA 3AU6A 2K4HA 4K8VA 2IHMA 3TFRA 3UPQA 4ED3A 4Y2VA 2BBJA 2BCSA 4C8LA 3QEAZ 3IV6A 4QZCA 3SV4A 4JLZA 4X4OA 4F72A 3WFRE 4R8UB 3RJHA 2ZXIA 3M9OB 4ECRA 4DLGA 3D2QA 1N61A 1RQNA 2KHVA 5KFJA 1TFWA 2BPCA 4DQSA 3SENA 3F2DA 4CRXA 2DRBA 3JPQA 2HHQA 3HJ4A 4F5OA 4CNQA 3IN5A 2IMWP 2YB4A 2K8CB 1WWVA 3MBYA 3H8WA 4LVSA 1L6NA 2I5HA 4DL4A 1DGJA 3C23A 8ICUA 2FJ6A 4F2RA 2KV2A 4J9LA 1X66A 2W7PA 4I2HA 1ZQLA 2F8KA 2VANA 3IP4B 3IG5A 4IS7A 4K96A 3IG8A 2EAOA 5GTIU 3KHLA 4F4YA 5KFGA 1FEZA 3G6XA 1RPLA 5KG3A 3C5GA 3O0FA 3NWIA 2LHTA 4KM5A 2DR8A 2WAQC 3ISDA 1Z00A 2XY7A 2J6TA 2W04A 5KFDA 4NKUA 4DF4A 3UMCA 2RHFA 3WFSC 4R65A 4QIWF 4DFDA 1C20A 3K1ZA 3KHGA 3KD3A 1ED1A 4GXJA 3FDSA 5BPCA 1VDVA 1H38A 1MIYA 2R8JA 4UARA 2QB0B 2BKEA 3SAFA 2C22A 1KLNA 2E8OA 2P6UA 5KT3A 2ZIXA 3H39A 4FHYA 4QJFB 5ALOA 4YXMA 2E8MA 1ZQSA 1S5LU 2FCLA 3ER8C 3NVWA 3QU5A 4ACOA 5J2CA 4KLQA 8ICPA 3M8SA 8ICEA 4DL2A 3BQ2A 5JRTA 2ZH3A 4TUPA 4KN7A 1ZQAA 3IDWA 2H5XA 3L3FX 3ISBA 2KJ8A 5J2IA 5KFMA 1TK5A 4F4KA 4XJEA 2W9CB 1KKXA 4QZ9A 1WUDA 3ZDBA 1HUOA 3WK4A 1J2MA 5DQHA 2W9BA 1L8OA 2XCAA 7ICHA 4PGQA 3HWTA 2EAPA 1S0NA 2KFNA 4RQMA 1KW4A 4DL5A 9ICPA 3N28A 2JEFA 2XVTA 1KTQA 1OW5A 4FHXA 5B5EU 3UPSA 2WHEA 4FH5A 4QW8A 3FC4A 2MUTA 1SV0C 4QW9A 3GIIA 4J9PA 4X4UA 4NWIA 5KG0A 3MGVA 2DKZA 1TFRA 4WC2A 3OVAA 2ISOA 5AI0A 4LZDA 2UVUA 3WK8A 3QZ8A 4FHWA 4UB2A 2YMMA 3GV5B 1Z19A 4FZLA 4QZDA 4QZGA 3LVWA 3MR3A 3NTUA 3RB3A 5HR6A 5HR9A 1WG8A 2W8LA 1SL0A 4NM1A 2BZFA 2F8LA 9ICKA 3SI8A 1BPYA 2KD1A 4KLTA 4DFMA 5CHEA 8ICVA 3NRZA 4F5NA 2HBLA 2BCQA 1XO1A 1RG6A 3V6KA 3WK6A 4M2YA 7ICQA 2YMQA 2JEGA 1WOTA 3H0RB 2VA8A 4AYBF 2BCRA 4ED6A 3K75D 2JGAA 3H37A 4K4HA 1ZQWA 4I2CA 4F5QA 4TURA 1L7OA 5ALJA 1X9SA 3GU3A 3KBBA 4DS5A 3RRGA 2QKQA 2JEJA 2Y1JA 4FO1A 5AKLA 2F1HA 1T94A 4DF8A 1QSYA 2W55A 4PZOA 5AK3A 3JZ0A 4OAGA 1XU4A 4AT7B 2ZUCA 5J2AA 1D8LA 2M2VA 4E0DA 2HHXA 2FE9A 4UB8U 3MGHA 4KLSA 4JLXA 1RYUA 1LV5A 2DWQA 3JPRA 3GDXA 1LB2B 3C1ZA 4JV2A 4O5EA 3H7IA 4JK1A 1MN8A 1MQ3A 4EBKA 3ZDDA 3LWMA 4TUSA 2XIDA 1RXWA 3QU9A 2ASDA 3MR6A 3HKZC 1IG6A 4F3OA 2KSOB 5AI6A 3RR7A 4PZNA 3PZPA 5DBBA 2R8KA 3SYZA 5ALUA 4P0QA 2W7OA 1A77A 1QQ5A 4NXTA 4DOBA 3WK7A 4NLBA 4YMNA 2ZH2A 2FPMA 1CI4A 1ZQZA 4C8MA 2ODGA 3H8MA 3M6KA 3PW0A 1U9LA 2KKVA 5DBAA 1S9FA 3DV9A 3EUB2 2F3NA 4B9MA 4FZMA 2ZIWB 5B3QA 5J0QA 5KFNA 2D8CA 2PFQA 1L7NA 4FS2A 3PX6A 4G3IA 4TUQA 5DEDA 4B9SA 5DDMA 2NO5A 8ICIA 2DQNB 4X0BA 3EPGA 2ZH6A 2BPFA 2EANA 3PMLA 4Q8FA 2W9MA 2HN2A 1SGGA 4RQNA 2O1PA 3SZ2A 4IQUA 1O08A 4J9SA 1PUZA 4RZRA 4KLUA 2ISPA 3PV8A 1ZQEA 3V6HA 4AT9B 3B9JA 4AP9A 5EE1A 4O3SA 2ZG6A 3T3FA 2D6FC 3CYMA 1TK8A 2YB1A 9ICGA 1L3UA 4I2IA 2OM6A 1A6SA 2V9WA 1Q3UA 1X9WA 1FFVA 5KNIA 5AI8A 4C8OA 2EH9A 3H40A 5J0YA 1OUQA 4QZ8A 4NL9C 5AIBA 3L5KA 4DFJA 4M9JA 4ECUA 4EEBA 1NKCA 1WCNA 3RJFA 1WWUA 3EWAA 3SEIA 3WKDA 4WBYA 5CA7A 4KLDA 4I2DA 5C0YA 2AQ0A 3UQ2A 1ZQBA 8ICMA 3OTQA 4OJPA 4RT2A 2YQEA 1NKBA 2MAXA 5AM5A 3QXGA 1AROP 5KT2A 4KX3A 5D49A 2VA3A 4RNMA 5ALSA 1TFYA 4I2EA 4YFKA 2W8KA 3JPSA 3F2BA 5KFEA 5KFYA 5J29A 3HJ1A 2K8AA 4QZBA 7ICKA 1K1QA 4EBEA 1PX5A 2OXOA 3WKBA 5DGBA 2Q0ZX 1ZQUA 4UBCA 4M9GA 3LYSA 4GFJA 5HREA 2Y0SC 5G5GA 4C4RA 2BPGA 2JMGA 2QARA 2WF8A 4OD0A 3GV7B 1QH9A 4EZ6A 4QWCA 4Z6DA 4QWAA 1U45A 3H3AA 3WK5A 2HOFA 5HRDA 5CFUA 4NLNA 1D8BA 4BDPA 5AKIA 2F76X 4GXIA 5AI4A 4CF3A 2WTFA 5ALRA 1NK5A 3KTQA 4UASA 5ALYA 2XO7A 1NK4A 5AIAA 5AI5A 4I2FA 4C7ZA 2K4IA 5JU5A 2V4QA 5A0LA 3RH5A 5TZVA 3CP8A 4FZNA 1SB3C 5G5HA 2F44A 7ICSA 2AH5A 2RFFA 3K4GA 5KFLA 1HUZA 8ICJA 2PFNA 2IHOA 4O3QA 2PMZF 5AKGA 3VC8A 4DLEA 5HRLA 2A1JB 4C8NA 1QSLA 1SV0A 4LT6A 4DWIA 5HHHA 2C28A 1U4BA 3NKUA 3BDPA 4I2JA 2XGPA 4MFCA 3GIKA 4S3NA 2DF4B 4EENA 1M6YA 5KFHA 4YVZA 4KLMA 4HYKA 4EX7A 4ZH4A 2HBKA 1URJA 3PSTA 2NRZA 4O0IA 2NRXA 3NUQA 1KN5A 4DO9A 1PVPA 4M9LA 2ZXHA 2F77X 4C0ZA 2VA2A 4IR1A 2HVHA 1RQLA 3QUBA 3OUYB 3TARA 4J9KA 1TE2A 8ICAA 4IQVA 3SAGA 3MR5A 1VJ5A 3H4BA 4GIBA 5KL8B 1LKYA 3N97B 2YMPA 4LJXA 1A0PA 2UVRA 3V7KA 1S10A 4QZHA 4R64A 4US9A 3AQNA 4RQ4A 2O5AA 4F8RA 4FO6A 2KNJA 3M7DA 1L7MA 1FIQA 1UQVA 3BZCA 3TADA 2AGOA 2OHFA 1KFSA 3H8SA 3JCFA 4BWJA 5L1LA 2KFZA 1BPBA 4C4TA 4DSEA 9ICQA 5DQIA 5KFAA 4KLJA 1T3QA 3PY8A 1ZQHA 5D63A 3RAXA 3PW5A 4O69A 1GPJA 4J9NA 2Y9UA 1V9PA 4YP3A 3L9DA 1HEKA 3MFIA 2R8HA 2P6RA 3PX4A 1SL2A 1SKRA 4QZAA 2AQ4A 4OJ6A 5AKXA 2KKPA 3BQ1A 4UBBA 3LVVA 4M04A 2G0AA 3PX0A 1CUKA 5J2JA 5D62A 1JROA 4F50A 1KDHA 5KFBA 1Z4OA 3KZIU 2Y9TA 2JR5A 1EXNA 2AGQA 1FFUA 3N7SC 4NLKA 5EWGA 3ZD8A 1IXRA 1KFTA 2FPKA 1YT3A 5F9NA 1YLQA 5HNKA 4DQIA 2B51A 1NJXA 3D6JA 4JV1A 3BQ0A 3Q8QB 4X0AA 4MEXA 5DB9A 3HP6A 4DSIA 1V85A 2ZHAA 4DOAA 2JZBA 2HOIA 4DSKA 5J0TA 4MKPA 3RTVA 2DPJA 2R8IA 1PK3A 2QB0A 3TKAA 3E58A 5BOLA 4P4OA 4F4ZA 4XA5A 3AQLA 2DRAA 5AKZA 3EPIA 2IUBA 4O3MA 3OPXA 4FH3A 1QQ6A 1ZETA 4ECWA 4EGWA 4RPYA 5ALKA 1F0MA 2BQ3A 3NYBA 3QYPA 2LYAA 2W11A 1N2XA 4KMUA 4I2AA 1U48A 3G6VA 4UAYA 3QUTA 5AKEA 5ALWA 4EX6A 4F91B 3ZDCA 2OYYA 3UXNA 4IL6U 4R66A 5L1KA 2K4PA 4P0PB 5DLGA 2K4EA 5J2EA 5GTHU 2ZJ8A 2ESEA 5D46A 3F53A 8ICNA 1UT5A 3QU7A 4UB5A 1NJYA 2G08A 5KT4A 2ZIUB 4F71A 9ICLA 4B9VA 2RLTA 2FMQA 4F4WA 2A1JA 5ALFA 5AKJA 4O9MA 4J9MA 2KN7A 4LZGA 1L3VA 2BCVA 3QNMA 3PVXA 4TQSA 2WF9A 3PW4A 4J9QA 2BCUA 1QSSA 4Y2JA 2XGQA 2IOFA 3H38A 3ETLA 5ALIA 3WFQE 1QLNA 5CP2A 1KL9A 4PH5A 9ICUA 4YCXA 3OHBA 1UT8A 4JB3A 1Z4NA 4PHEA 1XSPA 4FBUA 2MUTB 4X4VA 5CB1A 1XSNA 1V38A 3GIJA 1NOMA 5AICA 2E1FA 2ZTCA 4GXKA 3V7JA 5AM4A 2W43A 4NLZA 3Q8LA 3I1YA 5AM1A 3BJYA 9ICSA 3GZFA 2E5SA 2B6GA 4NXWA 4FS1A 9ICMA 1ZOLA 1NO5A 1JXLA 7ICGA 2EZZA 1TVAA 1OXJA 5AKHA 5HRKA 4KB6A 4RNOA 9ICWA 5IILA 4CCHA 4LEYA 4AYBC 3ISCA 5ALHA 3FYHA 5DG8A 1XSLA 1ZQPA 4RPXA 2P66A 2HBMA 2DBYA 7ICMA 4UB3A 3RB6A 4ELVA 4OAHA 3H4DA 1UPHA 3C1YA 4BWMA 3PSIA 1XS9D 2FLPA 2O6KA 3CRXA 2NRVA 2BQRA 2W03A 2AU0A 3EW9A 3H0MB 3MABA 2D3DA 3DDHA 3JPTA 4USAA 5C5JA 4NY8A 5ALVA 2ASJA 5K4LA 3RF9A 1Z00B 4B9TA 3M1YA 2DPIA 2KZMA 5L1IA 4DSJA 2LM1A 2WAQF 4QNLA 3OJUA 2HHTA 2LYHA 1NK7A 5ALTA 3R9KA 3AQMA 5HRGA 4BXOA 4EV6A 5ALLA 8ICWA 1BPZA 2JZBB 5KFUA 5T14A 3SR6A 4KLFA 3K7DA 4DSLA 2PFOA 2PXIA 8ICHA 3SD7A 4M5DA 3ZD9A 4OJLA 1X6JA 7ICEA 9ICIA 2ZIVB 3SV3A 1ZQTA 4PHAA 5KFVA 2VJ4A 5IIOA 1JX4A 1UHUA 3G6YA 4M47A 3MGIA 7ICTA 1KEJA 3WKCA 2A3VA 3OWGA 3HT3A 4YD2A 4UB4A 1D9DA 1NK9A 3VCBA 1IM4A 2IOFK 4US8A 4DL3A 2JH1A 4Y2SA 3AU2A 3GFKB 8ICCA 2F1JA 3AEVA 2NYVA 3OSNA 3M8RA 1PVQA 3OJSA 2ATLA 8ICLA 5CFSA 1PZNA 2ES6A 2LI6A 5AM3A 8ICRA 1P7DA 5EE0A 4CF5A 4JUZA 2EWRA 4Z6FA 3I28A 3C66A 4Y2UA 4O3OA 4IQTA 4RWOA 1ZQJA 1VFGA 5AK4A 2YTUA 3TANA 1MQ2A 1JIHA 4F4XA 4K99A 5J0PA 3MC1A 4I2BA 1NZBA 2WF5A 4IRCA 4EBJA 3C29A 1D9FA 4ED1A 5DG9A 4WC5A 2HDOA 1SV4A 3AMZA 4OAIZ 2GOLA 3ICXA 2EAMA 2FLLA 3D2NA 2XY5A 4YQWA 2KOBA 3BS7A 2HCFA 3B0XA 2IOHA 2E8NA 3QUCA 4NKTA 1IIPA 1ZQVA 2HOQA 1UA0A 4F93B 2OEHA 3NVZA 2C2DA 4MFFA 4K4IA 4IRDA 3ALRA 2J6SA 4DFKA 5IINA 3BQ7A 5AI9A 4FBTA 4RQ5A 5FP0A 4I29A 1N62A 4EEKA 3PNCA 1BPEA 9ICXA 3MR2A 4ED2A 3BQTA 5F2VO 2W3RA 2BGWA 4ED7A 4NLCA 3WU2U 9ICRA 4OJ5A 4RWQA 2KVCA 1DRGA 4EP7A 4MEYA 3JYYA 5B66U 3SAHA 4MFAA 4I2GA 4Y2XA 3M6ZA 1S0OA 2ZUBA 7ICIA 2ZHBA 1S8OA 9ICAA 3U26A 5D61A 2ID1A 3V6JA 3NVOA 3PW7A 3M9MB 1MIVA 1ZQIA 2XCPA 1L5UA 4WC4A 2DUYA 5DECA 4ATBB 4P0QB 4RQ0A 9ICBA 5AKKA 4GLXA 4P4PA 1JUDA 4RNNA 1BNPA 3T79A 3C28A 4J9OA 1SIJA 2KHQA 1PK1A 5HRBA 1L7PA 5DKWA 5HHIA 1HIWA 3BS5A 1ZQNA 2M2TA 4EBCA 1SZHA 1S76D 3KHHA 4X4SA 3ZDAA 1COOA 2ZIUA 4WOYA 3OHAA 3F5AA 5ALPA 3PHZA 2ZH5A 2A1AA 3RR8A 5KFRA 5DQGA 3QU2A 1DXSA 8ICZA 4A8EA 1CEZA 5CHGA 2UVVA 1X2IA 4Q44A 2JV3A 4QWBA 2FLNA 4NXZA 3OVBA 3HRDD 3UXOA 1Q78A 1DOQA 2ZH8A 2HHVA 2W3SA 4O5CA 8ICTA 2NRTA 2V4RA 1L3SA 5E79U 1NK0A 4C8KA 4KLHA 3TFSA 1K1SA 5HP4A 4K9BA 3T5HA 3OSPA 1ZD4A 9ICHA 2ASLA 4MHVA 4C4SA 2YY6A 5EOZA 1ZYQA 1R8CA 3BS5B 4IC9A 1GO3F 4J9RA 3HILA 4DEZA 1F44A 5KG1A 1ZD3A 1B4FA 2B4VA 2ZH9A 4EZ9A 5AHXA 3WK9A 1B43A 4TQRA 1SKSA 2BHNA 5D4BA 5ALGA 5HMMA 5J0UA 4MF2A 3RAQA 3RJJA 3GILA 1KQQA 1Y88A 3NASA 4E8FA 2KZZA 4YMOA 5KT7A 3OGUA 9ICTA 3MDCA 4LEWA 5DGAA 3TADC 4KLIA 2HHPA 1N56A 4RQ6A 5AKYA 5KFFA 1R89A 2G07A 3QEBZ 2ZIWA 4EEYA 5JTIA 2MU2A 4YXJA 1N5WA 4DFPA 2QLTA 4IRKA 3Q8MA 2QARB 4YN4A 3NRWA 2NO4A 2JHDA 4RUCA 3KHRA 2HHWA 1SWWA 1KNYA 2KEYA 3C21A 3RJGA 3LQCB 4GC6A 2DL0A 1DGSA 2DGZA 4AT8B 2M0NA 3FAHA 1SXEA 2JEIA 2HHUA 4Y2RA 1ZD2P 1X40A 1JXEA 1S0MA 2EQYA 2RP5A 3UMGA 8ICXA 1RYSA 1JALA 2MA1A 1T3NA 2VIXA 1ZQFA 3IRUA 2OH2A 4B6JA 2ZUDA 2ZIXB 3TAPA 4WC3A 1XNSA 4KN4A 1QTMA 4EYIB 2NRKA 2B56A 4AT7A 4BXOB 4KITB 1J97A 3PSFA 1X42A 8ICQA 1RZTA 1BVSA 2CPRA 4MF8A 5KFKA 4B9UA 3H8JA 4FHVA 3SMVA 4UD5A 2Y1IA 1NK6A 4U6PA 4WJ3B 1TAMA 1MC8A 3RB4A 4Q45A 9ICNA 4OO1J 1LKYB 4EBDA 1KBUA 7ICNA 3PMNA 1XWLA 3CW2C 4M6WA 1JI7A 3IM1A 1ZQQA 9ICVA 1JRPA 5JTGA 2BDPA 4KLEA 3HKZF 3ZDEA 4AT9A 4M9NA 1N5XA 1SZPA 5HRFA 1RYRA 2KJ5A 2CN1A 3FM9A 3HIYA 1TAQA 2I6XA 4ECXA 5H2FU 3GQCA 8ICKA 4JWMA 4F5PA 2PI5A 4CE6A 5ALMA 5CWRA 1YZ7A 3C2KA 1ZQRA 3Q8SB 2KP7A 2KG5A 1NI3A 3T5JA 3C2MA 3TACB 1NJWA 4WH5A 1R8AA 4ECZA 1TK0A 3JPNA 2BQUA 4E80A 4O5KA 4BUGA 3GIMA 3LK9A 1ZD5A 1Q46A 2Q4TA 3EYZA 2DR7A 2A19A 5DB8A 8ICYA 1SXDA 2ZJ5A 1JQRA 3NVYA 4R63A 4QWDA 2HN1A 1JAJA 2NV3A 1T8EA 2YX8A 3NVVA 3K1RB 5DBCA 5ALDA 2AXTU 7ICUA 2WB1F 4DL6A 2W9BB 1ZQOA 2CRXA 4M6WB 4FFDA 4YR3A 2E8PA 2HVIA 1RM6C 4PPXA 1FO4A 4OCZA 3THVA 2FDRA 3RJEA 1WYGA 7ICRA 1FA0A 4ECSA 3N4MB 4M0AA 2GLEA 4WC0A 3MFHA 3E0FA 5J2FA 2PFPA 4RQ2A 4RWPA 5BOMA 4NXXA 4IR9A 4N7RA 3RJIA 4Y2PA 2KIWA 1IV8A 1DK2A 2IHNA 4EEDA 4K4GA 2ALZA 5KFPA 4QWEA 1PVRA 2DR5A 5J0WA 2G06A 5KAFU 3IHQB 3TI0A 4JMUA 4BJQA 4KMOB 4ED8A 3HPOA 4UAWA 2KIVA 1ZQMA 3WKEA 5DB6A 4FE3A 5KFSA 3E2EA 2KVSA 4F5RA 2R18A 1NNLA 2L5YA 3PSPA 4KLOA 3GV8B 4FHPA 1BNOA 3QX7A 4WC1A 3H0LB 4WBZA 2OCEA 5L1JA 4X4QA 2WFAA 5J2KA 3TAQA 4EYHB 9ICFA 4ECVA 4PHPA 1VLBA 2W54A 5HC9A 4X4PA 1JN3A 3AL0B 4O68A 1Z1VA 4DS4A 5J2HA 4IQWA 5HRIA 3V72A 1L8LA 2XICA 3OV7A 3J81j 3OVSA 1TAUA 1B0XA 2HI0A 4PL2A 1ZQYA 5DDYA 2PKEA 3T5KA 3RH4A 2IA6A 2LM4A 3NS1A 5ALNA 8ICSA 3A0BU 2WF7A 4LEVA 5L9XA 3CNHA 4YR0A 1KSPA 5AK6A 2H3ZA 3F2CA 1UETA 5KL1B 5IIJA 1TV9A 1BPDA 3TQ1A 4DSFA 4ECTA 1ZRNA 1LVHA 2VJ5A 4YD1A 4NLGA 4E7XA 4ELUA 2ZJAA 2EDUA 2ZTDA 2RQ5A 4XRHA 1UEUA 1UA1A 2CXYA 5KFTA 4UD4A 4R8UA 3F5EA 5KFCA 3Q8PB 4M9HA 2W9CA 4CGZA 2HW3A 4F92B 1V97A 3C2LA 1SL1A 5KTQA 5HR7A 2KMDA 3CK6A 4Q43A 3KZXA 3QZ7A 5KG5A 1U47A 4I27A 4WCWA 5J0OA 2C2EA 4KLGA 2F1IA 3MDAA 2R8GA 2GAFD 4DL7A 3OUYA 1UCVA 4C80A 4NXUA 5JUMA 2HBJA 2KJ9A 3QUQA 4ICAA 5KG6A 3RBDA 3ETRA 2G5HB 4I0UA 4ELTA 4UB1A 1MSWD 2LKYA 2Z7JA 1Z1BA 1SKWA 4DQRA 1ZQKA 1F5SA 5J8YC 2QB1A 2GH1A 5EWFA 3B0YA 4PHDA 1COKA 4P4MA 3EZ5A 2KK0A 4KX5A 4YMMA 3Q8RB 5J2GA 2B21A 2FMSA 4RQ7A 1C7YA 5KFWA 4QZFA 2F2AB 8ICBA 2DFLA 4WQLA 4P0PA 3QU4A 3RB0A 1ZQXA 2PI4A 1WCLA 2BE3A 5CRXA 3WFOA 2FPLA 2KICA 4HAIA 3UXPA 3ZI4A 2GA9D 4ATBA 1L3TA 4CF4A 5CJ7A 4UB6U 1N63A 3N7RC 3AQKA 4F2SA 4DQPA 2EZXA 2FMPA 3BZKA 9ICOA 4K97A 5CR0A 4O3PA 1ZRMA 4RT3A 8ICOA 2KTQA 4RPZA 5DG7A 4PGYA 3DEEA 4ED0A 4RUAA 1UEVA 1KRPA 1RDFA 5KT5A 5J8YA 7ICJA 3ERCC 2H3FA 7ICPA 1AQ6A 2AJQA 4LEZA 3SQIA 1OU5A 5KG7A 4RU9A 3JPOA 2G5IB 2KZ3A 4K9AA 1BGXT 2KE7A 3JPPA 2NRWA 4P2HA 5HMLA 2LBOA 1T4GA 2AGPA 1ZJMA 1JMSA 1QCKA 5KFOA 1Q8KA 5KFIA 4KLLA 2MRLA 4DOCA 4QIWC 4X5VA 4X4TA 2E1EA 4ZOHC 3ER9B 2ZH7A 2VKQA 4EELA 4JV0A 5ALEA 4BGDA 2K89A 1XC9A 3HX0A 4RQ1A 4QZIA 5EE9A 5KFZA 7ICFA 2K8BB 3WKAA 1D8YA 1ZJNA 4J03A 2WF6A 4OJOA 4UQGA 3ONNA 5ALQA 5EWEA 1BPXA 2AHOB 2C2RA 7ICOA 3L4PA 1DK3A 2XI9A 1ZQCA 3A0HU 4Y2YA 3Q8KA 3KKAC 2DR9A 1S0VA 3UMBA 3N7PD 4NJ8A 4ECQA 4O67A 5DLFA 4GC7A 2FI1A 1B22A 3RRHA 5DB7A 3HJEA 2LPEA 4G9BA 5KT6A 3C5FA 4K98A 1O03A 7ICLA 2HMXA 5CEHA 4PJ0U 1MA7A 4HX0A 2M2UA 5EE3A 3AUOA 5KG4A 1QQ7A 2P35A 2YMLA 1NJZA 2GO7A 5AK5A 2M9NA 4RWNA 4NM2A 2K60A 3RFAA 2XC9A 1U49A 4ECYA 2LMRA 1ZQ1C 1S97A 2G09A 5IIIA 1SWVA 2N1RA 2RRDA 3AQFA 3PR5B 1ECWA 4Z6CA 1CRXA 1Z3EB 5TISU 2ZH4A 3S6JA 3D2SA 3C18A 4YG2A 4UAVA 2BR0A 4RQ8A 2DKXA 3EF2A 5L1MA 1RXVA 1X9MA 1V4AA 3KKAA 2XY6A 4O6AA 4X4NA 1ZQDA 4UATA 4DQQA 4AT8A 4BX9C 1PK1B 5AM0A 1Q3VA 4I28A 4PL1A 4Y2TA 4YR2A 4WC6A 1KFDA 3MCRA 4WC7A 1HJPA 3RBEA 2RDJA 3PR4A 2B0CA 5KAIU 2YN4A 4XQ7A 2I1QA 2LYBA 4QZEA 2HHSA 4C7YA 1N60A 4UAZA 2BDUA 2DVIA 1F5AA 5KFQA 2JH7A 2BBHA 3PO4A 3NGDA 2JRZA 3QE9Y 4NXVA 5ALZA 2RDIA 3V7LA 2I9GA 7ICVA 3UQ0A 2H3IA 5HRHA 1N48A 4Y2QA 3KFUF 2PBEA 2Q66A 4O3NA 5KFXA 1R8BA 5ALXA 2ZIVA 1X6IA 5J0XA 4X4RA 5J0RA 5J0SA 4O3RA 3M9NB 1NK8A 2PMZC 2Y0SF 1S77D 1XO0A 4U7CA 8ICFA 4CDGA 4PGXA 4B9LA 2M2WA 4XQ8A 5AM2A 5IIKA 1X9XA 3ORYA 1ZXIA 4DCCA 3AN1A 4JWNA 1A76A 5F9LA 2ZH1A 3LDAA 5KG2A 5J2DA 3AQEA 1TKDA 2KSOA 5J2BA 1Q79A 9ICJA 4OAFA 1K5OA 2J6UA 4IG8A 4KTQA 4RQ3A 3I76A 2GWSA 9ICCA 3KOOA 4XUSA 2MSNA 3ED5A 1YZ6A 5B3PA 3HW8A 3RJKA 1NKEA 2ZTEA 1T7PA 1NZPA 8ICGA 5F3XB 5CFTA 1J2NA 4Z6EA 4WQKA 2EZYA 3PW2A 4B9NA 4NV0A 4UW9A 3UM9A 2OWOA 1VJ7A 2E3TA 3T5LA 3AM9A 3PO5A 3RH6A 1ZQGA 2W9AA 2IBKA 2H3QA 4NL9A 2HSZA 4UAUA 2H3VA
chains in the Genus database with same CATH topology
4Q8EA 3WFPA 3OSNA 8ICLA 3M8RA 3OJSA 2ATLA 4ED8A 1PZNA 3HPOA 3LWLA 2UVWA 9ICEA 4NLNA 4UAWA 1MIWA 5IIMA 4BDPA 8ICRA 1ZQMA 3AU6A 4GXIA 5DB6A 2WTFA 4JUZA 5KFSA 1NK5A 2IHMA 4Z6FA 3KTQA 3C66A 3TFRA 2XO7A 3UPQA 4ED3A 4O3OA 3E2EA 4IQTA 1NK4A 2BCSA 4F5RA 1ZQJA 4RWOA 4C8LA 1VFGA 4I2FA 3QEAZ 4KLOA 3GV8B 4QZCA 3SV4A 4X4OA 3TANA 4FHPA 3WFRE 1MQ2A 1BNOA 2V4QA 4R8UB 3RJHA 4WC1A 3RH5A 5TZVA 1JIHA 4F4XA 4WBZA 5L1JA 4X4QA 5J0PA 3M9OB 5J2KA 4ECRA 3TAQA 7ICSA 4I2BA 2RFFA 3K4GA 5KFLA 4DLGA 4EYHB 1HUZA 9ICFA 4ECVA 4PHPA 4IRCA 4EBJA 8ICJA 2PFNA 3OUYB 1D9FA 4ED1A 5KFJA 1TFWA 5DG9A 4WC5A 2BPCA 4O3QA 4DQSA 4DLEA 5HC9A 4X4PA 1JN3A 5HRLA 2FLLA 2A1JB 4C8NA 4DS4A 1QSLA 2XY5A 4YQWA 3JPQA 2HHQA 4LT6A 2DRBA 3HJ4A 4F5OA 4DWIA 5HHHA 5J2HA 2IMWP 2C28A 4IQWA 3B0XA 5HRIA 1U4BA 9ICTA 3V72A 4NKTA 3OV7A 3BDPA 3MBYA 3OVSA 1ZQVA 1UA0A 4I2JA 3H8WA 2XGPA 4F93B 1TAUA 4LVSA 4MFCA 3GIKA 4S3NA 4DL4A 1ZQYA 5DDYA 5KFHA 3T5KA 4YVZA 3RH4A 2IA6A 3C23A 4KLMA 4HYKA 4F2RA 8ICUA 4ZH4A 2C2DA 4MFFA 8ICSA 4K4IA 4IRDA 2NRZA 4J9LA 2J6SA 4O0IA 2NRXA 5L9XA 4DFKA 4I2HA 1ZQLA 4DO9A 5IINA 4M9LA 4YR0A 1KSPA 2VANA 4FBTA 1UETA 4RQ5A 2VA2A 4I29A 3KHLA 4IR1A 2HVHA 3PNCA 1BPEA 5IIJA 9ICXA 4F4YA 1TV9A 5KFGA 1BPDA 3TQ1A 3G6XA 1RPLA 4DSFA 3MR2A 4J9KA 4ECTA 4ED2A 3BQTA 4YD1A 5KG3A 3TARA 4NLGA 8ICAA 2BGWA 5F2VO 3C5GA 4E7XA 4IQVA 3MR5A 4ED7A 4ELUA 2ZJAA 3H4BA 9ICRA 2ZTDA 4RWQA 2DR8A 4EP7A 4XRHA 3N97B 2UVRA 1UEUA 4MEYA 3V7KA 1UA1A 4QZHA 4MFAA 4R64A 3ISDA 1S10A 5KFTA 3AQNA 4RQ4A 4I2GA 3JYYA 4R8UA 1Z00A 4UD4A 2XY7A 5KFCA 2O5AA 2J6TA 4F8RA 3Q8PB 4M9HA 2W9CA 4FO6A 5KFDA 2HW3A 4NKUA 4F92B 3C2LA 1SL1A 4DF4A 1S0OA 5KTQA 2ZUBA 7ICIA 2ZHBA 2AGOA 3WFSC 9ICAA 4Q43A 1KFSA 4R65A 3H8SA 3QZ7A 4BWJA 3KHGA 5KG5A 5L1LA 1U47A 2KFZA 1BPBA 3V6JA 4DSEA 9ICQA 5DQIA 2ID1A 4I27A 4GXJA 3FDSA 4WCWA 5J0OA 5BPCA 1H38A 1MIYA 5KFAA 2C2EA 3PW7A 4KLJA 2R8JA 2C22A 1KLNA 2BKEA 3PY8A 1ZQHA 3M9MB 2F1IA 3MDAA 3RAXA 3PW5A 2P6UA 2R8GA 4KLGA 5KT3A 4DL7A 1MIVA 1ZQIA 3OUYA 2XCPA 3H39A 4J9NA 1L5UA 4FHYA 4WC4A 1V9PA 4YXMA 4YP3A 5DECA 4ATBB 3L9DA 4RQ0A 1ZQSA 9ICBA 3MFIA 2R8HA 4GLXA 2P6RA 5J2CA 5JUMA 4P4PA 3PX4A 1SL2A 4KLQA 4RNNA 1SKRA 4QZAA 1BNPA 2AQ4A 5KG6A 3M8SA 3RBDA 4J9OA 8ICPA 8ICEA 4DL2A 3BQ2A 4ELTA 3BQ1A 4UB1A 4UBBA 1MSWD 2ZH3A 4M04A 4TUPA 1SKWA 4KN7A 3PX0A 1CUKA 4DQRA 1ZQAA 2H5XA 5J2JA 5DKWA 5HHIA 1ZQKA 5HRBA 1YLQA 1ZQNA 2M2TA 4EBCA 3ISBA 4F50A 5J2IA 5EWFA 3B0YA 4PHDA 1KDHA 5KFBA 1S76D 5KFMA 3KHHA 1TK5A 3ZDAA 4F4KA 1COOA 4X4SA 1EXNA 4P4MA 3OHAA 2AGQA 2W9CB 4NLKA 3EZ5A 5EWGA 3ZD8A 4QZ9A 4YMMA 1IXRA 3Q8RB 2FPKA 1KFTA 5F9NA 5J2GA 3ZDBA 2B21A 2ZH5A 1HUOA 2FMSA 4RQ7A 5KFRA 1C7YA 5DQHA 5HNKA 2W9BA 3RR8A 4DQIA 5DQGA 2XCAA 5KFWA 4QZFA 8ICZA 7ICHA 8ICBA 4PGQA 1CEZA 2DFLA 3HWTA 1NJXA 3RB0A 1ZQXA 2PI4A 1WCLA 5CHGA 1S0NA 4JV1A 2BE3A 2KFNA 3BQ0A 3Q8QB 4X0AA 4MEXA 5DB9A 3WFOA 3HP6A 4DL5A 4DSIA 2FPLA 9ICPA 2JEFA 1KTQA 2UVVA 2ZHAA 4DOAA 1X2IA 2JZBA 4FHXA 4Q44A 3UPSA 3UXPA 4ATBA 4DSKA 5J0TA 1L3TA 4QW8A 4FH5A 2MUTA 4QWBA 2FLNA 4NXZA 4QW9A 3GIIA 5CJ7A 3RTVA 2DPJA 2R8IA 3OVBA 4J9PA 4X4UA 3UXOA 1Q78A 5KG0A 3AQKA 1DOQA 4DQPA 4F2SA 2HHVA 2ZH8A 8ICTA 4O5CA 2NRTA 2V4RA 1TFRA 4P4OA 5BOLA 2FMPA 4F4ZA 4XA5A 9ICOA 2F1JA 1L3SA 3AQLA 4WC2A 5CR0A 4O3PA 3OVAA 3EPIA 2DRAA 1NK0A 4C8KA 4KLHA 4FH3A 4RT3A 2ISOA 8ICOA 1ZETA 4LZDA 2UVUA 2KTQA 4RPZA 3QZ8A 3TFSA 5DG7A 1K1SA 5HP4A 4PGYA 4ECWA 3T5HA 4RPYA 3OSPA 4FHWA 2BQ3A 3NYBA 4UB2A 9ICHA 4ED0A 4RUAA 3GV5B 2ASLA 1UEVA 4QZDA 4QZGA 3MR3A 1KRPA 3NTUA 5EOZA 5KT5A 4KMUA 3RB3A 4I2AA 7ICJA 1ZYQA 1R8CA 5HR9A 1U48A 2W8LA 7ICPA 2AJQA 3G6VA 1SL0A 4J9RA 4NM1A 1OU5A 4UAYA 5KG7A 4RU9A 3JPOA 2KZ3A 9ICKA 4DEZA 1BGXT 5KG1A 4F91B 3SI8A 1BPYA 3ZDCA 3JPPA 2NRWA 3UXNA 4P2HA 2ZH9A 5HMLA 4EZ9A 4R66A 5L1KA 4KLTA 4DFMA 1B43A 1T4GA 2AGPA 4F5NA 1JMSA 1ZJMA 5KFOA 8ICVA 4TQRA 2BCQA 5KFIA 4KLLA 1XO1A 1SKSA 4DOCA 2BHNA 5D4BA 4X5VA 4X4TA 3V6KA 2ZH7A 5HMMA 5J0UA 4M2YA 7ICQA 5DLGA 4JV0A 3RAQA 3RJJA 3GILA 2JEGA 4MF2A 1Y88A 5J2EA 1WOTA 4E8FA 2KZZA 2VA8A 4YMOA 5KT7A 2BCRA 2ZJ8A 4BGDA 3OGUA 5D46A 3K75D 3MDCA 4ED6A 8ICNA 5DGAA 1UT5A 1ZQWA 4K4HA 1XC9A 3HX0A 4KLIA 3H37A 4RQ1A 4QZIA 4UB5A 1NJYA 5KFZA 5KT4A 7ICFA 2HHPA 4I2CA 4F5QA 4TURA 1N56A 1D8YA 9ICLA 1ZJNA 4RQ6A 4B9VA 5KFFA 1X9SA 4F4WA 2FMQA 2A1JA 4O9MA 1R89A 4UQGA 4DS5A 4J9MA 2KN7A 5EWEA 3QEBZ 4EEYA 1BPXA 2JEJA 2Y1JA 3RRGA 4LZGA 4YXJA 2C2RA 1L3VA 2BCVA 4DFPA 2F1HA 7ICOA 3PVXA 4IRKA 3Q8MA 1DK3A 4TQSA 4DF8A 4YN4A 1QSYA 1ZQCA 3PW4A 3JZ0A 4J9QA 2BCUA 1XU4A 2XGQA 1QSSA 3Q8KA 4AT7B 5J2AA 2ZUCA 3H38A 1S0VA 2DR9A 1D8LA 3ETLA 3WFQE 4RUCA 4ECQA 1QLNA 5DLFA 2M2VA 4GC7A 5CP2A 4E0DA 1B22A 2HHXA 3RRHA 3KHRA 2HHWA 5DB7A 3MGHA 4KLSA 1KNYA 5KT6A 3C21A 3C5FA 3RJGA 4PH5A 1LV5A 4GC6A 3LQCB 1LB2B 3JPRA 3GDXA 9ICUA 1DGSA 3C1ZA 7ICLA 4JV2A 4O5EA 4YCXA 3H7IA 4JK1A 1MQ3A 3OHBA 1UT8A 3ZDDA 4AT8B 4EBKA 2JEIA 3LWMA 4PHEA 4TUSA 1XSPA 4FBUA 2M2UA 2MUTB 1RXWA 2HHUA 2ASDA 5HRDA 3MR6A 4X4VA 5CB1A 1JXEA 3AUOA 1XSNA 1S0MA 5KG4A 4F3OA 3GIJA 1NOMA 8ICXA 3RR7A 5DBBA 1NJZA 1RYSA 1T3NA 2R8KA 3SYZA 1ZQFA 2ZTCA 2M9NA 4GXKA 4RWNA 3V7JA 4NM2A 1A77A 2ZUDA 2XC9A 1U49A 8ICCA 4NLZA 4ECYA 4DOBA 3TAPA 4WC3A 3Q8LA 4YMNA 1S97A 2ZH2A 4KN4A 5IIIA 1QTMA 4EYIB 2FPMA 1ZQZA 4C8MA 2NRKA 3PR5B 3PW0A 4AT7A 4Z6CA 3BJYA 9ICSA 1Z3EB 1U9LA 4BXOB 5DBAA 1S9FA 4KITB 2ZH4A 4FS1A 8ICQA 9ICMA 3C18A 4YG2A 1RZTA 1BVSA 1NO5A 4B9MA 1JXLA 4MF8A 7ICGA 2BR0A 5KFKA 4B9UA 3H8JA 4FHVA 1TVAA 5J0QA 5KFNA 4UD5A 4RQ8A 2Y1IA 2PFQA 1NK6A 5HRKA 1MC8A 4FS2A 3PX6A 4Q45A 4RNOA 4TUQA 5IILA 3RB4A 1RXVA 4G3IA 4B9SA 9ICWA 1X9MA 4CCHA 2XY6A 1V4AA 9ICNA 4X4NA 5DDMA 1ZQDA 4DQQA 4AT8A 4EBDA 7ICNA 3ISCA 8ICIA 4X0BA 3EPGA 3FYHA 5DG8A 2ZH6A 1XSLA 3PMNA 2BPFA 1XWLA 3PMLA 4I28A 2W9MA 4Q8FA 4M6WA 1ZQPA 3IM1A 4RPXA 4YR2A 1KFDA 1ZQQA 2P66A 2O1PA 4WC6A 3SZ2A 4IQUA 9ICVA 4J9SA 7ICMA 2BDPA 4KLEA 4RZRA 3ZDEA 4UB3A 2ISPA 1HJPA 3RBEA 4KLUA 4WC7A 3PV8A 1ZQEA 4AT9A 3RB6A 4ELVA 3PR4A 3H4DA 3C1YA 2RDJA 3V6HA 4BWMA 4M9NA 4XQ7A 1SZPA 5HRFA 4AT9B 2I1QA 2HHSA 4QZEA 2DVIA 1XS9D 4UAZA 1RYRA 1F5AA 4O3SA 5KFQA 2FLPA 3T3FA 3HIYA 1TAQA 3PO4A 4ECXA 3NGDA 2NRVA 3GQCA 2BQRA 1TK8A 2AU0A 3QE9Y 8ICKA 3EW9A 9ICGA 3MABA 1L3UA 4JWMA 4I2IA 2RDIA 3V7LA 2I9GA 4F5PA 7ICVA 2PI5A 3JPTA 3UQ0A 5CWRA 5C5JA 3C2KA 4NY8A 1ZQRA 2V9WA 1N48A 3Q8SB 2ASJA 1X9WA 2KP7A 5HRHA 2PBEA 3T5JA 3C2MA 1Z00B 4O3NA 4B9TA 2Q66A 1NJWA 4C8OA 3H40A 2DPIA 2KZMA 1R8AA 5KFXA 5L1IA 4DSJA 5J0YA 1R8BA 4QZ8A 4ECZA 1TK0A 3JPNA 3OJUA 4DFJA 4ECUA 2BQUA 2LYHA 1NK7A 1NKCA 4M9JA 1WCNA 3RJFA 4O5KA 2HHTA 5DEDA 4E80A 5J0XA 3EWAA 3GIMA 4X4RA 3LK9A 4WBYA 5CA7A 5J0RA 5J0SA 3EYZA 4KLDA 4O3RA 3AQMA 5HRGA 5DB8A 4BXOA 8ICYA 2DR7A 4I2DA 3M9NB 2ZJ5A 2AQ0A 3UQ2A 1ZQBA 1JQRA 1NK8A 4R63A 8ICWA 1S77D 4QWDA 1BPZA 8ICMA 8ICFA 2JZBB 4PGXA 4B9LA 4RT2A 2M2WA 4XQ8A 1JAJA 5KFUA 1T8EA 2MAXA 1NKBA 5IIKA 3ORYA 4KLFA 1AROP 4JWNA 1A76A 5F9LA 5KT2A 2ZH1A 3LDAA 5D49A 2PFOA 5DBCA 2PXIA 4RNMA 2VA3A 4DSLA 5KG2A 8ICHA 5J2DA 1TFYA 1TKDA 4I2EA 7ICUA 4M5DA 3ZD9A 4YFKA 5J2BA 2W9BB 4DL6A 4M6WB 1ZQOA 2W8KA 9ICJA 1Q79A 3JPSA 5KFEA 5KFYA 4YR3A 2J6UA 5J29A 4KTQA 2HVIA 7ICEA 3HJ1A 4QZBA 4IG8A 4PPXA 4RQ3A 3THVA 7ICKA 3RJEA 9ICIA 2GWSA 1K1QA 9ICCA 7ICRA 1FA0A 4ECSA 4EBEA 3SV3A 4XUSA 3N4MB 1PX5A 4M0AA 4WC0A 1ZQTA 5DGBA 3HW8A 4PHAA 5KFVA 3RJKA 1NKEA 2Q0ZX 5IIOA 3MFHA 2ZTEA 1JX4A 5J2FA 1ZQUA 4RQ2A 1T7PA 5BOMA 2PFPA 8ICGA 4UBCA 1NZPA 4RWPA 3G6YA 4M9GA 5HREA 4M47A 4IR9A 3MGIA 3RJIA 4Z6EA 1KEJA 3PW2A 2BPGA 7ICTA 4B9NA 3HT3A 4YD2A 4UB4A 3GV7B 1D9DA 1NK9A 4EZ6A 1DK2A 1IM4A 4DL3A 2IHNA 3T5LA 2OWOA 1VJ7A 3PO5A 3RH6A 1ZQGA 4QWCA 2ALZA 2W9AA 4K4GA 4Z6DA 5KFPA 4QWAA 4QWEA 1U45A 2IBKA 3AU2A 2DR5A 3H3AA 5J0WA 3GFKB 3TI0A 3IHQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q8E A;  3WFP A;  3OSN A;  8ICL A;  3M8R A;  3OJS A;  2ATL A;  4ED8 A;  1PZN A;  3HPO A;  3LWL A;  2UVW A;  9ICE A;  4NLN A;  4UAW A;  1MIW A;  5IIM A;  4BDP A;  8ICR A;  1ZQM A;  3AU6 A;  4GXI A;  5DB6 A;  2WTF A;  4JUZ A;  5KFS A;  1NK5 A;  2IHM A;  4Z6F A;  3KTQ A;  3C66 A;  3TFR A;  2XO7 A;  3UPQ A;  4ED3 A;  4O3O A;  3E2E A;  4IQT A;  1NK4 A;  2BCS A;  4F5R A;  1ZQJ A;  4RWO A;  4C8L A;  1VFG A;  4I2F A;  3QEA Z;  4KLO A;  3GV8 B;  4QZC A;  3SV4 A;  4X4O A;  3TAN A;  4FHP A;  3WFR E;  1MQ2 A;  1BNO A;  2V4Q A;  4R8U B;  3RJH A;  4WC1 A;  3RH5 A;  5TZV A;  1JIH A;  4F4X A;  4WBZ A;  5L1J A;  4X4Q A;  5J0P A;  3M9O B;  5J2K A;  4ECR A;  3TAQ A;  7ICS A;  4I2B A;  2RFF A;  3K4G A;  5KFL A;  4DLG A;  4EYH B;  1HUZ A;  9ICF A;  4ECV A;  4PHP A;  4IRC A;  4EBJ A;  8ICJ A;  2PFN A;  3OUY B;  1D9F A;  4ED1 A;  5KFJ A;  1TFW A;  5DG9 A;  4WC5 A;  2BPC A;  4O3Q A;  4DQS A;  4DLE A;  5HC9 A;  4X4P A;  1JN3 A;  5HRL A;  2FLL A;  2A1J B;  4C8N A;  4DS4 A;  1QSL A;  2XY5 A;  4YQW A;  3JPQ A;  2HHQ A;  4LT6 A;  2DRB A;  3HJ4 A;  4F5O A;  4DWI A;  5HHH A;  5J2H A;  2IMW P;  2C28 A;  4IQW A;  3B0X A;  5HRI A;  1U4B A;  9ICT A;  3V72 A;  4NKT A;  3OV7 A;  3BDP A;  3MBY A;  3OVS A;  1ZQV A;  1UA0 A;  4I2J A;  3H8W A;  2XGP A;  4F93 B;  1TAU A;  4LVS A;  4MFC A;  3GIK A;  4S3N A;  4DL4 A;  1ZQY A;  5DDY A;  5KFH A;  3T5K A;  4YVZ A;  3RH4 A;  2IA6 A;  3C23 A;  4KLM A;  4HYK A;  4F2R A;  8ICU A;  4ZH4 A;  2C2D A;  4MFF A;  8ICS A;  4K4I A;  4IRD A;  2NRZ A;  4J9L A;  2J6S A;  4O0I A;  2NRX A;  5L9X A;  4DFK A;  4I2H A;  1ZQL A;  4DO9 A;  5IIN A;  4M9L A;  4YR0 A;  1KSP A;  2VAN A;  4FBT A;  1UET A;  4RQ5 A;  2VA2 A;  4I29 A;  3KHL A;  4IR1 A;  2HVH A;  3PNC A;  1BPE A;  5IIJ A;  9ICX A;  4F4Y A;  1TV9 A;  5KFG A;  1BPD A;  3TQ1 A;  3G6X A;  1RPL A;  4DSF A;  3MR2 A;  4J9K A;  4ECT A;  4ED2 A;  3BQT A;  4YD1 A;  5KG3 A;  3TAR A;  4NLG A;  8ICA A;  2BGW A;  5F2V O;  3C5G A;  4E7X A;  4IQV A;  3MR5 A;  4ED7 A;  4ELU A;  2ZJA A;  3H4B A;  9ICR A;  2ZTD A;  4RWQ A;  2DR8 A;  4EP7 A;  4XRH A;  3N97 B;  2UVR A;  1UEU A;  4MEY A;  3V7K A;  1UA1 A;  4QZH A;  4MFA A;  4R64 A;  3ISD A;  1S10 A;  5KFT A;  3AQN A;  4RQ4 A;  4I2G A;  3JYY A;  4R8U A;  1Z00 A;  4UD4 A;  2XY7 A;  5KFC A;  2O5A A;  2J6T A;  4F8R A;  3Q8P B;  4M9H A;  2W9C A;  4FO6 A;  5KFD A;  2HW3 A;  4NKU A;  4F92 B;  3C2L A;  1SL1 A;  4DF4 A;  1S0O A;  5KTQ A;  2ZUB A;  7ICI A;  2ZHB A;  2AGO A;  3WFS C;  9ICA A;  4Q43 A;  1KFS A;  4R65 A;  3H8S A;  3QZ7 A;  4BWJ A;  3KHG A;  5KG5 A;  5L1L A;  1U47 A;  2KFZ A;  1BPB A;  3V6J A;  4DSE A;  9ICQ A;  5DQI A;  2ID1 A;  4I27 A;  4GXJ A;  3FDS A;  4WCW A;  5J0O A;  5BPC A;  1H38 A;  1MIY A;  5KFA A;  2C2E A;  3PW7 A;  4KLJ A;  2R8J A;  2C22 A;  1KLN A;  2BKE A;  3PY8 A;  1ZQH A;  3M9M B;  2F1I A;  3MDA A;  3RAX A;  3PW5 A;  2P6U A;  2R8G A;  4KLG A;  5KT3 A;  4DL7 A;  1MIV A;  1ZQI A;  3OUY A;  2XCP A;  3H39 A;  4J9N A;  1L5U A;  4FHY A;  4WC4 A;  1V9P A;  4YXM A;  4YP3 A;  5DEC A;  4ATB B;  3L9D A;  4RQ0 A;  1ZQS A;  9ICB A;  3MFI A;  2R8H A;  4GLX A;  2P6R A;  5J2C A;  5JUM A;  4P4P A;  3PX4 A;  1SL2 A;  4KLQ A;  4RNN A;  1SKR A;  4QZA A;  1BNP A;  2AQ4 A;  5KG6 A;  3M8S A;  3RBD A;  4J9O A;  8ICP A;  8ICE A;  4DL2 A;  3BQ2 A;  4ELT A;  3BQ1 A;  4UB1 A;  4UBB A;  1MSW D;  2ZH3 A;  4M04 A;  4TUP A;  1SKW A;  4KN7 A;  3PX0 A;  1CUK A;  4DQR A;  1ZQA A;  2H5X A;  5J2J A;  5DKW A;  5HHI A;  1ZQK A;  5HRB A;  1YLQ A;  1ZQN A;  2M2T A;  4EBC A;  3ISB A;  4F50 A;  5J2I A;  5EWF A;  3B0Y A;  4PHD A;  1KDH A;  5KFB A;  1S76 D;  5KFM A;  3KHH A;  1TK5 A;  3ZDA A;  4F4K A;  1COO A;  4X4S A;  1EXN A;  4P4M A;  3OHA A;  2AGQ A;  2W9C B;  4NLK A;  3EZ5 A;  5EWG A;  3ZD8 A;  4QZ9 A;  4YMM A;  1IXR A;  3Q8R B;  2FPK A;  1KFT A;  5F9N A;  5J2G A;  3ZDB A;  2B21 A;  2ZH5 A;  1HUO A;  2FMS A;  4RQ7 A;  5KFR A;  1C7Y A;  5DQH A;  5HNK A;  2W9B A;  3RR8 A;  4DQI A;  5DQG A;  2XCA A;  5KFW A;  4QZF A;  8ICZ A;  7ICH A;  8ICB A;  4PGQ A;  1CEZ A;  2DFL A;  3HWT A;  1NJX A;  3RB0 A;  1ZQX A;  2PI4 A;  1WCL A;  5CHG A;  1S0N A;  4JV1 A;  2BE3 A;  2KFN A;  3BQ0 A;  3Q8Q B;  4X0A A;  4MEX A;  5DB9 A;  3WFO A;  3HP6 A;  4DL5 A;  4DSI A;  2FPL A;  9ICP A;  2JEF A;  1KTQ A;  2UVV A;  2ZHA A;  4DOA A;  1X2I A;  2JZB A;  4FHX A;  4Q44 A;  3UPS A;  3UXP A;  4ATB A;  4DSK A;  5J0T A;  1L3T A;  4QW8 A;  4FH5 A;  2MUT A;  4QWB A;  2FLN A;  4NXZ A;  4QW9 A;  3GII A;  5CJ7 A;  3RTV A;  2DPJ A;  2R8I A;  3OVB A;  4J9P A;  4X4U A;  3UXO A;  1Q78 A;  5KG0 A;  3AQK A;  1DOQ A;  4DQP A;  4F2S A;  2HHV A;  2ZH8 A;  8ICT A;  4O5C A;  2NRT A;  2V4R A;  1TFR A;  4P4O A;  5BOL A;  2FMP A;  4F4Z A;  4XA5 A;  9ICO A;  2F1J A;  1L3S A;  3AQL A;  4WC2 A;  5CR0 A;  4O3P A;  3OVA A;  3EPI A;  2DRA A;  1NK0 A;  4C8K A;  4KLH A;  4FH3 A;  4RT3 A;  2ISO A;  8ICO A;  1ZET A;  4LZD A;  2UVU A;  2KTQ A;  4RPZ A;  3QZ8 A;  3TFS A;  5DG7 A;  1K1S A;  5HP4 A;  4PGY A;  4ECW A;  3T5H A;  4RPY A;  3OSP A;  4FHW A;  2BQ3 A;  3NYB A;  4UB2 A;  9ICH A;  4ED0 A;  4RUA A;  3GV5 B;  2ASL A;  1UEV A;  4QZD A;  4QZG A;  3MR3 A;  1KRP A;  3NTU A;  5EOZ A;  5KT5 A;  4KMU A;  3RB3 A;  4I2A A;  7ICJ A;  1ZYQ A;  1R8C A;  5HR9 A;  1U48 A;  2W8L A;  7ICP A;  2AJQ A;  3G6V A;  1SL0 A;  4J9R A;  4NM1 A;  1OU5 A;  4UAY A;  5KG7 A;  4RU9 A;  3JPO A;  2KZ3 A;  9ICK A;  4DEZ A;  1BGX T;  5KG1 A;  4F91 B;  3SI8 A;  1BPY A;  3ZDC A;  3JPP A;  2NRW A;  3UXN A;  4P2H A;  2ZH9 A;  5HML A;  4EZ9 A;  4R66 A;  5L1K A;  4KLT A;  4DFM A;  1B43 A;  1T4G A;  2AGP A;  4F5N A;  1JMS A;  1ZJM A;  5KFO A;  8ICV A;  4TQR A;  2BCQ A;  5KFI A;  4KLL A;  1XO1 A;  1SKS A;  4DOC A;  2BHN A;  5D4B A;  4X5V A;  4X4T A;  3V6K A;  2ZH7 A;  5HMM A;  5J0U A;  4M2Y A;  7ICQ A;  5DLG A;  4JV0 A;  3RAQ A;  3RJJ A;  3GIL A;  2JEG A;  4MF2 A;  1Y88 A;  5J2E A;  1WOT A;  4E8F A;  2KZZ A;  2VA8 A;  4YMO A;  5KT7 A;  2BCR A;  2ZJ8 A;  4BGD A;  3OGU A;  5D46 A;  3K75 D;  3MDC A;  4ED6 A;  8ICN A;  5DGA A;  1UT5 A;  1ZQW A;  4K4H A;  1XC9 A;  3HX0 A;  4KLI A;  3H37 A;  4RQ1 A;  4QZI A;  4UB5 A;  1NJY A;  5KFZ A;  5KT4 A;  7ICF A;  2HHP A;  4I2C A;  4F5Q A;  4TUR A;  1N56 A;  1D8Y A;  9ICL A;  1ZJN A;  4RQ6 A;  4B9V A;  5KFF A;  1X9S A;  4F4W A;  2FMQ A;  2A1J A;  4O9M A;  1R89 A;  4UQG A;  4DS5 A;  4J9M A;  2KN7 A;  5EWE A;  3QEB Z;  4EEY A;  1BPX A;  2JEJ A;  2Y1J A;  3RRG A;  4LZG A;  4YXJ A;  2C2R A;  1L3V A;  2BCV A;  4DFP A;  2F1H A;  7ICO A;  3PVX A;  4IRK A;  3Q8M A;  1DK3 A;  4TQS A;  4DF8 A;  4YN4 A;  1QSY A;  1ZQC A;  3PW4 A;  3JZ0 A;  4J9Q A;  2BCU A;  1XU4 A;  2XGQ A;  1QSS A;  3Q8K A;  4AT7 B;  5J2A A;  2ZUC A;  3H38 A;  1S0V A;  2DR9 A;  1D8L A;  3ETL A;  3WFQ E;  4RUC A;  4ECQ A;  1QLN A;  5DLF A;  2M2V A;  4GC7 A;  5CP2 A;  4E0D A;  1B22 A;  2HHX A;  3RRH A;  3KHR A;  2HHW A;  5DB7 A;  3MGH A;  4KLS A;  1KNY A;  5KT6 A;  3C21 A;  3C5F A;  3RJG A;  4PH5 A;  1LV5 A;  4GC6 A;  3LQC B;  1LB2 B;  3JPR A;  3GDX A;  9ICU A;  1DGS A;  3C1Z A;  7ICL A;  4JV2 A;  4O5E A;  4YCX A;  3H7I A;  4JK1 A;  1MQ3 A;  3OHB A;  1UT8 A;  3ZDD A;  4AT8 B;  4EBK A;  2JEI A;  3LWM A;  4PHE A;  4TUS A;  1XSP A;  4FBU A;  2M2U A;  2MUT B;  1RXW A;  2HHU A;  2ASD A;  5HRD A;  3MR6 A;  4X4V A;  5CB1 A;  1JXE A;  3AUO A;  1XSN A;  1S0M A;  5KG4 A;  4F3O A;  3GIJ A;  1NOM A;  8ICX A;  3RR7 A;  5DBB A;  1NJZ A;  1RYS A;  1T3N A;  2R8K A;  3SYZ A;  1ZQF A;  2ZTC A;  2M9N A;  4GXK A;  4RWN A;  3V7J A;  4NM2 A;  1A77 A;  2ZUD A;  2XC9 A;  1U49 A;  8ICC A;  4NLZ A;  4ECY A;  4DOB A;  3TAP A;  4WC3 A;  3Q8L A;  4YMN A;  1S97 A;  2ZH2 A;  4KN4 A;  5III A;  1QTM A;  4EYI B;  2FPM A;  1ZQZ A;  4C8M A;  2NRK A;  3PR5 B;  3PW0 A;  4AT7 A;  4Z6C A;  3BJY A;  9ICS A;  1Z3E B;  1U9L A;  4BXO B;  5DBA A;  1S9F A;  4KIT B;  2ZH4 A;  4FS1 A;  8ICQ A;  9ICM A;  3C18 A;  4YG2 A;  1RZT A;  1BVS A;  1NO5 A;  4B9M A;  1JXL A;  4MF8 A;  7ICG A;  2BR0 A;  5KFK A;  4B9U A;  3H8J A;  4FHV A;  1TVA A;  5J0Q A;  5KFN A;  4UD5 A;  4RQ8 A;  2Y1I A;  2PFQ A;  1NK6 A;  5HRK A;  1MC8 A;  4FS2 A;  3PX6 A;  4Q45 A;  4RNO A;  4TUQ A;  5IIL A;  3RB4 A;  1RXV A;  4G3I A;  4B9S A;  9ICW A;  1X9M A;  4CCH A;  2XY6 A;  1V4A A;  9ICN A;  4X4N A;  5DDM A;  1ZQD A;  4DQQ A;  4AT8 A;  4EBD A;  7ICN A;  3ISC A;  8ICI A;  4X0B A;  3EPG A;  3FYH A;  5DG8 A;  2ZH6 A;  1XSL A;  3PMN A;  2BPF A;  1XWL A;  3PML A;  4I28 A;  2W9M A;  4Q8F A;  4M6W A;  1ZQP A;  3IM1 A;  4RPX A;  4YR2 A;  1KFD A;  1ZQQ A;  2P66 A;  2O1P A;  4WC6 A;  3SZ2 A;  4IQU A;  9ICV A;  4J9S A;  7ICM A;  2BDP A;  4KLE A;  4RZR A;  3ZDE A;  4UB3 A;  2ISP A;  1HJP A;  3RBE A;  4KLU A;  4WC7 A;  3PV8 A;  1ZQE A;  4AT9 A;  3RB6 A;  4ELV A;  3PR4 A;  3H4D A;  3C1Y A;  2RDJ A;  3V6H A;  4BWM A;  4M9N A;  4XQ7 A;  1SZP A;  5HRF A;  4AT9 B;  2I1Q A;  2HHS A;  4QZE A;  2DVI A;  1XS9 D;  4UAZ A;  1RYR A;  1F5A A;  4O3S A;  5KFQ A;  2FLP A;  3T3F A;  3HIY A;  1TAQ A;  3PO4 A;  4ECX A;  3NGD A;  2NRV A;  3GQC A;  2BQR A;  1TK8 A;  2AU0 A;  3QE9 Y;  8ICK A;  3EW9 A;  9ICG A;  3MAB A;  1L3U A;  4JWM A;  4I2I A;  2RDI A;  3V7L A;  2I9G A;  4F5P A;  7ICV A;  2PI5 A;  3JPT A;  3UQ0 A;  5CWR A;  5C5J A;  3C2K A;  4NY8 A;  1ZQR A;  2V9W A;  1N48 A;  3Q8S B;  2ASJ A;  1X9W A;  2KP7 A;  5HRH A;  2PBE A;  3T5J A;  3C2M A;  1Z00 B;  4O3N A;  4B9T A;  2Q66 A;  1NJW A;  4C8O A;  3H40 A;  2DPI A;  2KZM A;  1R8A A;  5KFX A;  5L1I A;  4DSJ A;  5J0Y A;  1R8B A;  4QZ8 A;  4ECZ A;  1TK0 A;  3JPN A;  3OJU A;  4DFJ A;  4ECU A;  2BQU A;  2LYH A;  1NK7 A;  1NKC A;  4M9J A;  1WCN A;  3RJF A;  4O5K A;  2HHT A;  5DED A;  4E80 A;  5J0X A;  3EWA A;  3GIM A;  4X4R A;  3LK9 A;  4WBY A;  5CA7 A;  5J0R A;  5J0S A;  3EYZ A;  4KLD A;  4O3R A;  3AQM A;  5HRG A;  5DB8 A;  4BXO A;  8ICY A;  2DR7 A;  4I2D A;  3M9N B;  2ZJ5 A;  2AQ0 A;  3UQ2 A;  1ZQB A;  1JQR A;  1NK8 A;  4R63 A;  8ICW A;  1S77 D;  4QWD A;  1BPZ A;  8ICM A;  8ICF A;  2JZB B;  4PGX A;  4B9L A;  4RT2 A;  2M2W A;  4XQ8 A;  1JAJ A;  5KFU A;  1T8E A;  2MAX A;  1NKB A;  5IIK A;  3ORY A;  4KLF A;  1ARO P;  4JWN A;  1A76 A;  5F9L A;  5KT2 A;  2ZH1 A;  3LDA A;  5D49 A;  2PFO A;  5DBC A;  2PXI A;  4RNM A;  2VA3 A;  4DSL A;  5KG2 A;  8ICH A;  5J2D A;  1TFY A;  1TKD A;  4I2E A;  7ICU A;  4M5D A;  3ZD9 A;  4YFK A;  5J2B A;  2W9B B;  4DL6 A;  4M6W B;  1ZQO A;  2W8K A;  9ICJ A;  1Q79 A;  3JPS A;  5KFE A;  5KFY A;  4YR3 A;  2J6U A;  5J29 A;  4KTQ A;  2HVI A;  7ICE A;  3HJ1 A;  4QZB A;  4IG8 A;  4PPX A;  4RQ3 A;  3THV A;  7ICK A;  3RJE A;  9ICI A;  2GWS A;  1K1Q A;  9ICC A;  7ICR A;  1FA0 A;  4ECS A;  4EBE A;  3SV3 A;  4XUS A;  3N4M B;  1PX5 A;  4M0A A;  4WC0 A;  1ZQT A;  5DGB A;  3HW8 A;  4PHA A;  5KFV A;  3RJK A;  1NKE A;  2Q0Z X;  5IIO A;  3MFH A;  2ZTE A;  1JX4 A;  5J2F A;  1ZQU A;  4RQ2 A;  1T7P A;  5BOM A;  2PFP A;  8ICG A;  4UBC A;  1NZP A;  4RWP A;  3G6Y A;  4M9G A;  5HRE A;  4M47 A;  4IR9 A;  3MGI A;  3RJI A;  4Z6E A;  1KEJ A;  3PW2 A;  2BPG A;  7ICT A;  4B9N A;  3HT3 A;  4YD2 A;  4UB4 A;  3GV7 B;  1D9D A;  1NK9 A;  4EZ6 A;  1DK2 A;  1IM4 A;  4DL3 A;  2IHN A;  3T5L A;  2OWO A;  1VJ7 A;  3PO5 A;  3RH6 A;  1ZQG A;  4QWC A;  2ALZ A;  2W9A A;  4K4G A;  4Z6D A;  5KFP A;  4QWA A;  4QWE A;  1U45 A;  2IBK A;  3AU2 A;  2DR5 A;  3H3A A;  5J0W A;  3GFK B;  3TI0 A;  3IHQ B; 
#chains in the Genus database with same CATH topology
 4Q8E A;  3WFP A;  2WB1 C;  1MIW A;  3LWL A;  2UVW A;  9ICE A;  2JXJ A;  5IIM A;  3AU6 A;  2K4H A;  4K8V A;  2IHM A;  3TFR A;  3UPQ A;  4ED3 A;  4Y2V A;  2BBJ A;  2BCS A;  4C8L A;  3QEA Z;  3IV6 A;  4QZC A;  3SV4 A;  4JLZ A;  4X4O A;  4F72 A;  3WFR E;  4R8U B;  3RJH A;  2ZXI A;  3M9O B;  4ECR A;  4DLG A;  3D2Q A;  1N61 A;  1RQN A;  2KHV A;  5KFJ A;  1TFW A;  2BPC A;  4DQS A;  3SEN A;  3F2D A;  4CRX A;  2DRB A;  3JPQ A;  2HHQ A;  3HJ4 A;  4F5O A;  4CNQ A;  3IN5 A;  2IMW P;  2YB4 A;  2K8C B;  1WWV A;  3MBY A;  3H8W A;  4LVS A;  1L6N A;  2I5H A;  4DL4 A;  1DGJ A;  3C23 A;  8ICU A;  2FJ6 A;  4F2R A;  2KV2 A;  4J9L A;  1X66 A;  2W7P A;  4I2H A;  1ZQL A;  2F8K A;  2VAN A;  3IP4 B;  3IG5 A;  4IS7 A;  4K96 A;  3IG8 A;  2EAO A;  5GTI U;  3KHL A;  4F4Y A;  5KFG A;  1FEZ A;  3G6X A;  1RPL A;  5KG3 A;  3C5G A;  3O0F A;  3NWI A;  2LHT A;  4KM5 A;  2DR8 A;  2WAQ C;  3ISD A;  1Z00 A;  2XY7 A;  2J6T A;  2W04 A;  5KFD A;  4NKU A;  4DF4 A;  3UMC A;  2RHF A;  3WFS C;  4R65 A;  4QIW F;  4DFD A;  1C20 A;  3K1Z A;  3KHG A;  3KD3 A;  1ED1 A;  4GXJ A;  3FDS A;  5BPC A;  1VDV A;  1H38 A;  1MIY A;  2R8J A;  4UAR A;  2QB0 B;  2BKE A;  3SAF A;  2C22 A;  1KLN A;  2E8O A;  2P6U A;  5KT3 A;  2ZIX A;  3H39 A;  4FHY A;  4QJF B;  5ALO A;  4YXM A;  2E8M A;  1ZQS A;  1S5L U;  2FCL A;  3ER8 C;  3NVW A;  3QU5 A;  4ACO A;  5J2C A;  4KLQ A;  8ICP A;  3M8S A;  8ICE A;  4DL2 A;  3BQ2 A;  5JRT A;  2ZH3 A;  4TUP A;  4KN7 A;  1ZQA A;  3IDW A;  2H5X A;  3L3F X;  3ISB A;  2KJ8 A;  5J2I A;  5KFM A;  1TK5 A;  4F4K A;  4XJE A;  2W9C B;  1KKX A;  4QZ9 A;  1WUD A;  3ZDB A;  1HUO A;  3WK4 A;  1J2M A;  5DQH A;  2W9B A;  1L8O A;  2XCA A;  7ICH A;  4PGQ A;  3HWT A;  2EAP A;  1S0N A;  2KFN A;  4RQM A;  1KW4 A;  4DL5 A;  9ICP A;  3N28 A;  2JEF A;  2XVT A;  1KTQ A;  1OW5 A;  4FHX A;  5B5E U;  3UPS A;  2WHE A;  4FH5 A;  4QW8 A;  3FC4 A;  2MUT A;  1SV0 C;  4QW9 A;  3GII A;  4J9P A;  4X4U A;  4NWI A;  5KG0 A;  3MGV A;  2DKZ A;  1TFR A;  4WC2 A;  3OVA A;  2ISO A;  5AI0 A;  4LZD A;  2UVU A;  3WK8 A;  3QZ8 A;  4FHW A;  4UB2 A;  2YMM A;  3GV5 B;  1Z19 A;  4FZL A;  4QZD A;  4QZG A;  3LVW A;  3MR3 A;  3NTU A;  3RB3 A;  5HR6 A;  5HR9 A;  1WG8 A;  2W8L A;  1SL0 A;  4NM1 A;  2BZF A;  2F8L A;  9ICK A;  3SI8 A;  1BPY A;  2KD1 A;  4KLT A;  4DFM A;  5CHE A;  8ICV A;  3NRZ A;  4F5N A;  2HBL A;  2BCQ A;  1XO1 A;  1RG6 A;  3V6K A;  3WK6 A;  4M2Y A;  7ICQ A;  2YMQ A;  2JEG A;  1WOT A;  3H0R B;  2VA8 A;  4AYB F;  2BCR A;  4ED6 A;  3K75 D;  2JGA A;  3H37 A;  4K4H A;  1ZQW A;  4I2C A;  4F5Q A;  4TUR A;  1L7O A;  5ALJ A;  1X9S A;  3GU3 A;  3KBB A;  4DS5 A;  3RRG A;  2QKQ A;  2JEJ A;  2Y1J A;  4FO1 A;  5AKL A;  2F1H A;  1T94 A;  4DF8 A;  1QSY A;  2W55 A;  4PZO A;  5AK3 A;  3JZ0 A;  4OAG A;  1XU4 A;  4AT7 B;  2ZUC A;  5J2A A;  1D8L A;  2M2V A;  4E0D A;  2HHX A;  2FE9 A;  4UB8 U;  3MGH A;  4KLS A;  4JLX A;  1RYU A;  1LV5 A;  2DWQ A;  3JPR A;  3GDX A;  1LB2 B;  3C1Z A;  4JV2 A;  4O5E A;  3H7I A;  4JK1 A;  1MN8 A;  1MQ3 A;  4EBK A;  3ZDD A;  3LWM A;  4TUS A;  2XID A;  1RXW A;  3QU9 A;  2ASD A;  3MR6 A;  3HKZ C;  1IG6 A;  4F3O A;  2KSO B;  5AI6 A;  3RR7 A;  4PZN A;  3PZP A;  5DBB A;  2R8K A;  3SYZ A;  5ALU A;  4P0Q A;  2W7O A;  1A77 A;  1QQ5 A;  4NXT A;  4DOB A;  3WK7 A;  4NLB A;  4YMN A;  2ZH2 A;  2FPM A;  1CI4 A;  1ZQZ A;  4C8M A;  2ODG A;  3H8M A;  3M6K A;  3PW0 A;  1U9L A;  2KKV A;  5DBA A;  1S9F A;  3DV9 A;  3EUB 2;  2F3N A;  4B9M A;  4FZM A;  2ZIW B;  5B3Q A;  5J0Q A;  5KFN A;  2D8C A;  2PFQ A;  1L7N A;  4FS2 A;  3PX6 A;  4G3I A;  4TUQ A;  5DED A;  4B9S A;  5DDM A;  2NO5 A;  8ICI A;  2DQN B;  4X0B A;  3EPG A;  2ZH6 A;  2BPF A;  2EAN A;  3PML A;  4Q8F A;  2W9M A;  2HN2 A;  1SGG A;  4RQN A;  2O1P A;  3SZ2 A;  4IQU A;  1O08 A;  4J9S A;  1PUZ A;  4RZR A;  4KLU A;  2ISP A;  3PV8 A;  1ZQE A;  3V6H A;  4AT9 B;  3B9J A;  4AP9 A;  5EE1 A;  4O3S A;  2ZG6 A;  3T3F A;  2D6F C;  3CYM A;  1TK8 A;  2YB1 A;  9ICG A;  1L3U A;  4I2I A;  2OM6 A;  1A6S A;  2V9W A;  1Q3U A;  1X9W A;  1FFV A;  5KNI A;  5AI8 A;  4C8O A;  2EH9 A;  3H40 A;  5J0Y A;  1OUQ A;  4QZ8 A;  4NL9 C;  5AIB A;  3L5K A;  4DFJ A;  4M9J A;  4ECU A;  4EEB A;  1NKC A;  1WCN A;  3RJF A;  1WWU A;  3EWA A;  3SEI A;  3WKD A;  4WBY A;  5CA7 A;  4KLD A;  4I2D A;  5C0Y A;  2AQ0 A;  3UQ2 A;  1ZQB A;  8ICM A;  3OTQ A;  4OJP A;  4RT2 A;  2YQE A;  1NKB A;  2MAX A;  5AM5 A;  3QXG A;  1ARO P;  5KT2 A;  4KX3 A;  5D49 A;  2VA3 A;  4RNM A;  5ALS A;  1TFY A;  4I2E A;  4YFK A;  2W8K A;  3JPS A;  3F2B A;  5KFE A;  5KFY A;  5J29 A;  3HJ1 A;  2K8A A;  4QZB A;  7ICK A;  1K1Q A;  4EBE A;  1PX5 A;  2OXO A;  3WKB A;  5DGB A;  2Q0Z X;  1ZQU A;  4UBC A;  4M9G A;  3LYS A;  4GFJ A;  5HRE A;  2Y0S C;  5G5G A;  4C4R A;  2BPG A;  2JMG A;  2QAR A;  2WF8 A;  4OD0 A;  3GV7 B;  1QH9 A;  4EZ6 A;  4QWC A;  4Z6D A;  4QWA A;  1U45 A;  3H3A A;  3WK5 A;  2HOF A;  5HRD A;  5CFU A;  4NLN A;  1D8B A;  4BDP A;  5AKI A;  2F76 X;  4GXI A;  5AI4 A;  4CF3 A;  2WTF A;  5ALR A;  1NK5 A;  3KTQ A;  4UAS A;  5ALY A;  2XO7 A;  1NK4 A;  5AIA A;  5AI5 A;  4I2F A;  4C7Z A;  2K4I A;  5JU5 A;  2V4Q A;  5A0L A;  3RH5 A;  5TZV A;  3CP8 A;  4FZN A;  1SB3 C;  5G5H A;  2F44 A;  7ICS A;  2AH5 A;  2RFF A;  3K4G A;  5KFL A;  1HUZ A;  8ICJ A;  2PFN A;  2IHO A;  4O3Q A;  2PMZ F;  5AKG A;  3VC8 A;  4DLE A;  5HRL A;  2A1J B;  4C8N A;  1QSL A;  1SV0 A;  4LT6 A;  4DWI A;  5HHH A;  2C28 A;  1U4B A;  3NKU A;  3BDP A;  4I2J A;  2XGP A;  4MFC A;  3GIK A;  4S3N A;  2DF4 B;  4EEN A;  1M6Y A;  5KFH A;  4YVZ A;  4KLM A;  4HYK A;  4EX7 A;  4ZH4 A;  2HBK A;  1URJ A;  3PST A;  2NRZ A;  4O0I A;  2NRX A;  3NUQ A;  1KN5 A;  4DO9 A;  1PVP A;  4M9L A;  2ZXH A;  2F77 X;  4C0Z A;  2VA2 A;  4IR1 A;  2HVH A;  1RQL A;  3QUB A;  3OUY B;  3TAR A;  4J9K A;  1TE2 A;  8ICA A;  4IQV A;  3SAG A;  3MR5 A;  1VJ5 A;  3H4B A;  4GIB A;  5KL8 B;  1LKY A;  3N97 B;  2YMP A;  4LJX A;  1A0P A;  2UVR A;  3V7K A;  1S10 A;  4QZH A;  4R64 A;  4US9 A;  3AQN A;  4RQ4 A;  2O5A A;  4F8R A;  4FO6 A;  2KNJ A;  3M7D A;  1L7M A;  1FIQ A;  1UQV A;  3BZC A;  3TAD A;  2AGO A;  2OHF A;  1KFS A;  3H8S A;  3JCF A;  4BWJ A;  5L1L A;  2KFZ A;  1BPB A;  4C4T A;  4DSE A;  9ICQ A;  5DQI A;  5KFA A;  4KLJ A;  1T3Q A;  3PY8 A;  1ZQH A;  5D63 A;  3RAX A;  3PW5 A;  4O69 A;  1GPJ A;  4J9N A;  2Y9U A;  1V9P A;  4YP3 A;  3L9D A;  1HEK A;  3MFI A;  2R8H A;  2P6R A;  3PX4 A;  1SL2 A;  1SKR A;  4QZA A;  2AQ4 A;  4OJ6 A;  5AKX A;  2KKP A;  3BQ1 A;  4UBB A;  3LVV A;  4M04 A;  2G0A A;  3PX0 A;  1CUK A;  5J2J A;  5D62 A;  1JRO A;  4F50 A;  1KDH A;  5KFB A;  1Z4O A;  3KZI U;  2Y9T A;  2JR5 A;  1EXN A;  2AGQ A;  1FFU A;  3N7S C;  4NLK A;  5EWG A;  3ZD8 A;  1IXR A;  1KFT A;  2FPK A;  1YT3 A;  5F9N A;  1YLQ A;  5HNK A;  4DQI A;  2B51 A;  1NJX A;  3D6J A;  4JV1 A;  3BQ0 A;  3Q8Q B;  4X0A A;  4MEX A;  5DB9 A;  3HP6 A;  4DSI A;  1V85 A;  2ZHA A;  4DOA A;  2JZB A;  2HOI A;  4DSK A;  5J0T A;  4MKP A;  3RTV A;  2DPJ A;  2R8I A;  1PK3 A;  2QB0 A;  3TKA A;  3E58 A;  5BOL A;  4P4O A;  4F4Z A;  4XA5 A;  3AQL A;  2DRA A;  5AKZ A;  3EPI A;  2IUB A;  4O3M A;  3OPX A;  4FH3 A;  1QQ6 A;  1ZET A;  4ECW A;  4EGW A;  4RPY A;  5ALK A;  1F0M A;  2BQ3 A;  3NYB A;  3QYP A;  2LYA A;  2W11 A;  1N2X A;  4KMU A;  4I2A A;  1U48 A;  3G6V A;  4UAY A;  3QUT A;  5AKE A;  5ALW A;  4EX6 A;  4F91 B;  3ZDC A;  2OYY A;  3UXN A;  4IL6 U;  4R66 A;  5L1K A;  2K4P A;  4P0P B;  5DLG A;  2K4E A;  5J2E A;  5GTH U;  2ZJ8 A;  2ESE A;  5D46 A;  3F53 A;  8ICN A;  1UT5 A;  3QU7 A;  4UB5 A;  1NJY A;  2G08 A;  5KT4 A;  2ZIU B;  4F71 A;  9ICL A;  4B9V A;  2RLT A;  2FMQ A;  4F4W A;  2A1J A;  5ALF A;  5AKJ A;  4O9M A;  4J9M A;  2KN7 A;  4LZG A;  1L3V A;  2BCV A;  3QNM A;  3PVX A;  4TQS A;  2WF9 A;  3PW4 A;  4J9Q A;  2BCU A;  1QSS A;  4Y2J A;  2XGQ A;  2IOF A;  3H38 A;  3ETL A;  5ALI A;  3WFQ E;  1QLN A;  5CP2 A;  1KL9 A;  4PH5 A;  9ICU A;  4YCX A;  3OHB A;  1UT8 A;  4JB3 A;  1Z4N A;  4PHE A;  1XSP A;  4FBU A;  2MUT B;  4X4V A;  5CB1 A;  1XSN A;  1V38 A;  3GIJ A;  1NOM A;  5AIC A;  2E1F A;  2ZTC A;  4GXK A;  3V7J A;  5AM4 A;  2W43 A;  4NLZ A;  3Q8L A;  3I1Y A;  5AM1 A;  3BJY A;  9ICS A;  3GZF A;  2E5S A;  2B6G A;  4NXW A;  4FS1 A;  9ICM A;  1ZOL A;  1NO5 A;  1JXL A;  7ICG A;  2EZZ A;  1TVA A;  1OXJ A;  5AKH A;  5HRK A;  4KB6 A;  4RNO A;  9ICW A;  5IIL A;  4CCH A;  4LEY A;  4AYB C;  3ISC A;  5ALH A;  3FYH A;  5DG8 A;  1XSL A;  1ZQP A;  4RPX A;  2P66 A;  2HBM A;  2DBY A;  7ICM A;  4UB3 A;  3RB6 A;  4ELV A;  4OAH A;  3H4D A;  1UPH A;  3C1Y A;  4BWM A;  3PSI A;  1XS9 D;  2FLP A;  2O6K A;  3CRX A;  2NRV A;  2BQR A;  2W03 A;  2AU0 A;  3EW9 A;  3H0M B;  3MAB A;  2D3D A;  3DDH A;  3JPT A;  4USA A;  5C5J A;  4NY8 A;  5ALV A;  2ASJ A;  5K4L A;  3RF9 A;  1Z00 B;  4B9T A;  3M1Y A;  2DPI A;  2KZM A;  5L1I A;  4DSJ A;  2LM1 A;  2WAQ F;  4QNL A;  3OJU A;  2HHT A;  2LYH A;  1NK7 A;  5ALT A;  3R9K A;  3AQM A;  5HRG A;  4BXO A;  4EV6 A;  5ALL A;  8ICW A;  1BPZ A;  2JZB B;  5KFU A;  5T14 A;  3SR6 A;  4KLF A;  3K7D A;  4DSL A;  2PFO A;  2PXI A;  8ICH A;  3SD7 A;  4M5D A;  3ZD9 A;  4OJL A;  1X6J A;  7ICE A;  9ICI A;  2ZIV B;  3SV3 A;  1ZQT A;  4PHA A;  5KFV A;  2VJ4 A;  5IIO A;  1JX4 A;  1UHU A;  3G6Y A;  4M47 A;  3MGI A;  7ICT A;  1KEJ A;  3WKC A;  2A3V A;  3OWG A;  3HT3 A;  4YD2 A;  4UB4 A;  1D9D A;  1NK9 A;  3VCB A;  1IM4 A;  2IOF K;  4US8 A;  4DL3 A;  2JH1 A;  4Y2S A;  3AU2 A;  3GFK B;  8ICC A;  2F1J A;  3AEV A;  2NYV A;  3OSN A;  3M8R A;  1PVQ A;  3OJS A;  2ATL A;  8ICL A;  5CFS A;  1PZN A;  2ES6 A;  2LI6 A;  5AM3 A;  8ICR A;  1P7D A;  5EE0 A;  4CF5 A;  4JUZ A;  2EWR A;  4Z6F A;  3I28 A;  3C66 A;  4Y2U A;  4O3O A;  4IQT A;  4RWO A;  1ZQJ A;  1VFG A;  5AK4 A;  2YTU A;  3TAN A;  1MQ2 A;  1JIH A;  4F4X A;  4K99 A;  5J0P A;  3MC1 A;  4I2B A;  1NZB A;  2WF5 A;  4IRC A;  4EBJ A;  3C29 A;  1D9F A;  4ED1 A;  5DG9 A;  4WC5 A;  2HDO A;  1SV4 A;  3AMZ A;  4OAI Z;  2GOL A;  3ICX A;  2EAM A;  2FLL A;  3D2N A;  2XY5 A;  4YQW A;  2KOB A;  3BS7 A;  2HCF A;  3B0X A;  2IOH A;  2E8N A;  3QUC A;  4NKT A;  1IIP A;  1ZQV A;  2HOQ A;  1UA0 A;  4F93 B;  2OEH A;  3NVZ A;  2C2D A;  4MFF A;  4K4I A;  4IRD A;  3ALR A;  2J6S A;  4DFK A;  5IIN A;  3BQ7 A;  5AI9 A;  4FBT A;  4RQ5 A;  5FP0 A;  4I29 A;  1N62 A;  4EEK A;  3PNC A;  1BPE A;  9ICX A;  3MR2 A;  4ED2 A;  3BQT A;  5F2V O;  2W3R A;  2BGW A;  4ED7 A;  4NLC A;  3WU2 U;  9ICR A;  4OJ5 A;  4RWQ A;  2KVC A;  1DRG A;  4EP7 A;  4MEY A;  3JYY A;  5B66 U;  3SAH A;  4MFA A;  4I2G A;  4Y2X A;  3M6Z A;  1S0O A;  2ZUB A;  7ICI A;  2ZHB A;  1S8O A;  9ICA A;  3U26 A;  5D61 A;  2ID1 A;  3V6J A;  3NVO A;  3PW7 A;  3M9M B;  1MIV A;  1ZQI A;  2XCP A;  1L5U A;  4WC4 A;  2DUY A;  5DEC A;  4ATB B;  4P0Q B;  4RQ0 A;  9ICB A;  5AKK A;  4GLX A;  4P4P A;  1JUD A;  4RNN A;  1BNP A;  3T79 A;  3C28 A;  4J9O A;  1SIJ A;  2KHQ A;  1PK1 A;  5HRB A;  1L7P A;  5DKW A;  5HHI A;  1HIW A;  3BS5 A;  1ZQN A;  2M2T A;  4EBC A;  1SZH A;  1S76 D;  3KHH A;  4X4S A;  3ZDA A;  1COO A;  2ZIU A;  4WOY A;  3OHA A;  3F5A A;  5ALP A;  3PHZ A;  2ZH5 A;  2A1A A;  3RR8 A;  5KFR A;  5DQG A;  3QU2 A;  1DXS A;  8ICZ A;  4A8E A;  1CEZ A;  5CHG A;  2UVV A;  1X2I A;  4Q44 A;  2JV3 A;  4QWB A;  2FLN A;  4NXZ A;  3OVB A;  3HRD D;  3UXO A;  1Q78 A;  1DOQ A;  2ZH8 A;  2HHV A;  2W3S A;  4O5C A;  8ICT A;  2NRT A;  2V4R A;  1L3S A;  5E79 U;  1NK0 A;  4C8K A;  4KLH A;  3TFS A;  1K1S A;  5HP4 A;  4K9B A;  3T5H A;  3OSP A;  1ZD4 A;  9ICH A;  2ASL A;  4MHV A;  4C4S A;  2YY6 A;  5EOZ A;  1ZYQ A;  1R8C A;  3BS5 B;  4IC9 A;  1GO3 F;  4J9R A;  3HIL A;  4DEZ A;  1F44 A;  5KG1 A;  1ZD3 A;  1B4F A;  2B4V A;  2ZH9 A;  4EZ9 A;  5AHX A;  3WK9 A;  1B43 A;  4TQR A;  1SKS A;  2BHN A;  5D4B A;  5ALG A;  5HMM A;  5J0U A;  4MF2 A;  3RAQ A;  3RJJ A;  3GIL A;  1KQQ A;  1Y88 A;  3NAS A;  4E8F A;  2KZZ A;  4YMO A;  5KT7 A;  3OGU A;  9ICT A;  3MDC A;  4LEW A;  5DGA A;  3TAD C;  4KLI A;  2HHP A;  1N56 A;  4RQ6 A;  5AKY A;  5KFF A;  1R89 A;  2G07 A;  3QEB Z;  2ZIW A;  4EEY A;  5JTI A;  2MU2 A;  4YXJ A;  1N5W A;  4DFP A;  2QLT A;  4IRK A;  3Q8M A;  2QAR B;  4YN4 A;  3NRW A;  2NO4 A;  2JHD A;  4RUC A;  3KHR A;  2HHW A;  1SWW A;  1KNY A;  2KEY A;  3C21 A;  3RJG A;  3LQC B;  4GC6 A;  2DL0 A;  1DGS A;  2DGZ A;  4AT8 B;  2M0N A;  3FAH A;  1SXE A;  2JEI A;  2HHU A;  4Y2R A;  1ZD2 P;  1X40 A;  1JXE A;  1S0M A;  2EQY A;  2RP5 A;  3UMG A;  8ICX A;  1RYS A;  1JAL A;  2MA1 A;  1T3N A;  2VIX A;  1ZQF A;  3IRU A;  2OH2 A;  4B6J A;  2ZUD A;  2ZIX B;  3TAP A;  4WC3 A;  1XNS A;  4KN4 A;  1QTM A;  4EYI B;  2NRK A;  2B56 A;  4AT7 A;  4BXO B;  4KIT B;  1J97 A;  3PSF A;  1X42 A;  8ICQ A;  1RZT A;  1BVS A;  2CPR A;  4MF8 A;  5KFK A;  4B9U A;  3H8J A;  4FHV A;  3SMV A;  4UD5 A;  2Y1I A;  1NK6 A;  4U6P A;  4WJ3 B;  1TAM A;  1MC8 A;  3RB4 A;  4Q45 A;  9ICN A;  4OO1 J;  1LKY B;  4EBD A;  1KBU A;  7ICN A;  3PMN A;  1XWL A;  3CW2 C;  4M6W A;  1JI7 A;  3IM1 A;  1ZQQ A;  9ICV A;  1JRP A;  5JTG A;  2BDP A;  4KLE A;  3HKZ F;  3ZDE A;  4AT9 A;  4M9N A;  1N5X A;  1SZP A;  5HRF A;  1RYR A;  2KJ5 A;  2CN1 A;  3FM9 A;  3HIY A;  1TAQ A;  2I6X A;  4ECX A;  5H2F U;  3GQC A;  8ICK A;  4JWM A;  4F5P A;  2PI5 A;  4CE6 A;  5ALM A;  5CWR A;  1YZ7 A;  3C2K A;  1ZQR A;  3Q8S B;  2KP7 A;  2KG5 A;  1NI3 A;  3T5J A;  3C2M A;  3TAC B;  1NJW A;  4WH5 A;  1R8A A;  4ECZ A;  1TK0 A;  3JPN A;  2BQU A;  4E80 A;  4O5K A;  4BUG A;  3GIM A;  3LK9 A;  1ZD5 A;  1Q46 A;  2Q4T A;  3EYZ A;  2DR7 A;  2A19 A;  5DB8 A;  8ICY A;  1SXD A;  2ZJ5 A;  1JQR A;  3NVY A;  4R63 A;  4QWD A;  2HN1 A;  1JAJ A;  2NV3 A;  1T8E A;  2YX8 A;  3NVV A;  3K1R B;  5DBC A;  5ALD A;  2AXT U;  7ICU A;  2WB1 F;  4DL6 A;  2W9B B;  1ZQO A;  2CRX A;  4M6W B;  4FFD A;  4YR3 A;  2E8P A;  2HVI A;  1RM6 C;  4PPX A;  1FO4 A;  4OCZ A;  3THV A;  2FDR A;  3RJE A;  1WYG A;  7ICR A;  1FA0 A;  4ECS A;  3N4M B;  4M0A A;  2GLE A;  4WC0 A;  3MFH A;  3E0F A;  5J2F A;  2PFP A;  4RQ2 A;  4RWP A;  5BOM A;  4NXX A;  4IR9 A;  4N7R A;  3RJI A;  4Y2P A;  2KIW A;  1IV8 A;  1DK2 A;  2IHN A;  4EED A;  4K4G A;  2ALZ A;  5KFP A;  4QWE A;  1PVR A;  2DR5 A;  5J0W A;  2G06 A;  5KAF U;  3IHQ B;  3TI0 A;  4JMU A;  4BJQ A;  4KMO B;  4ED8 A;  3HPO A;  4UAW A;  2KIV A;  1ZQM A;  3WKE A;  5DB6 A;  4FE3 A;  5KFS A;  3E2E A;  2KVS A;  4F5R A;  2R18 A;  1NNL A;  2L5Y A;  3PSP A;  4KLO A;  3GV8 B;  4FHP A;  1BNO A;  3QX7 A;  4WC1 A;  3H0L B;  4WBZ A;  2OCE A;  5L1J A;  4X4Q A;  2WFA A;  5J2K A;  3TAQ A;  4EYH B;  9ICF A;  4ECV A;  4PHP A;  1VLB A;  2W54 A;  5HC9 A;  4X4P A;  1JN3 A;  3AL0 B;  4O68 A;  1Z1V A;  4DS4 A;  5J2H A;  4IQW A;  5HRI A;  3V72 A;  1L8L A;  2XIC A;  3OV7 A;  3J81 j;  3OVS A;  1TAU A;  1B0X A;  2HI0 A;  4PL2 A;  1ZQY A;  5DDY A;  2PKE A;  3T5K A;  3RH4 A;  2IA6 A;  2LM4 A;  3NS1 A;  5ALN A;  8ICS A;  3A0B U;  2WF7 A;  4LEV A;  5L9X A;  3CNH A;  4YR0 A;  1KSP A;  5AK6 A;  2H3Z A;  3F2C A;  1UET A;  5KL1 B;  5IIJ A;  1TV9 A;  1BPD A;  3TQ1 A;  4DSF A;  4ECT A;  1ZRN A;  1LVH A;  2VJ5 A;  4YD1 A;  4NLG A;  4E7X A;  4ELU A;  2ZJA A;  2EDU A;  2ZTD A;  2RQ5 A;  4XRH A;  1UEU A;  1UA1 A;  2CXY A;  5KFT A;  4UD4 A;  4R8U A;  3F5E A;  5KFC A;  3Q8P B;  4M9H A;  2W9C A;  4CGZ A;  2HW3 A;  4F92 B;  1V97 A;  3C2L A;  1SL1 A;  5KTQ A;  5HR7 A;  2KMD A;  3CK6 A;  4Q43 A;  3KZX A;  3QZ7 A;  5KG5 A;  1U47 A;  4I27 A;  4WCW A;  5J0O A;  2C2E A;  4KLG A;  2F1I A;  3MDA A;  2R8G A;  2GAF D;  4DL7 A;  3OUY A;  1UCV A;  4C80 A;  4NXU A;  5JUM A;  2HBJ A;  2KJ9 A;  3QUQ A;  4ICA A;  5KG6 A;  3RBD A;  3ETR A;  2G5H B;  4I0U A;  4ELT A;  4UB1 A;  1MSW D;  2LKY A;  2Z7J A;  1Z1B A;  1SKW A;  4DQR A;  1ZQK A;  1F5S A;  5J8Y C;  2QB1 A;  2GH1 A;  5EWF A;  3B0Y A;  4PHD A;  1COK A;  4P4M A;  3EZ5 A;  2KK0 A;  4KX5 A;  4YMM A;  3Q8R B;  5J2G A;  2B21 A;  2FMS A;  4RQ7 A;  1C7Y A;  5KFW A;  4QZF A;  2F2A B;  8ICB A;  2DFL A;  4WQL A;  4P0P A;  3QU4 A;  3RB0 A;  1ZQX A;  2PI4 A;  1WCL A;  2BE3 A;  5CRX A;  3WFO A;  2FPL A;  2KIC A;  4HAI A;  3UXP A;  3ZI4 A;  2GA9 D;  4ATB A;  1L3T A;  4CF4 A;  5CJ7 A;  4UB6 U;  1N63 A;  3N7R C;  3AQK A;  4F2S A;  4DQP A;  2EZX A;  2FMP A;  3BZK A;  9ICO A;  4K97 A;  5CR0 A;  4O3P A;  1ZRM A;  4RT3 A;  8ICO A;  2KTQ A;  4RPZ A;  5DG7 A;  4PGY A;  3DEE A;  4ED0 A;  4RUA A;  1UEV A;  1KRP A;  1RDF A;  5KT5 A;  5J8Y A;  7ICJ A;  3ERC C;  2H3F A;  7ICP A;  1AQ6 A;  2AJQ A;  4LEZ A;  3SQI A;  1OU5 A;  5KG7 A;  4RU9 A;  3JPO A;  2G5I B;  2KZ3 A;  4K9A A;  1BGX T;  2KE7 A;  3JPP A;  2NRW A;  4P2H A;  5HML A;  2LBO A;  1T4G A;  2AGP A;  1ZJM A;  1JMS A;  1QCK A;  5KFO A;  1Q8K A;  5KFI A;  4KLL A;  2MRL A;  4DOC A;  4QIW C;  4X5V A;  4X4T A;  2E1E A;  4ZOH C;  3ER9 B;  2ZH7 A;  2VKQ A;  4EEL A;  4JV0 A;  5ALE A;  4BGD A;  2K89 A;  1XC9 A;  3HX0 A;  4RQ1 A;  4QZI A;  5EE9 A;  5KFZ A;  7ICF A;  2K8B B;  3WKA A;  1D8Y A;  1ZJN A;  4J03 A;  2WF6 A;  4OJO A;  4UQG A;  3ONN A;  5ALQ A;  5EWE A;  1BPX A;  2AHO B;  2C2R A;  7ICO A;  3L4P A;  1DK3 A;  2XI9 A;  1ZQC A;  3A0H U;  4Y2Y A;  3Q8K A;  3KKA C;  2DR9 A;  1S0V A;  3UMB A;  3N7P D;  4NJ8 A;  4ECQ A;  4O67 A;  5DLF A;  4GC7 A;  2FI1 A;  1B22 A;  3RRH A;  5DB7 A;  3HJE A;  2LPE A;  4G9B A;  5KT6 A;  3C5F A;  4K98 A;  1O03 A;  7ICL A;  2HMX A;  5CEH A;  4PJ0 U;  1MA7 A;  4HX0 A;  2M2U A;  5EE3 A;  3AUO A;  5KG4 A;  1QQ7 A;  2P35 A;  2YML A;  1NJZ A;  2GO7 A;  5AK5 A;  2M9N A;  4RWN A;  4NM2 A;  2K60 A;  3RFA A;  2XC9 A;  1U49 A;  4ECY A;  2LMR A;  1ZQ1 C;  1S97 A;  2G09 A;  5III A;  1SWV A;  2N1R A;  2RRD A;  3AQF A;  3PR5 B;  1ECW A;  4Z6C A;  1CRX A;  1Z3E B;  5TIS U;  2ZH4 A;  3S6J A;  3D2S A;  3C18 A;  4YG2 A;  4UAV A;  2BR0 A;  4RQ8 A;  2DKX A;  3EF2 A;  5L1M A;  1RXV A;  1X9M A;  1V4A A;  3KKA A;  2XY6 A;  4O6A A;  4X4N A;  1ZQD A;  4UAT A;  4DQQ A;  4AT8 A;  4BX9 C;  1PK1 B;  5AM0 A;  1Q3V A;  4I28 A;  4PL1 A;  4Y2T A;  4YR2 A;  4WC6 A;  1KFD A;  3MCR A;  4WC7 A;  1HJP A;  3RBE A;  2RDJ A;  3PR4 A;  2B0C A;  5KAI U;  2YN4 A;  4XQ7 A;  2I1Q A;  2LYB A;  4QZE A;  2HHS A;  4C7Y A;  1N60 A;  4UAZ A;  2BDU A;  2DVI A;  1F5A A;  5KFQ A;  2JH7 A;  2BBH A;  3PO4 A;  3NGD A;  2JRZ A;  3QE9 Y;  4NXV A;  5ALZ A;  2RDI A;  3V7L A;  2I9G A;  7ICV A;  3UQ0 A;  2H3I A;  5HRH A;  1N48 A;  4Y2Q A;  3KFU F;  2PBE A;  2Q66 A;  4O3N A;  5KFX A;  1R8B A;  5ALX A;  2ZIV A;  1X6I A;  5J0X A;  4X4R A;  5J0R A;  5J0S A;  4O3R A;  3M9N B;  1NK8 A;  2PMZ C;  2Y0S F;  1S77 D;  1XO0 A;  4U7C A;  8ICF A;  4CDG A;  4PGX A;  4B9L A;  2M2W A;  4XQ8 A;  5AM2 A;  5IIK A;  1X9X A;  3ORY A;  1ZXI A;  4DCC A;  3AN1 A;  4JWN A;  1A76 A;  5F9L A;  2ZH1 A;  3LDA A;  5KG2 A;  5J2D A;  3AQE A;  1TKD A;  2KSO A;  5J2B A;  1Q79 A;  9ICJ A;  4OAF A;  1K5O A;  2J6U A;  4IG8 A;  4KTQ A;  4RQ3 A;  3I76 A;  2GWS A;  9ICC A;  3KOO A;  4XUS A;  2MSN A;  3ED5 A;  1YZ6 A;  5B3P A;  3HW8 A;  3RJK A;  1NKE A;  2ZTE A;  1T7P A;  1NZP A;  8ICG A;  5F3X B;  5CFT A;  1J2N A;  4Z6E A;  4WQK A;  2EZY A;  3PW2 A;  4B9N A;  4NV0 A;  4UW9 A;  3UM9 A;  2OWO A;  1VJ7 A;  2E3T A;  3T5L A;  3AM9 A;  3PO5 A;  3RH6 A;  1ZQG A;  2W9A A;  2IBK A;  2H3Q A;  4NL9 A;  2HSZ A;  4UAU A;  2H3V A; 
#chains in the Genus database with same CATH homology
 4Q8E A;  3WFP A;  3OSN A;  8ICL A;  3M8R A;  3OJS A;  2ATL A;  4ED8 A;  1PZN A;  3HPO A;  3LWL A;  2UVW A;  9ICE A;  4NLN A;  4UAW A;  1MIW A;  5IIM A;  4BDP A;  8ICR A;  1ZQM A;  3AU6 A;  4GXI A;  5DB6 A;  2WTF A;  4JUZ A;  5KFS A;  1NK5 A;  2IHM A;  4Z6F A;  3KTQ A;  3C66 A;  3TFR A;  2XO7 A;  3UPQ A;  4ED3 A;  4O3O A;  3E2E A;  4IQT A;  1NK4 A;  2BCS A;  4F5R A;  1ZQJ A;  4RWO A;  4C8L A;  1VFG A;  4I2F A;  3QEA Z;  4KLO A;  3GV8 B;  4QZC A;  3SV4 A;  4X4O A;  3TAN A;  4FHP A;  3WFR E;  1MQ2 A;  1BNO A;  2V4Q A;  4R8U B;  3RJH A;  4WC1 A;  3RH5 A;  5TZV A;  1JIH A;  4F4X A;  4WBZ A;  5L1J A;  4X4Q A;  5J0P A;  3M9O B;  5J2K A;  4ECR A;  3TAQ A;  7ICS A;  4I2B A;  2RFF A;  3K4G A;  5KFL A;  4DLG A;  4EYH B;  1HUZ A;  9ICF A;  4ECV A;  4PHP A;  4IRC A;  4EBJ A;  8ICJ A;  2PFN A;  3OUY B;  1D9F A;  4ED1 A;  5KFJ A;  1TFW A;  5DG9 A;  4WC5 A;  2BPC A;  4O3Q A;  4DQS A;  4DLE A;  5HC9 A;  4X4P A;  1JN3 A;  5HRL A;  2FLL A;  2A1J B;  4C8N A;  4DS4 A;  1QSL A;  2XY5 A;  4YQW A;  3JPQ A;  2HHQ A;  4LT6 A;  2DRB A;  3HJ4 A;  4F5O A;  4DWI A;  5HHH A;  5J2H A;  2IMW P;  2C28 A;  4IQW A;  3B0X A;  5HRI A;  1U4B A;  9ICT A;  3V72 A;  4NKT A;  3OV7 A;  3BDP A;  3MBY A;  3OVS A;  1ZQV A;  1UA0 A;  4I2J A;  3H8W A;  2XGP A;  4F93 B;  1TAU A;  4LVS A;  4MFC A;  3GIK A;  4S3N A;  4DL4 A;  1ZQY A;  5DDY A;  5KFH A;  3T5K A;  4YVZ A;  3RH4 A;  2IA6 A;  3C23 A;  4KLM A;  4HYK A;  4F2R A;  8ICU A;  4ZH4 A;  2C2D A;  4MFF A;  8ICS A;  4K4I A;  4IRD A;  2NRZ A;  4J9L A;  2J6S A;  4O0I A;  2NRX A;  5L9X A;  4DFK A;  4I2H A;  1ZQL A;  4DO9 A;  5IIN A;  4M9L A;  4YR0 A;  1KSP A;  2VAN A;  4FBT A;  1UET A;  4RQ5 A;  2VA2 A;  4I29 A;  3KHL A;  4IR1 A;  2HVH A;  3PNC A;  1BPE A;  5IIJ A;  9ICX A;  4F4Y A;  1TV9 A;  5KFG A;  1BPD A;  3TQ1 A;  3G6X A;  1RPL A;  4DSF A;  3MR2 A;  4J9K A;  4ECT A;  4ED2 A;  3BQT A;  4YD1 A;  5KG3 A;  3TAR A;  4NLG A;  8ICA A;  2BGW A;  5F2V O;  3C5G A;  4E7X A;  4IQV A;  3MR5 A;  4ED7 A;  4ELU A;  2ZJA A;  3H4B A;  9ICR A;  2ZTD A;  4RWQ A;  2DR8 A;  4EP7 A;  4XRH A;  3N97 B;  2UVR A;  1UEU A;  4MEY A;  3V7K A;  1UA1 A;  4QZH A;  4MFA A;  4R64 A;  3ISD A;  1S10 A;  5KFT A;  3AQN A;  4RQ4 A;  4I2G A;  3JYY A;  4R8U A;  1Z00 A;  4UD4 A;  2XY7 A;  5KFC A;  2O5A A;  2J6T A;  4F8R A;  3Q8P B;  4M9H A;  2W9C A;  4FO6 A;  5KFD A;  2HW3 A;  4NKU A;  4F92 B;  3C2L A;  1SL1 A;  4DF4 A;  1S0O A;  5KTQ A;  2ZUB A;  7ICI A;  2ZHB A;  2AGO A;  3WFS C;  9ICA A;  4Q43 A;  1KFS A;  4R65 A;  3H8S A;  3QZ7 A;  4BWJ A;  3KHG A;  5KG5 A;  5L1L A;  1U47 A;  2KFZ A;  1BPB A;  3V6J A;  4DSE A;  9ICQ A;  5DQI A;  2ID1 A;  4I27 A;  4GXJ A;  3FDS A;  4WCW A;  5J0O A;  5BPC A;  1H38 A;  1MIY A;  5KFA A;  2C2E A;  3PW7 A;  4KLJ A;  2R8J A;  2C22 A;  1KLN A;  2BKE A;  3PY8 A;  1ZQH A;  3M9M B;  2F1I A;  3MDA A;  3RAX A;  3PW5 A;  2P6U A;  2R8G A;  4KLG A;  5KT3 A;  4DL7 A;  1MIV A;  1ZQI A;  3OUY A;  2XCP A;  3H39 A;  4J9N A;  1L5U A;  4FHY A;  4WC4 A;  1V9P A;  4YXM A;  4YP3 A;  5DEC A;  4ATB B;  3L9D A;  4RQ0 A;  1ZQS A;  9ICB A;  3MFI A;  2R8H A;  4GLX A;  2P6R A;  5J2C A;  5JUM A;  4P4P A;  3PX4 A;  1SL2 A;  4KLQ A;  4RNN A;  1SKR A;  4QZA A;  1BNP A;  2AQ4 A;  5KG6 A;  3M8S A;  3RBD A;  4J9O A;  8ICP A;  8ICE A;  4DL2 A;  3BQ2 A;  4ELT A;  3BQ1 A;  4UB1 A;  4UBB A;  1MSW D;  2ZH3 A;  4M04 A;  4TUP A;  1SKW A;  4KN7 A;  3PX0 A;  1CUK A;  4DQR A;  1ZQA A;  2H5X A;  5J2J A;  5DKW A;  5HHI A;  1ZQK A;  5HRB A;  1YLQ A;  1ZQN A;  2M2T A;  4EBC A;  3ISB A;  4F50 A;  5J2I A;  5EWF A;  3B0Y A;  4PHD A;  1KDH A;  5KFB A;  1S76 D;  5KFM A;  3KHH A;  1TK5 A;  3ZDA A;  4F4K A;  1COO A;  4X4S A;  1EXN A;  4P4M A;  3OHA A;  2AGQ A;  2W9C B;  4NLK A;  3EZ5 A;  5EWG A;  3ZD8 A;  4QZ9 A;  4YMM A;  1IXR A;  3Q8R B;  2FPK A;  1KFT A;  5F9N A;  5J2G A;  3ZDB A;  2B21 A;  2ZH5 A;  1HUO A;  2FMS A;  4RQ7 A;  5KFR A;  1C7Y A;  5DQH A;  5HNK A;  2W9B A;  3RR8 A;  4DQI A;  5DQG A;  2XCA A;  5KFW A;  4QZF A;  8ICZ A;  7ICH A;  8ICB A;  4PGQ A;  1CEZ A;  2DFL A;  3HWT A;  1NJX A;  3RB0 A;  1ZQX A;  2PI4 A;  1WCL A;  5CHG A;  1S0N A;  4JV1 A;  2BE3 A;  2KFN A;  3BQ0 A;  3Q8Q B;  4X0A A;  4MEX A;  5DB9 A;  3WFO A;  3HP6 A;  4DL5 A;  4DSI A;  2FPL A;  9ICP A;  2JEF A;  1KTQ A;  2UVV A;  2ZHA A;  4DOA A;  1X2I A;  2JZB A;  4FHX A;  4Q44 A;  3UPS A;  3UXP A;  4ATB A;  4DSK A;  5J0T A;  1L3T A;  4QW8 A;  4FH5 A;  2MUT A;  4QWB A;  2FLN A;  4NXZ A;  4QW9 A;  3GII A;  5CJ7 A;  3RTV A;  2DPJ A;  2R8I A;  3OVB A;  4J9P A;  4X4U A;  3UXO A;  1Q78 A;  5KG0 A;  3AQK A;  1DOQ A;  4DQP A;  4F2S A;  2HHV A;  2ZH8 A;  8ICT A;  4O5C A;  2NRT A;  2V4R A;  1TFR A;  4P4O A;  5BOL A;  2FMP A;  4F4Z A;  4XA5 A;  9ICO A;  2F1J A;  1L3S A;  3AQL A;  4WC2 A;  5CR0 A;  4O3P A;  3OVA A;  3EPI A;  2DRA A;  1NK0 A;  4C8K A;  4KLH A;  4FH3 A;  4RT3 A;  2ISO A;  8ICO A;  1ZET A;  4LZD A;  2UVU A;  2KTQ A;  4RPZ A;  3QZ8 A;  3TFS A;  5DG7 A;  1K1S A;  5HP4 A;  4PGY A;  4ECW A;  3T5H A;  4RPY A;  3OSP A;  4FHW A;  2BQ3 A;  3NYB A;  4UB2 A;  9ICH A;  4ED0 A;  4RUA A;  3GV5 B;  2ASL A;  1UEV A;  4QZD A;  4QZG A;  3MR3 A;  1KRP A;  3NTU A;  5EOZ A;  5KT5 A;  4KMU A;  3RB3 A;  4I2A A;  7ICJ A;  1ZYQ A;  1R8C A;  5HR9 A;  1U48 A;  2W8L A;  7ICP A;  2AJQ A;  3G6V A;  1SL0 A;  4J9R A;  4NM1 A;  1OU5 A;  4UAY A;  5KG7 A;  4RU9 A;  3JPO A;  2KZ3 A;  9ICK A;  4DEZ A;  1BGX T;  5KG1 A;  4F91 B;  3SI8 A;  1BPY A;  3ZDC A;  3JPP A;  2NRW A;  3UXN A;  4P2H A;  2ZH9 A;  5HML A;  4EZ9 A;  4R66 A;  5L1K A;  4KLT A;  4DFM A;  1B43 A;  1T4G A;  2AGP A;  4F5N A;  1JMS A;  1ZJM A;  5KFO A;  8ICV A;  4TQR A;  2BCQ A;  5KFI A;  4KLL A;  1XO1 A;  1SKS A;  4DOC A;  2BHN A;  5D4B A;  4X5V A;  4X4T A;  3V6K A;  2ZH7 A;  5HMM A;  5J0U A;  4M2Y A;  7ICQ A;  5DLG A;  4JV0 A;  3RAQ A;  3RJJ A;  3GIL A;  2JEG A;  4MF2 A;  1Y88 A;  5J2E A;  1WOT A;  4E8F A;  2KZZ A;  2VA8 A;  4YMO A;  5KT7 A;  2BCR A;  2ZJ8 A;  4BGD A;  3OGU A;  5D46 A;  3K75 D;  3MDC A;  4ED6 A;  8ICN A;  5DGA A;  1UT5 A;  1ZQW A;  4K4H A;  1XC9 A;  3HX0 A;  4KLI A;  3H37 A;  4RQ1 A;  4QZI A;  4UB5 A;  1NJY A;  5KFZ A;  5KT4 A;  7ICF A;  2HHP A;  4I2C A;  4F5Q A;  4TUR A;  1N56 A;  1D8Y A;  9ICL A;  1ZJN A;  4RQ6 A;  4B9V A;  5KFF A;  1X9S A;  4F4W A;  2FMQ A;  2A1J A;  4O9M A;  1R89 A;  4UQG A;  4DS5 A;  4J9M A;  2KN7 A;  5EWE A;  3QEB Z;  4EEY A;  1BPX A;  2JEJ A;  2Y1J A;  3RRG A;  4LZG A;  4YXJ A;  2C2R A;  1L3V A;  2BCV A;  4DFP A;  2F1H A;  7ICO A;  3PVX A;  4IRK A;  3Q8M A;  1DK3 A;  4TQS A;  4DF8 A;  4YN4 A;  1QSY A;  1ZQC A;  3PW4 A;  3JZ0 A;  4J9Q A;  2BCU A;  1XU4 A;  2XGQ A;  1QSS A;  3Q8K A;  4AT7 B;  5J2A A;  2ZUC A;  3H38 A;  1S0V A;  2DR9 A;  1D8L A;  3ETL A;  3WFQ E;  4RUC A;  4ECQ A;  1QLN A;  5DLF A;  2M2V A;  4GC7 A;  5CP2 A;  4E0D A;  1B22 A;  2HHX A;  3RRH A;  3KHR A;  2HHW A;  5DB7 A;  3MGH A;  4KLS A;  1KNY A;  5KT6 A;  3C21 A;  3C5F A;  3RJG A;  4PH5 A;  1LV5 A;  4GC6 A;  3LQC B;  1LB2 B;  3JPR A;  3GDX A;  9ICU A;  1DGS A;  3C1Z A;  7ICL A;  4JV2 A;  4O5E A;  4YCX A;  3H7I A;  4JK1 A;  1MQ3 A;  3OHB A;  1UT8 A;  3ZDD A;  4AT8 B;  4EBK A;  2JEI A;  3LWM A;  4PHE A;  4TUS A;  1XSP A;  4FBU A;  2M2U A;  2MUT B;  1RXW A;  2HHU A;  2ASD A;  5HRD A;  3MR6 A;  4X4V A;  5CB1 A;  1JXE A;  3AUO A;  1XSN A;  1S0M A;  5KG4 A;  4F3O A;  3GIJ A;  1NOM A;  8ICX A;  3RR7 A;  5DBB A;  1NJZ A;  1RYS A;  1T3N A;  2R8K A;  3SYZ A;  1ZQF A;  2ZTC A;  2M9N A;  4GXK A;  4RWN A;  3V7J A;  4NM2 A;  1A77 A;  2ZUD A;  2XC9 A;  1U49 A;  8ICC A;  4NLZ A;  4ECY A;  4DOB A;  3TAP A;  4WC3 A;  3Q8L A;  4YMN A;  1S97 A;  2ZH2 A;  4KN4 A;  5III A;  1QTM A;  4EYI B;  2FPM A;  1ZQZ A;  4C8M A;  2NRK A;  3PR5 B;  3PW0 A;  4AT7 A;  4Z6C A;  3BJY A;  9ICS A;  1Z3E B;  1U9L A;  4BXO B;  5DBA A;  1S9F A;  4KIT B;  2ZH4 A;  4FS1 A;  8ICQ A;  9ICM A;  3C18 A;  4YG2 A;  1RZT A;  1BVS A;  1NO5 A;  4B9M A;  1JXL A;  4MF8 A;  7ICG A;  2BR0 A;  5KFK A;  4B9U A;  3H8J A;  4FHV A;  1TVA A;  5J0Q A;  5KFN A;  4UD5 A;  4RQ8 A;  2Y1I A;  2PFQ A;  1NK6 A;  5HRK A;  1MC8 A;  4FS2 A;  3PX6 A;  4Q45 A;  4RNO A;  4TUQ A;  5IIL A;  3RB4 A;  1RXV A;  4G3I A;  4B9S A;  9ICW A;  1X9M A;  4CCH A;  2XY6 A;  1V4A A;  9ICN A;  4X4N A;  5DDM A;  1ZQD A;  4DQQ A;  4AT8 A;  4EBD A;  7ICN A;  3ISC A;  8ICI A;  4X0B A;  3EPG A;  3FYH A;  5DG8 A;  2ZH6 A;  1XSL A;  3PMN A;  2BPF A;  1XWL A;  3PML A;  4I28 A;  2W9M A;  4Q8F A;  4M6W A;  1ZQP A;  3IM1 A;  4RPX A;  4YR2 A;  1KFD A;  1ZQQ A;  2P66 A;  2O1P A;  4WC6 A;  3SZ2 A;  4IQU A;  9ICV A;  4J9S A;  7ICM A;  2BDP A;  4KLE A;  4RZR A;  3ZDE A;  4UB3 A;  2ISP A;  1HJP A;  3RBE A;  4KLU A;  4WC7 A;  3PV8 A;  1ZQE A;  4AT9 A;  3RB6 A;  4ELV A;  3PR4 A;  3H4D A;  3C1Y A;  2RDJ A;  3V6H A;  4BWM A;  4M9N A;  4XQ7 A;  1SZP A;  5HRF A;  4AT9 B;  2I1Q A;  2HHS A;  4QZE A;  2DVI A;  1XS9 D;  4UAZ A;  1RYR A;  1F5A A;  4O3S A;  5KFQ A;  2FLP A;  3T3F A;  3HIY A;  1TAQ A;  3PO4 A;  4ECX A;  3NGD A;  2NRV A;  3GQC A;  2BQR A;  1TK8 A;  2AU0 A;  3QE9 Y;  8ICK A;  3EW9 A;  9ICG A;  3MAB A;  1L3U A;  4JWM A;  4I2I A;  2RDI A;  3V7L A;  2I9G A;  4F5P A;  7ICV A;  2PI5 A;  3JPT A;  3UQ0 A;  5CWR A;  5C5J A;  3C2K A;  4NY8 A;  1ZQR A;  2V9W A;  1N48 A;  3Q8S B;  2ASJ A;  1X9W A;  2KP7 A;  5HRH A;  2PBE A;  3T5J A;  3C2M A;  1Z00 B;  4O3N A;  4B9T A;  2Q66 A;  1NJW A;  4C8O A;  3H40 A;  2DPI A;  2KZM A;  1R8A A;  5KFX A;  5L1I A;  4DSJ A;  5J0Y A;  1R8B A;  4QZ8 A;  4ECZ A;  1TK0 A;  3JPN A;  3OJU A;  4DFJ A;  4ECU A;  2BQU A;  2LYH A;  1NK7 A;  1NKC A;  4M9J A;  1WCN A;  3RJF A;  4O5K A;  2HHT A;  5DED A;  4E80 A;  5J0X A;  3EWA A;  3GIM A;  4X4R A;  3LK9 A;  4WBY A;  5CA7 A;  5J0R A;  5J0S A;  3EYZ A;  4KLD A;  4O3R A;  3AQM A;  5HRG A;  5DB8 A;  4BXO A;  8ICY A;  2DR7 A;  4I2D A;  3M9N B;  2ZJ5 A;  2AQ0 A;  3UQ2 A;  1ZQB A;  1JQR A;  1NK8 A;  4R63 A;  8ICW A;  1S77 D;  4QWD A;  1BPZ A;  8ICM A;  8ICF A;  2JZB B;  4PGX A;  4B9L A;  4RT2 A;  2M2W A;  4XQ8 A;  1JAJ A;  5KFU A;  1T8E A;  2MAX A;  1NKB A;  5IIK A;  3ORY A;  4KLF A;  1ARO P;  4JWN A;  1A76 A;  5F9L A;  5KT2 A;  2ZH1 A;  3LDA A;  5D49 A;  2PFO A;  5DBC A;  2PXI A;  4RNM A;  2VA3 A;  4DSL A;  5KG2 A;  8ICH A;  5J2D A;  1TFY A;  1TKD A;  4I2E A;  7ICU A;  4M5D A;  3ZD9 A;  4YFK A;  5J2B A;  2W9B B;  4DL6 A;  4M6W B;  1ZQO A;  2W8K A;  9ICJ A;  1Q79 A;  3JPS A;  5KFE A;  5KFY A;  4YR3 A;  2J6U A;  5J29 A;  4KTQ A;  2HVI A;  7ICE A;  3HJ1 A;  4QZB A;  4IG8 A;  4PPX A;  4RQ3 A;  3THV A;  7ICK A;  3RJE A;  9ICI A;  2GWS A;  1K1Q A;  9ICC A;  7ICR A;  1FA0 A;  4ECS A;  4EBE A;  3SV3 A;  4XUS A;  3N4M B;  1PX5 A;  4M0A A;  4WC0 A;  1ZQT A;  5DGB A;  3HW8 A;  4PHA A;  5KFV A;  3RJK A;  1NKE A;  2Q0Z X;  5IIO A;  3MFH A;  2ZTE A;  1JX4 A;  5J2F A;  1ZQU A;  4RQ2 A;  1T7P A;  5BOM A;  2PFP A;  8ICG A;  4UBC A;  1NZP A;  4RWP A;  3G6Y A;  4M9G A;  5HRE A;  4M47 A;  4IR9 A;  3MGI A;  3RJI A;  4Z6E A;  1KEJ A;  3PW2 A;  2BPG A;  7ICT A;  4B9N A;  3HT3 A;  4YD2 A;  4UB4 A;  3GV7 B;  1D9D A;  1NK9 A;  4EZ6 A;  1DK2 A;  1IM4 A;  4DL3 A;  2IHN A;  3T5L A;  2OWO A;  1VJ7 A;  3PO5 A;  3RH6 A;  1ZQG A;  4QWC A;  2ALZ A;  2W9A A;  4K4G A;  4Z6D A;  5KFP A;  4QWA A;  4QWE A;  1U45 A;  2IBK A;  3AU2 A;  2DR5 A;  3H3A A;  5J0W A;  3GFK B;  3TI0 A;  3IHQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...