5J0UA

Binary complex crystal structure of dna polymerase beta with g:g mismatch at the primer terminus
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
330
structure length
326
Chain Sequence
APQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structures of DNA Polymerase Mispaired DNA Termini Transitioning to Pre-catalytic Complexes Support an Induced-Fit Fidelity Mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 107
structure length 326
sequence length 330
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5j0uA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5j0uA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5j0uA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5j0uA03
5DDMA 1D8LA 5DDYA 3T5JA 5J0SA 4IRDA 9ICIA 5KFRA 1Z3EB 5HRGA 4DOCA 1WCLA 1ZQEA 4FHXA 1OU5A 1K1SA 4DOAA 4JV0A 2M2WA 3RR8A 5F9NA 4RQ8A 3RJJA 1TAQA 8ICBA 5KT2A 2AGPA 4KLJA 2C2EA 3C21A 1KEJA 3TFRA 1L3SA 4I2DA 5KG5A 4ECXA 1S76D 3T5KA 3PW4A 8ICGA 5KT4A 8ICCA 2ASLA 1JIHA 2BCQA 3G6XA 4EYIB 3RBDA 1MQ3A 2HVHA 3B0YA 4O0IA 2BCSA 4DSKA 3OUYA 1NK7A 1A77A 3PMNA 9ICVA 3NYBA 3LK9A 4BWMA 4NLKA 4NLZA 4X4VA 2H5XA 2DRAA 1X2IA 8ICAA 1TAUA 3ETLA 5KFHA 4YR2A 4KLLA 5CP2A 3T5LA 4R66A 3AUOA 3RH5A 4O3SA 2PFPA 4QZBA 5KFUA 4GLXA 4IRCA 3OVBA 4YXJA 4J9MA 2BCUA 2DR7A 2ZJ8A 4BDPA 4M2YA 5HRHA 3M8SA 3RB4A 3QZ7A 3LQCB 3OUYB 2FLPA 1NKCA 9ICCA 3RTVA 4C8LA 1DGSA 3K75D 4XA5A 4Q45A 9ICRA 5HRKA 4KLMA 1X9SA 4B9NA 3C2KA 5HRFA 1ZQWA 5CJ7A 2PXIA 3ISBA 3C18A 5DBCA 4F5QA 3SV3A 4MFAA 4JK1A 3SYZA 2PFNA 5JUMA 2ZUCA 9ICOA 2ZH6A 4DO9A 4DOBA 5KFEA 2V4RA 4X4QA 2XGQA 4DQPA 9ICUA 9ICTA 3WFQE 4LZDA 1JMSA 4JV2A 1R89A 2Y1JA 1DK3A 2ZUDA 5KFPA 1BPZA 4QZ9A 3NGDA 3GQCA 4KN7A 3FDSA 5DGBA 1ZYQA 5HRIA 4F4KA 3RJFA 3AQNA 4M9NA 2GWSA 2NRWA 4QZFA 4F4XA 8ICOA 1S97A 3C66A 3GIIA 5DB7A 5KFQA 5D49A 4F92B 4ECVA 4TUPA 1IXRA 1PX5A 5IIKA 2FMQA 1ZQHA 1ZQJA 3M8RA 2Q66A 3H37A 3OJSA 2ASDA 1KLNA 1DK2A 8ICKA 2DPIA 4AT7A 3WFRE 4IQUA 1ZETA 4P4PA 3G6VA 1ZQOA 4RWNA 4DLGA 2ZHAA 3Q8KA 2AQ4A 1WCNA 1U4BA 4YCXA 4QZ8A 4UB1A 4FS1A 4ELVA 3LDAA 4QW8A 3MR5A 2W8KA 5J2IA 3PX4A 4YMOA 2VANA 3H38A 2BCRA 1KFSA 1ZQXA 4YP3A 4ECTA 4I27A 2FLLA 4DQIA 3WFPA 4R65A 4Z6EA 3BQ2A 2F1IA 2ZH1A 2DVIA 3RJIA 4HYKA 1T4GA 4UBCA 8ICFA 1A76A 5KFFA 1ZQZA 4I28A 1HUZA 3EWAA 2ATLA 1NK0A 1S0VA 1R8AA 4AT7B 4M04A 3BJYA 4KITB 1QSSA 5HHHA 1B22A 7ICQA 2XO7A 4I2IA 2W9CA 4DLEA 5KG0A 3N97B 4K4IA 2M2UA 1BPBA 4EBCA 3MR2A 4ED8A 4KTQA 5D4BA 4O3QA 4QZHA 2R8IA 9ICBA 4G3IA 4I2BA 2V4QA 3HX0A 3OVSA 2AJQA 3OHBA 2ZJAA 4E7XA 1RYRA 4Z6FA 2P6RA 8ICHA 1XSPA 2KTQA 1NJZA 3EW9A 5KFAA 3QEBZ 1SKRA 2P66A 2C28A 3H8SA 4YD1A 4PHDA 4RQ7A 5KT6A 4E0DA 3PO4A 3V6KA 1ZQSA 1ZQBA 4F4YA 3PVXA 3UQ2A 1TK5A 5HNKA 3RB0A 1XO1A 1XS9D 2ISPA 3Q8LA 4NKTA 4RZRA 2W9CB 4QWCA 1X9WA 9ICMA 4O3OA 1RPLA 1UA0A 5J2EA 5HRLA 4DL7A 8ICPA 4ECZA 4DFMA 2KZZA 2BPGA 4DQRA 4DSEA 2BHNA 4F5PA 3PX6A 1SL0A 4WBYA 3PW5A 3UPQA 3ZDDA 8ICYA 4I2AA 9ICJA 5KG1A 1JX4A 2XCPA 3EZ5A 3OV7A 4YG2A 5KT3A 1ZJMA 4J9NA 5KT7A 4DL2A 1TFRA 2FPMA 5KFMA 5J0QA 4RNNA 5J2HA 1TK0A 4NLGA 3BQTA 2ZJ5A 3GIKA 2W9MA 5KG7A 1HUOA 2IHNA 4ECRA 3PW2A 1NZPA 4GC7A 4S3NA 3V6JA 4RQ5A 2W8LA 2UVVA 2ID1A 4I29A 8ICMA 1KSPA 2KP7A 3KHRA 4F50A 4PHPA 3T5HA 1T7PA 4IQTA 2FMSA 5DEDA 4IR1A 3SI8A 4BXOA 2KFNA 5HRDA 4I2CA 4MFFA 3GV8B 3MR6A 7ICSA 4F5OA 2VA2A 4DS4A 4F3OA 1TVAA 1KTQA 3MFHA 4DWIA 3Q8QB 2BQUA 2I9GA 4DL6A 2M2TA 1QSYA 2UVUA 4RWOA 1NOMA 4FH3A 8ICRA 4WC0A 4XRHA 5J2CA 2BQRA 4F93B 3QE9Y 4KLEA 4M9LA 3JPNA 4KLSA 1ZQPA 9ICNA 4J9LA 1KNYA 2FMPA 5J2JA 4RNMA 4DQQA 3Q8MA 2BKEA 1L3TA 5J0RA 4XQ8A 3RRGA 3IM1A 3HT3A 3TFSA 1K1QA 4PHEA 5DQHA 1BPEA 5KFYA 3THVA 2VA3A 3TARA 5CHGA 5KFCA 4ECSA 4TUQA 1BVSA 4BXOB 1L5UA 4K4HA 5BOMA 4UB3A 3PNCA 4JWNA 4DFPA 4IQVA 2KN7A 2J6SA 4LT6A 2O1PA 4RQ4A 3BQ1A 2A1JA 3BQ0A 1MSWD 4FHVA 4ECYA 1TK8A 1F5AA 1U48A 2C2RA 4EBDA 4MEXA 1XWLA 4F2SA 3OVAA 2I1QA 1MIYA 3LWMA 5J2BA 4GXKA 4X5VA 1BNOA 4ELTA 4J9OA 3GV7B 1D9FA 1V9PA 3V7KA 2XY7A 4MF2A 3Q8SB 3TQ1A 4M47A 4Z6CA 4UAWA 3GIJA 1S9FA 4DSJA 4IRKA 4X4NA 1NKBA 2ZTEA 8ICXA 5HC9A 5J0YA 3H3AA 4F5NA 2ZHBA 4CCHA 3TAPA 4EBJA 1TFYA 3MDCA 4RQ0A 3JPTA 4LZGA 5IIOA 4NLNA 4RWQA 1FA0A 2DR8A 3ZD9A 2KFZA 5KFBA 5L1JA 2A1JB 2M9NA 2MAXA 2F1HA 5CA7A 3RH4A 4O3RA 3MGIA 3GDXA 9ICAA 2W9BA 1AROP 5DQIA 4RUCA 3M9MB 3T3FA 4DFJA 2ZTDA 2HHQA 2RFFA 1S10A 1SKWA 3V6HA 3OHAA 5KG6A 4Q44A 8ICZA 3RH6A 4FH5A 1JQRA 4EP7A 4B9LA 4KLIA 3RAQA 5J0TA 1NK4A 9ICEA 7ICNA 4NXZA 4O3NA 4C8OA 4UB2A 4M9GA 1KFTA 1L3UA 1Q78A 4NY8A 5J0OA 4QWDA 5KFKA 4Q8FA 3RJHA 2JEGA 1XSNA 4FHPA 3QZ8A 2J6UA 5KFWA 4ED1A 2IMWP 3H7IA 3V72A 4JWMA 3AQLA 4NKUA 4PH5A 4QZAA 4Q43A 1UEUA 2W9BB 4YD2A 3H4BA 1U45A 8ICTA 5J2GA 5DLFA 4DL4A 1KRPA 4AT9A 5KFNA 4TQSA 5J0UA 1CEZA 4O5KA 1UETA 2OWOA 5KTQA 5DQGA 4KLDA 2DR9A 4GC6A 4YQWA 3B0XA 7ICUA 2HHVA 2M2VA 5DKWA 3AU2A 1ZQTA 5KT5A 5L1LA 5KFGA 2XGPA 4RT3A 2BDPA 2PI4A 3AU6A 9ICFA 4PHAA 5KFSA 5DB9A 5DBAA 1MIVA 1U49A 7ICEA 4RUAA 3M9OB 1H38A 4MFCA 4Z6DA 3MDAA 5L9XA 3JPSA 4J9SA 4M9HA 5KFDA 1B43A 4ED7A 4AT8A 4KLHA 1KDHA 1D8YA 7ICPA 2BE3A 3HP6A 4EBKA 4QWBA 5HREA 3ZDEA 3JYYA 4J9RA 2JEIA 4LVSA 1CUKA 4KLOA 4KN4A 3RJEA 4KLQA 4KLUA 1LB2B 1ZQAA 4WCWA 4AT9B 1T3NA 2RDIA 3EYZA 2BPFA 3ZDAA 1JAJA 2R8JA 3EPIA 3GV5B 5DBBA 3ZDBA 2ZH7A 3UQ0A 4I2HA 3FYHA 4KLTA 3V7JA 3G6YA 4UB4A 4DEZA 2BCVA 1ZQUA 1ZJNA 4QWEA 4RPZA 5J0PA 1NJWA 2IHMA 2HHXA 9ICHA 3ISCA 1SL1A 4TQRA 4UAZA 2UVRA 2B21A 4FHWA 1MQ2A 3H8WA 4UB5A 3PMLA 2IA6A 5KFLA 1SZPA 4JUZA 2HHPA 5IIIA 2HHUA 1NK9A 4JV1A 5J0XA 4AT8B 4F5RA 4RQ1A 1QTMA 4B9MA 1NK5A 5EWGA 1D9DA 2HHTA 4EEYA 5KFTA 1UEVA 3UXOA 3KHHA 4YMMA 3RB3A 2ISOA 7ICRA 5J2AA 4EZ9A 4IQWA 4EBEA 4X4PA 5KFOA 1Z00A 4I2GA 1YLQA 1XU4A 4GXIA 4FBTA 4R64A 1VFGA 1JXEA 3Q8RB 5IINA 1JXLA 7ICIA 1NO5A 3V7LA 3OJUA 4DSLA 3C1ZA 3JPPA 1X9MA 2KZMA 4E8FA 5IILA 4YVZA 3RAXA 8ICJA 3OSPA 4I2JA 3PR4A 2R8GA 4RT2A 9ICSA 9ICKA 4ECUA 3EPGA 1NK8A 2FPKA 4RPXA 1BPYA 3C23A 2NRKA 1COOA 2C22A 4RQ6A 8ICIA 4Q8EA 5F9LA 1ZQFA 3UXPA 2J6TA 3C5GA 3PR5B 1L3VA 3PV8A 4DF4A 5HP4A 4ELUA 5L1IA 7ICVA 5KFIA 4ECQA 4GXJA 3H4DA 4WC3A 2BGWA 5KG2A 3PY8A 1Z00B 4PGXA 4J9PA 4DS5A 2HHSA 4EYHB 1LV5A 1ZQRA 3AQMA 9ICPA 2V9WA 5J2KA 2XY5A 5CWRA 1ZQDA 4NM2A 4RWPA 1BGXT 3ZD8A 3PW7A 5BPCA 1PZNA 4YR0A 2RDJA 3UXNA 2ZUBA 2JEJA 4ATBA 3HPOA 2WTFA 5IIMA 4I2FA 4FS2A 1ZQGA 1QSLA 5DECA 1UT8A 2NRZA 3GFKB 4RNOA 4XQ7A 4DSFA 3C1YA 5EWEA 1QLNA 3C2LA 4IG8A 2PBEA 4X4TA 4ED2A 4DF8A 2DPJA 1MC8A 4J9KA 5DLGA 3MGHA 5HRBA 5HMLA 4R63A 4KLFA 5DB8A 5C5JA 3MBYA 4M6WA 1TKDA 2PFQA 5D46A 2ZH8A 5KG3A 2AQ0A 3GILA 2Q0ZX 9ICWA 3HJ1A 2ZH4A 4DL3A 1SL2A 4B9VA 2BQ3A 2DR5A 4ATBB 4DFKA 4YFKA 4QWAA 1IM4A 2JEFA 1BPDA 4P4OA 2MUTA 3OGUA 5DGAA 2JZBA 3MABA 1NK6A 2PI5A 4K4GA 2AGOA 5BOLA 1HJPA 7ICOA 3MR3A 3TANA 2AU0A 7ICFA 5KFVA 5CR0A 4PGYA 3MFIA 1ZQCA 4M0AA 7ICGA 4QW9A 5DG7A 4DQSA 4C8KA 1ZQIA 2XC9A 9ICGA 4WC4A 2ZH5A 4E80A 5KFXA 1MIWA 4C8NA 4UD4A 5TZVA 1S0NA 1U9LA 4FHYA 2FPLA 3QEAZ 9ICXA 1UT5A 4F4ZA 3WFOA 3KHLA 3E2EA 3RJKA 2O5AA 4M6WB 2ZH3A 4I2EA 8ICVA 3NTUA 2Y1IA 2C2DA 1ZQNA 4O9MA 3TAQA 3HW8A 4QZDA 4UD5A 4X0BA 8ICQA 2HHWA 7ICTA 2MUTB 4BWJA 2JZBB 4RQ2A 3C2MA 3PX0A 4B9SA 4RPYA 2VA8A 3C5FA 4B9TA 3RB6A 3JPQA 3HJ4A 3H40A 4X4OA 4M5DA 2ALZA 3LWLA 2ZH9A 5KFZA 2HVIA 4O3PA 2BR0A 4PGQA 3ORYA 3KHGA 4RU9A 4P4MA 2XCAA 1XSLA 1BNPA 1TFWA 5EOZA 3H39A 3Q8PB 3RBEA 4RQ3A 4QZIA 2DRBA 4F2RA 1ZQMA 1RYSA 8ICSA 4EZ6A 4WC5A 1RXWA 3HWTA 2ASJA 8ICNA 1EXNA 4KLGA 4KMUA 5HR9A 1VJ7A 3AQKA 4X4RA 1KFDA 1UA1A 4DSIA 3WFSC 4XUSA 1TV9A 1NKEA 1S0OA 4B9UA 1S77D 2ZTCA 5J0WA 4J9QA 4ECWA 3RR7A 3ZDCA 8ICEA 9ICLA 3HIYA 4F4WA 1N56A 5KFJA 3IHQB 2IBKA 8ICUA 2PFOA 4P2HA 4DL5A 5KG4A 4FBUA 3OSNA 5HHIA 4IR9A 4MEYA 4M9JA 1Y88A 1ZQLA 3BDPA 8ICLA 3L9DA 4X4SA 3KTQA 3H8JA 4R8UA 1WOTA 5J2FA 1NJXA 3RJGA 4FO6A 5F2VO 1DOQA 4O5EA 3SV4A 7ICMA 2R8KA 4NM1A 4WBZA 1N48A 4WC2A 4YN4A 1ZQVA 4QZGA 1BPXA 5HMMA 9ICQA 7ICJA 3JZ0A 2W9AA 2R8HA 1T8EA 4YR3A 4C8MA 1SKSA 4X4UA 1ZQYA 3JPRA 4BGDA 1RXVA 5CB1A 7ICHA 2P6UA 2ZH2A 4ED6A 3GIMA 5J29A 4YXMA 5IIJA 4QZCA 1U47A 1C7YA 4PPXA 1Q79A 4WC1A 4F8RA 4TURA 4X0AA 5DG9A 4F91B 1RZTA 2HW3A 4UQGA 5J2DA 4MF8A 8ICWA 4R8UB 7ICLA 4UAYA 1XC9A 3PW0A 2NRTA 4WC6A 2BPCA 4ZH4A 3K4GA 4QZEA 3M9NB 4ED3A 4WC7A 2AGQA 2FLNA 2DFLA 3UPSA 4ED0A 4TUSA 3PO5A 3N4MB 2NRXA 1S0MA 5DG8A 5DB6A 5EWFA 1V4AA 1ZQQA 1R8CA 4O5CA 2XY6A 3JPOA 1NJYA 1ZQKA 2UVWA 3TI0A 4YMNA 4UBBA 2NRVA 2KZ3A 2LYHA 2F1JA 3RRHA 7ICKA 1R8BA 3SZ2A 5L1KA 3ISDA 1JN3A
chains in the Genus database with same CATH superfamily
3T5JA 5AI4A 5JRTA 3QX7A 5B66U 5KL1B 2M2WA 1TAQA 2AGPA 4NXTA 2C2EA 5AKJA 3TFRA 4I2DA 1S76D 8ICCA 4K96A 4A8EA 1JIHA 2EAPA 2HVHA 1NK7A 4O6AA 2HBLA 3WKEA 2KEYA 4NLZA 3HJEA 3UM9A 3IRUA 4OJOA 4UW9A 4R66A 5T14A 1FFUA 4IRCA 4YXJA 5AKGA 2DR7A 2ZJ8A 1O08A 4BDPA 3LQCB 2FLPA 2G08A 5ALJA 2EWRA 2YN4A 1K5OA 2K60A 3C18A 4F5QA 4JK1A 3F2BA 2XI9A 3IDWA 4DO9A 5J8YA 4DQPA 2W3SA 4FZLA 1NI3A 5HRIA 1N5XA 3RJFA 2GWSA 2NRWA 3C66A 4QIWC 3GIIA 5DB7A 3KOOA 5IIKA 5CFTA 1Q3UA 3L4PA 3G6VA 1ZQOA 1AQ6A 2EDUA 3QUTA 4UB1A 3CP8A 4Y2YA 3PX4A 3RJIA 2D6FC 1HUZA 1NK0A 1QSSA 2XICA 2EZXA 5KG0A 2M2UA 2JH7A 2BBJA 4EBCA 2ZG6A 3K1ZA 3HX0A 3QU2A 2P6RA 2KTQA 3QEBZ 2C28A 4Y2QA 3V6KA 2AHOB 3RB0A 2ISPA 2CN1A 5B3QA 1PK1A 4RZRA 4O3OA 1RPLA 2VIXA 1UA0A 5JU5A 2LYBA 2KJ8A 2KZZA 3FM9A 2BPGA 2BHNA 1TAMA 5ALTA 3UPQA 3BZCA 4J9NA 2RQ5A 4US9A 1HUOA 3GIKA 2IHNA 4NL9A 4S3NA 4RQ5A 2UVVA 8ICMA 4F50A 4PHPA 3SI8A 1KW4A 5HRDA 2HN2A 2LYAA 3MR6A 2VA2A 4DWIA 4DL6A 3M7DA 3AL0B 2JR5A 2BQRA 5EE1A 3QE9Y 4GIBA 5D61A 2MU2A 4KLSA 3IN5A 4KM5A 1PVQA 3IM1A 3TFSA 2VA3A 3THVA 2KV2A 2F2AB 2DKZA 3PNCA 4F72A 4DFPA 2O1PA 3BQ0A 1F5AA 2C2RA 1N60A 2WF7A 2LBOA 4X5VA 5J2BA 4J9OA 3GV7B 3Q8SB 4UAWA 4IRKA 2ZTEA 8ICXA 5HC9A 2FDRA 3TAPA 5AM2A 3F53A 4RWQA 1FA0A 3ZD9A 3EF2A 2A1JB 2M9NA 9ICAA 3MGIA 1F0MA 1ZRNA 4DFJA 5AM4A 2K4PA 2RFFA 3OHAA 2DUYA 5KG6A 8ICZA 3RH6A 4FH5A 1SWWA 3RAQA 1NK4A 4P0QB 4PZOA 2JXJA 4Q8FA 1XSNA 4ED1A 3V72A 4NKUA 4Q43A 3H4BA 8ICTA 4AT9A 5KFNA 5J0UA 5DQGA 2A3VA 5C0YA 5KT5A 5L1LA 2WB1C 5KAFU 1FO4A 4M9HA 3F5EA 5AKKA 2BE3A 3DEEA 1L8LA 3JYYA 1SGGA 3H0MB 4LVSA 3KKAC 4KLOA 4WCWA 4USAA 4C4SA 2BPFA 1JAJA 3GV5B 2GH1A 2H3ZA 2ZH7A 3KZXA 3UQ0A 3V7JA 3G6YA 4DEZA 1QCKA 1ZJNA 4UAZA 2DWQA 4UB5A 5KFLA 1SZPA 5JTGA 5AI8A 5J0XA 4RQ1A 4B9MA 4PL2A 3IG8A 4EEYA 3UXOA 3KHHA 4YMMA 3ZI4A 2QLTA 7ICRA 4IQWA 4EBEA 1Q46A 4I2GA 4R64A 1VFGA 1QH9A 3OJUA 3JPPA 5AM1A 4YVZA 4I2JA 9ICKA 4ECUA 3C23A 4CRXA 4Q8EA 1ZQFA 3EUB2 4ELUA 4DF4A 4ECQA 4GXJA 4WC3A 5AKYA 3KD3A 5KG2A 2HHSA 2W3RA 1LVHA 2B56A 3KZIU 9ICPA 3AQMA 4NXWA 5BPCA 2RDJA 2JEJA 2ZUBA 1ZQGA 2W11A 4RNOA 2GAFD 3GFKB 5EWEA 3C2LA 4IG8A 2PBEA 4X4TA 5DLGA 3SAHA 2PFQA 2AQ0A 4DL3A 1SL2A 4B9VA 2DR5A 4DFKA 1BPDA 4P4OA 1NK6A 2JZBA 3MABA 2PI5A 4K4GA 2AGOA 5BOLA 7ICOA 3TANA 7ICFA 1SZHA 4QW9A 4WC4A 1MIWA 2HBJA 4FHYA 2DL0A 4F4ZA 3WFOA 4I2EA 8ICVA 4NJ8A 4EELA 3I76A 4UD5A 8ICQA 4MKPA 4EGWA 4RQ2A 4X4OA 2QKQA 4B9TA 3C5FA 4UAUA 4M5DA 4QNLA 5EE0A 4O3PA 3KHGA 3A0HU 2W7OA 3H39A 3RBEA 1SIJA 4F2RA 1RXWA 3HWTA 2ASJA 3H8MA 4KMUA 2OYYA 4ECWA 3RR7A 9ICLA 3ZDCA 3HIYA 2HOFA 3IHQB 2KE7A 4IR9A 1Y88A 1ZQLA 4P0PB 1B4FA 2W55A 5F2VO 5ALZA 4NM1A 4WBZA 1N48A 4YN4A 1BPXA 1T3QA 3JZ0A 4RQMA 1T8EA 4X4UA 2ZIWB 5CB1A 2ZH2A 2D8CA 3GIMA 5J29A 4ED6A 1U47A 2WF6A 5AM0A 1RZTA 4F91B 4MF8A 8ICWA 4UAYA 3OTQA 2BPCA 4ED3A 3M9NB 2IOHA 3U26A 2HOIA 2K4EA 3N4MB 2RP5A 4FZNA 1ZD3A 3SD7A 1R8CA 4O5CA 2XY6A 1ZQKA 4YMNA 2LYHA 7ICKA 4NWIA 5CHEA 3O0FA 4HAIA 1Z3EB 4WOYA 5HRGA 1ZQEA 1OU5A 3RJJA 4NV0A 1KEJA 5KG5A 1ZXIA 5KT4A 2NV3A 3MC1A 3G6XA 3PMNA 9ICVA 5EE3A 3LK9A 2DRAA 8ICAA 1TAUA 3ETLA 4KX5A 3T79A 3M6ZA 4QZBA 4GLXA 2KJ9A 2EAMA 1L7NA 5ALEA 2BCUA 3HKZC 1RYUA 2ODGA 3OUYB 2B0CA 9ICCA 1DGSA 4XA5A 4Q45A 9ICRA 5AICA 5HRKA 1X9SA 2DQNB 5HRFA 5DBCA 3SEIA 5JUMA 2ZH6A 5KFEA 2KSOB 3NS1A 2OCEA 1JMSA 4K9AA 3QU4A 1YZ7A 3NGDA 3AQNA 4F4KA 4QZFA 5D49A 5AI5A 1ZQHA 3M8RA 3H37A 3OJSA 5ALQA 2ASDA 2DPIA 1ZETA 2DKXA 4ZOHC 3Q8KA 2AQ4A 1WCNA 4FS1A 4ELVA 3MR5A 3NVWA 3H38A 2CRXA 4ECTA 4DQIA 4R65A 1JRPA 2F1IA 1T4GA 4UBCA 8ICFA 1A76A 2ATLA 3TADC 1ZOLA 1S0VA 1R8AA 4AT7B 3BJYA 5HHHA 7ICQA 2XO7A 4I2IA 4WH5A 5D4BA 4NXXA 1J97A 9ICBA 4G3IA 4UAVA 5D63A 2XVTA 2ZJAA 3EW9A 4RQNA 3H8SA 4WJ3B 2EQYA 4O68A 5ALYA 5AI9A 1ZQBA 3UQ2A 1ZD5A 2IOFK 1RQNA 2W9CB 4QWCA 4EEDA 2ZIUA 4ECZA 4DQRA 4WBYA 4NXVA 4I2AA 2IOFA 1JX4A 2XCPA 3EZ5A 3OV7A 4YG2A 1TFRA 5KFMA 4RNNA 5J2HA 4NLGA 3PW2A 3NRWA 2KKPA 2KP7A 1KSPA 4Y2TA 3N7RC 1N61A 4UB6U 4BXOA 3GV8B 7ICSA 4F5OA 2A1AA 4DS4A 4F3OA 1KTQA 2VJ5A 3Q8QB 2BQUA 2I9GA 2UVUA 4RWOA 1NOMA 4FH3A 2Q4TA 5AK4A 2QB0A 1VDVA 5E79U 1UCVA 5J2JA 3Q8MA 1Z4OA 1K1QA 4NLCA 4PHEA 1BPEA 3TARA 1L8OA 5KFCA 4ECSA 3NWIA 5ALPA 1L5UA 4K4HA 4O67A 2G5HB 4IQVA 4I0UA 3BQ1A 4ECYA 5AI0A 1U48A 3FC4A 4F2SA 3OVAA 3LWMA 3GU3A 1BNOA 2VKQA 3V7KA 3IV6A 1NKBA 3H3AA 4RQ0A 5L1JA 1ZD4A 4OAFA 2W9BA 2ZTDA 2K4IA 3BS5B 1SKWA 5CEHA 4LEWA 3PZPA 3HKZF 2YY6A 1JQRA 4FFDA 4FO1A 4J03A 4Y2RA 3N7PD 1L3UA 4NY8A 3QYPA 5J0OA 2JMGA 3RJHA 4FHPA 1SXEA 4CGZA 3H7IA 3AQLA 5AKZA 1V85A 4UB8U 5AKLA 5J2GA 5DLFA 4DL4A 4TQSA 1UETA 1CEZA 2KICA 2OWOA 3WK6A 1WUDA 4KLDA 4YQWA 2HHVA 2Y9TA 2YX8A 2XGPA 4RT3A 9ICFA 2B4VA 5KFSA 5DBAA 4RUAA 3WK5A 3MDAA 4J9SA 4ED7A 4AT8A 4KLHA 1KDHA 3QUCA 1D8YA 7ICPA 5HREA 1CI4A 4J9RA 4KN4A 1SB3C 1T3NA 3EYZA 3ZDAA 3AN1A 3I1YA 3FYHA 4RPZA 5J0PA 4CF3A 3ISCA 1SL1A 4TQRA 4FHWA 1MQ2A 2HHPA 4JUZA 5ALMA 1QQ6A 4US8A 1NK9A 1O03A 4F5RA 2L5YA 1QTMA 1NK5A 2PKEA 1B0XA 1UEVA 1LKYA 3RB3A 2ISOA 5J2AA 4EZ9A 4X4PA 5KFOA 1Z00A 1YLQA 2YMQA 3LYSA 2Y9UA 1Z1BA 3N7SC 1Z1VA 1NO5A 2CXYA 2VJ4A 1L7OA 3C1ZA 1X9MA 8ICJA 2YMLA 3OSPA 3PR4A 5ALXA 2R8GA 2QARA 1COOA 3QU7A 4RQ6A 2HBMA 5F9LA 2J6TA 1S5LU 3UXPA 3C5GA 3NRZA 3PR5B 3PV8A 5HP4A 1L3VA 5L1IA 1KL9A 1LV5A 1ZQRA 3WK9A 1N62A 3TADA 5J2KA 5AIAA 5IIMA 2WTFA 4XQ7A 2F3NA 3E0FA 3C1YA 1WWVA 2W54A 1QLNA 3E58A 4EV6A 1X9XA 2QB1A 4QJFB 2DPJA 3WK7A 4R63A 3MBYA 1TKDA 1YZ6A 3HJ1A 2ZH4A 1PUZA 3NVVA 1GPJA 4ATBB 4QWAA 4IS7A 4Y2XA 5KFVA 2K8CB 5CR0A 2XC9A 4E80A 3CW2C 3L3FX 1U9LA 2ZIXB 4OO1J 3ER9B 2KJ5A 3M6KA 2IHOA 4M6WB 5ALUA 2C2DA 3TAQA 4X0BA 4OD0A 2HHWA 2MUTB 4BWJA 3C2MA 4RPYA 5AHXA 1QQ7A 2BR0A 4HX0A 1XSLA 1TFWA 1COKA 4RQ3A 3ALRA 3WFSC 4KLGA 4DSIA 4XUSA 1S0OA 1X42A 4B9UA 3CRXA 1L7MA 8ICEA 2JHDA 2JV3A 4F4WA 8ICUA 5KG4A 4MEYA 8ICLA 3L9DA 2RHFA 1NJXA 3RJGA 3K7DA 2ZIVA 2F8LA 4O5EA 3SV4A 2H3FA 1ZQ1C 1DXSA 9ICQA 3N28A 1SKSA 4U6PA 1ZQYA 3LVWA 4BGDA 4CE6A 2R18A 7ICHA 4XJEA 1C20A 4TURA 4UQGA 4R8UB 2K89A 4EX7A 3NVOA 2ESEA 3K4GA 4QZEA 2FLNA 4ED0A 4TUSA 1RQLA 3VCBA 5H2FU 3F2CA 2NRXA 5EWFA 1V4AA 5ALWA 1NJYA 2PMZF 3TI0A 4UBBA 2H3IA 2NRVA 2F1JA 5L1KA 1UPHA 3ISDA 2ZH3A 1JN3A 1X2IA 1D8LA 5DDYA 4Y2PA 2E8PA 2KIWA 1WCLA 4JV0A 3OPXA 5EE9A 4RQ8A 3SAGA 8ICBA 3H0RB 2MA1A 4ECXA 2OEHA 2BCQA 4EYIB 4O0IA 2BCSA 4DSKA 1A77A 3NYBA 2K8BB 4X4VA 2H5XA 3GZFA 5KFHA 2YB4A 3T5LA 3AUOA 2D3DA 4O3SA 4OAGA 4K98A 5JTIA 1V97A 1IV8A 1SV4A 3OVBA 3M8SA 4JMUA 3HRDD 3RTVA 4KLMA 2BBHA 3C2KA 3SR6A 1ZQWA 1FEZA 5GTIU 2PXIA 1DRGA 2PFNA 2OH2A 3OWGA 2V4RA 3WK4A 2XGQA 9ICUA 1SV0C 2G06A 2JH1A 3WFQE 4LZDA 1N5WA 4JV2A 1DK3A 2Y1JA 5KFPA 4QZ9A 3GQCA 4LEVA 4KN7A 3FDSA 5DGBA 2MSNA 4M9NA 1RM6C 5CFSA 4F4XA 8ICOA 5KFQA 4ECVA 4TUPA 2B51A 5G5HA 1IXRA 1PX5A 3BQ7A 4Y2SA 3RF9A 2NO5A 5CFUA 1KLNA 2WF5A 3WFRE 3F5AA 2Y0SF 4PJ0U 4P4PA 1U4BA 4BUGA 4QZ8A 3LDAA 4QW8A 1ZQXA 1ED1A 4YP3A 4I27A 2FLLA 3AQFA 3WFPA 1ECWA 2ZH1A 1FIQA 4HYKA 5KFFA 1ZQZA 4I28A 1F5SA 2YMMA 4KITB 4DLEA 3NASA 1BPBA 3MR2A 3DV9A 4KMOB 4O3QA 4I2BA 3OVSA 4C4RA 2AJQA 4E7XA 2WF9A 8ICHA 1XSPA 2KHQA 1SKRA 3JCFA 3M1YA 4RQ7A 5ALSA 4E0DA 3PO4A 1WYGA 4NKTA 5HNKA 1XS9D 1XO1A 3Q8LA 1X9WA 5HRLA 5ALFA 3NVZA 1SL0A 4F5PA 2KVSA 3PW5A 3ZDDA 3PSPA 5KG1A 1ZJMA 5KT7A 2FPMA 1TK0A 3BQTA 2W9MA 5GTHU 1NZPA 4ICAA 1PK1B 4GC7A 2W8LA 3BZKA 5ALIA 2ID1A 1SXDA 1RDFA 1T7PA 3T5HA 2RLTA 4IQTA 2FMSA 4IR1A 2HDOA 4AYBF 1V38A 1TVAA 2M2TA 4OJ5A 1QSYA 2KG5A 1OUQA 4WC0A 4OCZA 4F93B 4KLEA 4CNQA 2KK0A 1HIWA 2ZXHA 1KNYA 4J9LA 4DQQA 5J0RA 4XQ8A 3HT3A 5DQHA 3KBBA 1Q8KA 4EEBA 1BVSA 3L5KA 5BOMA 3KFUF 5AIBA 4JWNA 4CF4A 2KN7A 2J6SA 5ALRA 3NKUA 2A1JA 3ONNA 4EBDA 1GO3F 1MIYA 4GXKA 1VJ5A 4MF2A 3TQ1A 4Z6CA 1S9FA 1URJA 2G0AA 4P0QA 1A0PA 2YB1A 2ZHBA 4CCHA 3MDCA 3JPTA 2DR8A 5IIOA 2KFZA 2WAQC 2F1HA 5CA7A 3RH4A 5ALOA 3NVYA 4UARA 2GOLA 1J2MA 5DQIA 4RUCA 1S10A 2KOBA 3V6HA 4B9LA 2BDUA 2KVCA 9ICEA 2I5HA 1UHUA 4C8OA 4UB2A 4M9GA 1Q78A 4QWDA 5KFKA 4K8VA 1S8OA 2J6UA 5KFWA 2IMWP 2LMRA 4QZAA 2NYVA 4AP9A 1KRPA 2XIDA 1JI7A 5KTQA 2DR9A 4GC6A 3B0XA 2HOQA 1NNLA 4MHVA 1ZQTA 3AU2A 3AU6A 1MIVA 5DB9A 7ICEA 3M9OB 4WQLA 4MFCA 3QUBA 5KFDA 3HP6A 3UMBA 2JEIA 2W7PA 4KLUA 4KLQA 4B6JA 1ZQAA 4AT9B 2F77X 1CRXA 3CK6A 2R8JA 4BX9C 4I2HA 4UB4A 2BCVA 9ICHA 4QWEA 2B21A 1SV0A 2HN1A 3H8WA 3PMLA 2AH5A 2EZYA 5D62A 1IIPA 5EWGA 4OJPA 4GXIA 4FBTA 1JXEA 3Q8RB 7ICIA 3V7LA 4DSLA 1FFVA 5IILA 4RT2A 9ICSA 2RRDA 2FPKA 4RPXA 2NRKA 5ALVA 5ALNA 5FP0A 3PSTA 7ICVA 5KFIA 4EEKA 3H4DA 3QU9A 2F8KA 4K99A 4J9PA 2EH9A 4DS5A 1ZQDA 2XY5A 5CWRA 3WKAA 4RWPA 1BGXT 3ZD8A 4JLXA 3UXNA 3HPOA 4I2FA 5ALDA 1ZRMA 2WF8A 2W03A 1KKXA 2HSZA 4GFJA 5KNIA 3HILA 4PL1A 2G5IB 5ALLA 1MC8A 4C0ZA 4J9KA 4KLFA 1ZD2P 2ZH8A 5C5JA 5D46A 5KG3A 3GILA 2Q0ZX 9ICWA 3UMCA 5AK5A 1IM4A 5DGAA 3OGUA 2AU0A 2HVIA 5AK3A 4PGYA 1ZQCA 4PZNA 3I28A 9ICGA 2ZH5A 2E8OA 5KFXA 4C8NA 4UD4A 5TZVA 1S0NA 3C28A 2Z7JA 1YT3A 4Y2VA 3KHLA 3RJKA 2O5AA 3BS7A 2GLEA 1ZQNA 4O9MA 3HW8A 1VLBA 2NO4A 2JZBB 4EX6A 3PX0A 4B9SA 5AKEA 5KL8B 3JPQA 4NLBA 1PK3A 5ALKA 3LWLA 2ZH9A 2I6XA 4PGQA 1BNPA 5K4LA 5EOZA 3Q8PB 4P0PA 2WAQF 2LKYA 4K97A 2DRBA 5AK6A 8ICNA 5HR9A 4X4RA 1KFDA 1UA1A 1TV9A 1Z4NA 2ZTCA 5J0WA 1N56A 5KFJA 2IBKA 2LM4A 2PFOA 2ZIWA 4DL5A 4IC9A 5HHIA 1WWUA 4JLZA 3BDPA 3ETRA 3KTQA 1WOTA 4NXUA 1X66A 4N7RA 2PMZC 1DGJA 7ICMA 4WC2A 3QXGA 2MRLA 3TACB 1ZQVA 2E5SA 2EANA 7ICJA 2W9AA 4C8MA 1OXJA 2A19A 3JPRA 1XO0A 1RXVA 2P6UA 4YXMA 4QZCA 4F8RA 4LJXA 2HW3A 1UQVA 5J2DA 7ICLA 2HI0A 4ZH4A 4WC7A 3UPSA 3PO5A 4C4TA 1ZQQA 3JPOA 2UVWA 2JGAA 3J81j 2B6GA 5DDMA 5G5GA 2YMPA 5J0SA 4IRDA 9ICIA 5KFRA 4DOCA 4FHXA 1K1SA 4DOAA 3RR8A 5F9NA 5KT2A 4KLJA 3C21A 1L3SA 8ICGA 3T5KA 2E1FA 3PW4A 2ASLA 4G9BA 2DF4B 3D2NA 3RBDA 1MQ3A 3B0YA 3OUYA 3A0BU 2KNJA 5L1MA 4BWMA 4NLKA 4O3MA 3ERCC 4YR2A 2GA9D 4KLLA 5CP2A 3RH5A 2KSOA 2PFPA 5KFUA 3VC8A 4J9MA 1N63A 3IP4B 2W04A 4M2YA 5HRHA 2DGZA 3RB4A 1N2XA 3QZ7A 1NKCA 2O6KA 4C8LA 3K75D 2Y0SC 4B9NA 2ES6A 2EZZA 5CJ7A 3ISBA 3SV3A 4MFAA 3SYZA 2ZUCA 5TISU 5HR6A 9ICOA 4DOBA 1IG6A 4X4QA 5AKIA 9ICTA 2YTUA 3C29A 1R89A 3WK8A 2ZUDA 1BPZA 1ZYQA 4KX3A 2KMDA 3CNHA 1S97A 4UATA 4F92B 2HCFA 1XNSA 2FMQA 2Q66A 1ZQJA 5KAIU 1DK2A 8ICKA 2FJ6A 4AT7A 4IQUA 3R9KA 4OJLA 4DLGA 2ZHAA 4CF5A 4YCXA 2W8KA 5J2IA 4YMOA 2VANA 4KB6A 2BCRA 1KFSA 1L6NA 4Z6EA 3BQ2A 2DVIA 5AM3A 3EWAA 2E3TA 4M04A 4QIWF 1B22A 4LEZA 3N97B 2W9CA 4K4IA 4ED8A 4KTQA 4OJ6A 4QZHA 2R8IA 3F2DA 4K9BA 2V4QA 3OHBA 4OAIZ 1RYRA 4Z6FA 2FCLA 1NJZA 5KFAA 2P66A 4YD1A 4PHDA 5KT6A 4IL6U 2GO7A 1ZQSA 4AYBC 4F4YA 3PVXA 1TK5A 9ICMA 1KBUA 5J2EA 4DL7A 8ICPA 2DBYA 4DFMA 1JALA 4DSEA 3PX6A 9ICJA 8ICYA 3MCRA 5KT3A 4DL2A 2IUBA 2K8AA 5J0QA 3WU2U 1L7PA 3LVVA 2ZJ5A 5KG7A 4ECRA 3QU5A 3V6JA 4I29A 2FI1A 3KHRA 5DEDA 4RWNA 2FE9A 2ZIUB 2KFNA 4I2CA 4MFFA 1NZBA 4C7ZA 5A0LA 3MFHA 4JB3A 4FZMA 2OHFA 4XRHA 5J2CA 4M9LA 3JPNA 1ZQPA 9ICNA 2FMPA 4RNMA 2BKEA 1L3TA 3RRGA 2M0NA 5KFYA 5CHGA 3WKCA 4TUQA 4BXOB 1KQQA 4UB3A 4LT6A 4RQ4A 4FHVA 1MSWD 1TK8A 4MEXA 1XWLA 2I1QA 3BS5A 2QB0B 2P35A 3H0LB 4EENA 4ELTA 1D9FA 1MA7A 4U7CA 1V9PA 2XY7A 4M47A 3GIJA 4DSJA 4X4NA 5B5EU 5J0YA 1F44A 4F5NA 4EBJA 1TFYA 1MN8A 3QUQA 4NLNA 3CYMA 5KFBA 3ED5A 2MAXA 4O3RA 5CRXA 3GDXA 1AROP 3M9MB 3T3FA 1PVRA 2HHQA 3SAFA 4Q44A 1JROA 4EP7A 2LM1A 4C80A 4KLIA 5J0TA 3AEVA 7ICNA 4NXZA 4O3NA 1KFTA 2JEGA 4BJQA 3QZ8A 4JWMA 2HMXA 2WFAA 3FAHA 4PH5A 5B3PA 1UEUA 2W9BB 4YD2A 1U45A 5ALHA 5AKHA 4O5KA 3UMGA 4FE3A 4OAHA 3RFAA 2BZFA 3NUQA 5F3XB 7ICUA 2M2VA 1QQ5A 5DKWA 2OXOA 5KFGA 4O69A 2BDPA 1X40A 2PI4A 4DFDA 4C7YA 4PHAA 1A6SA 1U49A 1H38A 4Y2UA 4Z6DA 5L9XA 3JPSA 1B43A 3PHZA 4EBKA 4QWBA 3ZDEA 1CUKA 3RJEA 1LB2B 2RDIA 5AKXA 3EPIA 5DBBA 3ZDBA 4KLTA 3AM9A 4ACOA 1ZQUA 2HHXA 1NJWA 3SMVA 2IHMA 2UVRA 3ICXA 3WKBA 2IA6A 5IIIA 2HHUA 4JV1A 4AT8B 2WB1F 3PSIA 2HHTA 1D9DA 3IG5A 2KIVA 5KFTA 4DCCA 3PSFA 2G07A 2N1RA 4UASA 3ER8C 1XU4A 3DDHA 4WQKA 5IINA 1JXLA 2H3VA 2KHVA 5J8YC 2W43A 4E8FA 2KZMA 3RAXA 3WKDA 3EPGA 1NK8A 1BPYA 2C22A 8ICIA 5HR7A 1R8BA 1LKYB 3TKAA 2BGWA 2H3QA 3PY8A 1Z00B 3AMZA 4PGXA 4EYHB 3B9JA 2V9WA 2KKVA 4NM2A 2HBKA 3PW7A 1PZNA 4YR0A 4ATBA 2QARB 4FS2A 1QSLA 5DECA 1UT8A 2NRZA 3D2QA 4DSFA 2E8NA 3KKAA 4ED2A 4DF8A 2ZIXA 3MGHA 5HMLA 5DB8A 4M6WA 2G09A 2BQ3A 4YFKA 3SQIA 2JEFA 4LZGA 2MUTA 1HJPA 3MR3A 3MFIA 4M0AA 1RG6A 7ICGA 5DG7A 2F44A 4DQSA 1ZQIA 4C8KA 2FPLA 1TE2A 3QEAZ 9ICXA 1UT5A 3E2EA 2AXTU 1M6YA 3NTUA 2OM6A 1X6IA 2Y1IA 2JRZA 4QZDA 7ICTA 2EAOA 1KN5A 2VA8A 3HJ4A 3RB6A 3H40A 1SWVA 2ALZA 1D8BA 5KFZA 5AI6A 3K1RB 3ORYA 4RU9A 4P4MA 2XCAA 4F71A 1PVPA 4QZIA 1HEKA 2E8MA 1OW5A 1RYSA 4NL9C 1ZQMA 4EZ6A 2WHEA 8ICSA 2F76X 4WC5A 1EXNA 1VJ7A 3AQKA 2K4HA 1NKEA 3S6JA 1S77D 4J9QA 3QNMA 5ALGA 3SENA 4P2HA 4FBUA 3OSNA 4M9JA 5AM5A 1T94A 4X4SA 3H8JA 4R8UA 2LHTA 5J2FA 4FO6A 3D2SA 1DOQA 2CPRA 2R8KA 2E1EA 1Q3VA 4QZGA 5HMMA 1P7DA 2LPEA 2R8HA 4YR3A 1JUDA 1J2NA 4CDGA 3MGVA 4Y2JA 2LI6A 1Z19A 4PPXA 5IIJA 1C7YA 1Q79A 4WC1A 4X0AA 5DG9A 3D6JA 3AQEA 4LEYA 4WC6A 1X6JA 3PW0A 2NRTA 2ZIVB 1XC9A 2KD1A 2AGQA 2DFLA 2YQEA 1S0MA 5DG8A 5DB6A 2ZXIA 1WG8A 2KZ3A 3RRHA 3SZ2A 8ICRA 5HRBA
chains in the Genus database with same CATH topology
5DDMA 1D8LA 5DDYA 3T5JA 5J0SA 4IRDA 9ICIA 5KFRA 1Z3EB 5HRGA 4DOCA 1WCLA 1ZQEA 4FHXA 1OU5A 1K1SA 4DOAA 4JV0A 2M2WA 3RR8A 5F9NA 4RQ8A 3RJJA 1TAQA 8ICBA 5KT2A 2AGPA 4KLJA 2C2EA 3C21A 1KEJA 3TFRA 1L3SA 4I2DA 5KG5A 4ECXA 1S76D 3T5KA 3PW4A 8ICGA 5KT4A 8ICCA 2ASLA 1JIHA 2BCQA 3G6XA 4EYIB 3RBDA 1MQ3A 2HVHA 3B0YA 4O0IA 2BCSA 4DSKA 3OUYA 1NK7A 1A77A 3PMNA 9ICVA 3NYBA 3LK9A 4BWMA 4NLKA 4NLZA 4X4VA 2H5XA 2DRAA 1X2IA 8ICAA 1TAUA 3ETLA 5KFHA 4YR2A 4KLLA 5CP2A 3T5LA 4R66A 3AUOA 3RH5A 4O3SA 2PFPA 4QZBA 5KFUA 4GLXA 4IRCA 3OVBA 4YXJA 4J9MA 2BCUA 2DR7A 2ZJ8A 4BDPA 4M2YA 5HRHA 3M8SA 3RB4A 3QZ7A 3LQCB 3OUYB 2FLPA 1NKCA 9ICCA 3RTVA 4C8LA 1DGSA 3K75D 4XA5A 4Q45A 9ICRA 5HRKA 4KLMA 1X9SA 4B9NA 3C2KA 5HRFA 1ZQWA 5CJ7A 2PXIA 3ISBA 3C18A 5DBCA 4F5QA 3SV3A 4MFAA 4JK1A 3SYZA 2PFNA 5JUMA 2ZUCA 9ICOA 2ZH6A 4DO9A 4DOBA 5KFEA 2V4RA 4X4QA 2XGQA 4DQPA 9ICUA 9ICTA 3WFQE 4LZDA 1JMSA 4JV2A 1R89A 2Y1JA 1DK3A 2ZUDA 5KFPA 1BPZA 4QZ9A 3NGDA 3GQCA 4KN7A 3FDSA 5DGBA 1ZYQA 5HRIA 4F4KA 3RJFA 3AQNA 4M9NA 2GWSA 2NRWA 4QZFA 4F4XA 8ICOA 1S97A 3C66A 3GIIA 5DB7A 5KFQA 5D49A 4F92B 4ECVA 4TUPA 1IXRA 1PX5A 5IIKA 2FMQA 1ZQHA 1ZQJA 3M8RA 2Q66A 3H37A 3OJSA 2ASDA 1KLNA 1DK2A 8ICKA 2DPIA 4AT7A 3WFRE 4IQUA 1ZETA 4P4PA 3G6VA 1ZQOA 4RWNA 4DLGA 2ZHAA 3Q8KA 2AQ4A 1WCNA 1U4BA 4YCXA 4QZ8A 4UB1A 4FS1A 4ELVA 3LDAA 4QW8A 3MR5A 2W8KA 5J2IA 3PX4A 4YMOA 2VANA 3H38A 2BCRA 1KFSA 1ZQXA 4YP3A 4ECTA 4I27A 2FLLA 4DQIA 3WFPA 4R65A 4Z6EA 3BQ2A 2F1IA 2ZH1A 2DVIA 3RJIA 4HYKA 1T4GA 4UBCA 8ICFA 1A76A 5KFFA 1ZQZA 4I28A 1HUZA 3EWAA 2ATLA 1NK0A 1S0VA 1R8AA 4AT7B 4M04A 3BJYA 4KITB 1QSSA 5HHHA 1B22A 7ICQA 2XO7A 4I2IA 2W9CA 4DLEA 5KG0A 3N97B 4K4IA 2M2UA 1BPBA 4EBCA 3MR2A 4ED8A 4KTQA 5D4BA 4O3QA 4QZHA 2R8IA 9ICBA 4G3IA 4I2BA 2V4QA 3HX0A 3OVSA 2AJQA 3OHBA 2ZJAA 4E7XA 1RYRA 4Z6FA 2P6RA 8ICHA 1XSPA 2KTQA 1NJZA 3EW9A 5KFAA 3QEBZ 1SKRA 2P66A 2C28A 3H8SA 4YD1A 4PHDA 4RQ7A 5KT6A 4E0DA 3PO4A 3V6KA 1ZQSA 1ZQBA 4F4YA 3PVXA 3UQ2A 1TK5A 5HNKA 3RB0A 1XO1A 1XS9D 2ISPA 3Q8LA 4NKTA 4RZRA 2W9CB 4QWCA 1X9WA 9ICMA 4O3OA 1RPLA 1UA0A 5J2EA 5HRLA 4DL7A 8ICPA 4ECZA 4DFMA 2KZZA 2BPGA 4DQRA 4DSEA 2BHNA 4F5PA 3PX6A 1SL0A 4WBYA 3PW5A 3UPQA 3ZDDA 8ICYA 4I2AA 9ICJA 5KG1A 1JX4A 2XCPA 3EZ5A 3OV7A 4YG2A 5KT3A 1ZJMA 4J9NA 5KT7A 4DL2A 1TFRA 2FPMA 5KFMA 5J0QA 4RNNA 5J2HA 1TK0A 4NLGA 3BQTA 2ZJ5A 3GIKA 2W9MA 5KG7A 1HUOA 2IHNA 4ECRA 3PW2A 1NZPA 4GC7A 4S3NA 3V6JA 4RQ5A 2W8LA 2UVVA 2ID1A 4I29A 8ICMA 1KSPA 2KP7A 3KHRA 4F50A 4PHPA 3T5HA 1T7PA 4IQTA 2FMSA 5DEDA 4IR1A 3SI8A 4BXOA 2KFNA 5HRDA 4I2CA 4MFFA 3GV8B 3MR6A 7ICSA 4F5OA 2VA2A 4DS4A 4F3OA 1TVAA 1KTQA 3MFHA 4DWIA 3Q8QB 2BQUA 2I9GA 4DL6A 2M2TA 1QSYA 2UVUA 4RWOA 1NOMA 4FH3A 8ICRA 4WC0A 4XRHA 5J2CA 2BQRA 4F93B 3QE9Y 4KLEA 4M9LA 3JPNA 4KLSA 1ZQPA 9ICNA 4J9LA 1KNYA 2FMPA 5J2JA 4RNMA 4DQQA 3Q8MA 2BKEA 1L3TA 5J0RA 4XQ8A 3RRGA 3IM1A 3HT3A 3TFSA 1K1QA 4PHEA 5DQHA 1BPEA 5KFYA 3THVA 2VA3A 3TARA 5CHGA 5KFCA 4ECSA 4TUQA 1BVSA 4BXOB 1L5UA 4K4HA 5BOMA 4UB3A 3PNCA 4JWNA 4DFPA 4IQVA 2KN7A 2J6SA 4LT6A 2O1PA 4RQ4A 3BQ1A 2A1JA 3BQ0A 1MSWD 4FHVA 4ECYA 1TK8A 1F5AA 1U48A 2C2RA 4EBDA 4MEXA 1XWLA 4F2SA 3OVAA 2I1QA 1MIYA 3LWMA 5J2BA 4GXKA 4X5VA 1BNOA 4ELTA 4J9OA 3GV7B 1D9FA 1V9PA 3V7KA 2XY7A 4MF2A 3Q8SB 3TQ1A 4M47A 4Z6CA 4UAWA 3GIJA 1S9FA 4DSJA 4IRKA 4X4NA 1NKBA 2ZTEA 8ICXA 5HC9A 5J0YA 3H3AA 4F5NA 2ZHBA 4CCHA 3TAPA 4EBJA 1TFYA 3MDCA 4RQ0A 3JPTA 4LZGA 5IIOA 4NLNA 4RWQA 1FA0A 2DR8A 3ZD9A 2KFZA 5KFBA 5L1JA 2A1JB 2M9NA 2MAXA 2F1HA 5CA7A 3RH4A 4O3RA 3MGIA 3GDXA 9ICAA 2W9BA 1AROP 5DQIA 4RUCA 3M9MB 3T3FA 4DFJA 2ZTDA 2HHQA 2RFFA 1S10A 1SKWA 3V6HA 3OHAA 5KG6A 4Q44A 8ICZA 3RH6A 4FH5A 1JQRA 4EP7A 4B9LA 4KLIA 3RAQA 5J0TA 1NK4A 9ICEA 7ICNA 4NXZA 4O3NA 4C8OA 4UB2A 4M9GA 1KFTA 1L3UA 1Q78A 4NY8A 5J0OA 4QWDA 5KFKA 4Q8FA 3RJHA 2JEGA 1XSNA 4FHPA 3QZ8A 2J6UA 5KFWA 4ED1A 2IMWP 3H7IA 3V72A 4JWMA 3AQLA 4NKUA 4PH5A 4QZAA 4Q43A 1UEUA 2W9BB 4YD2A 3H4BA 1U45A 8ICTA 5J2GA 5DLFA 4DL4A 1KRPA 4AT9A 5KFNA 4TQSA 5J0UA 1CEZA 4O5KA 1UETA 2OWOA 5KTQA 5DQGA 4KLDA 2DR9A 4GC6A 4YQWA 3B0XA 7ICUA 2HHVA 2M2VA 5DKWA 3AU2A 1ZQTA 5KT5A 5L1LA 5KFGA 2XGPA 4RT3A 2BDPA 2PI4A 3AU6A 9ICFA 4PHAA 5KFSA 5DB9A 5DBAA 1MIVA 1U49A 7ICEA 4RUAA 3M9OB 1H38A 4MFCA 4Z6DA 3MDAA 5L9XA 3JPSA 4J9SA 4M9HA 5KFDA 1B43A 4ED7A 4AT8A 4KLHA 1KDHA 1D8YA 7ICPA 2BE3A 3HP6A 4EBKA 4QWBA 5HREA 3ZDEA 3JYYA 4J9RA 2JEIA 4LVSA 1CUKA 4KLOA 4KN4A 3RJEA 4KLQA 4KLUA 1LB2B 1ZQAA 4WCWA 4AT9B 1T3NA 2RDIA 3EYZA 2BPFA 3ZDAA 1JAJA 2R8JA 3EPIA 3GV5B 5DBBA 3ZDBA 2ZH7A 3UQ0A 4I2HA 3FYHA 4KLTA 3V7JA 3G6YA 4UB4A 4DEZA 2BCVA 1ZQUA 1ZJNA 4QWEA 4RPZA 5J0PA 1NJWA 2IHMA 2HHXA 9ICHA 3ISCA 1SL1A 4TQRA 4UAZA 2UVRA 2B21A 4FHWA 1MQ2A 3H8WA 4UB5A 3PMLA 2IA6A 5KFLA 1SZPA 4JUZA 2HHPA 5IIIA 2HHUA 1NK9A 4JV1A 5J0XA 4AT8B 4F5RA 4RQ1A 1QTMA 4B9MA 1NK5A 5EWGA 1D9DA 2HHTA 4EEYA 5KFTA 1UEVA 3UXOA 3KHHA 4YMMA 3RB3A 2ISOA 7ICRA 5J2AA 4EZ9A 4IQWA 4EBEA 4X4PA 5KFOA 1Z00A 4I2GA 1YLQA 1XU4A 4GXIA 4FBTA 4R64A 1VFGA 1JXEA 3Q8RB 5IINA 1JXLA 7ICIA 1NO5A 3V7LA 3OJUA 4DSLA 3C1ZA 3JPPA 1X9MA 2KZMA 4E8FA 5IILA 4YVZA 3RAXA 8ICJA 3OSPA 4I2JA 3PR4A 2R8GA 4RT2A 9ICSA 9ICKA 4ECUA 3EPGA 1NK8A 2FPKA 4RPXA 1BPYA 3C23A 2NRKA 1COOA 2C22A 4RQ6A 8ICIA 4Q8EA 5F9LA 1ZQFA 3UXPA 2J6TA 3C5GA 3PR5B 1L3VA 3PV8A 4DF4A 5HP4A 4ELUA 5L1IA 7ICVA 5KFIA 4ECQA 4GXJA 3H4DA 4WC3A 2BGWA 5KG2A 3PY8A 1Z00B 4PGXA 4J9PA 4DS5A 2HHSA 4EYHB 1LV5A 1ZQRA 3AQMA 9ICPA 2V9WA 5J2KA 2XY5A 5CWRA 1ZQDA 4NM2A 4RWPA 1BGXT 3ZD8A 3PW7A 5BPCA 1PZNA 4YR0A 2RDJA 3UXNA 2ZUBA 2JEJA 4ATBA 3HPOA 2WTFA 5IIMA 4I2FA 4FS2A 1ZQGA 1QSLA 5DECA 1UT8A 2NRZA 3GFKB 4RNOA 4XQ7A 4DSFA 3C1YA 5EWEA 1QLNA 3C2LA 4IG8A 2PBEA 4X4TA 4ED2A 4DF8A 2DPJA 1MC8A 4J9KA 5DLGA 3MGHA 5HRBA 5HMLA 4R63A 4KLFA 5DB8A 5C5JA 3MBYA 4M6WA 1TKDA 2PFQA 5D46A 2ZH8A 5KG3A 2AQ0A 3GILA 2Q0ZX 9ICWA 3HJ1A 2ZH4A 4DL3A 1SL2A 4B9VA 2BQ3A 2DR5A 4ATBB 4DFKA 4YFKA 4QWAA 1IM4A 2JEFA 1BPDA 4P4OA 2MUTA 3OGUA 5DGAA 2JZBA 3MABA 1NK6A 2PI5A 4K4GA 2AGOA 5BOLA 1HJPA 7ICOA 3MR3A 3TANA 2AU0A 7ICFA 5KFVA 5CR0A 4PGYA 3MFIA 1ZQCA 4M0AA 7ICGA 4QW9A 5DG7A 4DQSA 4C8KA 1ZQIA 2XC9A 9ICGA 4WC4A 2ZH5A 4E80A 5KFXA 1MIWA 4C8NA 4UD4A 5TZVA 1S0NA 1U9LA 4FHYA 2FPLA 3QEAZ 9ICXA 1UT5A 4F4ZA 3WFOA 3KHLA 3E2EA 3RJKA 2O5AA 4M6WB 2ZH3A 4I2EA 8ICVA 3NTUA 2Y1IA 2C2DA 1ZQNA 4O9MA 3TAQA 3HW8A 4QZDA 4UD5A 4X0BA 8ICQA 2HHWA 7ICTA 2MUTB 4BWJA 2JZBB 4RQ2A 3C2MA 3PX0A 4B9SA 4RPYA 2VA8A 3C5FA 4B9TA 3RB6A 3JPQA 3HJ4A 3H40A 4X4OA 4M5DA 2ALZA 3LWLA 2ZH9A 5KFZA 2HVIA 4O3PA 2BR0A 4PGQA 3ORYA 3KHGA 4RU9A 4P4MA 2XCAA 1XSLA 1BNPA 1TFWA 5EOZA 3H39A 3Q8PB 3RBEA 4RQ3A 4QZIA 2DRBA 4F2RA 1ZQMA 1RYSA 8ICSA 4EZ6A 4WC5A 1RXWA 3HWTA 2ASJA 8ICNA 1EXNA 4KLGA 4KMUA 5HR9A 1VJ7A 3AQKA 4X4RA 1KFDA 1UA1A 4DSIA 3WFSC 4XUSA 1TV9A 1NKEA 1S0OA 4B9UA 1S77D 2ZTCA 5J0WA 4J9QA 4ECWA 3RR7A 3ZDCA 8ICEA 9ICLA 3HIYA 4F4WA 1N56A 5KFJA 3IHQB 2IBKA 8ICUA 2PFOA 4P2HA 4DL5A 5KG4A 4FBUA 3OSNA 5HHIA 4IR9A 4MEYA 4M9JA 1Y88A 1ZQLA 3BDPA 8ICLA 3L9DA 4X4SA 3KTQA 3H8JA 4R8UA 1WOTA 5J2FA 1NJXA 3RJGA 4FO6A 5F2VO 1DOQA 4O5EA 3SV4A 7ICMA 2R8KA 4NM1A 4WBZA 1N48A 4WC2A 4YN4A 1ZQVA 4QZGA 1BPXA 5HMMA 9ICQA 7ICJA 3JZ0A 2W9AA 2R8HA 1T8EA 4YR3A 4C8MA 1SKSA 4X4UA 1ZQYA 3JPRA 4BGDA 1RXVA 5CB1A 7ICHA 2P6UA 2ZH2A 4ED6A 3GIMA 5J29A 4YXMA 5IIJA 4QZCA 1U47A 1C7YA 4PPXA 1Q79A 4WC1A 4F8RA 4TURA 4X0AA 5DG9A 4F91B 1RZTA 2HW3A 4UQGA 5J2DA 4MF8A 8ICWA 4R8UB 7ICLA 4UAYA 1XC9A 3PW0A 2NRTA 4WC6A 2BPCA 4ZH4A 3K4GA 4QZEA 3M9NB 4ED3A 4WC7A 2AGQA 2FLNA 2DFLA 3UPSA 4ED0A 4TUSA 3PO5A 3N4MB 2NRXA 1S0MA 5DG8A 5DB6A 5EWFA 1V4AA 1ZQQA 1R8CA 4O5CA 2XY6A 3JPOA 1NJYA 1ZQKA 2UVWA 3TI0A 4YMNA 4UBBA 2NRVA 2KZ3A 2LYHA 2F1JA 3RRHA 7ICKA 1R8BA 3SZ2A 5L1KA 3ISDA 1JN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DDM A;  1D8L A;  5DDY A;  3T5J A;  5J0S A;  4IRD A;  9ICI A;  5KFR A;  1Z3E B;  5HRG A;  4DOC A;  1WCL A;  1ZQE A;  4FHX A;  1OU5 A;  1K1S A;  4DOA A;  4JV0 A;  2M2W A;  3RR8 A;  5F9N A;  4RQ8 A;  3RJJ A;  1TAQ A;  8ICB A;  5KT2 A;  2AGP A;  4KLJ A;  2C2E A;  3C21 A;  1KEJ A;  3TFR A;  1L3S A;  4I2D A;  5KG5 A;  4ECX A;  1S76 D;  3T5K A;  3PW4 A;  8ICG A;  5KT4 A;  8ICC A;  2ASL A;  1JIH A;  2BCQ A;  3G6X A;  4EYI B;  3RBD A;  1MQ3 A;  2HVH A;  3B0Y A;  4O0I A;  2BCS A;  4DSK A;  3OUY A;  1NK7 A;  1A77 A;  3PMN A;  9ICV A;  3NYB A;  3LK9 A;  4BWM A;  4NLK A;  4NLZ A;  4X4V A;  2H5X A;  2DRA A;  1X2I A;  8ICA A;  1TAU A;  3ETL A;  5KFH A;  4YR2 A;  4KLL A;  5CP2 A;  3T5L A;  4R66 A;  3AUO A;  3RH5 A;  4O3S A;  2PFP A;  4QZB A;  5KFU A;  4GLX A;  4IRC A;  3OVB A;  4YXJ A;  4J9M A;  2BCU A;  2DR7 A;  2ZJ8 A;  4BDP A;  4M2Y A;  5HRH A;  3M8S A;  3RB4 A;  3QZ7 A;  3LQC B;  3OUY B;  2FLP A;  1NKC A;  9ICC A;  3RTV A;  4C8L A;  1DGS A;  3K75 D;  4XA5 A;  4Q45 A;  9ICR A;  5HRK A;  4KLM A;  1X9S A;  4B9N A;  3C2K A;  5HRF A;  1ZQW A;  5CJ7 A;  2PXI A;  3ISB A;  3C18 A;  5DBC A;  4F5Q A;  3SV3 A;  4MFA A;  4JK1 A;  3SYZ A;  2PFN A;  5JUM A;  2ZUC A;  9ICO A;  2ZH6 A;  4DO9 A;  4DOB A;  5KFE A;  2V4R A;  4X4Q A;  2XGQ A;  4DQP A;  9ICU A;  9ICT A;  3WFQ E;  4LZD A;  1JMS A;  4JV2 A;  1R89 A;  2Y1J A;  1DK3 A;  2ZUD A;  5KFP A;  1BPZ A;  4QZ9 A;  3NGD A;  3GQC A;  4KN7 A;  3FDS A;  5DGB A;  1ZYQ A;  5HRI A;  4F4K A;  3RJF A;  3AQN A;  4M9N A;  2GWS A;  2NRW A;  4QZF A;  4F4X A;  8ICO A;  1S97 A;  3C66 A;  3GII A;  5DB7 A;  5KFQ A;  5D49 A;  4F92 B;  4ECV A;  4TUP A;  1IXR A;  1PX5 A;  5IIK A;  2FMQ A;  1ZQH A;  1ZQJ A;  3M8R A;  2Q66 A;  3H37 A;  3OJS A;  2ASD A;  1KLN A;  1DK2 A;  8ICK A;  2DPI A;  4AT7 A;  3WFR E;  4IQU A;  1ZET A;  4P4P A;  3G6V A;  1ZQO A;  4RWN A;  4DLG A;  2ZHA A;  3Q8K A;  2AQ4 A;  1WCN A;  1U4B A;  4YCX A;  4QZ8 A;  4UB1 A;  4FS1 A;  4ELV A;  3LDA A;  4QW8 A;  3MR5 A;  2W8K A;  5J2I A;  3PX4 A;  4YMO A;  2VAN A;  3H38 A;  2BCR A;  1KFS A;  1ZQX A;  4YP3 A;  4ECT A;  4I27 A;  2FLL A;  4DQI A;  3WFP A;  4R65 A;  4Z6E A;  3BQ2 A;  2F1I A;  2ZH1 A;  2DVI A;  3RJI A;  4HYK A;  1T4G A;  4UBC A;  8ICF A;  1A76 A;  5KFF A;  1ZQZ A;  4I28 A;  1HUZ A;  3EWA A;  2ATL A;  1NK0 A;  1S0V A;  1R8A A;  4AT7 B;  4M04 A;  3BJY A;  4KIT B;  1QSS A;  5HHH A;  1B22 A;  7ICQ A;  2XO7 A;  4I2I A;  2W9C A;  4DLE A;  5KG0 A;  3N97 B;  4K4I A;  2M2U A;  1BPB A;  4EBC A;  3MR2 A;  4ED8 A;  4KTQ A;  5D4B A;  4O3Q A;  4QZH A;  2R8I A;  9ICB A;  4G3I A;  4I2B A;  2V4Q A;  3HX0 A;  3OVS A;  2AJQ A;  3OHB A;  2ZJA A;  4E7X A;  1RYR A;  4Z6F A;  2P6R A;  8ICH A;  1XSP A;  2KTQ A;  1NJZ A;  3EW9 A;  5KFA A;  3QEB Z;  1SKR A;  2P66 A;  2C28 A;  3H8S A;  4YD1 A;  4PHD A;  4RQ7 A;  5KT6 A;  4E0D A;  3PO4 A;  3V6K A;  1ZQS A;  1ZQB A;  4F4Y A;  3PVX A;  3UQ2 A;  1TK5 A;  5HNK A;  3RB0 A;  1XO1 A;  1XS9 D;  2ISP A;  3Q8L A;  4NKT A;  4RZR A;  2W9C B;  4QWC A;  1X9W A;  9ICM A;  4O3O A;  1RPL A;  1UA0 A;  5J2E A;  5HRL A;  4DL7 A;  8ICP A;  4ECZ A;  4DFM A;  2KZZ A;  2BPG A;  4DQR A;  4DSE A;  2BHN A;  4F5P A;  3PX6 A;  1SL0 A;  4WBY A;  3PW5 A;  3UPQ A;  3ZDD A;  8ICY A;  4I2A A;  9ICJ A;  5KG1 A;  1JX4 A;  2XCP A;  3EZ5 A;  3OV7 A;  4YG2 A;  5KT3 A;  1ZJM A;  4J9N A;  5KT7 A;  4DL2 A;  1TFR A;  2FPM A;  5KFM A;  5J0Q A;  4RNN A;  5J2H A;  1TK0 A;  4NLG A;  3BQT A;  2ZJ5 A;  3GIK A;  2W9M A;  5KG7 A;  1HUO A;  2IHN A;  4ECR A;  3PW2 A;  1NZP A;  4GC7 A;  4S3N A;  3V6J A;  4RQ5 A;  2W8L A;  2UVV A;  2ID1 A;  4I29 A;  8ICM A;  1KSP A;  2KP7 A;  3KHR A;  4F50 A;  4PHP A;  3T5H A;  1T7P A;  4IQT A;  2FMS A;  5DED A;  4IR1 A;  3SI8 A;  4BXO A;  2KFN A;  5HRD A;  4I2C A;  4MFF A;  3GV8 B;  3MR6 A;  7ICS A;  4F5O A;  2VA2 A;  4DS4 A;  4F3O A;  1TVA A;  1KTQ A;  3MFH A;  4DWI A;  3Q8Q B;  2BQU A;  2I9G A;  4DL6 A;  2M2T A;  1QSY A;  2UVU A;  4RWO A;  1NOM A;  4FH3 A;  8ICR A;  4WC0 A;  4XRH A;  5J2C A;  2BQR A;  4F93 B;  3QE9 Y;  4KLE A;  4M9L A;  3JPN A;  4KLS A;  1ZQP A;  9ICN A;  4J9L A;  1KNY A;  2FMP A;  5J2J A;  4RNM A;  4DQQ A;  3Q8M A;  2BKE A;  1L3T A;  5J0R A;  4XQ8 A;  3RRG A;  3IM1 A;  3HT3 A;  3TFS A;  1K1Q A;  4PHE A;  5DQH A;  1BPE A;  5KFY A;  3THV A;  2VA3 A;  3TAR A;  5CHG A;  5KFC A;  4ECS A;  4TUQ A;  1BVS A;  4BXO B;  1L5U A;  4K4H A;  5BOM A;  4UB3 A;  3PNC A;  4JWN A;  4DFP A;  4IQV A;  2KN7 A;  2J6S A;  4LT6 A;  2O1P A;  4RQ4 A;  3BQ1 A;  2A1J A;  3BQ0 A;  1MSW D;  4FHV A;  4ECY A;  1TK8 A;  1F5A A;  1U48 A;  2C2R A;  4EBD A;  4MEX A;  1XWL A;  4F2S A;  3OVA A;  2I1Q A;  1MIY A;  3LWM A;  5J2B A;  4GXK A;  4X5V A;  1BNO A;  4ELT A;  4J9O A;  3GV7 B;  1D9F A;  1V9P A;  3V7K A;  2XY7 A;  4MF2 A;  3Q8S B;  3TQ1 A;  4M47 A;  4Z6C A;  4UAW A;  3GIJ A;  1S9F A;  4DSJ A;  4IRK A;  4X4N A;  1NKB A;  2ZTE A;  8ICX A;  5HC9 A;  5J0Y A;  3H3A A;  4F5N A;  2ZHB A;  4CCH A;  3TAP A;  4EBJ A;  1TFY A;  3MDC A;  4RQ0 A;  3JPT A;  4LZG A;  5IIO A;  4NLN A;  4RWQ A;  1FA0 A;  2DR8 A;  3ZD9 A;  2KFZ A;  5KFB A;  5L1J A;  2A1J B;  2M9N A;  2MAX A;  2F1H A;  5CA7 A;  3RH4 A;  4O3R A;  3MGI A;  3GDX A;  9ICA A;  2W9B A;  1ARO P;  5DQI A;  4RUC A;  3M9M B;  3T3F A;  4DFJ A;  2ZTD A;  2HHQ A;  2RFF A;  1S10 A;  1SKW A;  3V6H A;  3OHA A;  5KG6 A;  4Q44 A;  8ICZ A;  3RH6 A;  4FH5 A;  1JQR A;  4EP7 A;  4B9L A;  4KLI A;  3RAQ A;  5J0T A;  1NK4 A;  9ICE A;  7ICN A;  4NXZ A;  4O3N A;  4C8O A;  4UB2 A;  4M9G A;  1KFT A;  1L3U A;  1Q78 A;  4NY8 A;  5J0O A;  4QWD A;  5KFK A;  4Q8F A;  3RJH A;  2JEG A;  1XSN A;  4FHP A;  3QZ8 A;  2J6U A;  5KFW A;  4ED1 A;  2IMW P;  3H7I A;  3V72 A;  4JWM A;  3AQL A;  4NKU A;  4PH5 A;  4QZA A;  4Q43 A;  1UEU A;  2W9B B;  4YD2 A;  3H4B A;  1U45 A;  8ICT A;  5J2G A;  5DLF A;  4DL4 A;  1KRP A;  4AT9 A;  5KFN A;  4TQS A;  5J0U A;  1CEZ A;  4O5K A;  1UET A;  2OWO A;  5KTQ A;  5DQG A;  4KLD A;  2DR9 A;  4GC6 A;  4YQW A;  3B0X A;  7ICU A;  2HHV A;  2M2V A;  5DKW A;  3AU2 A;  1ZQT A;  5KT5 A;  5L1L A;  5KFG A;  2XGP A;  4RT3 A;  2BDP A;  2PI4 A;  3AU6 A;  9ICF A;  4PHA A;  5KFS A;  5DB9 A;  5DBA A;  1MIV A;  1U49 A;  7ICE A;  4RUA A;  3M9O B;  1H38 A;  4MFC A;  4Z6D A;  3MDA A;  5L9X A;  3JPS A;  4J9S A;  4M9H A;  5KFD A;  1B43 A;  4ED7 A;  4AT8 A;  4KLH A;  1KDH A;  1D8Y A;  7ICP A;  2BE3 A;  3HP6 A;  4EBK A;  4QWB A;  5HRE A;  3ZDE A;  3JYY A;  4J9R A;  2JEI A;  4LVS A;  1CUK A;  4KLO A;  4KN4 A;  3RJE A;  4KLQ A;  4KLU A;  1LB2 B;  1ZQA A;  4WCW A;  4AT9 B;  1T3N A;  2RDI A;  3EYZ A;  2BPF A;  3ZDA A;  1JAJ A;  2R8J A;  3EPI A;  3GV5 B;  5DBB A;  3ZDB A;  2ZH7 A;  3UQ0 A;  4I2H A;  3FYH A;  4KLT A;  3V7J A;  3G6Y A;  4UB4 A;  4DEZ A;  2BCV A;  1ZQU A;  1ZJN A;  4QWE A;  4RPZ A;  5J0P A;  1NJW A;  2IHM A;  2HHX A;  9ICH A;  3ISC A;  1SL1 A;  4TQR A;  4UAZ A;  2UVR A;  2B21 A;  4FHW A;  1MQ2 A;  3H8W A;  4UB5 A;  3PML A;  2IA6 A;  5KFL A;  1SZP A;  4JUZ A;  2HHP A;  5III A;  2HHU A;  1NK9 A;  4JV1 A;  5J0X A;  4AT8 B;  4F5R A;  4RQ1 A;  1QTM A;  4B9M A;  1NK5 A;  5EWG A;  1D9D A;  2HHT A;  4EEY A;  5KFT A;  1UEV A;  3UXO A;  3KHH A;  4YMM A;  3RB3 A;  2ISO A;  7ICR A;  5J2A A;  4EZ9 A;  4IQW A;  4EBE A;  4X4P A;  5KFO A;  1Z00 A;  4I2G A;  1YLQ A;  1XU4 A;  4GXI A;  4FBT A;  4R64 A;  1VFG A;  1JXE A;  3Q8R B;  5IIN A;  1JXL A;  7ICI A;  1NO5 A;  3V7L A;  3OJU A;  4DSL A;  3C1Z A;  3JPP A;  1X9M A;  2KZM A;  4E8F A;  5IIL A;  4YVZ A;  3RAX A;  8ICJ A;  3OSP A;  4I2J A;  3PR4 A;  2R8G A;  4RT2 A;  9ICS A;  9ICK A;  4ECU A;  3EPG A;  1NK8 A;  2FPK A;  4RPX A;  1BPY A;  3C23 A;  2NRK A;  1COO A;  2C22 A;  4RQ6 A;  8ICI A;  4Q8E A;  5F9L A;  1ZQF A;  3UXP A;  2J6T A;  3C5G A;  3PR5 B;  1L3V A;  3PV8 A;  4DF4 A;  5HP4 A;  4ELU A;  5L1I A;  7ICV A;  5KFI A;  4ECQ A;  4GXJ A;  3H4D A;  4WC3 A;  2BGW A;  5KG2 A;  3PY8 A;  1Z00 B;  4PGX A;  4J9P A;  4DS5 A;  2HHS A;  4EYH B;  1LV5 A;  1ZQR A;  3AQM A;  9ICP A;  2V9W A;  5J2K A;  2XY5 A;  5CWR A;  1ZQD A;  4NM2 A;  4RWP A;  1BGX T;  3ZD8 A;  3PW7 A;  5BPC A;  1PZN A;  4YR0 A;  2RDJ A;  3UXN A;  2ZUB A;  2JEJ A;  4ATB A;  3HPO A;  2WTF A;  5IIM A;  4I2F A;  4FS2 A;  1ZQG A;  1QSL A;  5DEC A;  1UT8 A;  2NRZ A;  3GFK B;  4RNO A;  4XQ7 A;  4DSF A;  3C1Y A;  5EWE A;  1QLN A;  3C2L A;  4IG8 A;  2PBE A;  4X4T A;  4ED2 A;  4DF8 A;  2DPJ A;  1MC8 A;  4J9K A;  5DLG A;  3MGH A;  5HRB A;  5HML A;  4R63 A;  4KLF A;  5DB8 A;  5C5J A;  3MBY A;  4M6W A;  1TKD A;  2PFQ A;  5D46 A;  2ZH8 A;  5KG3 A;  2AQ0 A;  3GIL A;  2Q0Z X;  9ICW A;  3HJ1 A;  2ZH4 A;  4DL3 A;  1SL2 A;  4B9V A;  2BQ3 A;  2DR5 A;  4ATB B;  4DFK A;  4YFK A;  4QWA A;  1IM4 A;  2JEF A;  1BPD A;  4P4O A;  2MUT A;  3OGU A;  5DGA A;  2JZB A;  3MAB A;  1NK6 A;  2PI5 A;  4K4G A;  2AGO A;  5BOL A;  1HJP A;  7ICO A;  3MR3 A;  3TAN A;  2AU0 A;  7ICF A;  5KFV A;  5CR0 A;  4PGY A;  3MFI A;  1ZQC A;  4M0A A;  7ICG A;  4QW9 A;  5DG7 A;  4DQS A;  4C8K A;  1ZQI A;  2XC9 A;  9ICG A;  4WC4 A;  2ZH5 A;  4E80 A;  5KFX A;  1MIW A;  4C8N A;  4UD4 A;  5TZV A;  1S0N A;  1U9L A;  4FHY A;  2FPL A;  3QEA Z;  9ICX A;  1UT5 A;  4F4Z A;  3WFO A;  3KHL A;  3E2E A;  3RJK A;  2O5A A;  4M6W B;  2ZH3 A;  4I2E A;  8ICV A;  3NTU A;  2Y1I A;  2C2D A;  1ZQN A;  4O9M A;  3TAQ A;  3HW8 A;  4QZD A;  4UD5 A;  4X0B A;  8ICQ A;  2HHW A;  7ICT A;  2MUT B;  4BWJ A;  2JZB B;  4RQ2 A;  3C2M A;  3PX0 A;  4B9S A;  4RPY A;  2VA8 A;  3C5F A;  4B9T A;  3RB6 A;  3JPQ A;  3HJ4 A;  3H40 A;  4X4O A;  4M5D A;  2ALZ A;  3LWL A;  2ZH9 A;  5KFZ A;  2HVI A;  4O3P A;  2BR0 A;  4PGQ A;  3ORY A;  3KHG A;  4RU9 A;  4P4M A;  2XCA A;  1XSL A;  1BNP A;  1TFW A;  5EOZ A;  3H39 A;  3Q8P B;  3RBE A;  4RQ3 A;  4QZI A;  2DRB A;  4F2R A;  1ZQM A;  1RYS A;  8ICS A;  4EZ6 A;  4WC5 A;  1RXW A;  3HWT A;  2ASJ A;  8ICN A;  1EXN A;  4KLG A;  4KMU A;  5HR9 A;  1VJ7 A;  3AQK A;  4X4R A;  1KFD A;  1UA1 A;  4DSI A;  3WFS C;  4XUS A;  1TV9 A;  1NKE A;  1S0O A;  4B9U A;  1S77 D;  2ZTC A;  5J0W A;  4J9Q A;  4ECW A;  3RR7 A;  3ZDC A;  8ICE A;  9ICL A;  3HIY A;  4F4W A;  1N56 A;  5KFJ A;  3IHQ B;  2IBK A;  8ICU A;  2PFO A;  4P2H A;  4DL5 A;  5KG4 A;  4FBU A;  3OSN A;  5HHI A;  4IR9 A;  4MEY A;  4M9J A;  1Y88 A;  1ZQL A;  3BDP A;  8ICL A;  3L9D A;  4X4S A;  3KTQ A;  3H8J A;  4R8U A;  1WOT A;  5J2F A;  1NJX A;  3RJG A;  4FO6 A;  5F2V O;  1DOQ A;  4O5E A;  3SV4 A;  7ICM A;  2R8K A;  4NM1 A;  4WBZ A;  1N48 A;  4WC2 A;  4YN4 A;  1ZQV A;  4QZG A;  1BPX A;  5HMM A;  9ICQ A;  7ICJ A;  3JZ0 A;  2W9A A;  2R8H A;  1T8E A;  4YR3 A;  4C8M A;  1SKS A;  4X4U A;  1ZQY A;  3JPR A;  4BGD A;  1RXV A;  5CB1 A;  7ICH A;  2P6U A;  2ZH2 A;  4ED6 A;  3GIM A;  5J29 A;  4YXM A;  5IIJ A;  4QZC A;  1U47 A;  1C7Y A;  4PPX A;  1Q79 A;  4WC1 A;  4F8R A;  4TUR A;  4X0A A;  5DG9 A;  4F91 B;  1RZT A;  2HW3 A;  4UQG A;  5J2D A;  4MF8 A;  8ICW A;  4R8U B;  7ICL A;  4UAY A;  1XC9 A;  3PW0 A;  2NRT A;  4WC6 A;  2BPC A;  4ZH4 A;  3K4G A;  4QZE A;  3M9N B;  4ED3 A;  4WC7 A;  2AGQ A;  2FLN A;  2DFL A;  3UPS A;  4ED0 A;  4TUS A;  3PO5 A;  3N4M B;  2NRX A;  1S0M A;  5DG8 A;  5DB6 A;  5EWF A;  1V4A A;  1ZQQ A;  1R8C A;  4O5C A;  2XY6 A;  3JPO A;  1NJY A;  1ZQK A;  2UVW A;  3TI0 A;  4YMN A;  4UBB A;  2NRV A;  2KZ3 A;  2LYH A;  2F1J A;  3RRH A;  7ICK A;  1R8B A;  3SZ2 A;  5L1K A;  3ISD A;  1JN3 A; 
#chains in the Genus database with same CATH topology
 3T5J A;  5AI4 A;  5JRT A;  3QX7 A;  5B66 U;  5KL1 B;  2M2W A;  1TAQ A;  2AGP A;  4NXT A;  2C2E A;  5AKJ A;  3TFR A;  4I2D A;  1S76 D;  8ICC A;  4K96 A;  4A8E A;  1JIH A;  2EAP A;  2HVH A;  1NK7 A;  4O6A A;  2HBL A;  3WKE A;  2KEY A;  4NLZ A;  3HJE A;  3UM9 A;  3IRU A;  4OJO A;  4UW9 A;  4R66 A;  5T14 A;  1FFU A;  4IRC A;  4YXJ A;  5AKG A;  2DR7 A;  2ZJ8 A;  1O08 A;  4BDP A;  3LQC B;  2FLP A;  2G08 A;  5ALJ A;  2EWR A;  2YN4 A;  1K5O A;  2K60 A;  3C18 A;  4F5Q A;  4JK1 A;  3F2B A;  2XI9 A;  3IDW A;  4DO9 A;  5J8Y A;  4DQP A;  2W3S A;  4FZL A;  1NI3 A;  5HRI A;  1N5X A;  3RJF A;  2GWS A;  2NRW A;  3C66 A;  4QIW C;  3GII A;  5DB7 A;  3KOO A;  5IIK A;  5CFT A;  1Q3U A;  3L4P A;  3G6V A;  1ZQO A;  1AQ6 A;  2EDU A;  3QUT A;  4UB1 A;  3CP8 A;  4Y2Y A;  3PX4 A;  3RJI A;  2D6F C;  1HUZ A;  1NK0 A;  1QSS A;  2XIC A;  2EZX A;  5KG0 A;  2M2U A;  2JH7 A;  2BBJ A;  4EBC A;  2ZG6 A;  3K1Z A;  3HX0 A;  3QU2 A;  2P6R A;  2KTQ A;  3QEB Z;  2C28 A;  4Y2Q A;  3V6K A;  2AHO B;  3RB0 A;  2ISP A;  2CN1 A;  5B3Q A;  1PK1 A;  4RZR A;  4O3O A;  1RPL A;  2VIX A;  1UA0 A;  5JU5 A;  2LYB A;  2KJ8 A;  2KZZ A;  3FM9 A;  2BPG A;  2BHN A;  1TAM A;  5ALT A;  3UPQ A;  3BZC A;  4J9N A;  2RQ5 A;  4US9 A;  1HUO A;  3GIK A;  2IHN A;  4NL9 A;  4S3N A;  4RQ5 A;  2UVV A;  8ICM A;  4F50 A;  4PHP A;  3SI8 A;  1KW4 A;  5HRD A;  2HN2 A;  2LYA A;  3MR6 A;  2VA2 A;  4DWI A;  4DL6 A;  3M7D A;  3AL0 B;  2JR5 A;  2BQR A;  5EE1 A;  3QE9 Y;  4GIB A;  5D61 A;  2MU2 A;  4KLS A;  3IN5 A;  4KM5 A;  1PVQ A;  3IM1 A;  3TFS A;  2VA3 A;  3THV A;  2KV2 A;  2F2A B;  2DKZ A;  3PNC A;  4F72 A;  4DFP A;  2O1P A;  3BQ0 A;  1F5A A;  2C2R A;  1N60 A;  2WF7 A;  2LBO A;  4X5V A;  5J2B A;  4J9O A;  3GV7 B;  3Q8S B;  4UAW A;  4IRK A;  2ZTE A;  8ICX A;  5HC9 A;  2FDR A;  3TAP A;  5AM2 A;  3F53 A;  4RWQ A;  1FA0 A;  3ZD9 A;  3EF2 A;  2A1J B;  2M9N A;  9ICA A;  3MGI A;  1F0M A;  1ZRN A;  4DFJ A;  5AM4 A;  2K4P A;  2RFF A;  3OHA A;  2DUY A;  5KG6 A;  8ICZ A;  3RH6 A;  4FH5 A;  1SWW A;  3RAQ A;  1NK4 A;  4P0Q B;  4PZO A;  2JXJ A;  4Q8F A;  1XSN A;  4ED1 A;  3V72 A;  4NKU A;  4Q43 A;  3H4B A;  8ICT A;  4AT9 A;  5KFN A;  5J0U A;  5DQG A;  2A3V A;  5C0Y A;  5KT5 A;  5L1L A;  2WB1 C;  5KAF U;  1FO4 A;  4M9H A;  3F5E A;  5AKK A;  2BE3 A;  3DEE A;  1L8L A;  3JYY A;  1SGG A;  3H0M B;  4LVS A;  3KKA C;  4KLO A;  4WCW A;  4USA A;  4C4S A;  2BPF A;  1JAJ A;  3GV5 B;  2GH1 A;  2H3Z A;  2ZH7 A;  3KZX A;  3UQ0 A;  3V7J A;  3G6Y A;  4DEZ A;  1QCK A;  1ZJN A;  4UAZ A;  2DWQ A;  4UB5 A;  5KFL A;  1SZP A;  5JTG A;  5AI8 A;  5J0X A;  4RQ1 A;  4B9M A;  4PL2 A;  3IG8 A;  4EEY A;  3UXO A;  3KHH A;  4YMM A;  3ZI4 A;  2QLT A;  7ICR A;  4IQW A;  4EBE A;  1Q46 A;  4I2G A;  4R64 A;  1VFG A;  1QH9 A;  3OJU A;  3JPP A;  5AM1 A;  4YVZ A;  4I2J A;  9ICK A;  4ECU A;  3C23 A;  4CRX A;  4Q8E A;  1ZQF A;  3EUB 2;  4ELU A;  4DF4 A;  4ECQ A;  4GXJ A;  4WC3 A;  5AKY A;  3KD3 A;  5KG2 A;  2HHS A;  2W3R A;  1LVH A;  2B56 A;  3KZI U;  9ICP A;  3AQM A;  4NXW A;  5BPC A;  2RDJ A;  2JEJ A;  2ZUB A;  1ZQG A;  2W11 A;  4RNO A;  2GAF D;  3GFK B;  5EWE A;  3C2L A;  4IG8 A;  2PBE A;  4X4T A;  5DLG A;  3SAH A;  2PFQ A;  2AQ0 A;  4DL3 A;  1SL2 A;  4B9V A;  2DR5 A;  4DFK A;  1BPD A;  4P4O A;  1NK6 A;  2JZB A;  3MAB A;  2PI5 A;  4K4G A;  2AGO A;  5BOL A;  7ICO A;  3TAN A;  7ICF A;  1SZH A;  4QW9 A;  4WC4 A;  1MIW A;  2HBJ A;  4FHY A;  2DL0 A;  4F4Z A;  3WFO A;  4I2E A;  8ICV A;  4NJ8 A;  4EEL A;  3I76 A;  4UD5 A;  8ICQ A;  4MKP A;  4EGW A;  4RQ2 A;  4X4O A;  2QKQ A;  4B9T A;  3C5F A;  4UAU A;  4M5D A;  4QNL A;  5EE0 A;  4O3P A;  3KHG A;  3A0H U;  2W7O A;  3H39 A;  3RBE A;  1SIJ A;  4F2R A;  1RXW A;  3HWT A;  2ASJ A;  3H8M A;  4KMU A;  2OYY A;  4ECW A;  3RR7 A;  9ICL A;  3ZDC A;  3HIY A;  2HOF A;  3IHQ B;  2KE7 A;  4IR9 A;  1Y88 A;  1ZQL A;  4P0P B;  1B4F A;  2W55 A;  5F2V O;  5ALZ A;  4NM1 A;  4WBZ A;  1N48 A;  4YN4 A;  1BPX A;  1T3Q A;  3JZ0 A;  4RQM A;  1T8E A;  4X4U A;  2ZIW B;  5CB1 A;  2ZH2 A;  2D8C A;  3GIM A;  5J29 A;  4ED6 A;  1U47 A;  2WF6 A;  5AM0 A;  1RZT A;  4F91 B;  4MF8 A;  8ICW A;  4UAY A;  3OTQ A;  2BPC A;  4ED3 A;  3M9N B;  2IOH A;  3U26 A;  2HOI A;  2K4E A;  3N4M B;  2RP5 A;  4FZN A;  1ZD3 A;  3SD7 A;  1R8C A;  4O5C A;  2XY6 A;  1ZQK A;  4YMN A;  2LYH A;  7ICK A;  4NWI A;  5CHE A;  3O0F A;  4HAI A;  1Z3E B;  4WOY A;  5HRG A;  1ZQE A;  1OU5 A;  3RJJ A;  4NV0 A;  1KEJ A;  5KG5 A;  1ZXI A;  5KT4 A;  2NV3 A;  3MC1 A;  3G6X A;  3PMN A;  9ICV A;  5EE3 A;  3LK9 A;  2DRA A;  8ICA A;  1TAU A;  3ETL A;  4KX5 A;  3T79 A;  3M6Z A;  4QZB A;  4GLX A;  2KJ9 A;  2EAM A;  1L7N A;  5ALE A;  2BCU A;  3HKZ C;  1RYU A;  2ODG A;  3OUY B;  2B0C A;  9ICC A;  1DGS A;  4XA5 A;  4Q45 A;  9ICR A;  5AIC A;  5HRK A;  1X9S A;  2DQN B;  5HRF A;  5DBC A;  3SEI A;  5JUM A;  2ZH6 A;  5KFE A;  2KSO B;  3NS1 A;  2OCE A;  1JMS A;  4K9A A;  3QU4 A;  1YZ7 A;  3NGD A;  3AQN A;  4F4K A;  4QZF A;  5D49 A;  5AI5 A;  1ZQH A;  3M8R A;  3H37 A;  3OJS A;  5ALQ A;  2ASD A;  2DPI A;  1ZET A;  2DKX A;  4ZOH C;  3Q8K A;  2AQ4 A;  1WCN A;  4FS1 A;  4ELV A;  3MR5 A;  3NVW A;  3H38 A;  2CRX A;  4ECT A;  4DQI A;  4R65 A;  1JRP A;  2F1I A;  1T4G A;  4UBC A;  8ICF A;  1A76 A;  2ATL A;  3TAD C;  1ZOL A;  1S0V A;  1R8A A;  4AT7 B;  3BJY A;  5HHH A;  7ICQ A;  2XO7 A;  4I2I A;  4WH5 A;  5D4B A;  4NXX A;  1J97 A;  9ICB A;  4G3I A;  4UAV A;  5D63 A;  2XVT A;  2ZJA A;  3EW9 A;  4RQN A;  3H8S A;  4WJ3 B;  2EQY A;  4O68 A;  5ALY A;  5AI9 A;  1ZQB A;  3UQ2 A;  1ZD5 A;  2IOF K;  1RQN A;  2W9C B;  4QWC A;  4EED A;  2ZIU A;  4ECZ A;  4DQR A;  4WBY A;  4NXV A;  4I2A A;  2IOF A;  1JX4 A;  2XCP A;  3EZ5 A;  3OV7 A;  4YG2 A;  1TFR A;  5KFM A;  4RNN A;  5J2H A;  4NLG A;  3PW2 A;  3NRW A;  2KKP A;  2KP7 A;  1KSP A;  4Y2T A;  3N7R C;  1N61 A;  4UB6 U;  4BXO A;  3GV8 B;  7ICS A;  4F5O A;  2A1A A;  4DS4 A;  4F3O A;  1KTQ A;  2VJ5 A;  3Q8Q B;  2BQU A;  2I9G A;  2UVU A;  4RWO A;  1NOM A;  4FH3 A;  2Q4T A;  5AK4 A;  2QB0 A;  1VDV A;  5E79 U;  1UCV A;  5J2J A;  3Q8M A;  1Z4O A;  1K1Q A;  4NLC A;  4PHE A;  1BPE A;  3TAR A;  1L8O A;  5KFC A;  4ECS A;  3NWI A;  5ALP A;  1L5U A;  4K4H A;  4O67 A;  2G5H B;  4IQV A;  4I0U A;  3BQ1 A;  4ECY A;  5AI0 A;  1U48 A;  3FC4 A;  4F2S A;  3OVA A;  3LWM A;  3GU3 A;  1BNO A;  2VKQ A;  3V7K A;  3IV6 A;  1NKB A;  3H3A A;  4RQ0 A;  5L1J A;  1ZD4 A;  4OAF A;  2W9B A;  2ZTD A;  2K4I A;  3BS5 B;  1SKW A;  5CEH A;  4LEW A;  3PZP A;  3HKZ F;  2YY6 A;  1JQR A;  4FFD A;  4FO1 A;  4J03 A;  4Y2R A;  3N7P D;  1L3U A;  4NY8 A;  3QYP A;  5J0O A;  2JMG A;  3RJH A;  4FHP A;  1SXE A;  4CGZ A;  3H7I A;  3AQL A;  5AKZ A;  1V85 A;  4UB8 U;  5AKL A;  5J2G A;  5DLF A;  4DL4 A;  4TQS A;  1UET A;  1CEZ A;  2KIC A;  2OWO A;  3WK6 A;  1WUD A;  4KLD A;  4YQW A;  2HHV A;  2Y9T A;  2YX8 A;  2XGP A;  4RT3 A;  9ICF A;  2B4V A;  5KFS A;  5DBA A;  4RUA A;  3WK5 A;  3MDA A;  4J9S A;  4ED7 A;  4AT8 A;  4KLH A;  1KDH A;  3QUC A;  1D8Y A;  7ICP A;  5HRE A;  1CI4 A;  4J9R A;  4KN4 A;  1SB3 C;  1T3N A;  3EYZ A;  3ZDA A;  3AN1 A;  3I1Y A;  3FYH A;  4RPZ A;  5J0P A;  4CF3 A;  3ISC A;  1SL1 A;  4TQR A;  4FHW A;  1MQ2 A;  2HHP A;  4JUZ A;  5ALM A;  1QQ6 A;  4US8 A;  1NK9 A;  1O03 A;  4F5R A;  2L5Y A;  1QTM A;  1NK5 A;  2PKE A;  1B0X A;  1UEV A;  1LKY A;  3RB3 A;  2ISO A;  5J2A A;  4EZ9 A;  4X4P A;  5KFO A;  1Z00 A;  1YLQ A;  2YMQ A;  3LYS A;  2Y9U A;  1Z1B A;  3N7S C;  1Z1V A;  1NO5 A;  2CXY A;  2VJ4 A;  1L7O A;  3C1Z A;  1X9M A;  8ICJ A;  2YML A;  3OSP A;  3PR4 A;  5ALX A;  2R8G A;  2QAR A;  1COO A;  3QU7 A;  4RQ6 A;  2HBM A;  5F9L A;  2J6T A;  1S5L U;  3UXP A;  3C5G A;  3NRZ A;  3PR5 B;  3PV8 A;  5HP4 A;  1L3V A;  5L1I A;  1KL9 A;  1LV5 A;  1ZQR A;  3WK9 A;  1N62 A;  3TAD A;  5J2K A;  5AIA A;  5IIM A;  2WTF A;  4XQ7 A;  2F3N A;  3E0F A;  3C1Y A;  1WWV A;  2W54 A;  1QLN A;  3E58 A;  4EV6 A;  1X9X A;  2QB1 A;  4QJF B;  2DPJ A;  3WK7 A;  4R63 A;  3MBY A;  1TKD A;  1YZ6 A;  3HJ1 A;  2ZH4 A;  1PUZ A;  3NVV A;  1GPJ A;  4ATB B;  4QWA A;  4IS7 A;  4Y2X A;  5KFV A;  2K8C B;  5CR0 A;  2XC9 A;  4E80 A;  3CW2 C;  3L3F X;  1U9L A;  2ZIX B;  4OO1 J;  3ER9 B;  2KJ5 A;  3M6K A;  2IHO A;  4M6W B;  5ALU A;  2C2D A;  3TAQ A;  4X0B A;  4OD0 A;  2HHW A;  2MUT B;  4BWJ A;  3C2M A;  4RPY A;  5AHX A;  1QQ7 A;  2BR0 A;  4HX0 A;  1XSL A;  1TFW A;  1COK A;  4RQ3 A;  3ALR A;  3WFS C;  4KLG A;  4DSI A;  4XUS A;  1S0O A;  1X42 A;  4B9U A;  3CRX A;  1L7M A;  8ICE A;  2JHD A;  2JV3 A;  4F4W A;  8ICU A;  5KG4 A;  4MEY A;  8ICL A;  3L9D A;  2RHF A;  1NJX A;  3RJG A;  3K7D A;  2ZIV A;  2F8L A;  4O5E A;  3SV4 A;  2H3F A;  1ZQ1 C;  1DXS A;  9ICQ A;  3N28 A;  1SKS A;  4U6P A;  1ZQY A;  3LVW A;  4BGD A;  4CE6 A;  2R18 A;  7ICH A;  4XJE A;  1C20 A;  4TUR A;  4UQG A;  4R8U B;  2K89 A;  4EX7 A;  3NVO A;  2ESE A;  3K4G A;  4QZE A;  2FLN A;  4ED0 A;  4TUS A;  1RQL A;  3VCB A;  5H2F U;  3F2C A;  2NRX A;  5EWF A;  1V4A A;  5ALW A;  1NJY A;  2PMZ F;  3TI0 A;  4UBB A;  2H3I A;  2NRV A;  2F1J A;  5L1K A;  1UPH A;  3ISD A;  2ZH3 A;  1JN3 A;  1X2I A;  1D8L A;  5DDY A;  4Y2P A;  2E8P A;  2KIW A;  1WCL A;  4JV0 A;  3OPX A;  5EE9 A;  4RQ8 A;  3SAG A;  8ICB A;  3H0R B;  2MA1 A;  4ECX A;  2OEH A;  2BCQ A;  4EYI B;  4O0I A;  2BCS A;  4DSK A;  1A77 A;  3NYB A;  2K8B B;  4X4V A;  2H5X A;  3GZF A;  5KFH A;  2YB4 A;  3T5L A;  3AUO A;  2D3D A;  4O3S A;  4OAG A;  4K98 A;  5JTI A;  1V97 A;  1IV8 A;  1SV4 A;  3OVB A;  3M8S A;  4JMU A;  3HRD D;  3RTV A;  4KLM A;  2BBH A;  3C2K A;  3SR6 A;  1ZQW A;  1FEZ A;  5GTI U;  2PXI A;  1DRG A;  2PFN A;  2OH2 A;  3OWG A;  2V4R A;  3WK4 A;  2XGQ A;  9ICU A;  1SV0 C;  2G06 A;  2JH1 A;  3WFQ E;  4LZD A;  1N5W A;  4JV2 A;  1DK3 A;  2Y1J A;  5KFP A;  4QZ9 A;  3GQC A;  4LEV A;  4KN7 A;  3FDS A;  5DGB A;  2MSN A;  4M9N A;  1RM6 C;  5CFS A;  4F4X A;  8ICO A;  5KFQ A;  4ECV A;  4TUP A;  2B51 A;  5G5H A;  1IXR A;  1PX5 A;  3BQ7 A;  4Y2S A;  3RF9 A;  2NO5 A;  5CFU A;  1KLN A;  2WF5 A;  3WFR E;  3F5A A;  2Y0S F;  4PJ0 U;  4P4P A;  1U4B A;  4BUG A;  4QZ8 A;  3LDA A;  4QW8 A;  1ZQX A;  1ED1 A;  4YP3 A;  4I27 A;  2FLL A;  3AQF A;  3WFP A;  1ECW A;  2ZH1 A;  1FIQ A;  4HYK A;  5KFF A;  1ZQZ A;  4I28 A;  1F5S A;  2YMM A;  4KIT B;  4DLE A;  3NAS A;  1BPB A;  3MR2 A;  3DV9 A;  4KMO B;  4O3Q A;  4I2B A;  3OVS A;  4C4R A;  2AJQ A;  4E7X A;  2WF9 A;  8ICH A;  1XSP A;  2KHQ A;  1SKR A;  3JCF A;  3M1Y A;  4RQ7 A;  5ALS A;  4E0D A;  3PO4 A;  1WYG A;  4NKT A;  5HNK A;  1XS9 D;  1XO1 A;  3Q8L A;  1X9W A;  5HRL A;  5ALF A;  3NVZ A;  1SL0 A;  4F5P A;  2KVS A;  3PW5 A;  3ZDD A;  3PSP A;  5KG1 A;  1ZJM A;  5KT7 A;  2FPM A;  1TK0 A;  3BQT A;  2W9M A;  5GTH U;  1NZP A;  4ICA A;  1PK1 B;  4GC7 A;  2W8L A;  3BZK A;  5ALI A;  2ID1 A;  1SXD A;  1RDF A;  1T7P A;  3T5H A;  2RLT A;  4IQT A;  2FMS A;  4IR1 A;  2HDO A;  4AYB F;  1V38 A;  1TVA A;  2M2T A;  4OJ5 A;  1QSY A;  2KG5 A;  1OUQ A;  4WC0 A;  4OCZ A;  4F93 B;  4KLE A;  4CNQ A;  2KK0 A;  1HIW A;  2ZXH A;  1KNY A;  4J9L A;  4DQQ A;  5J0R A;  4XQ8 A;  3HT3 A;  5DQH A;  3KBB A;  1Q8K A;  4EEB A;  1BVS A;  3L5K A;  5BOM A;  3KFU F;  5AIB A;  4JWN A;  4CF4 A;  2KN7 A;  2J6S A;  5ALR A;  3NKU A;  2A1J A;  3ONN A;  4EBD A;  1GO3 F;  1MIY A;  4GXK A;  1VJ5 A;  4MF2 A;  3TQ1 A;  4Z6C A;  1S9F A;  1URJ A;  2G0A A;  4P0Q A;  1A0P A;  2YB1 A;  2ZHB A;  4CCH A;  3MDC A;  3JPT A;  2DR8 A;  5IIO A;  2KFZ A;  2WAQ C;  2F1H A;  5CA7 A;  3RH4 A;  5ALO A;  3NVY A;  4UAR A;  2GOL A;  1J2M A;  5DQI A;  4RUC A;  1S10 A;  2KOB A;  3V6H A;  4B9L A;  2BDU A;  2KVC A;  9ICE A;  2I5H A;  1UHU A;  4C8O A;  4UB2 A;  4M9G A;  1Q78 A;  4QWD A;  5KFK A;  4K8V A;  1S8O A;  2J6U A;  5KFW A;  2IMW P;  2LMR A;  4QZA A;  2NYV A;  4AP9 A;  1KRP A;  2XID A;  1JI7 A;  5KTQ A;  2DR9 A;  4GC6 A;  3B0X A;  2HOQ A;  1NNL A;  4MHV A;  1ZQT A;  3AU2 A;  3AU6 A;  1MIV A;  5DB9 A;  7ICE A;  3M9O B;  4WQL A;  4MFC A;  3QUB A;  5KFD A;  3HP6 A;  3UMB A;  2JEI A;  2W7P A;  4KLU A;  4KLQ A;  4B6J A;  1ZQA A;  4AT9 B;  2F77 X;  1CRX A;  3CK6 A;  2R8J A;  4BX9 C;  4I2H A;  4UB4 A;  2BCV A;  9ICH A;  4QWE A;  2B21 A;  1SV0 A;  2HN1 A;  3H8W A;  3PML A;  2AH5 A;  2EZY A;  5D62 A;  1IIP A;  5EWG A;  4OJP A;  4GXI A;  4FBT A;  1JXE A;  3Q8R B;  7ICI A;  3V7L A;  4DSL A;  1FFV A;  5IIL A;  4RT2 A;  9ICS A;  2RRD A;  2FPK A;  4RPX A;  2NRK A;  5ALV A;  5ALN A;  5FP0 A;  3PST A;  7ICV A;  5KFI A;  4EEK A;  3H4D A;  3QU9 A;  2F8K A;  4K99 A;  4J9P A;  2EH9 A;  4DS5 A;  1ZQD A;  2XY5 A;  5CWR A;  3WKA A;  4RWP A;  1BGX T;  3ZD8 A;  4JLX A;  3UXN A;  3HPO A;  4I2F A;  5ALD A;  1ZRM A;  2WF8 A;  2W03 A;  1KKX A;  2HSZ A;  4GFJ A;  5KNI A;  3HIL A;  4PL1 A;  2G5I B;  5ALL A;  1MC8 A;  4C0Z A;  4J9K A;  4KLF A;  1ZD2 P;  2ZH8 A;  5C5J A;  5D46 A;  5KG3 A;  3GIL A;  2Q0Z X;  9ICW A;  3UMC A;  5AK5 A;  1IM4 A;  5DGA A;  3OGU A;  2AU0 A;  2HVI A;  5AK3 A;  4PGY A;  1ZQC A;  4PZN A;  3I28 A;  9ICG A;  2ZH5 A;  2E8O A;  5KFX A;  4C8N A;  4UD4 A;  5TZV A;  1S0N A;  3C28 A;  2Z7J A;  1YT3 A;  4Y2V A;  3KHL A;  3RJK A;  2O5A A;  3BS7 A;  2GLE A;  1ZQN A;  4O9M A;  3HW8 A;  1VLB A;  2NO4 A;  2JZB B;  4EX6 A;  3PX0 A;  4B9S A;  5AKE A;  5KL8 B;  3JPQ A;  4NLB A;  1PK3 A;  5ALK A;  3LWL A;  2ZH9 A;  2I6X A;  4PGQ A;  1BNP A;  5K4L A;  5EOZ A;  3Q8P B;  4P0P A;  2WAQ F;  2LKY A;  4K97 A;  2DRB A;  5AK6 A;  8ICN A;  5HR9 A;  4X4R A;  1KFD A;  1UA1 A;  1TV9 A;  1Z4N A;  2ZTC A;  5J0W A;  1N56 A;  5KFJ A;  2IBK A;  2LM4 A;  2PFO A;  2ZIW A;  4DL5 A;  4IC9 A;  5HHI A;  1WWU A;  4JLZ A;  3BDP A;  3ETR A;  3KTQ A;  1WOT A;  4NXU A;  1X66 A;  4N7R A;  2PMZ C;  1DGJ A;  7ICM A;  4WC2 A;  3QXG A;  2MRL A;  3TAC B;  1ZQV A;  2E5S A;  2EAN A;  7ICJ A;  2W9A A;  4C8M A;  1OXJ A;  2A19 A;  3JPR A;  1XO0 A;  1RXV A;  2P6U A;  4YXM A;  4QZC A;  4F8R A;  4LJX A;  2HW3 A;  1UQV A;  5J2D A;  7ICL A;  2HI0 A;  4ZH4 A;  4WC7 A;  3UPS A;  3PO5 A;  4C4T A;  1ZQQ A;  3JPO A;  2UVW A;  2JGA A;  3J81 j;  2B6G A;  5DDM A;  5G5G A;  2YMP A;  5J0S A;  4IRD A;  9ICI A;  5KFR A;  4DOC A;  4FHX A;  1K1S A;  4DOA A;  3RR8 A;  5F9N A;  5KT2 A;  4KLJ A;  3C21 A;  1L3S A;  8ICG A;  3T5K A;  2E1F A;  3PW4 A;  2ASL A;  4G9B A;  2DF4 B;  3D2N A;  3RBD A;  1MQ3 A;  3B0Y A;  3OUY A;  3A0B U;  2KNJ A;  5L1M A;  4BWM A;  4NLK A;  4O3M A;  3ERC C;  4YR2 A;  2GA9 D;  4KLL A;  5CP2 A;  3RH5 A;  2KSO A;  2PFP A;  5KFU A;  3VC8 A;  4J9M A;  1N63 A;  3IP4 B;  2W04 A;  4M2Y A;  5HRH A;  2DGZ A;  3RB4 A;  1N2X A;  3QZ7 A;  1NKC A;  2O6K A;  4C8L A;  3K75 D;  2Y0S C;  4B9N A;  2ES6 A;  2EZZ A;  5CJ7 A;  3ISB A;  3SV3 A;  4MFA A;  3SYZ A;  2ZUC A;  5TIS U;  5HR6 A;  9ICO A;  4DOB A;  1IG6 A;  4X4Q A;  5AKI A;  9ICT A;  2YTU A;  3C29 A;  1R89 A;  3WK8 A;  2ZUD A;  1BPZ A;  1ZYQ A;  4KX3 A;  2KMD A;  3CNH A;  1S97 A;  4UAT A;  4F92 B;  2HCF A;  1XNS A;  2FMQ A;  2Q66 A;  1ZQJ A;  5KAI U;  1DK2 A;  8ICK A;  2FJ6 A;  4AT7 A;  4IQU A;  3R9K A;  4OJL A;  4DLG A;  2ZHA A;  4CF5 A;  4YCX A;  2W8K A;  5J2I A;  4YMO A;  2VAN A;  4KB6 A;  2BCR A;  1KFS A;  1L6N A;  4Z6E A;  3BQ2 A;  2DVI A;  5AM3 A;  3EWA A;  2E3T A;  4M04 A;  4QIW F;  1B22 A;  4LEZ A;  3N97 B;  2W9C A;  4K4I A;  4ED8 A;  4KTQ A;  4OJ6 A;  4QZH A;  2R8I A;  3F2D A;  4K9B A;  2V4Q A;  3OHB A;  4OAI Z;  1RYR A;  4Z6F A;  2FCL A;  1NJZ A;  5KFA A;  2P66 A;  4YD1 A;  4PHD A;  5KT6 A;  4IL6 U;  2GO7 A;  1ZQS A;  4AYB C;  4F4Y A;  3PVX A;  1TK5 A;  9ICM A;  1KBU A;  5J2E A;  4DL7 A;  8ICP A;  2DBY A;  4DFM A;  1JAL A;  4DSE A;  3PX6 A;  9ICJ A;  8ICY A;  3MCR A;  5KT3 A;  4DL2 A;  2IUB A;  2K8A A;  5J0Q A;  3WU2 U;  1L7P A;  3LVV A;  2ZJ5 A;  5KG7 A;  4ECR A;  3QU5 A;  3V6J A;  4I29 A;  2FI1 A;  3KHR A;  5DED A;  4RWN A;  2FE9 A;  2ZIU B;  2KFN A;  4I2C A;  4MFF A;  1NZB A;  4C7Z A;  5A0L A;  3MFH A;  4JB3 A;  4FZM A;  2OHF A;  4XRH A;  5J2C A;  4M9L A;  3JPN A;  1ZQP A;  9ICN A;  2FMP A;  4RNM A;  2BKE A;  1L3T A;  3RRG A;  2M0N A;  5KFY A;  5CHG A;  3WKC A;  4TUQ A;  4BXO B;  1KQQ A;  4UB3 A;  4LT6 A;  4RQ4 A;  4FHV A;  1MSW D;  1TK8 A;  4MEX A;  1XWL A;  2I1Q A;  3BS5 A;  2QB0 B;  2P35 A;  3H0L B;  4EEN A;  4ELT A;  1D9F A;  1MA7 A;  4U7C A;  1V9P A;  2XY7 A;  4M47 A;  3GIJ A;  4DSJ A;  4X4N A;  5B5E U;  5J0Y A;  1F44 A;  4F5N A;  4EBJ A;  1TFY A;  1MN8 A;  3QUQ A;  4NLN A;  3CYM A;  5KFB A;  3ED5 A;  2MAX A;  4O3R A;  5CRX A;  3GDX A;  1ARO P;  3M9M B;  3T3F A;  1PVR A;  2HHQ A;  3SAF A;  4Q44 A;  1JRO A;  4EP7 A;  2LM1 A;  4C80 A;  4KLI A;  5J0T A;  3AEV A;  7ICN A;  4NXZ A;  4O3N A;  1KFT A;  2JEG A;  4BJQ A;  3QZ8 A;  4JWM A;  2HMX A;  2WFA A;  3FAH A;  4PH5 A;  5B3P A;  1UEU A;  2W9B B;  4YD2 A;  1U45 A;  5ALH A;  5AKH A;  4O5K A;  3UMG A;  4FE3 A;  4OAH A;  3RFA A;  2BZF A;  3NUQ A;  5F3X B;  7ICU A;  2M2V A;  1QQ5 A;  5DKW A;  2OXO A;  5KFG A;  4O69 A;  2BDP A;  1X40 A;  2PI4 A;  4DFD A;  4C7Y A;  4PHA A;  1A6S A;  1U49 A;  1H38 A;  4Y2U A;  4Z6D A;  5L9X A;  3JPS A;  1B43 A;  3PHZ A;  4EBK A;  4QWB A;  3ZDE A;  1CUK A;  3RJE A;  1LB2 B;  2RDI A;  5AKX A;  3EPI A;  5DBB A;  3ZDB A;  4KLT A;  3AM9 A;  4ACO A;  1ZQU A;  2HHX A;  1NJW A;  3SMV A;  2IHM A;  2UVR A;  3ICX A;  3WKB A;  2IA6 A;  5III A;  2HHU A;  4JV1 A;  4AT8 B;  2WB1 F;  3PSI A;  2HHT A;  1D9D A;  3IG5 A;  2KIV A;  5KFT A;  4DCC A;  3PSF A;  2G07 A;  2N1R A;  4UAS A;  3ER8 C;  1XU4 A;  3DDH A;  4WQK A;  5IIN A;  1JXL A;  2H3V A;  2KHV A;  5J8Y C;  2W43 A;  4E8F A;  2KZM A;  3RAX A;  3WKD A;  3EPG A;  1NK8 A;  1BPY A;  2C22 A;  8ICI A;  5HR7 A;  1R8B A;  1LKY B;  3TKA A;  2BGW A;  2H3Q A;  3PY8 A;  1Z00 B;  3AMZ A;  4PGX A;  4EYH B;  3B9J A;  2V9W A;  2KKV A;  4NM2 A;  2HBK A;  3PW7 A;  1PZN A;  4YR0 A;  4ATB A;  2QAR B;  4FS2 A;  1QSL A;  5DEC A;  1UT8 A;  2NRZ A;  3D2Q A;  4DSF A;  2E8N A;  3KKA A;  4ED2 A;  4DF8 A;  2ZIX A;  3MGH A;  5HML A;  5DB8 A;  4M6W A;  2G09 A;  2BQ3 A;  4YFK A;  3SQI A;  2JEF A;  4LZG A;  2MUT A;  1HJP A;  3MR3 A;  3MFI A;  4M0A A;  1RG6 A;  7ICG A;  5DG7 A;  2F44 A;  4DQS A;  1ZQI A;  4C8K A;  2FPL A;  1TE2 A;  3QEA Z;  9ICX A;  1UT5 A;  3E2E A;  2AXT U;  1M6Y A;  3NTU A;  2OM6 A;  1X6I A;  2Y1I A;  2JRZ A;  4QZD A;  7ICT A;  2EAO A;  1KN5 A;  2VA8 A;  3HJ4 A;  3RB6 A;  3H40 A;  1SWV A;  2ALZ A;  1D8B A;  5KFZ A;  5AI6 A;  3K1R B;  3ORY A;  4RU9 A;  4P4M A;  2XCA A;  4F71 A;  1PVP A;  4QZI A;  1HEK A;  2E8M A;  1OW5 A;  1RYS A;  4NL9 C;  1ZQM A;  4EZ6 A;  2WHE A;  8ICS A;  2F76 X;  4WC5 A;  1EXN A;  1VJ7 A;  3AQK A;  2K4H A;  1NKE A;  3S6J A;  1S77 D;  4J9Q A;  3QNM A;  5ALG A;  3SEN A;  4P2H A;  4FBU A;  3OSN A;  4M9J A;  5AM5 A;  1T94 A;  4X4S A;  3H8J A;  4R8U A;  2LHT A;  5J2F A;  4FO6 A;  3D2S A;  1DOQ A;  2CPR A;  2R8K A;  2E1E A;  1Q3V A;  4QZG A;  5HMM A;  1P7D A;  2LPE A;  2R8H A;  4YR3 A;  1JUD A;  1J2N A;  4CDG A;  3MGV A;  4Y2J A;  2LI6 A;  1Z19 A;  4PPX A;  5IIJ A;  1C7Y A;  1Q79 A;  4WC1 A;  4X0A A;  5DG9 A;  3D6J A;  3AQE A;  4LEY A;  4WC6 A;  1X6J A;  3PW0 A;  2NRT A;  2ZIV B;  1XC9 A;  2KD1 A;  2AGQ A;  2DFL A;  2YQE A;  1S0M A;  5DG8 A;  5DB6 A;  2ZXI A;  1WG8 A;  2KZ3 A;  3RRH A;  3SZ2 A;  8ICR A;  5HRB A; 
#chains in the Genus database with same CATH homology
 5DDM A;  1D8L A;  5DDY A;  3T5J A;  5J0S A;  4IRD A;  9ICI A;  5KFR A;  1Z3E B;  5HRG A;  4DOC A;  1WCL A;  1ZQE A;  4FHX A;  1OU5 A;  1K1S A;  4DOA A;  4JV0 A;  2M2W A;  3RR8 A;  5F9N A;  4RQ8 A;  3RJJ A;  1TAQ A;  8ICB A;  5KT2 A;  2AGP A;  4KLJ A;  2C2E A;  3C21 A;  1KEJ A;  3TFR A;  1L3S A;  4I2D A;  5KG5 A;  4ECX A;  1S76 D;  3T5K A;  3PW4 A;  8ICG A;  5KT4 A;  8ICC A;  2ASL A;  1JIH A;  2BCQ A;  3G6X A;  4EYI B;  3RBD A;  1MQ3 A;  2HVH A;  3B0Y A;  4O0I A;  2BCS A;  4DSK A;  3OUY A;  1NK7 A;  1A77 A;  3PMN A;  9ICV A;  3NYB A;  3LK9 A;  4BWM A;  4NLK A;  4NLZ A;  4X4V A;  2H5X A;  2DRA A;  1X2I A;  8ICA A;  1TAU A;  3ETL A;  5KFH A;  4YR2 A;  4KLL A;  5CP2 A;  3T5L A;  4R66 A;  3AUO A;  3RH5 A;  4O3S A;  2PFP A;  4QZB A;  5KFU A;  4GLX A;  4IRC A;  3OVB A;  4YXJ A;  4J9M A;  2BCU A;  2DR7 A;  2ZJ8 A;  4BDP A;  4M2Y A;  5HRH A;  3M8S A;  3RB4 A;  3QZ7 A;  3LQC B;  3OUY B;  2FLP A;  1NKC A;  9ICC A;  3RTV A;  4C8L A;  1DGS A;  3K75 D;  4XA5 A;  4Q45 A;  9ICR A;  5HRK A;  4KLM A;  1X9S A;  4B9N A;  3C2K A;  5HRF A;  1ZQW A;  5CJ7 A;  2PXI A;  3ISB A;  3C18 A;  5DBC A;  4F5Q A;  3SV3 A;  4MFA A;  4JK1 A;  3SYZ A;  2PFN A;  5JUM A;  2ZUC A;  9ICO A;  2ZH6 A;  4DO9 A;  4DOB A;  5KFE A;  2V4R A;  4X4Q A;  2XGQ A;  4DQP A;  9ICU A;  9ICT A;  3WFQ E;  4LZD A;  1JMS A;  4JV2 A;  1R89 A;  2Y1J A;  1DK3 A;  2ZUD A;  5KFP A;  1BPZ A;  4QZ9 A;  3NGD A;  3GQC A;  4KN7 A;  3FDS A;  5DGB A;  1ZYQ A;  5HRI A;  4F4K A;  3RJF A;  3AQN A;  4M9N A;  2GWS A;  2NRW A;  4QZF A;  4F4X A;  8ICO A;  1S97 A;  3C66 A;  3GII A;  5DB7 A;  5KFQ A;  5D49 A;  4F92 B;  4ECV A;  4TUP A;  1IXR A;  1PX5 A;  5IIK A;  2FMQ A;  1ZQH A;  1ZQJ A;  3M8R A;  2Q66 A;  3H37 A;  3OJS A;  2ASD A;  1KLN A;  1DK2 A;  8ICK A;  2DPI A;  4AT7 A;  3WFR E;  4IQU A;  1ZET A;  4P4P A;  3G6V A;  1ZQO A;  4RWN A;  4DLG A;  2ZHA A;  3Q8K A;  2AQ4 A;  1WCN A;  1U4B A;  4YCX A;  4QZ8 A;  4UB1 A;  4FS1 A;  4ELV A;  3LDA A;  4QW8 A;  3MR5 A;  2W8K A;  5J2I A;  3PX4 A;  4YMO A;  2VAN A;  3H38 A;  2BCR A;  1KFS A;  1ZQX A;  4YP3 A;  4ECT A;  4I27 A;  2FLL A;  4DQI A;  3WFP A;  4R65 A;  4Z6E A;  3BQ2 A;  2F1I A;  2ZH1 A;  2DVI A;  3RJI A;  4HYK A;  1T4G A;  4UBC A;  8ICF A;  1A76 A;  5KFF A;  1ZQZ A;  4I28 A;  1HUZ A;  3EWA A;  2ATL A;  1NK0 A;  1S0V A;  1R8A A;  4AT7 B;  4M04 A;  3BJY A;  4KIT B;  1QSS A;  5HHH A;  1B22 A;  7ICQ A;  2XO7 A;  4I2I A;  2W9C A;  4DLE A;  5KG0 A;  3N97 B;  4K4I A;  2M2U A;  1BPB A;  4EBC A;  3MR2 A;  4ED8 A;  4KTQ A;  5D4B A;  4O3Q A;  4QZH A;  2R8I A;  9ICB A;  4G3I A;  4I2B A;  2V4Q A;  3HX0 A;  3OVS A;  2AJQ A;  3OHB A;  2ZJA A;  4E7X A;  1RYR A;  4Z6F A;  2P6R A;  8ICH A;  1XSP A;  2KTQ A;  1NJZ A;  3EW9 A;  5KFA A;  3QEB Z;  1SKR A;  2P66 A;  2C28 A;  3H8S A;  4YD1 A;  4PHD A;  4RQ7 A;  5KT6 A;  4E0D A;  3PO4 A;  3V6K A;  1ZQS A;  1ZQB A;  4F4Y A;  3PVX A;  3UQ2 A;  1TK5 A;  5HNK A;  3RB0 A;  1XO1 A;  1XS9 D;  2ISP A;  3Q8L A;  4NKT A;  4RZR A;  2W9C B;  4QWC A;  1X9W A;  9ICM A;  4O3O A;  1RPL A;  1UA0 A;  5J2E A;  5HRL A;  4DL7 A;  8ICP A;  4ECZ A;  4DFM A;  2KZZ A;  2BPG A;  4DQR A;  4DSE A;  2BHN A;  4F5P A;  3PX6 A;  1SL0 A;  4WBY A;  3PW5 A;  3UPQ A;  3ZDD A;  8ICY A;  4I2A A;  9ICJ A;  5KG1 A;  1JX4 A;  2XCP A;  3EZ5 A;  3OV7 A;  4YG2 A;  5KT3 A;  1ZJM A;  4J9N A;  5KT7 A;  4DL2 A;  1TFR A;  2FPM A;  5KFM A;  5J0Q A;  4RNN A;  5J2H A;  1TK0 A;  4NLG A;  3BQT A;  2ZJ5 A;  3GIK A;  2W9M A;  5KG7 A;  1HUO A;  2IHN A;  4ECR A;  3PW2 A;  1NZP A;  4GC7 A;  4S3N A;  3V6J A;  4RQ5 A;  2W8L A;  2UVV A;  2ID1 A;  4I29 A;  8ICM A;  1KSP A;  2KP7 A;  3KHR A;  4F50 A;  4PHP A;  3T5H A;  1T7P A;  4IQT A;  2FMS A;  5DED A;  4IR1 A;  3SI8 A;  4BXO A;  2KFN A;  5HRD A;  4I2C A;  4MFF A;  3GV8 B;  3MR6 A;  7ICS A;  4F5O A;  2VA2 A;  4DS4 A;  4F3O A;  1TVA A;  1KTQ A;  3MFH A;  4DWI A;  3Q8Q B;  2BQU A;  2I9G A;  4DL6 A;  2M2T A;  1QSY A;  2UVU A;  4RWO A;  1NOM A;  4FH3 A;  8ICR A;  4WC0 A;  4XRH A;  5J2C A;  2BQR A;  4F93 B;  3QE9 Y;  4KLE A;  4M9L A;  3JPN A;  4KLS A;  1ZQP A;  9ICN A;  4J9L A;  1KNY A;  2FMP A;  5J2J A;  4RNM A;  4DQQ A;  3Q8M A;  2BKE A;  1L3T A;  5J0R A;  4XQ8 A;  3RRG A;  3IM1 A;  3HT3 A;  3TFS A;  1K1Q A;  4PHE A;  5DQH A;  1BPE A;  5KFY A;  3THV A;  2VA3 A;  3TAR A;  5CHG A;  5KFC A;  4ECS A;  4TUQ A;  1BVS A;  4BXO B;  1L5U A;  4K4H A;  5BOM A;  4UB3 A;  3PNC A;  4JWN A;  4DFP A;  4IQV A;  2KN7 A;  2J6S A;  4LT6 A;  2O1P A;  4RQ4 A;  3BQ1 A;  2A1J A;  3BQ0 A;  1MSW D;  4FHV A;  4ECY A;  1TK8 A;  1F5A A;  1U48 A;  2C2R A;  4EBD A;  4MEX A;  1XWL A;  4F2S A;  3OVA A;  2I1Q A;  1MIY A;  3LWM A;  5J2B A;  4GXK A;  4X5V A;  1BNO A;  4ELT A;  4J9O A;  3GV7 B;  1D9F A;  1V9P A;  3V7K A;  2XY7 A;  4MF2 A;  3Q8S B;  3TQ1 A;  4M47 A;  4Z6C A;  4UAW A;  3GIJ A;  1S9F A;  4DSJ A;  4IRK A;  4X4N A;  1NKB A;  2ZTE A;  8ICX A;  5HC9 A;  5J0Y A;  3H3A A;  4F5N A;  2ZHB A;  4CCH A;  3TAP A;  4EBJ A;  1TFY A;  3MDC A;  4RQ0 A;  3JPT A;  4LZG A;  5IIO A;  4NLN A;  4RWQ A;  1FA0 A;  2DR8 A;  3ZD9 A;  2KFZ A;  5KFB A;  5L1J A;  2A1J B;  2M9N A;  2MAX A;  2F1H A;  5CA7 A;  3RH4 A;  4O3R A;  3MGI A;  3GDX A;  9ICA A;  2W9B A;  1ARO P;  5DQI A;  4RUC A;  3M9M B;  3T3F A;  4DFJ A;  2ZTD A;  2HHQ A;  2RFF A;  1S10 A;  1SKW A;  3V6H A;  3OHA A;  5KG6 A;  4Q44 A;  8ICZ A;  3RH6 A;  4FH5 A;  1JQR A;  4EP7 A;  4B9L A;  4KLI A;  3RAQ A;  5J0T A;  1NK4 A;  9ICE A;  7ICN A;  4NXZ A;  4O3N A;  4C8O A;  4UB2 A;  4M9G A;  1KFT A;  1L3U A;  1Q78 A;  4NY8 A;  5J0O A;  4QWD A;  5KFK A;  4Q8F A;  3RJH A;  2JEG A;  1XSN A;  4FHP A;  3QZ8 A;  2J6U A;  5KFW A;  4ED1 A;  2IMW P;  3H7I A;  3V72 A;  4JWM A;  3AQL A;  4NKU A;  4PH5 A;  4QZA A;  4Q43 A;  1UEU A;  2W9B B;  4YD2 A;  3H4B A;  1U45 A;  8ICT A;  5J2G A;  5DLF A;  4DL4 A;  1KRP A;  4AT9 A;  5KFN A;  4TQS A;  5J0U A;  1CEZ A;  4O5K A;  1UET A;  2OWO A;  5KTQ A;  5DQG A;  4KLD A;  2DR9 A;  4GC6 A;  4YQW A;  3B0X A;  7ICU A;  2HHV A;  2M2V A;  5DKW A;  3AU2 A;  1ZQT A;  5KT5 A;  5L1L A;  5KFG A;  2XGP A;  4RT3 A;  2BDP A;  2PI4 A;  3AU6 A;  9ICF A;  4PHA A;  5KFS A;  5DB9 A;  5DBA A;  1MIV A;  1U49 A;  7ICE A;  4RUA A;  3M9O B;  1H38 A;  4MFC A;  4Z6D A;  3MDA A;  5L9X A;  3JPS A;  4J9S A;  4M9H A;  5KFD A;  1B43 A;  4ED7 A;  4AT8 A;  4KLH A;  1KDH A;  1D8Y A;  7ICP A;  2BE3 A;  3HP6 A;  4EBK A;  4QWB A;  5HRE A;  3ZDE A;  3JYY A;  4J9R A;  2JEI A;  4LVS A;  1CUK A;  4KLO A;  4KN4 A;  3RJE A;  4KLQ A;  4KLU A;  1LB2 B;  1ZQA A;  4WCW A;  4AT9 B;  1T3N A;  2RDI A;  3EYZ A;  2BPF A;  3ZDA A;  1JAJ A;  2R8J A;  3EPI A;  3GV5 B;  5DBB A;  3ZDB A;  2ZH7 A;  3UQ0 A;  4I2H A;  3FYH A;  4KLT A;  3V7J A;  3G6Y A;  4UB4 A;  4DEZ A;  2BCV A;  1ZQU A;  1ZJN A;  4QWE A;  4RPZ A;  5J0P A;  1NJW A;  2IHM A;  2HHX A;  9ICH A;  3ISC A;  1SL1 A;  4TQR A;  4UAZ A;  2UVR A;  2B21 A;  4FHW A;  1MQ2 A;  3H8W A;  4UB5 A;  3PML A;  2IA6 A;  5KFL A;  1SZP A;  4JUZ A;  2HHP A;  5III A;  2HHU A;  1NK9 A;  4JV1 A;  5J0X A;  4AT8 B;  4F5R A;  4RQ1 A;  1QTM A;  4B9M A;  1NK5 A;  5EWG A;  1D9D A;  2HHT A;  4EEY A;  5KFT A;  1UEV A;  3UXO A;  3KHH A;  4YMM A;  3RB3 A;  2ISO A;  7ICR A;  5J2A A;  4EZ9 A;  4IQW A;  4EBE A;  4X4P A;  5KFO A;  1Z00 A;  4I2G A;  1YLQ A;  1XU4 A;  4GXI A;  4FBT A;  4R64 A;  1VFG A;  1JXE A;  3Q8R B;  5IIN A;  1JXL A;  7ICI A;  1NO5 A;  3V7L A;  3OJU A;  4DSL A;  3C1Z A;  3JPP A;  1X9M A;  2KZM A;  4E8F A;  5IIL A;  4YVZ A;  3RAX A;  8ICJ A;  3OSP A;  4I2J A;  3PR4 A;  2R8G A;  4RT2 A;  9ICS A;  9ICK A;  4ECU A;  3EPG A;  1NK8 A;  2FPK A;  4RPX A;  1BPY A;  3C23 A;  2NRK A;  1COO A;  2C22 A;  4RQ6 A;  8ICI A;  4Q8E A;  5F9L A;  1ZQF A;  3UXP A;  2J6T A;  3C5G A;  3PR5 B;  1L3V A;  3PV8 A;  4DF4 A;  5HP4 A;  4ELU A;  5L1I A;  7ICV A;  5KFI A;  4ECQ A;  4GXJ A;  3H4D A;  4WC3 A;  2BGW A;  5KG2 A;  3PY8 A;  1Z00 B;  4PGX A;  4J9P A;  4DS5 A;  2HHS A;  4EYH B;  1LV5 A;  1ZQR A;  3AQM A;  9ICP A;  2V9W A;  5J2K A;  2XY5 A;  5CWR A;  1ZQD A;  4NM2 A;  4RWP A;  1BGX T;  3ZD8 A;  3PW7 A;  5BPC A;  1PZN A;  4YR0 A;  2RDJ A;  3UXN A;  2ZUB A;  2JEJ A;  4ATB A;  3HPO A;  2WTF A;  5IIM A;  4I2F A;  4FS2 A;  1ZQG A;  1QSL A;  5DEC A;  1UT8 A;  2NRZ A;  3GFK B;  4RNO A;  4XQ7 A;  4DSF A;  3C1Y A;  5EWE A;  1QLN A;  3C2L A;  4IG8 A;  2PBE A;  4X4T A;  4ED2 A;  4DF8 A;  2DPJ A;  1MC8 A;  4J9K A;  5DLG A;  3MGH A;  5HRB A;  5HML A;  4R63 A;  4KLF A;  5DB8 A;  5C5J A;  3MBY A;  4M6W A;  1TKD A;  2PFQ A;  5D46 A;  2ZH8 A;  5KG3 A;  2AQ0 A;  3GIL A;  2Q0Z X;  9ICW A;  3HJ1 A;  2ZH4 A;  4DL3 A;  1SL2 A;  4B9V A;  2BQ3 A;  2DR5 A;  4ATB B;  4DFK A;  4YFK A;  4QWA A;  1IM4 A;  2JEF A;  1BPD A;  4P4O A;  2MUT A;  3OGU A;  5DGA A;  2JZB A;  3MAB A;  1NK6 A;  2PI5 A;  4K4G A;  2AGO A;  5BOL A;  1HJP A;  7ICO A;  3MR3 A;  3TAN A;  2AU0 A;  7ICF A;  5KFV A;  5CR0 A;  4PGY A;  3MFI A;  1ZQC A;  4M0A A;  7ICG A;  4QW9 A;  5DG7 A;  4DQS A;  4C8K A;  1ZQI A;  2XC9 A;  9ICG A;  4WC4 A;  2ZH5 A;  4E80 A;  5KFX A;  1MIW A;  4C8N A;  4UD4 A;  5TZV A;  1S0N A;  1U9L A;  4FHY A;  2FPL A;  3QEA Z;  9ICX A;  1UT5 A;  4F4Z A;  3WFO A;  3KHL A;  3E2E A;  3RJK A;  2O5A A;  4M6W B;  2ZH3 A;  4I2E A;  8ICV A;  3NTU A;  2Y1I A;  2C2D A;  1ZQN A;  4O9M A;  3TAQ A;  3HW8 A;  4QZD A;  4UD5 A;  4X0B A;  8ICQ A;  2HHW A;  7ICT A;  2MUT B;  4BWJ A;  2JZB B;  4RQ2 A;  3C2M A;  3PX0 A;  4B9S A;  4RPY A;  2VA8 A;  3C5F A;  4B9T A;  3RB6 A;  3JPQ A;  3HJ4 A;  3H40 A;  4X4O A;  4M5D A;  2ALZ A;  3LWL A;  2ZH9 A;  5KFZ A;  2HVI A;  4O3P A;  2BR0 A;  4PGQ A;  3ORY A;  3KHG A;  4RU9 A;  4P4M A;  2XCA A;  1XSL A;  1BNP A;  1TFW A;  5EOZ A;  3H39 A;  3Q8P B;  3RBE A;  4RQ3 A;  4QZI A;  2DRB A;  4F2R A;  1ZQM A;  1RYS A;  8ICS A;  4EZ6 A;  4WC5 A;  1RXW A;  3HWT A;  2ASJ A;  8ICN A;  1EXN A;  4KLG A;  4KMU A;  5HR9 A;  1VJ7 A;  3AQK A;  4X4R A;  1KFD A;  1UA1 A;  4DSI A;  3WFS C;  4XUS A;  1TV9 A;  1NKE A;  1S0O A;  4B9U A;  1S77 D;  2ZTC A;  5J0W A;  4J9Q A;  4ECW A;  3RR7 A;  3ZDC A;  8ICE A;  9ICL A;  3HIY A;  4F4W A;  1N56 A;  5KFJ A;  3IHQ B;  2IBK A;  8ICU A;  2PFO A;  4P2H A;  4DL5 A;  5KG4 A;  4FBU A;  3OSN A;  5HHI A;  4IR9 A;  4MEY A;  4M9J A;  1Y88 A;  1ZQL A;  3BDP A;  8ICL A;  3L9D A;  4X4S A;  3KTQ A;  3H8J A;  4R8U A;  1WOT A;  5J2F A;  1NJX A;  3RJG A;  4FO6 A;  5F2V O;  1DOQ A;  4O5E A;  3SV4 A;  7ICM A;  2R8K A;  4NM1 A;  4WBZ A;  1N48 A;  4WC2 A;  4YN4 A;  1ZQV A;  4QZG A;  1BPX A;  5HMM A;  9ICQ A;  7ICJ A;  3JZ0 A;  2W9A A;  2R8H A;  1T8E A;  4YR3 A;  4C8M A;  1SKS A;  4X4U A;  1ZQY A;  3JPR A;  4BGD A;  1RXV A;  5CB1 A;  7ICH A;  2P6U A;  2ZH2 A;  4ED6 A;  3GIM A;  5J29 A;  4YXM A;  5IIJ A;  4QZC A;  1U47 A;  1C7Y A;  4PPX A;  1Q79 A;  4WC1 A;  4F8R A;  4TUR A;  4X0A A;  5DG9 A;  4F91 B;  1RZT A;  2HW3 A;  4UQG A;  5J2D A;  4MF8 A;  8ICW A;  4R8U B;  7ICL A;  4UAY A;  1XC9 A;  3PW0 A;  2NRT A;  4WC6 A;  2BPC A;  4ZH4 A;  3K4G A;  4QZE A;  3M9N B;  4ED3 A;  4WC7 A;  2AGQ A;  2FLN A;  2DFL A;  3UPS A;  4ED0 A;  4TUS A;  3PO5 A;  3N4M B;  2NRX A;  1S0M A;  5DG8 A;  5DB6 A;  5EWF A;  1V4A A;  1ZQQ A;  1R8C A;  4O5C A;  2XY6 A;  3JPO A;  1NJY A;  1ZQK A;  2UVW A;  3TI0 A;  4YMN A;  4UBB A;  2NRV A;  2KZ3 A;  2LYH A;  2F1J A;  3RRH A;  7ICK A;  1R8B A;  3SZ2 A;  5L1K A;  3ISD A;  1JN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...