5J0UA

Binary complex crystal structure of dna polymerase beta with g:g mismatch at the primer terminus
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
330
structure length
326
Chain Sequence
APQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of DNA Polymerase Mispaired DNA Termini Transitioning to Pre-catalytic Complexes Support an Induced-Fit Fidelity Mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 107
structure length 326
sequence length 330
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5j0uA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5j0uA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5j0uA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5j0uA03
5KFUA 3EPGA 4DF4A 1KLNA 1NK7A 3ZDCA 3SYZA 1KNYA 2NRKA 2ZH6A 4DOBA 1SL2A 3JPRA 4FO6A 3PO4A 2HHXA 2DRBA 2XO7A 3HPOA 4NLGA 2DPIA 5IINA 9ICJA 2O1PA 9ICPA 2IMWP 3AU2A 1Z3EB 2F1JA 1XC9A 2BQRA 4ELTA 5HHHA 5HRBA 3C2MA 4F4YA 3RB3A 3MR3A 1NK5A 1MSWD 4TUSA 1JQRA 2FPKA 5IIOA 5DDMA 5J2KA 4ECUA 1ZQAA 4DQIA 4RWOA 4EBJA 4QWEA 4HYKA 1MQ3A 9ICMA 7ICLA 4R64A 4J9KA 4ECYA 4IG8A 4DFPA 2BDPA 1D8LA 3PX6A 4RNOA 2F1HA 3MGIA 3T5KA 5KFFA 4KN4A 3C23A 4B9TA 3M9OB 4QZDA 1ZQMA 1KEJA 5J0UA 7ICEA 5DBAA 8ICIA 2XCPA 1NK6A 2ZH4A 5KG1A 2UVUA 4EBKA 3FYHA 1TVAA 7ICIA 1BPDA 4C8MA 4F92B 1K1SA 2LYHA 2Q0ZX 4LZDA 3N97B 4YR2A 4BXOB 4YN4A 4I28A 5HRDA 4AT8A 4O3QA 1S0OA 1QSSA 4O3NA 4YXJA 1NJXA 9ICNA 1K1QA 4J9PA 2AGOA 5DGBA 2HW3A 3OVBA 9ICVA 3V7KA 2BCQA 1B22A 2FPLA 3C21A 5KT6A 5DB6A 4DO9A 1T3NA 1N48A 2FMPA 1NJZA 3RAQA 4F8RA 2DRAA 3ZD8A 4KN7A 5KT7A 4YMOA 5KFOA 4IQVA 4PGYA 1H38A 2ZJ5A 1JMSA 2UVRA 4B9LA 4PPXA 3OUYB 2DPJA 1QLNA 5J0YA 4O0IA 3BJYA 2PFOA 4ECSA 3TI0A 1BPZA 4DL2A 5IIKA 4DFMA 4R8UB 5DBBA 2NRZA 4RQ0A 3V6JA 2UVWA 3H40A 1ZETA 2AQ4A 1F5AA 2KZ3A 5DQIA 2ASJA 1V4AA 3OV7A 3LQCB 1BPXA 4M0AA 4RQ8A 1KFTA 2AGQA 9ICTA 3PW5A 1UEVA 2A1JA 3HW8A 3JPTA 4XRHA 4QWAA 3GQCA 2JEFA 4F4ZA 4ECRA 4RQ2A 3PVXA 2OWOA 3JPSA 2A1JB 4YMMA 4J9OA 5DG8A 3PMNA 5KFYA 9ICBA 3G6XA 3M9MB 5D46A 4AT9B 3M8RA 2DVIA 2ZHAA 8ICEA 1UT8A 3H38A 4YVZA 4GC7A 1ZQHA 4Q8FA 2HHSA 1TAQA 2W9CB 1BPEA 3AQKA 5IIMA 2XY6A 4I29A 4KLJA 9ICWA 1NK4A 2KFZA 4Z6DA 5KFBA 8ICXA 4X4PA 3HX0A 5J2EA 2BCUA 3H8SA 4NXZA 3JPNA 3MR6A 3Q8MA 3B0XA 3JPQA 2XCAA 4J9MA 4FBTA 1L3VA 1DGSA 1ZQEA 4B9UA 4M47A 9ICEA 2H5XA 3AQMA 4K4HA 4C8LA 4FHVA 2VA3A 3ISDA 4R63A 2RDJA 3V72A 7ICNA 2P66A 4YQWA 4M9LA 2M2UA 3UPSA 1Y88A 3EYZA 4ED3A 4ED6A 3RR8A 3V7JA 5HR9A 4F5PA 3UXNA 4F5RA 4BXOA 2BKEA 5CP2A 3RH6A 4DS4A 8ICAA 4DSJA 4LZGA 2PBEA 1TK8A 4DOCA 1UT5A 1Q79A 1NK8A 3RTVA 7ICQA 5CHGA 3WFQE 1NJYA 4E7XA 4O3PA 3TFRA 4I2EA 1Z00A 5EWFA 2ZTEA 5KFMA 3AQLA 2P6UA 4UAZA 1JXEA 2FMSA 4RNMA 4YXMA 3Q8KA 2ZUCA 3M8SA 2ZH2A 4MF2A 1S0MA 4DL7A 5KG7A 2HVIA 4MEYA 7ICOA 4RT3A 3QZ8A 4C8KA 3GV5B 5J2GA 1SKSA 8ICWA 3ETLA 2J6UA 3AU6A 4QZGA 5KFDA 4FHPA 3C18A 1ZQWA 5J2DA 1JX4A 2R8GA 3PO5A 4UB4A 5KT2A 5C5JA 3BQ1A 4BGDA 3OSNA 5KFSA 1SZPA 1TK5A 4JV1A 4O3SA 1ZQCA 5J0OA 8ICZA 4M2YA 3OHBA 4DF8A 1MIWA 5KG0A 3K75D 3Q8LA 2DR7A 4KLIA 9ICAA 3TAPA 3C66A 1LB2B 3ORYA 4DQQA 1TFRA 2KZZA 2KZMA 4RZRA 1RYRA 3RJFA 3PX0A 2IA6A 4AT8B 3C5GA 3UXPA 1NK0A 2V9WA 4EZ9A 4KLLA 4E8FA 5J2IA 1COOA 2JEJA 1ZQUA 5J0XA 4O5CA 4ECWA 3LDAA 4RQ4A 4J9QA 4MFAA 3TARA 7ICFA 2HHWA 5KG6A 1ZQPA 5HHIA 7ICGA 4PHAA 2WTFA 3MABA 3ZDAA 4NLNA 2IHNA 4DSIA 3HJ1A 4XQ8A 5J2FA 3RB6A 9ICCA 3WFRE 4P2HA 2PFPA 5DG7A 2W9CA 4KLMA 3KHGA 3PW2A 3GIKA 2NRWA 1NKBA 1U45A 8ICVA 4DQRA 1MIYA 4B9MA 2M2VA 3PMLA 3MGHA 5J29A 2XGQA 1SL0A 3HP6A 1AROP 4ATBB 3Q8PB 3AUOA 4I2IA 3PW0A 7ICKA 4WC2A 4M9GA 4FH5A 4ZH4A 3C2KA 1DOQA 5DQGA 5KFKA 1B43A 5KFWA 5L9XA 2ZH8A 5J0PA 1SL1A 1BPBA 1XSNA 4DL5A 2FLLA 4NM2A 5DG9A 1ZQXA 1UEUA 3KHLA 4B9SA 1DK2A 4YR0A 1HJPA 3EWAA 5KT4A 5DBCA 7ICPA 4FHYA 4E80A 2ZH1A 4QZ8A 4DLEA 5DB8A 8ICQA 1XWLA 4WC3A 3HJ4A 4EBEA 1UA0A 4JV2A 3RB0A 2KTQA 2AQ0A 1Q78A 5DQHA 4QZIA 2I1QA 3PX4A 7ICSA 8ICMA 3MFIA 9ICOA 2BCVA 4KMUA 4Z6EA 3NYBA 4DFKA 1XS9D 1C7YA 1NOMA 4RWPA 4IQTA 8ICRA 5L1JA 4O9MA 4RQ1A 8ICSA 4P4OA 1PZNA 1T4GA 5J2BA 2KN7A 4F5NA 4UAWA 4EYHB 2C2DA 5J0RA 1NJWA 1YLQA 5J0TA 3MR5A 3LWMA 2FPMA 2XY7A 3GIJA 4WBYA 4UB5A 1ZQNA 3H4DA 2BPCA 4QWBA 1ZQTA 8ICGA 1BVSA 1ZYQA 3EZ5A 1R8AA 3OUYA 5KFJA 2ID1A 4F93B 2NRTA 4ELUA 4Q44A 4UB1A 4F50A 5HRIA 2BQ3A 1TV9A 4MEXA 4KLGA 4MFCA 4X0AA 1WCNA 5J0SA 2HHVA 1S9FA 1A77A 2BR0A 2PXIA 4TURA 4M5DA 3JZ0A 3BQTA 1RXWA 1SKWA 2M2WA 4K4IA 4QZFA 1VFGA 3PR4A 3BQ0A 1RYSA 1S97A 2XC9A 2ASDA 3MDCA 1L5UA 1S0VA 4RNNA 5HP4A 1ZQOA 4YD1A 4NLZA 4YFKA 3H37A 2DR8A 1R8CA 3C1ZA 4F5QA 1N56A 3KHHA 4UQGA 1FA0A 2NRXA 4XQ7A 3WFSC 5DDYA 4J9LA 4KTQA 4XA5A 2BQUA 1R89A 3FDSA 1ZJNA 3WFPA 4X5VA 3OVAA 1KTQA 2XY5A 4GC6A 3OVSA 2HHTA 4X4QA 4QWCA 5DLFA 5CA7A 1ZQFA 2R8HA 1ZQJA 1ZQBA 3BDPA 1WOTA 4UB3A 4C8OA 4Q45A 1QSYA 4M9JA 3H7IA 4EZ6A 7ICMA 4DSLA 3MFHA 3ZDBA 4M6WA 3MBYA 1JXLA 5D4BA 2C28A 2HHPA 1U9LA 2B21A 4QZEA 4TQRA 1RXVA 5HRGA 3L9DA 5DB9A 5KFPA 2JEGA 5KT5A 3T5JA 5J2AA 1UETA 3GV8B 1ZQVA 1R8BA 1WCLA 9ICXA 1ZQZA 1X2IA 4O5EA 4F4XA 3T5LA 3PV8A 4DL6A 3PY8A 1OU5A 2M9NA 4X0BA 4DEZA 4NY8A 1A76A 1MC8A 3C1YA 2XGPA 2BGWA 3RRHA 3RRGA 3EW9A 4I2BA 8ICJA 2ALZA 1BPYA 3Q8SB 3H8WA 3ZDDA 2MUTA 4DSKA 4O3RA 4AT9A 5DLGA 3UQ2A 4M04A 5DKWA 2FMQA 3RJJA 5D49A 9ICIA 3IM1A 4WC6A 2J6SA 2BHNA 4KLSA 4RT2A 4JK1A 4M9NA 1NZPA 2O5AA 4WC4A 4ATBA 5KFRA 1ZQDA 1ZQQA 2Q66A 8ICTA 4DSFA 4ECTA 4GXIA 1Z00B 4UAYA 2R8KA 1BGXT 5J2HA 5L1KA 1XSPA 3RJGA 4X4UA 4PHDA 4Q43A 3C5FA 1U4BA 1X9SA 4YD2A 1ZQYA 3G6VA 3QEAZ 1X9MA 4F2SA 1KRPA 2ZH5A 4KLUA 1TK0A 3GFKB 4I2FA 4Z6FA 3QE9Y 2HHUA 2ZHBA 4KLTA 4I2AA 4F4KA 3LWLA 3NTUA 4NLKA 4IRDA 7ICRA 4WC1A 4X4SA 3G6YA 3AQNA 4UD5A 2MAXA 4O5KA 2AU0A 3V6KA 2NRVA 3T5HA 3RB4A 4I2JA 5KFVA 1D8YA 2ISOA 4I2HA 5HMMA 2ZJ8A 4I2CA 4QZAA 2C22A 5KFNA 2PFNA 4E0DA 4KLHA 1TFYA 1NKCA 4QZBA 1MQ2A 2BCRA 4IRKA 1S10A 5HRHA 5F2VO 1U47A 4IR9A 3RAXA 4UBBA 2W8KA 4EYIB 3PW4A 4JWNA 3E2EA 3EPIA 4F5OA 3QZ7A 2I9GA 3H8JA 5KFAA 1CUKA 4PHPA 4DL3A 4C8NA 2J6TA 4BWMA 5J2JA 1VJ7A 1HUOA 3LK9A 3RJHA 3N4MB 1BNPA 1RPLA 4FBUA 3GDXA 4WC5A 4X4RA 1HUZA 2VA8A 4PH5A 3MR2A 3K4GA 4TUPA 2RDIA 4G3IA 4AT7A 1PX5A 1X9WA 8ICNA 4BWJA 4UB2A 4RU9A 4BDPA 4FHXA 4RWQA 4NM1A 4EBDA 5CWRA 3NGDA 3ISCA 1KFSA 1ZQIA 5KFHA 1NKEA 4KLOA 5KFQA 4O3OA 4PGQA 2W9BB 4DLGA 1JIHA 4EBCA 2UVVA 1TAUA 4LT6A 3WFOA 4F3OA 4I2GA 4NKTA 3MDAA 3UPQA 3T3FA 1TFWA 4X4VA 1S76D 5KG2A 4M9HA 2DR5A 1KDHA 3RJKA 1CEZA 8ICPA 2W9BA 1IM4A 5JUMA 1RZTA 1XO1A 1TKDA 4RPXA 5L1IA 1UA1A 5KG5A 2PI4A 8ICOA 1L3SA 2HHQA 1L3TA 5HREA 1IXRA 4DL4A 5KG3A 4KLEA 5EOZA 4R66A 4K4GA 2M2TA 4AT7B 4S3NA 2ZH9A 4PHEA 1QTMA 5J2CA 5IIIA 1ZQKA 4ECZA 5HMLA 3OJSA 5BPCA 3RJIA 1U49A 4YCXA 3RBEA 4YG2A 5KTQA 5CR0A 2ZTDA 5HRFA 3KHRA 2F1IA 4F4WA 3Q8RB 5EWEA 4P4PA 3OJUA 9ICGA 8ICHA 3GIIA 3RBDA 3UQ0A 4ECQA 4JV0A 5IIJA 4QW8A 4LVSA 5KFLA 1KFDA 4ECXA 4IRCA 5KFCA 5EWGA 5CB1A 4DWIA 5BOLA 4UD4A 4J9SA 8ICKA 4I2DA 3IHQB 4IQUA 4MF8A 4X4TA 4JUZA 2ASLA 4WC7A 2V4QA 2RFFA 2Y1JA 4EEYA 4QZCA 4M6WB 9ICUA 2V4RA 3JYYA 5DEDA 4UBCA 2HVHA 3H39A 4WCWA 5DB7A 4P4MA 3HWTA 3KTQA 9ICQA 1BNOA 3HT3A 4ECVA 2BE3A 3GV7B 3V7LA 5CJ7A 4R8UA 4RPZA 1QSLA 7ICTA 4WBZA 4RUCA 2KP7A 3GILA 5HNKA 2ZH3A 1XU4A 2ATLA 4JWMA 1V9PA 2ZJAA 4YMNA 4GXKA 4CCHA 4IR1A 4I27A 5TZVA 8ICYA 1D9DA 5DECA 4RPYA 1T8EA 4Q8EA 4QW9A 2BPGA 5J0QA 4Z6CA 1JN3A 5KFGA 5F9LA 4GXJA 4B9VA 4QWDA 4FH3A 3ZDEA 4KITB 4YP3A 4TUQA 5L1LA 4DSEA 4DFJA 4ELVA 4NKUA 3H4BA 3SZ2A 5KFIA 9ICKA 3V6HA 2P6RA 2MUTB 4RQ3A 3JPPA 4J9NA 1L3UA 5HRKA 4ED0A 4RWNA 4WC0A 3ISBA 9ICHA 1ZQGA 3JPOA 3UXOA 2JZBA 4F2RA 3RH5A 2PFQA 4ED7A 3PNCA 2W8LA 3PW7A 2VA2A 5HC9A 2ZUBA 2JZBB 3OSPA 4MFFA 3B0YA 4PGXA 5F9NA 2JEIA 3OGUA 4QZHA 7ICUA 4X4OA 2ZTCA 3HIYA 2PI5A 4QZ9A 4FS1A 5DGAA 2IHMA 8ICBA 3M9NB 1T7PA 4EP7A 9ICRA 3ZD9A 2DFLA 3SV3A 1ZJMA 7ICVA 8ICFA 1D9FA 1U48A 4FS2A 1EXNA 2VANA 4DS5A 1LV5A 3QEBZ 3RH4A 1DK3A 3PR5B 1S0NA 4DQPA 1NO5A 3H3AA 5HRLA 7ICHA 4TQSA 4KLFA 9ICSA 5KFEA 3TQ1A 1NK9A 2BCSA 2C2EA 4FHWA 4YR3A 2ISPA 5J0WA 3TANA 4RQ5A 2C2RA 4ED2A 7ICJA 1ZQRA 1SKRA 5BOMA 3OHAA 2FLPA 2ZH7A 3C2LA 1ZQLA 2GWSA 3RR7A 1KSPA 3RJEA 3Q8QB 4ED1A 3TFSA 2BPFA 4RQ7A 4R65A 5KT3A 4J9RA 2AJQA 1ZQSA 4F91B 3THVA 1S77D 4X4NA 8ICLA 2Y1IA 4B9NA 5KFXA 4ED8A 3SI8A 4DOAA 4RUAA 4KLDA 9ICFA 2W9MA 2W9AA 2FLNA 2R8IA 9ICLA 2AGPA 3BQ2A 3GIMA 3SV4A 4DQSA 1JAJA 2KFNA 5IILA 2DR9A 5KFZA 8ICCA 4KLQA 4RQ6A 4GLXA 1MIVA 2ZUDA 2IBKA 2R8JA 5KFTA 8ICUA 1XSLA 4XUSA 4IQWA 5KG4A 3TAQA
chains in the Genus database with same CATH superfamily
5KFUA 3EPGA 2WF8A 4DF4A 1NK7A 3ZDCA 5AI8A 2NRKA 2ZH6A 1SL2A 1WUDA 5H2FU 4NLGA 3H0RB 2IMWP 3AU2A 1Z3EB 2F1JA 2BQRA 4ELTA 1MSWD 5T14A 5DDMA 4ECUA 1ZQAA 1IIPA 2IHOA 4K9AA 4HYKA 4P0QB 1X40A 1PVQA 3TADA 4DFPA 3PX6A 2F1HA 2GAFD 2KKVA 5KFFA 3C23A 1ZD5A 4FZNA 4K96A 5AM1A 2ZH4A 1TVAA 4FE3A 5ALQA 4F92B 5E79U 4BXOB 2Q0ZX 5HRDA 4I28A 1YT3A 4NL9A 4J9PA 2AGOA 3KBBA 2HW3A 2BCQA 1L7PA 5KT6A 5GTIU 1NJZA 3RAQA 4NV0A 1N2XA 2W54A 3ER8C 5KT7A 4YMOA 5J0YA 2PFOA 1OXJA 1BPZA 4DL2A 2UVWA 3V6JA 2ODGA 3SD7A 1V4AA 2KZ3A 5F3XB 4RQ8A 1UEVA 3PW5A 5ALIA 4XRHA 4QWAA 4FZMA 2JEFA 1S8OA 4YMMA 2CRXA 4JMUA 2G06A 3G6XA 3PSPA 8ICEA 3ERCC 4YVZA 4GC7A 1ZQHA 1BPEA 4KLJA 8ICXA 1QCKA 4Z6DA 5KFBA 4X4PA 3Q8MA 2IOHA 2KJ9A 4OAGA 5ALEA 4R63A 3V72A 1RYUA 4M9LA 4ED6A 3V7JA 3UXNA 1B0XA 4NLBA 4LZGA 2PBEA 4DOCA 1UT5A 1J2MA 3WFQE 4I2EA 4WQKA 2ZTEA 1ZD2P 3NVZA 3IG5A 2ZIVB 4MF2A 5JRTA 3GV5B 2MA1A 2J6UA 3AU6A 1L7NA 3C18A 4A8EA 4UB4A 1TK5A 4C4SA 4C80A 4K8VA 4O3SA 4OAHA 5J0OA 3OHBA 1KQQA 5KG0A 1DXSA 3TAPA 3C66A 1J97A 1TFRA 4RQNA 2KZMA 2E8MA 1PK3A 3C5GA 2V9WA 4EZ9A 2Y0SF 4E8FA 5J2IA 1T94A 4O5CA 4ECWA 2EWRA 2PMZF 4MFAA 3TARA 3ZDAA 3HJ1A 5J2FA 3RB6A 5ALOA 2Y0SC 4KLMA 3GIKA 3QXGA 1U45A 3SAFA 4DQRA 2LI6A 3MGHA 3HP6A 2F76X 2MRLA 1AROP 4ATBB 2KNJA 3Q8PB 3AUOA 4I2IA 4ZH4A 4AYBF 3C2KA 1DOQA 5DQGA 5KFKA 1B43A 3RF9A 5KFWA 2K4IA 3NRZA 1WYGA 3D2NA 4NM2A 1SXEA 4B9SA 1T3QA 5DBCA 4E80A 3HJ4A 3KKAC 4JV2A 2LKYA 2AQ0A 1Q78A 3PX4A 4US8A 2H3QA 2FDRA 2EANA 3NYBA 4DFKA 4GFJA 5AK5A 2YTUA 1SV4A 4O9MA 1PZNA 4UAWA 5J0RA 5J0TA 2QARA 1OUQA 1SV0A 1ZQNA 3H4DA 1L6NA 4ELUA 3FC4A 4Y2PA 1LKYB 2GO7A 4MFCA 4X0AA 1A77A 2BR0A 4TURA 3BQ0A 1RYSA 3MDCA 1L5UA 4YD1A 4YFKA 3I28A 3WFSC 2W7OA 4US9A 4KTQA 2BQUA 4Y2JA 4EEKA 1R89A 3FDSA 4X5VA 2XY5A 1CI4A 5CA7A 2R8HA 3BS5A 5AKXA 1ZQBA 4UB3A 4Q45A 2EQYA 1QSYA 2WHEA 1JXLA 2C28A 2JEGA 4NXWA 5KT5A 3QUCA 1UETA 4C4RA 1R8BA 2EAPA 4EGWA 3OPXA 2YB4A 3T5LA 1A76A 1MC8A 3H8WA 5EE1A 4O3RA 2G08A 5D49A 2O5AA 4JK1A 4WC4A 1A6SA 2KE7A 3UMBA 4ECTA 2ZIWA 3RJGA 2JGAA 3L4PA 1U4BA 4P0QA 3G6VA 1X9MA 5HR7A 3GFKB 4KLTA 4F4KA 4O5KA 4I2HA 3T5HA 4I2JA 5KFNA 1UHUA 5AK6A 4IRKA 3PSFA 5HRHA 4PL2A 2W8KA 5AI5A 3EPIA 4F5OA 4N7RA 5KFAA 2KIWA 1CUKA 3H0LB 4C8NA 5J2JA 3RJHA 4FBUA 4WC5A 4GIBA 4PH5A 4K9BA 4UAUA 4AP9A 2KVSA 3ZI4A 4BDPA 3FM9A 4RWQA 1SGGA 4OD0A 1NKEA 1JIHA 4I2GA 4NKTA 1S76D 5KG2A 1KDHA 2K8BB 2OYYA 2ZXIA 2A1AA 4FFDA 1IV8A 2MSNA 4EENA 1XO1A 1TKDA 8ICOA 2HHQA 1L3TA 1O03A 2M2TA 5KG3A 4K4GA 4AT7B 4PHEA 4ECZA 5HMLA 5BPCA 2W03A 1U49A 4WH5A 5CR0A 9ICGA 1GO3F 2DBYA 5JU5A 3D2SA 1PK1A 2HMXA 4CE6A 3O0FA 4UD4A 3IDWA 8ICKA 4X4TA 2V4QA 9ICUA 3JYYA 2HVHA 3GV7B 3V7LA 4WBZA 3GILA 5HNKA 3LQCB 4JWMA 2ZJAA 4IR1A 5TZVA 3JCFA 1D9DA 1T8EA 1JN3A 4QWDA 1F5SA 4YP3A 4DFJA 4ACOA 4LEVA 3SZ2A 1QH9A 2P6RA 4KB6A 2H3ZA 4WC0A 2W8LA 3PW7A 2CN1A 3B0YA 3SAHA 2XICA 1V97A 2ZTCA 2IHMA 9ICRA 3ZD9A 7ICVA 4NXVA 1D9FA 1LV5A 5AKLA 2QB0A 2E5SA 1NO5A 3L3FX 5HRLA 2BCSA 3TQ1A 4FHWA 4YR3A 3SR6A 5J0WA 4KM5A 2ZH7A 3OHAA 2W04A 4CNQA 1N5XA 3C2LA 1ZQLA 4Y2UA 3RJEA 3EUB2 4C7ZA 5AM2A 2DQNB 4X4NA 8ICLA 2Y1IA 2E1EA 2R8IA 2KV2A 5KFZA 1XO0A 8ICCA 2ZUDA 2IBKA 4ICAA 5KFTA 2ZIUB 1RM6C 1KNYA 4OJPA 1RQLA 4FO6A 3PO4A 2HHXA 1S5LU 5CFSA 9ICJA 2KHQA 5TISU 1XC9A 4NWIA 5AHXA 5HHHA 1NK5A 1UCVA 4IC9A 2FPKA 1PK1B 4EBJA 4QWEA 4Y2QA 3K7DA 4ECYA 1KKXA 3MGIA 3QU4A 2E8NA 2K4PA 3T5KA 4KN4A 4PJ0U 5J0UA 2XCPA 3FYHA 2LYHA 4YR2A 2B6GA 4O3NA 4J03A 4WQLA 1RQNA 9ICVA 3V7KA 4DO9A 2DRAA 2DF4B 3TKAA 4KN7A 3ZD8A 5C0YA 2G5HB 1H38A 1JMSA 1C20A 1QLNA 4CF4A 2HSZA 4O0IA 4ECSA 4I2FA 4R8UB 5DBBA 4RQ0A 3H40A 3E58A 2ASJA 3OV7A 2LM1A 3U26A 4M0AA 2AGQA 3GQCA 5B3PA 4F4ZA 4ECRA 3PVXA 2A1JB 1OW5A 1N62A 4J9OA 4AT9B 2ZHAA 1UT8A 2YX8A 2HHSA 2W9CB 3AQKA 9ICWA 4OO1J 2KFZA 3WK7A 3WKDA 2BCUA 3VCBA 2GLEA 3IP4B 3B0XA 4J9MA 4FBTA 1ZQEA 1KW4A 1UPHA 4C8LA 2VA3A 2F77X 5G5GA 3ISDA 1N61A 2RDJA 4MKPA 5KAIU 2P66A 2M2UA 1NI3A 1Y88A 3EYZA 5HR9A 4F5RA 2BKEA 1TK8A 1Q79A 3RTVA 5ALKA 5CHGA 3TFRA 1L8OA 5AK3A 1JXEA 2ZUCA 4UARA 2JHDA 2HVIA 4C8KA 8ICWA 2IOFK 2G5IB 2W55A 1ZQWA 5J2DA 1JX4A 2R8GA 2DKXA 3J81j 3OSNA 3KKAA 2RHFA 2RRDA 4M2YA 5AKIA 3K75D 3ORYA 4DQQA 5KL8B 4P0PB 2HBMA 2BZFA 1RYRA 2RP5A 4AT8B 1P7DA 4KLLA 4ZOHC 2JEJA 5J0XA 3LDAA 4J9QA 2HHWA 4O69A 7ICGA 2WTFA 5ALZA 2IHNA 4DSIA 9ICCA 3WFRE 4P2HA 2EAOA 5DG7A 2W9CA 3KHGA 3PW2A 4LEWA 2XGQA 2QB1A 4WC2A 4M9GA 4FH5A 2QB0B 5L1MA 3GU3A 2EH9A 1BPBA 4DL5A 3BZCA 4EEBA 3KHLA 5ALNA 2FJ6A 4P0PA 4QZ8A 1XWLA 5AM3A 1UA0A 2KTQA 3F2BA 3AL0B 4QZIA 8ICMA 3NASA 9ICOA 1DGJA 1XS9D 1WWVA 2G07A 4IQTA 5L1JA 1WG8A 5J2BA 4F5NA 3VC8A 1YLQA 4UATA 1Z4OA 4WBYA 3GIJA 2BPCA 8ICGA 3OUYA 1R8AA 2ID1A 4Q44A 4MEXA 3SMVA 3WKAA 4M5DA 3D6JA 2HBLA 3MC1A 3PR4A 3KFUF 2KSOB 5ALMA 3F2DA 1SWWA 2ZIUA 5HP4A 3H37A 2DR8A 1R8CA 2H3VA 2NRXA 4XQ7A 5DDYA 2OXOA 2GOLA 1ZJNA 1KTQA 3OVSA 3NRWA 4M9JA 4EZ6A 1K5OA 2HHPA 5D4BA 2B21A 4QZEA 5HRGA 3L9DA 5DB9A 3T5JA 3GV8B 3A0BU 1ZOLA 1ZQZA 1X2IA 3ETRA 1OU5A 2FCLA 2M9NA 3NUQA 4NY8A 1FIQA 3C1YA 3RRHA 4I2BA 8ICJA 2ALZA 4PZOA 3ZDDA 4DSKA 4AT9A 5DLGA 3UQ2A 5DKWA 3RJJA 4WC6A 2J6SA 1Z1VA 2NO5A 1KBUA 4ATBA 1ZQDA 1ZQQA 2AXTU 4QNLA 4GXIA 3WU2U 2R8KA 1XSPA 2DL0A 2KVCA 4X4UA 4PHDA 4Q43A 1X9SA 4F2SA 3AEVA 1KRPA 1WWUA 2WB1C 3QE9Y 2HHUA 2E8PA 2DKZA 3NVVA 1DRGA 3NTUA 3G6YA 3AQNA 3PHZA 2AHOB 2NRVA 2ISOA 2ZJ8A 4I2CA 4QZAA 2C22A 4E0DA 4KLHA 2YMPA 4KX3A 4QZBA 2BCRA 2HI0A 5ALSA 5F2VO 1U47A 4EYIB 3E2EA 1JRPA 4JLZA 2I9GA 2J6TA 1Q3VA 2F8LA 3D2QA 3N4MB 4X4RA 2N1RA 2QARB 2RDIA 5ALYA 1X9WA 4UB2A 4NM1A 4EBDA 3NGDA 2UVVA 4LT6A 4EBCA 5AK4A 2KG5A 1Z4NA 3UPQA 2HN2A 2BDUA 4X4VA 3GZFA 5JUMA 1IM4A 3AN1A 3QUQA 5L1IA 1UA1A 2PI4A 3WK6A 1X42A 3PSTA 4DL4A 1SWVA 3OJSA 4YCXA 3RBEA 1QQ6A 5ALGA 4F4WA 4P4PA 2E3TA 3RBDA 5IIJA 3TADC 1KFDA 2F44A 4IRCA 5KFCA 4OAFA 4I2DA 4IQUA 4MF8A 1SV0C 3CW2C 4USAA 4JUZA 4C7YA 2RFFA 5AIBA 2E1FA 4M6WB 4OCZA 2K4HA 2V4RA 5DEDA 3KTQA 1BNOA 4R8UA 4CDGA 2EZZA 2KP7A 4RUCA 2ZH3A 1XU4A 2ATLA 2W3RA 4RPYA 2IOFA 2BPGA 4Z6CA 5F9LA 1N60A 5KNIA 3UMGA 5L1LA 1ECWA 3V6HA 3EF2A 3JPPA 4RQ3A 1V38A 1ZQGA 3JPOA 3HKZC 2PFQA 4ED7A 5AKZA 2HCFA 2VA2A 2JZBB 2JEIA 2FI1A 2XVTA 4QZHA 4X4OA 2Q4TA 3HIYA 2PI5A 4FS1A 4HAIA 3WKEA 8ICFA 4DS5A 5AM0A 3QEBZ 3RH4A 1DK3A 3H3AA 3NVOA 7ICHA 9ICSA 5KFEA 1NK9A 5ALLA 2ISPA 4ED2A 1ZQRA 2KOBA 1F0MA 4ED1A 3TFSA 3C29A 4RQ7A 4R65A 2LM4A 2AJQA 2KJ8A 1ZQSA 2W11A 4F91B 1S77D 1N5WA 4ED8A 3SI8A 4I0UA 3UM9A 3N7RC 2W9AA 1JAJA 5IILA 3N28A 4Y2RA 3DEEA 4KLQA 2R8JA 1XSLA 2JV3A 4IQWA 2KD1A 2DRBA 2XO7A 2DPIA 5IINA 5HRBA 3MR3A 4NXTA 4TUSA 3AQEA 5IIOA 4DQIA 4IS7A 9ICMA 3BS5B 7ICLA 4J9KA 4U6PA 2OEHA 2OHFA 4EELA 3M9OB 1ZQMA 1KEJA 2HBKA 3F5EA 5DBAA 2WAQF 5KG1A 2UVUA 7ICIA 1BPDA 4C8MA 2ZG6A 3N97B 4LZDA 4AT8A 4EEDA 1QSSA 2ZXHA 3OVBA 3A0HU 4O3MA 1B22A 2FPLA 2VIXA 3C21A 5DB6A 1T3NA 1Q3UA 2FMPA 4F8RA 2KICA 3SEIA 4CF3A 1ZD3A 4IQVA 4EV6A 2ZJ5A 2ES6A 4B9LA 3BJYA 5IIKA 2NRZA 1F5AA 4OJLA 2EAMA 1BPXA 5EE3A 2MU2A 3HW8A 2QLTA 3JPSA 3NKUA 3H0MB 3H38A 1FO4A 1TAQA 5J8YA 5IIMA 4I29A 3PZPA 1NK4A 5J2EA 3H8SA 3MR6A 3JPQA 5CHEA 2JH1A 4M47A 2H5XA 3AQMA 4K4HA 4FHVA 3UPSA 2JRZA 1YZ6A 4ED3A 3HILA 3RR8A 4F5PA 2PMZC 4BXOA 5ALWA 3RH6A 4DS4A 8ICAA 2RQ5A 4DSJA 1NJYA 4O3PA 1Z00A 5EWFA 3AQLA 2YQEA 2P6UA 5G5HA 4U7CA 3WK4A 4RNMA 4YXMA 3Q8KA 2FMSA 2KEYA 3M8SA 2ZH2A 3ALRA 5KG7A 2Y9UA 5J2GA 1A0PA 2WF5A 4QZGA 4FHPA 5KT2A 5C5JA 4BGDA 5KFSA 1SZPA 4JV1A 1ZQCA 5ALUA 3Q8LA 2KZZA 2I5HA 4RZRA 2YY6A 3PX0A 2IA6A 3UXPA 1NK0A 2B0CA 2FE9A 1ZQUA 4IL6U 2CXYA 1UQVA 5HHIA 1ZQPA 4NLNA 3MABA 4XQ8A 5A0LA 5AKJA 2PFPA 3IN5A 4UW9A 3AMZA 1NKBA 2BBJA 4B9MA 4KX5A 2M2VA 3PMLA 1SL0A 5ALRA 3PW0A 5D62A 4CGZA 1X6JA 1VDVA 5AKHA 2ZH8A 5J0PA 1SL1A 1XSNA 2I6XA 5DG9A 1ZQXA 1DK2A 4YR0A 2ZH1A 7ICPA 3I76A 2CPRA 4FHYA 8ICQA 2HDOA 4OJ5A 5J8YC 1TAMA 2LYBA 2KIVA 5DQHA 2LPEA 7ICSA 3MFIA 4Y2VA 4Z6EA 3QUBA 1FFUA 1C7YA 2B51A 4RWPA 2DGZA 4RQ1A 1PVRA 4P4OA 4EYHB 3SAGA 1NJWA 3MR5A 2XY7A 2FPMA 4UB5A 1ZQTA 3B9JA 4WOYA 2JR5A 5GTHU 1ZYQA 5KFJA 4AYBC 2NRTA 4KLGA 1S9FA 3MCRA 1VLBA 2B56A 3JZ0A 3BQTA 5D61A 4UAVA 1S97A 2W43A 1L7MA 3FAHA 2W7PA 1ZQOA 4NLZA 3KOOA 5EE0A 3C1ZA 4F5QA 2G09A 1N56A 3KHHA 4CF5A 4UQGA 4C4TA 1AQ6A 4J9LA 4OJOA 5K4LA 3WFPA 3BQ7A 4GC6A 4X4QA 5DLFA 1ZQJA 4BX9C 3H7IA 7ICMA 4DSLA 3MFHA 3ZDBA 4M6WA 1RXVA 3T79A 1ZQVA 4XJEA 9ICXA 3F5AA 4O5EA 4F4XA 3PV8A 4O6AA 4DEZA 3RRGA 2ESEA 3EW9A 4M04A 1PUZA 1JALA 9ICIA 1NZPA 4M9NA 1Z19A 4Y2TA 3HRDD 5EE9A 5CFUA 2K4EA 8ICTA 3WKCA 2NYVA 5L1KA 3KD3A 4QJFB 3C5FA 1KN5A 4YD2A 3QEAZ 1TK0A 4Z6FA 3KZIU 1M6YA 4I2AA 3LWLA 2HOIA 4WC1A 2AU0A 2L5YA 3V6KA 1D8YA 5HMMA 1TFYA 2JXJA 2PFNA 1NKCA 1S10A 2NO4A 4UBBA 4JWNA 4UB6U 3PW4A 3QZ7A 1RG6A 4PHPA 4BWMA 2KSOA 3CYMA 1HUOA 3LK9A 3I1YA 3GDXA 1RDFA 3MR2A 4TUPA 4G3IA 4Y2XA 4AT7A 3N7PD 1PX5A 4BWJA 1VJ5A 3IG8A 5B3QA 5CWRA 3ISCA 1ZRMA 4KLOA 5KFHA 5KFQA 4PGQA 3WFOA 3QX7A 3MDAA 3T3FA 4OJ6A 5AKGA 4M9HA 2DR5A 3RJKA 1CEZA 2GH1A 8ICPA 2W9BA 3AM9A 2H3IA 2HN1A 3BZKA 5HREA 2HOFA 1IXRA 4KLEA 5EOZA 1L7OA 2LHTA 2ZH9A 1QTMA 5J2CA 5IIIA 3LYSA 2ZTDA 5HRFA 3Q8RB 3OJUA 3GIIA 2D3DA 3DDHA 3UQ0A 4KMOB 5KFLA 3ONNA 3DV9A 3ED5A 1GPJA 4DWIA 2JH7A 2IUBA 3BS7A 5CEHA 3IHQB 4NLCA 2WF6A 4WC7A 5D63A 2F3NA 2KKPA 4QZCA 3AQFA 3RFAA 4UBCA 3H39A 5DB7A 3HWTA 9ICQA 5ALXA 3HT3A 4ECVA 1QSLA 7ICTA 3H8MA 1V9PA 4YMNA 8ICYA 4GXKA 4O68A 2ZIXA 4Q8EA 4QW9A 5KFGA 4FH3A 3ZDEA 4KITB 4TUQA 4NKUA 4DSEA 4ELVA 3LVWA 2MUTB 3R9KA 1L3UA 4ED0A 4RWNA 3RH5A 3QUTA 5HC9A 2HOQA 3OSPA 2F2AB 2BBHA 5F9NA 7ICUA 4K98A 5ALJA 4OAIZ 8ICBA 1T7PA 2EZYA 1CRXA 4EP7A 2DFLA 1U48A 3PR5B 3SQIA 1IG6A 4TQSA 3WKBA 4Y2YA 5CRXA 4PL1A 2C2EA 3NS1A 3TANA 7ICJA 5BOMA 1KSPA 3QU7A 1B4FA 4BJQA 3HJEA 4NL9C 4B9NA 9ICFA 4RUAA 4KLDA 3QU9A 9ICLA 3GIMA 3SV4A 4MHVA 2KFNA 2DR9A 3N7SC 4GLXA 3UMCA 3WK9A 8ICUA 4DL6A 5KG4A 3TAQA 1KLNA 3F53A 5KL1B 3SYZA 4DOBA 3JPRA 3HPOA 1KL9A 2O1PA 9ICPA 2KK0A 3C2MA 4F4YA 3RB3A 1JQRA 5J2KA 4RWOA 2OCEA 1SIJA 3L5KA 3E0FA 4EX6A 1MQ3A 2H3FA 4R64A 2WF7A 4IG8A 3NVYA 4JLXA 2RLTA 1D8LA 3NVWA 2QKQA 4RNOA 1JUDA 2BDPA 2XI9A 5AI0A 4B9TA 7ICEA 4QZDA 2WB1F 8ICIA 1NK6A 4EBKA 1K1SA 4YN4A 4O3QA 1S0OA 4YXJA 1NJXA 9ICNA 1K1QA 5AM4A 5DGBA 1N48A 5KFOA 2UVRA 3OUYB 4PGYA 3K1ZA 4PPXA 2DPJA 3TI0A 2YMMA 4DFMA 1ZETA 2AQ4A 5DQIA 3WK5A 1XNSA 1KFTA 9ICTA 2A1JA 3JPTA 1ZQ1C 2OWOA 4RQ2A 5AKYA 2W3SA 2A3VA 5DG8A 3PMNA 5KFYA 9ICBA 3M9MB 5D46A 3M8RA 2DVIA 1PVPA 2EDUA 4QIWF 4Q8FA 3SENA 3ER9B 2XY6A 1Q46A 5KAFU 3HX0A 3JPNA 2R18A 4NXZA 3MGVA 2XCAA 1L3VA 1DGSA 3M1YA 4B9UA 9ICEA 1X6IA 7ICNA 4YQWA 5CP2A 1SXDA 1ZD4A 1NK8A 7ICQA 4E7XA 2ZIWB 5KFMA 2YB1A 4UAZA 1S0MA 4DL7A 7ICOA 4MEYA 4RT3A 3QZ8A 1Z1BA 1SKSA 2WAQC 3ETLA 3M6KA 5KFDA 3PO5A 8ICHA 4LVSA 4PZNA 3BQ1A 3IV6A 8ICZA 4HX0A 4DF8A 1MIWA 2DR7A 4KLIA 9ICAA 1LB2B 2KJ5A 3RJFA 2ZIXB 3NWIA 1COOA 3KZXA 5ALTA 4RQ4A 7ICFA 1NNLA 5KG6A 2KHVA 4PHAA 4B6JA 4LEZA 2PKEA 2NRWA 8ICVA 1MIYA 3TACB 1JROA 2VJ4A 5J29A 1JI7A 7ICKA 3QU5A 1N63A 3OTQA 2VJ5A 5L9XA 3CK6A 2GA9D 2FLLA 2DUYA 1UEUA 5AIAA 2OH2A 1HJPA 3EWAA 5KT4A 3C28A 2K60A 4DLEA 5DB8A 4WC3A 4EBEA 5AI9A 3RB0A 2I1QA 3QU2A 2BCVA 4KMUA 2AH5A 1NOMA 8ICRA 8ICSA 3HKZF 2KN7A 1T4GA 2C2DA 4C0ZA 5HR6A 2WF9A 3LWMA 2OM6A 3M6ZA 4QWBA 1BVSA 3EZ5A 4G9BA 4F93B 5AM5A 4UB1A 2YMLA 4F50A 5HRIA 2BQ3A 2P35A 1TV9A 1WCNA 5AICA 5J0SA 4F72A 2HHVA 2PXIA 1HIWA 1V85A 3QNMA 1RXWA 1SKWA 2M2WA 5JTGA 3QYPA 4K4IA 4QZFA 4F71A 1VFGA 5ALDA 2XC9A 2ASDA 2G0AA 1YZ7A 1S0VA 4RNNA 4RQMA 1FA0A 2ZIVA 4XA5A 2HBJA 1QQ7A 3OVAA 1ED1A 2YMQA 1J2NA 4QWCA 1ZQFA 4DCCA 4JB3A 3BDPA 1WOTA 2B4VA 4C8OA 3LVVA 3MBYA 1U9LA 4TQRA 5KFPA 5J2AA 4FO1A 4LJXA 1WCLA 3IRUA 2DWQA 3PY8A 2D8CA 4WJ3B 4X0BA 2BGWA 2XGPA 4BUGA 1BPYA 3Q8SB 2MUTA 2WFAA 2FMQA 3IM1A 1X9XA 2BHNA 4KLSA 4RT2A 2Z7JA 2Y9TA 5KFRA 2Q66A 4DSFA 1Z00B 4UAYA 1BGXT 5J2HA 2EZXA 4K99A 2ZH5A 1ZQYA 4KLUA 1ZXIA 2ZHBA 4NLKA 4IRDA 7ICRA 4X4SA 4UD5A 2MAXA 2XIDA 3RB4A 4QIWC 2HHTA 2D6FC 5KFVA 3F2CA 2F8KA 1MQ2A 4UASA 4IR9A 3RAXA 1SZHA 5AI4A 3H8JA 1LKYA 4DFDA 4DL3A 4LEYA 1VJ7A 1BNPA 1RPLA 1QQ5A 1HUZA 1SB3C 2VA8A 1Q8KA 3K4GA 8ICNA 4NJ8A 5B5EU 4NXUA 1O08A 2LMRA 4RU9A 4FHXA 5B66U 2LBOA 1KFSA 1ZQIA 4K97A 4DLGA 4O3OA 2YN4A 2W9BB 1TAUA 4F3OA 1TFWA 1COKA 2K8CB 1RZTA 3ICXA 4RPXA 3K1RB 5KG5A 1L3SA 2JMGA 4S3NA 4R66A 5ALFA 1HEKA 1ZQKA 2E8OA 3RJIA 4YG2A 5KTQA 4FZLA 3KHRA 2F1IA 5EWEA 2A19A 1URJA 4ECQA 4JV0A 4QW8A 3M7DA 4ECXA 5EWGA 5CB1A 5BOLA 4J9SA 1D8BA 1NZBA 5JTIA 1MN8A 2K89A 3CP8A 4EX7A 5AI6A 2ASLA 5ALPA 2Y1JA 2O6KA 4EEYA 4WCWA 4P4MA 2BE3A 2KMDA 5CJ7A 4RPZA 2NV3A 4I27A 4CCHA 5DECA 2M0NA 4GXJA 5J0QA 4B9VA 2K8AA 3CRXA 3PSIA 2VKQA 5CFTA 3H4BA 5KFIA 9ICKA 4UB8U 4J9NA 5FP0A 1FEZA 5HRKA 3ISBA 9ICHA 4F2RA 1FFVA 2JZBA 3UXOA 3CNHA 3WK8A 1MA7A 4CRXA 3OWGA 3PNCA 3S6JA 4NXXA 2ZUBA 4MFFA 2LYAA 4PGXA 3OGUA 1X66A 4QZ9A 5DGAA 4O67A 3M9NB 1F44A 3SV3A 1ZJMA 4FS2A 1EXNA 2VANA 1S0NA 4DQPA 1TE2A 5ALHA 4KLFA 1L8LA 4RQ5A 2C2RA 1SKRA 2FLPA 3RR7A 2GWSA 5ALVA 3Q8QB 5AKKA 2BPFA 5KT3A 4J9RA 3THVA 4Y2SA 1LVHA 5KFXA 4DOAA 2W9MA 5AKEA 2FLNA 2AGPA 3BQ2A 4DQSA 4RQ6A 1MIVA 1ZRNA 4XUSA
chains in the Genus database with same CATH topology
5KFUA 3EPGA 4DF4A 1KLNA 1NK7A 3ZDCA 3SYZA 1KNYA 2NRKA 2ZH6A 4DOBA 1SL2A 3JPRA 4FO6A 3PO4A 2HHXA 2DRBA 2XO7A 3HPOA 4NLGA 2DPIA 5IINA 9ICJA 2O1PA 9ICPA 2IMWP 3AU2A 1Z3EB 2F1JA 1XC9A 2BQRA 4ELTA 5HHHA 5HRBA 3C2MA 4F4YA 3RB3A 3MR3A 1NK5A 1MSWD 4TUSA 1JQRA 2FPKA 5IIOA 5DDMA 5J2KA 4ECUA 1ZQAA 4DQIA 4RWOA 4EBJA 4QWEA 4HYKA 1MQ3A 9ICMA 7ICLA 4R64A 4J9KA 4ECYA 4IG8A 4DFPA 2BDPA 1D8LA 3PX6A 4RNOA 2F1HA 3MGIA 3T5KA 5KFFA 4KN4A 3C23A 4B9TA 3M9OB 4QZDA 1ZQMA 1KEJA 5J0UA 7ICEA 5DBAA 8ICIA 2XCPA 1NK6A 2ZH4A 5KG1A 2UVUA 4EBKA 3FYHA 1TVAA 7ICIA 1BPDA 4C8MA 4F92B 1K1SA 2LYHA 2Q0ZX 4LZDA 3N97B 4YR2A 4BXOB 4YN4A 4I28A 5HRDA 4AT8A 4O3QA 1S0OA 1QSSA 4O3NA 4YXJA 1NJXA 9ICNA 1K1QA 4J9PA 2AGOA 5DGBA 2HW3A 3OVBA 9ICVA 3V7KA 2BCQA 1B22A 2FPLA 3C21A 5KT6A 5DB6A 4DO9A 1T3NA 1N48A 2FMPA 1NJZA 3RAQA 4F8RA 2DRAA 3ZD8A 4KN7A 5KT7A 4YMOA 5KFOA 4IQVA 4PGYA 1H38A 2ZJ5A 1JMSA 2UVRA 4B9LA 4PPXA 3OUYB 2DPJA 1QLNA 5J0YA 4O0IA 3BJYA 2PFOA 4ECSA 3TI0A 1BPZA 4DL2A 5IIKA 4DFMA 4R8UB 5DBBA 2NRZA 4RQ0A 3V6JA 2UVWA 3H40A 1ZETA 2AQ4A 1F5AA 2KZ3A 5DQIA 2ASJA 1V4AA 3OV7A 3LQCB 1BPXA 4M0AA 4RQ8A 1KFTA 2AGQA 9ICTA 3PW5A 1UEVA 2A1JA 3HW8A 3JPTA 4XRHA 4QWAA 3GQCA 2JEFA 4F4ZA 4ECRA 4RQ2A 3PVXA 2OWOA 3JPSA 2A1JB 4YMMA 4J9OA 5DG8A 3PMNA 5KFYA 9ICBA 3G6XA 3M9MB 5D46A 4AT9B 3M8RA 2DVIA 2ZHAA 8ICEA 1UT8A 3H38A 4YVZA 4GC7A 1ZQHA 4Q8FA 2HHSA 1TAQA 2W9CB 1BPEA 3AQKA 5IIMA 2XY6A 4I29A 4KLJA 9ICWA 1NK4A 2KFZA 4Z6DA 5KFBA 8ICXA 4X4PA 3HX0A 5J2EA 2BCUA 3H8SA 4NXZA 3JPNA 3MR6A 3Q8MA 3B0XA 3JPQA 2XCAA 4J9MA 4FBTA 1L3VA 1DGSA 1ZQEA 4B9UA 4M47A 9ICEA 2H5XA 3AQMA 4K4HA 4C8LA 4FHVA 2VA3A 3ISDA 4R63A 2RDJA 3V72A 7ICNA 2P66A 4YQWA 4M9LA 2M2UA 3UPSA 1Y88A 3EYZA 4ED3A 4ED6A 3RR8A 3V7JA 5HR9A 4F5PA 3UXNA 4F5RA 4BXOA 2BKEA 5CP2A 3RH6A 4DS4A 8ICAA 4DSJA 4LZGA 2PBEA 1TK8A 4DOCA 1UT5A 1Q79A 1NK8A 3RTVA 7ICQA 5CHGA 3WFQE 1NJYA 4E7XA 4O3PA 3TFRA 4I2EA 1Z00A 5EWFA 2ZTEA 5KFMA 3AQLA 2P6UA 4UAZA 1JXEA 2FMSA 4RNMA 4YXMA 3Q8KA 2ZUCA 3M8SA 2ZH2A 4MF2A 1S0MA 4DL7A 5KG7A 2HVIA 4MEYA 7ICOA 4RT3A 3QZ8A 4C8KA 3GV5B 5J2GA 1SKSA 8ICWA 3ETLA 2J6UA 3AU6A 4QZGA 5KFDA 4FHPA 3C18A 1ZQWA 5J2DA 1JX4A 2R8GA 3PO5A 4UB4A 5KT2A 5C5JA 3BQ1A 4BGDA 3OSNA 5KFSA 1SZPA 1TK5A 4JV1A 4O3SA 1ZQCA 5J0OA 8ICZA 4M2YA 3OHBA 4DF8A 1MIWA 5KG0A 3K75D 3Q8LA 2DR7A 4KLIA 9ICAA 3TAPA 3C66A 1LB2B 3ORYA 4DQQA 1TFRA 2KZZA 2KZMA 4RZRA 1RYRA 3RJFA 3PX0A 2IA6A 4AT8B 3C5GA 3UXPA 1NK0A 2V9WA 4EZ9A 4KLLA 4E8FA 5J2IA 1COOA 2JEJA 1ZQUA 5J0XA 4O5CA 4ECWA 3LDAA 4RQ4A 4J9QA 4MFAA 3TARA 7ICFA 2HHWA 5KG6A 1ZQPA 5HHIA 7ICGA 4PHAA 2WTFA 3MABA 3ZDAA 4NLNA 2IHNA 4DSIA 3HJ1A 4XQ8A 5J2FA 3RB6A 9ICCA 3WFRE 4P2HA 2PFPA 5DG7A 2W9CA 4KLMA 3KHGA 3PW2A 3GIKA 2NRWA 1NKBA 1U45A 8ICVA 4DQRA 1MIYA 4B9MA 2M2VA 3PMLA 3MGHA 5J29A 2XGQA 1SL0A 3HP6A 1AROP 4ATBB 3Q8PB 3AUOA 4I2IA 3PW0A 7ICKA 4WC2A 4M9GA 4FH5A 4ZH4A 3C2KA 1DOQA 5DQGA 5KFKA 1B43A 5KFWA 5L9XA 2ZH8A 5J0PA 1SL1A 1BPBA 1XSNA 4DL5A 2FLLA 4NM2A 5DG9A 1ZQXA 1UEUA 3KHLA 4B9SA 1DK2A 4YR0A 1HJPA 3EWAA 5KT4A 5DBCA 7ICPA 4FHYA 4E80A 2ZH1A 4QZ8A 4DLEA 5DB8A 8ICQA 1XWLA 4WC3A 3HJ4A 4EBEA 1UA0A 4JV2A 3RB0A 2KTQA 2AQ0A 1Q78A 5DQHA 4QZIA 2I1QA 3PX4A 7ICSA 8ICMA 3MFIA 9ICOA 2BCVA 4KMUA 4Z6EA 3NYBA 4DFKA 1XS9D 1C7YA 1NOMA 4RWPA 4IQTA 8ICRA 5L1JA 4O9MA 4RQ1A 8ICSA 4P4OA 1PZNA 1T4GA 5J2BA 2KN7A 4F5NA 4UAWA 4EYHB 2C2DA 5J0RA 1NJWA 1YLQA 5J0TA 3MR5A 3LWMA 2FPMA 2XY7A 3GIJA 4WBYA 4UB5A 1ZQNA 3H4DA 2BPCA 4QWBA 1ZQTA 8ICGA 1BVSA 1ZYQA 3EZ5A 1R8AA 3OUYA 5KFJA 2ID1A 4F93B 2NRTA 4ELUA 4Q44A 4UB1A 4F50A 5HRIA 2BQ3A 1TV9A 4MEXA 4KLGA 4MFCA 4X0AA 1WCNA 5J0SA 2HHVA 1S9FA 1A77A 2BR0A 2PXIA 4TURA 4M5DA 3JZ0A 3BQTA 1RXWA 1SKWA 2M2WA 4K4IA 4QZFA 1VFGA 3PR4A 3BQ0A 1RYSA 1S97A 2XC9A 2ASDA 3MDCA 1L5UA 1S0VA 4RNNA 5HP4A 1ZQOA 4YD1A 4NLZA 4YFKA 3H37A 2DR8A 1R8CA 3C1ZA 4F5QA 1N56A 3KHHA 4UQGA 1FA0A 2NRXA 4XQ7A 3WFSC 5DDYA 4J9LA 4KTQA 4XA5A 2BQUA 1R89A 3FDSA 1ZJNA 3WFPA 4X5VA 3OVAA 1KTQA 2XY5A 4GC6A 3OVSA 2HHTA 4X4QA 4QWCA 5DLFA 5CA7A 1ZQFA 2R8HA 1ZQJA 1ZQBA 3BDPA 1WOTA 4UB3A 4C8OA 4Q45A 1QSYA 4M9JA 3H7IA 4EZ6A 7ICMA 4DSLA 3MFHA 3ZDBA 4M6WA 3MBYA 1JXLA 5D4BA 2C28A 2HHPA 1U9LA 2B21A 4QZEA 4TQRA 1RXVA 5HRGA 3L9DA 5DB9A 5KFPA 2JEGA 5KT5A 3T5JA 5J2AA 1UETA 3GV8B 1ZQVA 1R8BA 1WCLA 9ICXA 1ZQZA 1X2IA 4O5EA 4F4XA 3T5LA 3PV8A 4DL6A 3PY8A 1OU5A 2M9NA 4X0BA 4DEZA 4NY8A 1A76A 1MC8A 3C1YA 2XGPA 2BGWA 3RRHA 3RRGA 3EW9A 4I2BA 8ICJA 2ALZA 1BPYA 3Q8SB 3H8WA 3ZDDA 2MUTA 4DSKA 4O3RA 4AT9A 5DLGA 3UQ2A 4M04A 5DKWA 2FMQA 3RJJA 5D49A 9ICIA 3IM1A 4WC6A 2J6SA 2BHNA 4KLSA 4RT2A 4JK1A 4M9NA 1NZPA 2O5AA 4WC4A 4ATBA 5KFRA 1ZQDA 1ZQQA 2Q66A 8ICTA 4DSFA 4ECTA 4GXIA 1Z00B 4UAYA 2R8KA 1BGXT 5J2HA 5L1KA 1XSPA 3RJGA 4X4UA 4PHDA 4Q43A 3C5FA 1U4BA 1X9SA 4YD2A 1ZQYA 3G6VA 3QEAZ 1X9MA 4F2SA 1KRPA 2ZH5A 4KLUA 1TK0A 3GFKB 4I2FA 4Z6FA 3QE9Y 2HHUA 2ZHBA 4KLTA 4I2AA 4F4KA 3LWLA 3NTUA 4NLKA 4IRDA 7ICRA 4WC1A 4X4SA 3G6YA 3AQNA 4UD5A 2MAXA 4O5KA 2AU0A 3V6KA 2NRVA 3T5HA 3RB4A 4I2JA 5KFVA 1D8YA 2ISOA 4I2HA 5HMMA 2ZJ8A 4I2CA 4QZAA 2C22A 5KFNA 2PFNA 4E0DA 4KLHA 1TFYA 1NKCA 4QZBA 1MQ2A 2BCRA 4IRKA 1S10A 5HRHA 5F2VO 1U47A 4IR9A 3RAXA 4UBBA 2W8KA 4EYIB 3PW4A 4JWNA 3E2EA 3EPIA 4F5OA 3QZ7A 2I9GA 3H8JA 5KFAA 1CUKA 4PHPA 4DL3A 4C8NA 2J6TA 4BWMA 5J2JA 1VJ7A 1HUOA 3LK9A 3RJHA 3N4MB 1BNPA 1RPLA 4FBUA 3GDXA 4WC5A 4X4RA 1HUZA 2VA8A 4PH5A 3MR2A 3K4GA 4TUPA 2RDIA 4G3IA 4AT7A 1PX5A 1X9WA 8ICNA 4BWJA 4UB2A 4RU9A 4BDPA 4FHXA 4RWQA 4NM1A 4EBDA 5CWRA 3NGDA 3ISCA 1KFSA 1ZQIA 5KFHA 1NKEA 4KLOA 5KFQA 4O3OA 4PGQA 2W9BB 4DLGA 1JIHA 4EBCA 2UVVA 1TAUA 4LT6A 3WFOA 4F3OA 4I2GA 4NKTA 3MDAA 3UPQA 3T3FA 1TFWA 4X4VA 1S76D 5KG2A 4M9HA 2DR5A 1KDHA 3RJKA 1CEZA 8ICPA 2W9BA 1IM4A 5JUMA 1RZTA 1XO1A 1TKDA 4RPXA 5L1IA 1UA1A 5KG5A 2PI4A 8ICOA 1L3SA 2HHQA 1L3TA 5HREA 1IXRA 4DL4A 5KG3A 4KLEA 5EOZA 4R66A 4K4GA 2M2TA 4AT7B 4S3NA 2ZH9A 4PHEA 1QTMA 5J2CA 5IIIA 1ZQKA 4ECZA 5HMLA 3OJSA 5BPCA 3RJIA 1U49A 4YCXA 3RBEA 4YG2A 5KTQA 5CR0A 2ZTDA 5HRFA 3KHRA 2F1IA 4F4WA 3Q8RB 5EWEA 4P4PA 3OJUA 9ICGA 8ICHA 3GIIA 3RBDA 3UQ0A 4ECQA 4JV0A 5IIJA 4QW8A 4LVSA 5KFLA 1KFDA 4ECXA 4IRCA 5KFCA 5EWGA 5CB1A 4DWIA 5BOLA 4UD4A 4J9SA 8ICKA 4I2DA 3IHQB 4IQUA 4MF8A 4X4TA 4JUZA 2ASLA 4WC7A 2V4QA 2RFFA 2Y1JA 4EEYA 4QZCA 4M6WB 9ICUA 2V4RA 3JYYA 5DEDA 4UBCA 2HVHA 3H39A 4WCWA 5DB7A 4P4MA 3HWTA 3KTQA 9ICQA 1BNOA 3HT3A 4ECVA 2BE3A 3GV7B 3V7LA 5CJ7A 4R8UA 4RPZA 1QSLA 7ICTA 4WBZA 4RUCA 2KP7A 3GILA 5HNKA 2ZH3A 1XU4A 2ATLA 4JWMA 1V9PA 2ZJAA 4YMNA 4GXKA 4CCHA 4IR1A 4I27A 5TZVA 8ICYA 1D9DA 5DECA 4RPYA 1T8EA 4Q8EA 4QW9A 2BPGA 5J0QA 4Z6CA 1JN3A 5KFGA 5F9LA 4GXJA 4B9VA 4QWDA 4FH3A 3ZDEA 4KITB 4YP3A 4TUQA 5L1LA 4DSEA 4DFJA 4ELVA 4NKUA 3H4BA 3SZ2A 5KFIA 9ICKA 3V6HA 2P6RA 2MUTB 4RQ3A 3JPPA 4J9NA 1L3UA 5HRKA 4ED0A 4RWNA 4WC0A 3ISBA 9ICHA 1ZQGA 3JPOA 3UXOA 2JZBA 4F2RA 3RH5A 2PFQA 4ED7A 3PNCA 2W8LA 3PW7A 2VA2A 5HC9A 2ZUBA 2JZBB 3OSPA 4MFFA 3B0YA 4PGXA 5F9NA 2JEIA 3OGUA 4QZHA 7ICUA 4X4OA 2ZTCA 3HIYA 2PI5A 4QZ9A 4FS1A 5DGAA 2IHMA 8ICBA 3M9NB 1T7PA 4EP7A 9ICRA 3ZD9A 2DFLA 3SV3A 1ZJMA 7ICVA 8ICFA 1D9FA 1U48A 4FS2A 1EXNA 2VANA 4DS5A 1LV5A 3QEBZ 3RH4A 1DK3A 3PR5B 1S0NA 4DQPA 1NO5A 3H3AA 5HRLA 7ICHA 4TQSA 4KLFA 9ICSA 5KFEA 3TQ1A 1NK9A 2BCSA 2C2EA 4FHWA 4YR3A 2ISPA 5J0WA 3TANA 4RQ5A 2C2RA 4ED2A 7ICJA 1ZQRA 1SKRA 5BOMA 3OHAA 2FLPA 2ZH7A 3C2LA 1ZQLA 2GWSA 3RR7A 1KSPA 3RJEA 3Q8QB 4ED1A 3TFSA 2BPFA 4RQ7A 4R65A 5KT3A 4J9RA 2AJQA 1ZQSA 4F91B 3THVA 1S77D 4X4NA 8ICLA 2Y1IA 4B9NA 5KFXA 4ED8A 3SI8A 4DOAA 4RUAA 4KLDA 9ICFA 2W9MA 2W9AA 2FLNA 2R8IA 9ICLA 2AGPA 3BQ2A 3GIMA 3SV4A 4DQSA 1JAJA 2KFNA 5IILA 2DR9A 5KFZA 8ICCA 4KLQA 4RQ6A 4GLXA 1MIVA 2ZUDA 2IBKA 2R8JA 5KFTA 8ICUA 1XSLA 4XUSA 4IQWA 5KG4A 3TAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KFU A;  3EPG A;  4DF4 A;  1KLN A;  1NK7 A;  3ZDC A;  3SYZ A;  1KNY A;  2NRK A;  2ZH6 A;  4DOB A;  1SL2 A;  3JPR A;  4FO6 A;  3PO4 A;  2HHX A;  2DRB A;  2XO7 A;  3HPO A;  4NLG A;  2DPI A;  5IIN A;  9ICJ A;  2O1P A;  9ICP A;  2IMW P;  3AU2 A;  1Z3E B;  2F1J A;  1XC9 A;  2BQR A;  4ELT A;  5HHH A;  5HRB A;  3C2M A;  4F4Y A;  3RB3 A;  3MR3 A;  1NK5 A;  1MSW D;  4TUS A;  1JQR A;  2FPK A;  5IIO A;  5DDM A;  5J2K A;  4ECU A;  1ZQA A;  4DQI A;  4RWO A;  4EBJ A;  4QWE A;  4HYK A;  1MQ3 A;  9ICM A;  7ICL A;  4R64 A;  4J9K A;  4ECY A;  4IG8 A;  4DFP A;  2BDP A;  1D8L A;  3PX6 A;  4RNO A;  2F1H A;  3MGI A;  3T5K A;  5KFF A;  4KN4 A;  3C23 A;  4B9T A;  3M9O B;  4QZD A;  1ZQM A;  1KEJ A;  5J0U A;  7ICE A;  5DBA A;  8ICI A;  2XCP A;  1NK6 A;  2ZH4 A;  5KG1 A;  2UVU A;  4EBK A;  3FYH A;  1TVA A;  7ICI A;  1BPD A;  4C8M A;  4F92 B;  1K1S A;  2LYH A;  2Q0Z X;  4LZD A;  3N97 B;  4YR2 A;  4BXO B;  4YN4 A;  4I28 A;  5HRD A;  4AT8 A;  4O3Q A;  1S0O A;  1QSS A;  4O3N A;  4YXJ A;  1NJX A;  9ICN A;  1K1Q A;  4J9P A;  2AGO A;  5DGB A;  2HW3 A;  3OVB A;  9ICV A;  3V7K A;  2BCQ A;  1B22 A;  2FPL A;  3C21 A;  5KT6 A;  5DB6 A;  4DO9 A;  1T3N A;  1N48 A;  2FMP A;  1NJZ A;  3RAQ A;  4F8R A;  2DRA A;  3ZD8 A;  4KN7 A;  5KT7 A;  4YMO A;  5KFO A;  4IQV A;  4PGY A;  1H38 A;  2ZJ5 A;  1JMS A;  2UVR A;  4B9L A;  4PPX A;  3OUY B;  2DPJ A;  1QLN A;  5J0Y A;  4O0I A;  3BJY A;  2PFO A;  4ECS A;  3TI0 A;  1BPZ A;  4DL2 A;  5IIK A;  4DFM A;  4R8U B;  5DBB A;  2NRZ A;  4RQ0 A;  3V6J A;  2UVW A;  3H40 A;  1ZET A;  2AQ4 A;  1F5A A;  2KZ3 A;  5DQI A;  2ASJ A;  1V4A A;  3OV7 A;  3LQC B;  1BPX A;  4M0A A;  4RQ8 A;  1KFT A;  2AGQ A;  9ICT A;  3PW5 A;  1UEV A;  2A1J A;  3HW8 A;  3JPT A;  4XRH A;  4QWA A;  3GQC A;  2JEF A;  4F4Z A;  4ECR A;  4RQ2 A;  3PVX A;  2OWO A;  3JPS A;  2A1J B;  4YMM A;  4J9O A;  5DG8 A;  3PMN A;  5KFY A;  9ICB A;  3G6X A;  3M9M B;  5D46 A;  4AT9 B;  3M8R A;  2DVI A;  2ZHA A;  8ICE A;  1UT8 A;  3H38 A;  4YVZ A;  4GC7 A;  1ZQH A;  4Q8F A;  2HHS A;  1TAQ A;  2W9C B;  1BPE A;  3AQK A;  5IIM A;  2XY6 A;  4I29 A;  4KLJ A;  9ICW A;  1NK4 A;  2KFZ A;  4Z6D A;  5KFB A;  8ICX A;  4X4P A;  3HX0 A;  5J2E A;  2BCU A;  3H8S A;  4NXZ A;  3JPN A;  3MR6 A;  3Q8M A;  3B0X A;  3JPQ A;  2XCA A;  4J9M A;  4FBT A;  1L3V A;  1DGS A;  1ZQE A;  4B9U A;  4M47 A;  9ICE A;  2H5X A;  3AQM A;  4K4H A;  4C8L A;  4FHV A;  2VA3 A;  3ISD A;  4R63 A;  2RDJ A;  3V72 A;  7ICN A;  2P66 A;  4YQW A;  4M9L A;  2M2U A;  3UPS A;  1Y88 A;  3EYZ A;  4ED3 A;  4ED6 A;  3RR8 A;  3V7J A;  5HR9 A;  4F5P A;  3UXN A;  4F5R A;  4BXO A;  2BKE A;  5CP2 A;  3RH6 A;  4DS4 A;  8ICA A;  4DSJ A;  4LZG A;  2PBE A;  1TK8 A;  4DOC A;  1UT5 A;  1Q79 A;  1NK8 A;  3RTV A;  7ICQ A;  5CHG A;  3WFQ E;  1NJY A;  4E7X A;  4O3P A;  3TFR A;  4I2E A;  1Z00 A;  5EWF A;  2ZTE A;  5KFM A;  3AQL A;  2P6U A;  4UAZ A;  1JXE A;  2FMS A;  4RNM A;  4YXM A;  3Q8K A;  2ZUC A;  3M8S A;  2ZH2 A;  4MF2 A;  1S0M A;  4DL7 A;  5KG7 A;  2HVI A;  4MEY A;  7ICO A;  4RT3 A;  3QZ8 A;  4C8K A;  3GV5 B;  5J2G A;  1SKS A;  8ICW A;  3ETL A;  2J6U A;  3AU6 A;  4QZG A;  5KFD A;  4FHP A;  3C18 A;  1ZQW A;  5J2D A;  1JX4 A;  2R8G A;  3PO5 A;  4UB4 A;  5KT2 A;  5C5J A;  3BQ1 A;  4BGD A;  3OSN A;  5KFS A;  1SZP A;  1TK5 A;  4JV1 A;  4O3S A;  1ZQC A;  5J0O A;  8ICZ A;  4M2Y A;  3OHB A;  4DF8 A;  1MIW A;  5KG0 A;  3K75 D;  3Q8L A;  2DR7 A;  4KLI A;  9ICA A;  3TAP A;  3C66 A;  1LB2 B;  3ORY A;  4DQQ A;  1TFR A;  2KZZ A;  2KZM A;  4RZR A;  1RYR A;  3RJF A;  3PX0 A;  2IA6 A;  4AT8 B;  3C5G A;  3UXP A;  1NK0 A;  2V9W A;  4EZ9 A;  4KLL A;  4E8F A;  5J2I A;  1COO A;  2JEJ A;  1ZQU A;  5J0X A;  4O5C A;  4ECW A;  3LDA A;  4RQ4 A;  4J9Q A;  4MFA A;  3TAR A;  7ICF A;  2HHW A;  5KG6 A;  1ZQP A;  5HHI A;  7ICG A;  4PHA A;  2WTF A;  3MAB A;  3ZDA A;  4NLN A;  2IHN A;  4DSI A;  3HJ1 A;  4XQ8 A;  5J2F A;  3RB6 A;  9ICC A;  3WFR E;  4P2H A;  2PFP A;  5DG7 A;  2W9C A;  4KLM A;  3KHG A;  3PW2 A;  3GIK A;  2NRW A;  1NKB A;  1U45 A;  8ICV A;  4DQR A;  1MIY A;  4B9M A;  2M2V A;  3PML A;  3MGH A;  5J29 A;  2XGQ A;  1SL0 A;  3HP6 A;  1ARO P;  4ATB B;  3Q8P B;  3AUO A;  4I2I A;  3PW0 A;  7ICK A;  4WC2 A;  4M9G A;  4FH5 A;  4ZH4 A;  3C2K A;  1DOQ A;  5DQG A;  5KFK A;  1B43 A;  5KFW A;  5L9X A;  2ZH8 A;  5J0P A;  1SL1 A;  1BPB A;  1XSN A;  4DL5 A;  2FLL A;  4NM2 A;  5DG9 A;  1ZQX A;  1UEU A;  3KHL A;  4B9S A;  1DK2 A;  4YR0 A;  1HJP A;  3EWA A;  5KT4 A;  5DBC A;  7ICP A;  4FHY A;  4E80 A;  2ZH1 A;  4QZ8 A;  4DLE A;  5DB8 A;  8ICQ A;  1XWL A;  4WC3 A;  3HJ4 A;  4EBE A;  1UA0 A;  4JV2 A;  3RB0 A;  2KTQ A;  2AQ0 A;  1Q78 A;  5DQH A;  4QZI A;  2I1Q A;  3PX4 A;  7ICS A;  8ICM A;  3MFI A;  9ICO A;  2BCV A;  4KMU A;  4Z6E A;  3NYB A;  4DFK A;  1XS9 D;  1C7Y A;  1NOM A;  4RWP A;  4IQT A;  8ICR A;  5L1J A;  4O9M A;  4RQ1 A;  8ICS A;  4P4O A;  1PZN A;  1T4G A;  5J2B A;  2KN7 A;  4F5N A;  4UAW A;  4EYH B;  2C2D A;  5J0R A;  1NJW A;  1YLQ A;  5J0T A;  3MR5 A;  3LWM A;  2FPM A;  2XY7 A;  3GIJ A;  4WBY A;  4UB5 A;  1ZQN A;  3H4D A;  2BPC A;  4QWB A;  1ZQT A;  8ICG A;  1BVS A;  1ZYQ A;  3EZ5 A;  1R8A A;  3OUY A;  5KFJ A;  2ID1 A;  4F93 B;  2NRT A;  4ELU A;  4Q44 A;  4UB1 A;  4F50 A;  5HRI A;  2BQ3 A;  1TV9 A;  4MEX A;  4KLG A;  4MFC A;  4X0A A;  1WCN A;  5J0S A;  2HHV A;  1S9F A;  1A77 A;  2BR0 A;  2PXI A;  4TUR A;  4M5D A;  3JZ0 A;  3BQT A;  1RXW A;  1SKW A;  2M2W A;  4K4I A;  4QZF A;  1VFG A;  3PR4 A;  3BQ0 A;  1RYS A;  1S97 A;  2XC9 A;  2ASD A;  3MDC A;  1L5U A;  1S0V A;  4RNN A;  5HP4 A;  1ZQO A;  4YD1 A;  4NLZ A;  4YFK A;  3H37 A;  2DR8 A;  1R8C A;  3C1Z A;  4F5Q A;  1N56 A;  3KHH A;  4UQG A;  1FA0 A;  2NRX A;  4XQ7 A;  3WFS C;  5DDY A;  4J9L A;  4KTQ A;  4XA5 A;  2BQU A;  1R89 A;  3FDS A;  1ZJN A;  3WFP A;  4X5V A;  3OVA A;  1KTQ A;  2XY5 A;  4GC6 A;  3OVS A;  2HHT A;  4X4Q A;  4QWC A;  5DLF A;  5CA7 A;  1ZQF A;  2R8H A;  1ZQJ A;  1ZQB A;  3BDP A;  1WOT A;  4UB3 A;  4C8O A;  4Q45 A;  1QSY A;  4M9J A;  3H7I A;  4EZ6 A;  7ICM A;  4DSL A;  3MFH A;  3ZDB A;  4M6W A;  3MBY A;  1JXL A;  5D4B A;  2C28 A;  2HHP A;  1U9L A;  2B21 A;  4QZE A;  4TQR A;  1RXV A;  5HRG A;  3L9D A;  5DB9 A;  5KFP A;  2JEG A;  5KT5 A;  3T5J A;  5J2A A;  1UET A;  3GV8 B;  1ZQV A;  1R8B A;  1WCL A;  9ICX A;  1ZQZ A;  1X2I A;  4O5E A;  4F4X A;  3T5L A;  3PV8 A;  4DL6 A;  3PY8 A;  1OU5 A;  2M9N A;  4X0B A;  4DEZ A;  4NY8 A;  1A76 A;  1MC8 A;  3C1Y A;  2XGP A;  2BGW A;  3RRH A;  3RRG A;  3EW9 A;  4I2B A;  8ICJ A;  2ALZ A;  1BPY A;  3Q8S B;  3H8W A;  3ZDD A;  2MUT A;  4DSK A;  4O3R A;  4AT9 A;  5DLG A;  3UQ2 A;  4M04 A;  5DKW A;  2FMQ A;  3RJJ A;  5D49 A;  9ICI A;  3IM1 A;  4WC6 A;  2J6S A;  2BHN A;  4KLS A;  4RT2 A;  4JK1 A;  4M9N A;  1NZP A;  2O5A A;  4WC4 A;  4ATB A;  5KFR A;  1ZQD A;  1ZQQ A;  2Q66 A;  8ICT A;  4DSF A;  4ECT A;  4GXI A;  1Z00 B;  4UAY A;  2R8K A;  1BGX T;  5J2H A;  5L1K A;  1XSP A;  3RJG A;  4X4U A;  4PHD A;  4Q43 A;  3C5F A;  1U4B A;  1X9S A;  4YD2 A;  1ZQY A;  3G6V A;  3QEA Z;  1X9M A;  4F2S A;  1KRP A;  2ZH5 A;  4KLU A;  1TK0 A;  3GFK B;  4I2F A;  4Z6F A;  3QE9 Y;  2HHU A;  2ZHB A;  4KLT A;  4I2A A;  4F4K A;  3LWL A;  3NTU A;  4NLK A;  4IRD A;  7ICR A;  4WC1 A;  4X4S A;  3G6Y A;  3AQN A;  4UD5 A;  2MAX A;  4O5K A;  2AU0 A;  3V6K A;  2NRV A;  3T5H A;  3RB4 A;  4I2J A;  5KFV A;  1D8Y A;  2ISO A;  4I2H A;  5HMM A;  2ZJ8 A;  4I2C A;  4QZA A;  2C22 A;  5KFN A;  2PFN A;  4E0D A;  4KLH A;  1TFY A;  1NKC A;  4QZB A;  1MQ2 A;  2BCR A;  4IRK A;  1S10 A;  5HRH A;  5F2V O;  1U47 A;  4IR9 A;  3RAX A;  4UBB A;  2W8K A;  4EYI B;  3PW4 A;  4JWN A;  3E2E A;  3EPI A;  4F5O A;  3QZ7 A;  2I9G A;  3H8J A;  5KFA A;  1CUK A;  4PHP A;  4DL3 A;  4C8N A;  2J6T A;  4BWM A;  5J2J A;  1VJ7 A;  1HUO A;  3LK9 A;  3RJH A;  3N4M B;  1BNP A;  1RPL A;  4FBU A;  3GDX A;  4WC5 A;  4X4R A;  1HUZ A;  2VA8 A;  4PH5 A;  3MR2 A;  3K4G A;  4TUP A;  2RDI A;  4G3I A;  4AT7 A;  1PX5 A;  1X9W A;  8ICN A;  4BWJ A;  4UB2 A;  4RU9 A;  4BDP A;  4FHX A;  4RWQ A;  4NM1 A;  4EBD A;  5CWR A;  3NGD A;  3ISC A;  1KFS A;  1ZQI A;  5KFH A;  1NKE A;  4KLO A;  5KFQ A;  4O3O A;  4PGQ A;  2W9B B;  4DLG A;  1JIH A;  4EBC A;  2UVV A;  1TAU A;  4LT6 A;  3WFO A;  4F3O A;  4I2G A;  4NKT A;  3MDA A;  3UPQ A;  3T3F A;  1TFW A;  4X4V A;  1S76 D;  5KG2 A;  4M9H A;  2DR5 A;  1KDH A;  3RJK A;  1CEZ A;  8ICP A;  2W9B A;  1IM4 A;  5JUM A;  1RZT A;  1XO1 A;  1TKD A;  4RPX A;  5L1I A;  1UA1 A;  5KG5 A;  2PI4 A;  8ICO A;  1L3S A;  2HHQ A;  1L3T A;  5HRE A;  1IXR A;  4DL4 A;  5KG3 A;  4KLE A;  5EOZ A;  4R66 A;  4K4G A;  2M2T A;  4AT7 B;  4S3N A;  2ZH9 A;  4PHE A;  1QTM A;  5J2C A;  5III A;  1ZQK A;  4ECZ A;  5HML A;  3OJS A;  5BPC A;  3RJI A;  1U49 A;  4YCX A;  3RBE A;  4YG2 A;  5KTQ A;  5CR0 A;  2ZTD A;  5HRF A;  3KHR A;  2F1I A;  4F4W A;  3Q8R B;  5EWE A;  4P4P A;  3OJU A;  9ICG A;  8ICH A;  3GII A;  3RBD A;  3UQ0 A;  4ECQ A;  4JV0 A;  5IIJ A;  4QW8 A;  4LVS A;  5KFL A;  1KFD A;  4ECX A;  4IRC A;  5KFC A;  5EWG A;  5CB1 A;  4DWI A;  5BOL A;  4UD4 A;  4J9S A;  8ICK A;  4I2D A;  3IHQ B;  4IQU A;  4MF8 A;  4X4T A;  4JUZ A;  2ASL A;  4WC7 A;  2V4Q A;  2RFF A;  2Y1J A;  4EEY A;  4QZC A;  4M6W B;  9ICU A;  2V4R A;  3JYY A;  5DED A;  4UBC A;  2HVH A;  3H39 A;  4WCW A;  5DB7 A;  4P4M A;  3HWT A;  3KTQ A;  9ICQ A;  1BNO A;  3HT3 A;  4ECV A;  2BE3 A;  3GV7 B;  3V7L A;  5CJ7 A;  4R8U A;  4RPZ A;  1QSL A;  7ICT A;  4WBZ A;  4RUC A;  2KP7 A;  3GIL A;  5HNK A;  2ZH3 A;  1XU4 A;  2ATL A;  4JWM A;  1V9P A;  2ZJA A;  4YMN A;  4GXK A;  4CCH A;  4IR1 A;  4I27 A;  5TZV A;  8ICY A;  1D9D A;  5DEC A;  4RPY A;  1T8E A;  4Q8E A;  4QW9 A;  2BPG A;  5J0Q A;  4Z6C A;  1JN3 A;  5KFG A;  5F9L A;  4GXJ A;  4B9V A;  4QWD A;  4FH3 A;  3ZDE A;  4KIT B;  4YP3 A;  4TUQ A;  5L1L A;  4DSE A;  4DFJ A;  4ELV A;  4NKU A;  3H4B A;  3SZ2 A;  5KFI A;  9ICK A;  3V6H A;  2P6R A;  2MUT B;  4RQ3 A;  3JPP A;  4J9N A;  1L3U A;  5HRK A;  4ED0 A;  4RWN A;  4WC0 A;  3ISB A;  9ICH A;  1ZQG A;  3JPO A;  3UXO A;  2JZB A;  4F2R A;  3RH5 A;  2PFQ A;  4ED7 A;  3PNC A;  2W8L A;  3PW7 A;  2VA2 A;  5HC9 A;  2ZUB A;  2JZB B;  3OSP A;  4MFF A;  3B0Y A;  4PGX A;  5F9N A;  2JEI A;  3OGU A;  4QZH A;  7ICU A;  4X4O A;  2ZTC A;  3HIY A;  2PI5 A;  4QZ9 A;  4FS1 A;  5DGA A;  2IHM A;  8ICB A;  3M9N B;  1T7P A;  4EP7 A;  9ICR A;  3ZD9 A;  2DFL A;  3SV3 A;  1ZJM A;  7ICV A;  8ICF A;  1D9F A;  1U48 A;  4FS2 A;  1EXN A;  2VAN A;  4DS5 A;  1LV5 A;  3QEB Z;  3RH4 A;  1DK3 A;  3PR5 B;  1S0N A;  4DQP A;  1NO5 A;  3H3A A;  5HRL A;  7ICH A;  4TQS A;  4KLF A;  9ICS A;  5KFE A;  3TQ1 A;  1NK9 A;  2BCS A;  2C2E A;  4FHW A;  4YR3 A;  2ISP A;  5J0W A;  3TAN A;  4RQ5 A;  2C2R A;  4ED2 A;  7ICJ A;  1ZQR A;  1SKR A;  5BOM A;  3OHA A;  2FLP A;  2ZH7 A;  3C2L A;  1ZQL A;  2GWS A;  3RR7 A;  1KSP A;  3RJE A;  3Q8Q B;  4ED1 A;  3TFS A;  2BPF A;  4RQ7 A;  4R65 A;  5KT3 A;  4J9R A;  2AJQ A;  1ZQS A;  4F91 B;  3THV A;  1S77 D;  4X4N A;  8ICL A;  2Y1I A;  4B9N A;  5KFX A;  4ED8 A;  3SI8 A;  4DOA A;  4RUA A;  4KLD A;  9ICF A;  2W9M A;  2W9A A;  2FLN A;  2R8I A;  9ICL A;  2AGP A;  3BQ2 A;  3GIM A;  3SV4 A;  4DQS A;  1JAJ A;  2KFN A;  5IIL A;  2DR9 A;  5KFZ A;  8ICC A;  4KLQ A;  4RQ6 A;  4GLX A;  1MIV A;  2ZUD A;  2IBK A;  2R8J A;  5KFT A;  8ICU A;  1XSL A;  4XUS A;  4IQW A;  5KG4 A;  3TAQ A; 
#chains in the Genus database with same CATH topology
 5KFU A;  3EPG A;  2WF8 A;  4DF4 A;  1NK7 A;  3ZDC A;  5AI8 A;  2NRK A;  2ZH6 A;  1SL2 A;  1WUD A;  5H2F U;  4NLG A;  3H0R B;  2IMW P;  3AU2 A;  1Z3E B;  2F1J A;  2BQR A;  4ELT A;  1MSW D;  5T14 A;  5DDM A;  4ECU A;  1ZQA A;  1IIP A;  2IHO A;  4K9A A;  4HYK A;  4P0Q B;  1X40 A;  1PVQ A;  3TAD A;  4DFP A;  3PX6 A;  2F1H A;  2GAF D;  2KKV A;  5KFF A;  3C23 A;  1ZD5 A;  4FZN A;  4K96 A;  5AM1 A;  2ZH4 A;  1TVA A;  4FE3 A;  5ALQ A;  4F92 B;  5E79 U;  4BXO B;  2Q0Z X;  5HRD A;  4I28 A;  1YT3 A;  4NL9 A;  4J9P A;  2AGO A;  3KBB A;  2HW3 A;  2BCQ A;  1L7P A;  5KT6 A;  5GTI U;  1NJZ A;  3RAQ A;  4NV0 A;  1N2X A;  2W54 A;  3ER8 C;  5KT7 A;  4YMO A;  5J0Y A;  2PFO A;  1OXJ A;  1BPZ A;  4DL2 A;  2UVW A;  3V6J A;  2ODG A;  3SD7 A;  1V4A A;  2KZ3 A;  5F3X B;  4RQ8 A;  1UEV A;  3PW5 A;  5ALI A;  4XRH A;  4QWA A;  4FZM A;  2JEF A;  1S8O A;  4YMM A;  2CRX A;  4JMU A;  2G06 A;  3G6X A;  3PSP A;  8ICE A;  3ERC C;  4YVZ A;  4GC7 A;  1ZQH A;  1BPE A;  4KLJ A;  8ICX A;  1QCK A;  4Z6D A;  5KFB A;  4X4P A;  3Q8M A;  2IOH A;  2KJ9 A;  4OAG A;  5ALE A;  4R63 A;  3V72 A;  1RYU A;  4M9L A;  4ED6 A;  3V7J A;  3UXN A;  1B0X A;  4NLB A;  4LZG A;  2PBE A;  4DOC A;  1UT5 A;  1J2M A;  3WFQ E;  4I2E A;  4WQK A;  2ZTE A;  1ZD2 P;  3NVZ A;  3IG5 A;  2ZIV B;  4MF2 A;  5JRT A;  3GV5 B;  2MA1 A;  2J6U A;  3AU6 A;  1L7N A;  3C18 A;  4A8E A;  4UB4 A;  1TK5 A;  4C4S A;  4C80 A;  4K8V A;  4O3S A;  4OAH A;  5J0O A;  3OHB A;  1KQQ A;  5KG0 A;  1DXS A;  3TAP A;  3C66 A;  1J97 A;  1TFR A;  4RQN A;  2KZM A;  2E8M A;  1PK3 A;  3C5G A;  2V9W A;  4EZ9 A;  2Y0S F;  4E8F A;  5J2I A;  1T94 A;  4O5C A;  4ECW A;  2EWR A;  2PMZ F;  4MFA A;  3TAR A;  3ZDA A;  3HJ1 A;  5J2F A;  3RB6 A;  5ALO A;  2Y0S C;  4KLM A;  3GIK A;  3QXG A;  1U45 A;  3SAF A;  4DQR A;  2LI6 A;  3MGH A;  3HP6 A;  2F76 X;  2MRL A;  1ARO P;  4ATB B;  2KNJ A;  3Q8P B;  3AUO A;  4I2I A;  4ZH4 A;  4AYB F;  3C2K A;  1DOQ A;  5DQG A;  5KFK A;  1B43 A;  3RF9 A;  5KFW A;  2K4I A;  3NRZ A;  1WYG A;  3D2N A;  4NM2 A;  1SXE A;  4B9S A;  1T3Q A;  5DBC A;  4E80 A;  3HJ4 A;  3KKA C;  4JV2 A;  2LKY A;  2AQ0 A;  1Q78 A;  3PX4 A;  4US8 A;  2H3Q A;  2FDR A;  2EAN A;  3NYB A;  4DFK A;  4GFJ A;  5AK5 A;  2YTU A;  1SV4 A;  4O9M A;  1PZN A;  4UAW A;  5J0R A;  5J0T A;  2QAR A;  1OUQ A;  1SV0 A;  1ZQN A;  3H4D A;  1L6N A;  4ELU A;  3FC4 A;  4Y2P A;  1LKY B;  2GO7 A;  4MFC A;  4X0A A;  1A77 A;  2BR0 A;  4TUR A;  3BQ0 A;  1RYS A;  3MDC A;  1L5U A;  4YD1 A;  4YFK A;  3I28 A;  3WFS C;  2W7O A;  4US9 A;  4KTQ A;  2BQU A;  4Y2J A;  4EEK A;  1R89 A;  3FDS A;  4X5V A;  2XY5 A;  1CI4 A;  5CA7 A;  2R8H A;  3BS5 A;  5AKX A;  1ZQB A;  4UB3 A;  4Q45 A;  2EQY A;  1QSY A;  2WHE A;  1JXL A;  2C28 A;  2JEG A;  4NXW A;  5KT5 A;  3QUC A;  1UET A;  4C4R A;  1R8B A;  2EAP A;  4EGW A;  3OPX A;  2YB4 A;  3T5L A;  1A76 A;  1MC8 A;  3H8W A;  5EE1 A;  4O3R A;  2G08 A;  5D49 A;  2O5A A;  4JK1 A;  4WC4 A;  1A6S A;  2KE7 A;  3UMB A;  4ECT A;  2ZIW A;  3RJG A;  2JGA A;  3L4P A;  1U4B A;  4P0Q A;  3G6V A;  1X9M A;  5HR7 A;  3GFK B;  4KLT A;  4F4K A;  4O5K A;  4I2H A;  3T5H A;  4I2J A;  5KFN A;  1UHU A;  5AK6 A;  4IRK A;  3PSF A;  5HRH A;  4PL2 A;  2W8K A;  5AI5 A;  3EPI A;  4F5O A;  4N7R A;  5KFA A;  2KIW A;  1CUK A;  3H0L B;  4C8N A;  5J2J A;  3RJH A;  4FBU A;  4WC5 A;  4GIB A;  4PH5 A;  4K9B A;  4UAU A;  4AP9 A;  2KVS A;  3ZI4 A;  4BDP A;  3FM9 A;  4RWQ A;  1SGG A;  4OD0 A;  1NKE A;  1JIH A;  4I2G A;  4NKT A;  1S76 D;  5KG2 A;  1KDH A;  2K8B B;  2OYY A;  2ZXI A;  2A1A A;  4FFD A;  1IV8 A;  2MSN A;  4EEN A;  1XO1 A;  1TKD A;  8ICO A;  2HHQ A;  1L3T A;  1O03 A;  2M2T A;  5KG3 A;  4K4G A;  4AT7 B;  4PHE A;  4ECZ A;  5HML A;  5BPC A;  2W03 A;  1U49 A;  4WH5 A;  5CR0 A;  9ICG A;  1GO3 F;  2DBY A;  5JU5 A;  3D2S A;  1PK1 A;  2HMX A;  4CE6 A;  3O0F A;  4UD4 A;  3IDW A;  8ICK A;  4X4T A;  2V4Q A;  9ICU A;  3JYY A;  2HVH A;  3GV7 B;  3V7L A;  4WBZ A;  3GIL A;  5HNK A;  3LQC B;  4JWM A;  2ZJA A;  4IR1 A;  5TZV A;  3JCF A;  1D9D A;  1T8E A;  1JN3 A;  4QWD A;  1F5S A;  4YP3 A;  4DFJ A;  4ACO A;  4LEV A;  3SZ2 A;  1QH9 A;  2P6R A;  4KB6 A;  2H3Z A;  4WC0 A;  2W8L A;  3PW7 A;  2CN1 A;  3B0Y A;  3SAH A;  2XIC A;  1V97 A;  2ZTC A;  2IHM A;  9ICR A;  3ZD9 A;  7ICV A;  4NXV A;  1D9F A;  1LV5 A;  5AKL A;  2QB0 A;  2E5S A;  1NO5 A;  3L3F X;  5HRL A;  2BCS A;  3TQ1 A;  4FHW A;  4YR3 A;  3SR6 A;  5J0W A;  4KM5 A;  2ZH7 A;  3OHA A;  2W04 A;  4CNQ A;  1N5X A;  3C2L A;  1ZQL A;  4Y2U A;  3RJE A;  3EUB 2;  4C7Z A;  5AM2 A;  2DQN B;  4X4N A;  8ICL A;  2Y1I A;  2E1E A;  2R8I A;  2KV2 A;  5KFZ A;  1XO0 A;  8ICC A;  2ZUD A;  2IBK A;  4ICA A;  5KFT A;  2ZIU B;  1RM6 C;  1KNY A;  4OJP A;  1RQL A;  4FO6 A;  3PO4 A;  2HHX A;  1S5L U;  5CFS A;  9ICJ A;  2KHQ A;  5TIS U;  1XC9 A;  4NWI A;  5AHX A;  5HHH A;  1NK5 A;  1UCV A;  4IC9 A;  2FPK A;  1PK1 B;  4EBJ A;  4QWE A;  4Y2Q A;  3K7D A;  4ECY A;  1KKX A;  3MGI A;  3QU4 A;  2E8N A;  2K4P A;  3T5K A;  4KN4 A;  4PJ0 U;  5J0U A;  2XCP A;  3FYH A;  2LYH A;  4YR2 A;  2B6G A;  4O3N A;  4J03 A;  4WQL A;  1RQN A;  9ICV A;  3V7K A;  4DO9 A;  2DRA A;  2DF4 B;  3TKA A;  4KN7 A;  3ZD8 A;  5C0Y A;  2G5H B;  1H38 A;  1JMS A;  1C20 A;  1QLN A;  4CF4 A;  2HSZ A;  4O0I A;  4ECS A;  4I2F A;  4R8U B;  5DBB A;  4RQ0 A;  3H40 A;  3E58 A;  2ASJ A;  3OV7 A;  2LM1 A;  3U26 A;  4M0A A;  2AGQ A;  3GQC A;  5B3P A;  4F4Z A;  4ECR A;  3PVX A;  2A1J B;  1OW5 A;  1N62 A;  4J9O A;  4AT9 B;  2ZHA A;  1UT8 A;  2YX8 A;  2HHS A;  2W9C B;  3AQK A;  9ICW A;  4OO1 J;  2KFZ A;  3WK7 A;  3WKD A;  2BCU A;  3VCB A;  2GLE A;  3IP4 B;  3B0X A;  4J9M A;  4FBT A;  1ZQE A;  1KW4 A;  1UPH A;  4C8L A;  2VA3 A;  2F77 X;  5G5G A;  3ISD A;  1N61 A;  2RDJ A;  4MKP A;  5KAI U;  2P66 A;  2M2U A;  1NI3 A;  1Y88 A;  3EYZ A;  5HR9 A;  4F5R A;  2BKE A;  1TK8 A;  1Q79 A;  3RTV A;  5ALK A;  5CHG A;  3TFR A;  1L8O A;  5AK3 A;  1JXE A;  2ZUC A;  4UAR A;  2JHD A;  2HVI A;  4C8K A;  8ICW A;  2IOF K;  2G5I B;  2W55 A;  1ZQW A;  5J2D A;  1JX4 A;  2R8G A;  2DKX A;  3J81 j;  3OSN A;  3KKA A;  2RHF A;  2RRD A;  4M2Y A;  5AKI A;  3K75 D;  3ORY A;  4DQQ A;  5KL8 B;  4P0P B;  2HBM A;  2BZF A;  1RYR A;  2RP5 A;  4AT8 B;  1P7D A;  4KLL A;  4ZOH C;  2JEJ A;  5J0X A;  3LDA A;  4J9Q A;  2HHW A;  4O69 A;  7ICG A;  2WTF A;  5ALZ A;  2IHN A;  4DSI A;  9ICC A;  3WFR E;  4P2H A;  2EAO A;  5DG7 A;  2W9C A;  3KHG A;  3PW2 A;  4LEW A;  2XGQ A;  2QB1 A;  4WC2 A;  4M9G A;  4FH5 A;  2QB0 B;  5L1M A;  3GU3 A;  2EH9 A;  1BPB A;  4DL5 A;  3BZC A;  4EEB A;  3KHL A;  5ALN A;  2FJ6 A;  4P0P A;  4QZ8 A;  1XWL A;  5AM3 A;  1UA0 A;  2KTQ A;  3F2B A;  3AL0 B;  4QZI A;  8ICM A;  3NAS A;  9ICO A;  1DGJ A;  1XS9 D;  1WWV A;  2G07 A;  4IQT A;  5L1J A;  1WG8 A;  5J2B A;  4F5N A;  3VC8 A;  1YLQ A;  4UAT A;  1Z4O A;  4WBY A;  3GIJ A;  2BPC A;  8ICG A;  3OUY A;  1R8A A;  2ID1 A;  4Q44 A;  4MEX A;  3SMV A;  3WKA A;  4M5D A;  3D6J A;  2HBL A;  3MC1 A;  3PR4 A;  3KFU F;  2KSO B;  5ALM A;  3F2D A;  1SWW A;  2ZIU A;  5HP4 A;  3H37 A;  2DR8 A;  1R8C A;  2H3V A;  2NRX A;  4XQ7 A;  5DDY A;  2OXO A;  2GOL A;  1ZJN A;  1KTQ A;  3OVS A;  3NRW A;  4M9J A;  4EZ6 A;  1K5O A;  2HHP A;  5D4B A;  2B21 A;  4QZE A;  5HRG A;  3L9D A;  5DB9 A;  3T5J A;  3GV8 B;  3A0B U;  1ZOL A;  1ZQZ A;  1X2I A;  3ETR A;  1OU5 A;  2FCL A;  2M9N A;  3NUQ A;  4NY8 A;  1FIQ A;  3C1Y A;  3RRH A;  4I2B A;  8ICJ A;  2ALZ A;  4PZO A;  3ZDD A;  4DSK A;  4AT9 A;  5DLG A;  3UQ2 A;  5DKW A;  3RJJ A;  4WC6 A;  2J6S A;  1Z1V A;  2NO5 A;  1KBU A;  4ATB A;  1ZQD A;  1ZQQ A;  2AXT U;  4QNL A;  4GXI A;  3WU2 U;  2R8K A;  1XSP A;  2DL0 A;  2KVC A;  4X4U A;  4PHD A;  4Q43 A;  1X9S A;  4F2S A;  3AEV A;  1KRP A;  1WWU A;  2WB1 C;  3QE9 Y;  2HHU A;  2E8P A;  2DKZ A;  3NVV A;  1DRG A;  3NTU A;  3G6Y A;  3AQN A;  3PHZ A;  2AHO B;  2NRV A;  2ISO A;  2ZJ8 A;  4I2C A;  4QZA A;  2C22 A;  4E0D A;  4KLH A;  2YMP A;  4KX3 A;  4QZB A;  2BCR A;  2HI0 A;  5ALS A;  5F2V O;  1U47 A;  4EYI B;  3E2E A;  1JRP A;  4JLZ A;  2I9G A;  2J6T A;  1Q3V A;  2F8L A;  3D2Q A;  3N4M B;  4X4R A;  2N1R A;  2QAR B;  2RDI A;  5ALY A;  1X9W A;  4UB2 A;  4NM1 A;  4EBD A;  3NGD A;  2UVV A;  4LT6 A;  4EBC A;  5AK4 A;  2KG5 A;  1Z4N A;  3UPQ A;  2HN2 A;  2BDU A;  4X4V A;  3GZF A;  5JUM A;  1IM4 A;  3AN1 A;  3QUQ A;  5L1I A;  1UA1 A;  2PI4 A;  3WK6 A;  1X42 A;  3PST A;  4DL4 A;  1SWV A;  3OJS A;  4YCX A;  3RBE A;  1QQ6 A;  5ALG A;  4F4W A;  4P4P A;  2E3T A;  3RBD A;  5IIJ A;  3TAD C;  1KFD A;  2F44 A;  4IRC A;  5KFC A;  4OAF A;  4I2D A;  4IQU A;  4MF8 A;  1SV0 C;  3CW2 C;  4USA A;  4JUZ A;  4C7Y A;  2RFF A;  5AIB A;  2E1F A;  4M6W B;  4OCZ A;  2K4H A;  2V4R A;  5DED A;  3KTQ A;  1BNO A;  4R8U A;  4CDG A;  2EZZ A;  2KP7 A;  4RUC A;  2ZH3 A;  1XU4 A;  2ATL A;  2W3R A;  4RPY A;  2IOF A;  2BPG A;  4Z6C A;  5F9L A;  1N60 A;  5KNI A;  3UMG A;  5L1L A;  1ECW A;  3V6H A;  3EF2 A;  3JPP A;  4RQ3 A;  1V38 A;  1ZQG A;  3JPO A;  3HKZ C;  2PFQ A;  4ED7 A;  5AKZ A;  2HCF A;  2VA2 A;  2JZB B;  2JEI A;  2FI1 A;  2XVT A;  4QZH A;  4X4O A;  2Q4T A;  3HIY A;  2PI5 A;  4FS1 A;  4HAI A;  3WKE A;  8ICF A;  4DS5 A;  5AM0 A;  3QEB Z;  3RH4 A;  1DK3 A;  3H3A A;  3NVO A;  7ICH A;  9ICS A;  5KFE A;  1NK9 A;  5ALL A;  2ISP A;  4ED2 A;  1ZQR A;  2KOB A;  1F0M A;  4ED1 A;  3TFS A;  3C29 A;  4RQ7 A;  4R65 A;  2LM4 A;  2AJQ A;  2KJ8 A;  1ZQS A;  2W11 A;  4F91 B;  1S77 D;  1N5W A;  4ED8 A;  3SI8 A;  4I0U A;  3UM9 A;  3N7R C;  2W9A A;  1JAJ A;  5IIL A;  3N28 A;  4Y2R A;  3DEE A;  4KLQ A;  2R8J A;  1XSL A;  2JV3 A;  4IQW A;  2KD1 A;  2DRB A;  2XO7 A;  2DPI A;  5IIN A;  5HRB A;  3MR3 A;  4NXT A;  4TUS A;  3AQE A;  5IIO A;  4DQI A;  4IS7 A;  9ICM A;  3BS5 B;  7ICL A;  4J9K A;  4U6P A;  2OEH A;  2OHF A;  4EEL A;  3M9O B;  1ZQM A;  1KEJ A;  2HBK A;  3F5E A;  5DBA A;  2WAQ F;  5KG1 A;  2UVU A;  7ICI A;  1BPD A;  4C8M A;  2ZG6 A;  3N97 B;  4LZD A;  4AT8 A;  4EED A;  1QSS A;  2ZXH A;  3OVB A;  3A0H U;  4O3M A;  1B22 A;  2FPL A;  2VIX A;  3C21 A;  5DB6 A;  1T3N A;  1Q3U A;  2FMP A;  4F8R A;  2KIC A;  3SEI A;  4CF3 A;  1ZD3 A;  4IQV A;  4EV6 A;  2ZJ5 A;  2ES6 A;  4B9L A;  3BJY A;  5IIK A;  2NRZ A;  1F5A A;  4OJL A;  2EAM A;  1BPX A;  5EE3 A;  2MU2 A;  3HW8 A;  2QLT A;  3JPS A;  3NKU A;  3H0M B;  3H38 A;  1FO4 A;  1TAQ A;  5J8Y A;  5IIM A;  4I29 A;  3PZP A;  1NK4 A;  5J2E A;  3H8S A;  3MR6 A;  3JPQ A;  5CHE A;  2JH1 A;  4M47 A;  2H5X A;  3AQM A;  4K4H A;  4FHV A;  3UPS A;  2JRZ A;  1YZ6 A;  4ED3 A;  3HIL A;  3RR8 A;  4F5P A;  2PMZ C;  4BXO A;  5ALW A;  3RH6 A;  4DS4 A;  8ICA A;  2RQ5 A;  4DSJ A;  1NJY A;  4O3P A;  1Z00 A;  5EWF A;  3AQL A;  2YQE A;  2P6U A;  5G5H A;  4U7C A;  3WK4 A;  4RNM A;  4YXM A;  3Q8K A;  2FMS A;  2KEY A;  3M8S A;  2ZH2 A;  3ALR A;  5KG7 A;  2Y9U A;  5J2G A;  1A0P A;  2WF5 A;  4QZG A;  4FHP A;  5KT2 A;  5C5J A;  4BGD A;  5KFS A;  1SZP A;  4JV1 A;  1ZQC A;  5ALU A;  3Q8L A;  2KZZ A;  2I5H A;  4RZR A;  2YY6 A;  3PX0 A;  2IA6 A;  3UXP A;  1NK0 A;  2B0C A;  2FE9 A;  1ZQU A;  4IL6 U;  2CXY A;  1UQV A;  5HHI A;  1ZQP A;  4NLN A;  3MAB A;  4XQ8 A;  5A0L A;  5AKJ A;  2PFP A;  3IN5 A;  4UW9 A;  3AMZ A;  1NKB A;  2BBJ A;  4B9M A;  4KX5 A;  2M2V A;  3PML A;  1SL0 A;  5ALR A;  3PW0 A;  5D62 A;  4CGZ A;  1X6J A;  1VDV A;  5AKH A;  2ZH8 A;  5J0P A;  1SL1 A;  1XSN A;  2I6X A;  5DG9 A;  1ZQX A;  1DK2 A;  4YR0 A;  2ZH1 A;  7ICP A;  3I76 A;  2CPR A;  4FHY A;  8ICQ A;  2HDO A;  4OJ5 A;  5J8Y C;  1TAM A;  2LYB A;  2KIV A;  5DQH A;  2LPE A;  7ICS A;  3MFI A;  4Y2V A;  4Z6E A;  3QUB A;  1FFU A;  1C7Y A;  2B51 A;  4RWP A;  2DGZ A;  4RQ1 A;  1PVR A;  4P4O A;  4EYH B;  3SAG A;  1NJW A;  3MR5 A;  2XY7 A;  2FPM A;  4UB5 A;  1ZQT A;  3B9J A;  4WOY A;  2JR5 A;  5GTH U;  1ZYQ A;  5KFJ A;  4AYB C;  2NRT A;  4KLG A;  1S9F A;  3MCR A;  1VLB A;  2B56 A;  3JZ0 A;  3BQT A;  5D61 A;  4UAV A;  1S97 A;  2W43 A;  1L7M A;  3FAH A;  2W7P A;  1ZQO A;  4NLZ A;  3KOO A;  5EE0 A;  3C1Z A;  4F5Q A;  2G09 A;  1N56 A;  3KHH A;  4CF5 A;  4UQG A;  4C4T A;  1AQ6 A;  4J9L A;  4OJO A;  5K4L A;  3WFP A;  3BQ7 A;  4GC6 A;  4X4Q A;  5DLF A;  1ZQJ A;  4BX9 C;  3H7I A;  7ICM A;  4DSL A;  3MFH A;  3ZDB A;  4M6W A;  1RXV A;  3T79 A;  1ZQV A;  4XJE A;  9ICX A;  3F5A A;  4O5E A;  4F4X A;  3PV8 A;  4O6A A;  4DEZ A;  3RRG A;  2ESE A;  3EW9 A;  4M04 A;  1PUZ A;  1JAL A;  9ICI A;  1NZP A;  4M9N A;  1Z19 A;  4Y2T A;  3HRD D;  5EE9 A;  5CFU A;  2K4E A;  8ICT A;  3WKC A;  2NYV A;  5L1K A;  3KD3 A;  4QJF B;  3C5F A;  1KN5 A;  4YD2 A;  3QEA Z;  1TK0 A;  4Z6F A;  3KZI U;  1M6Y A;  4I2A A;  3LWL A;  2HOI A;  4WC1 A;  2AU0 A;  2L5Y A;  3V6K A;  1D8Y A;  5HMM A;  1TFY A;  2JXJ A;  2PFN A;  1NKC A;  1S10 A;  2NO4 A;  4UBB A;  4JWN A;  4UB6 U;  3PW4 A;  3QZ7 A;  1RG6 A;  4PHP A;  4BWM A;  2KSO A;  3CYM A;  1HUO A;  3LK9 A;  3I1Y A;  3GDX A;  1RDF A;  3MR2 A;  4TUP A;  4G3I A;  4Y2X A;  4AT7 A;  3N7P D;  1PX5 A;  4BWJ A;  1VJ5 A;  3IG8 A;  5B3Q A;  5CWR A;  3ISC A;  1ZRM A;  4KLO A;  5KFH A;  5KFQ A;  4PGQ A;  3WFO A;  3QX7 A;  3MDA A;  3T3F A;  4OJ6 A;  5AKG A;  4M9H A;  2DR5 A;  3RJK A;  1CEZ A;  2GH1 A;  8ICP A;  2W9B A;  3AM9 A;  2H3I A;  2HN1 A;  3BZK A;  5HRE A;  2HOF A;  1IXR A;  4KLE A;  5EOZ A;  1L7O A;  2LHT A;  2ZH9 A;  1QTM A;  5J2C A;  5III A;  3LYS A;  2ZTD A;  5HRF A;  3Q8R B;  3OJU A;  3GII A;  2D3D A;  3DDH A;  3UQ0 A;  4KMO B;  5KFL A;  3ONN A;  3DV9 A;  3ED5 A;  1GPJ A;  4DWI A;  2JH7 A;  2IUB A;  3BS7 A;  5CEH A;  3IHQ B;  4NLC A;  2WF6 A;  4WC7 A;  5D63 A;  2F3N A;  2KKP A;  4QZC A;  3AQF A;  3RFA A;  4UBC A;  3H39 A;  5DB7 A;  3HWT A;  9ICQ A;  5ALX A;  3HT3 A;  4ECV A;  1QSL A;  7ICT A;  3H8M A;  1V9P A;  4YMN A;  8ICY A;  4GXK A;  4O68 A;  2ZIX A;  4Q8E A;  4QW9 A;  5KFG A;  4FH3 A;  3ZDE A;  4KIT B;  4TUQ A;  4NKU A;  4DSE A;  4ELV A;  3LVW A;  2MUT B;  3R9K A;  1L3U A;  4ED0 A;  4RWN A;  3RH5 A;  3QUT A;  5HC9 A;  2HOQ A;  3OSP A;  2F2A B;  2BBH A;  5F9N A;  7ICU A;  4K98 A;  5ALJ A;  4OAI Z;  8ICB A;  1T7P A;  2EZY A;  1CRX A;  4EP7 A;  2DFL A;  1U48 A;  3PR5 B;  3SQI A;  1IG6 A;  4TQS A;  3WKB A;  4Y2Y A;  5CRX A;  4PL1 A;  2C2E A;  3NS1 A;  3TAN A;  7ICJ A;  5BOM A;  1KSP A;  3QU7 A;  1B4F A;  4BJQ A;  3HJE A;  4NL9 C;  4B9N A;  9ICF A;  4RUA A;  4KLD A;  3QU9 A;  9ICL A;  3GIM A;  3SV4 A;  4MHV A;  2KFN A;  2DR9 A;  3N7S C;  4GLX A;  3UMC A;  3WK9 A;  8ICU A;  4DL6 A;  5KG4 A;  3TAQ A;  1KLN A;  3F53 A;  5KL1 B;  3SYZ A;  4DOB A;  3JPR A;  3HPO A;  1KL9 A;  2O1P A;  9ICP A;  2KK0 A;  3C2M A;  4F4Y A;  3RB3 A;  1JQR A;  5J2K A;  4RWO A;  2OCE A;  1SIJ A;  3L5K A;  3E0F A;  4EX6 A;  1MQ3 A;  2H3F A;  4R64 A;  2WF7 A;  4IG8 A;  3NVY A;  4JLX A;  2RLT A;  1D8L A;  3NVW A;  2QKQ A;  4RNO A;  1JUD A;  2BDP A;  2XI9 A;  5AI0 A;  4B9T A;  7ICE A;  4QZD A;  2WB1 F;  8ICI A;  1NK6 A;  4EBK A;  1K1S A;  4YN4 A;  4O3Q A;  1S0O A;  4YXJ A;  1NJX A;  9ICN A;  1K1Q A;  5AM4 A;  5DGB A;  1N48 A;  5KFO A;  2UVR A;  3OUY B;  4PGY A;  3K1Z A;  4PPX A;  2DPJ A;  3TI0 A;  2YMM A;  4DFM A;  1ZET A;  2AQ4 A;  5DQI A;  3WK5 A;  1XNS A;  1KFT A;  9ICT A;  2A1J A;  3JPT A;  1ZQ1 C;  2OWO A;  4RQ2 A;  5AKY A;  2W3S A;  2A3V A;  5DG8 A;  3PMN A;  5KFY A;  9ICB A;  3M9M B;  5D46 A;  3M8R A;  2DVI A;  1PVP A;  2EDU A;  4QIW F;  4Q8F A;  3SEN A;  3ER9 B;  2XY6 A;  1Q46 A;  5KAF U;  3HX0 A;  3JPN A;  2R18 A;  4NXZ A;  3MGV A;  2XCA A;  1L3V A;  1DGS A;  3M1Y A;  4B9U A;  9ICE A;  1X6I A;  7ICN A;  4YQW A;  5CP2 A;  1SXD A;  1ZD4 A;  1NK8 A;  7ICQ A;  4E7X A;  2ZIW B;  5KFM A;  2YB1 A;  4UAZ A;  1S0M A;  4DL7 A;  7ICO A;  4MEY A;  4RT3 A;  3QZ8 A;  1Z1B A;  1SKS A;  2WAQ C;  3ETL A;  3M6K A;  5KFD A;  3PO5 A;  8ICH A;  4LVS A;  4PZN A;  3BQ1 A;  3IV6 A;  8ICZ A;  4HX0 A;  4DF8 A;  1MIW A;  2DR7 A;  4KLI A;  9ICA A;  1LB2 B;  2KJ5 A;  3RJF A;  2ZIX B;  3NWI A;  1COO A;  3KZX A;  5ALT A;  4RQ4 A;  7ICF A;  1NNL A;  5KG6 A;  2KHV A;  4PHA A;  4B6J A;  4LEZ A;  2PKE A;  2NRW A;  8ICV A;  1MIY A;  3TAC B;  1JRO A;  2VJ4 A;  5J29 A;  1JI7 A;  7ICK A;  3QU5 A;  1N63 A;  3OTQ A;  2VJ5 A;  5L9X A;  3CK6 A;  2GA9 D;  2FLL A;  2DUY A;  1UEU A;  5AIA A;  2OH2 A;  1HJP A;  3EWA A;  5KT4 A;  3C28 A;  2K60 A;  4DLE A;  5DB8 A;  4WC3 A;  4EBE A;  5AI9 A;  3RB0 A;  2I1Q A;  3QU2 A;  2BCV A;  4KMU A;  2AH5 A;  1NOM A;  8ICR A;  8ICS A;  3HKZ F;  2KN7 A;  1T4G A;  2C2D A;  4C0Z A;  5HR6 A;  2WF9 A;  3LWM A;  2OM6 A;  3M6Z A;  4QWB A;  1BVS A;  3EZ5 A;  4G9B A;  4F93 B;  5AM5 A;  4UB1 A;  2YML A;  4F50 A;  5HRI A;  2BQ3 A;  2P35 A;  1TV9 A;  1WCN A;  5AIC A;  5J0S A;  4F72 A;  2HHV A;  2PXI A;  1HIW A;  1V85 A;  3QNM A;  1RXW A;  1SKW A;  2M2W A;  5JTG A;  3QYP A;  4K4I A;  4QZF A;  4F71 A;  1VFG A;  5ALD A;  2XC9 A;  2ASD A;  2G0A A;  1YZ7 A;  1S0V A;  4RNN A;  4RQM A;  1FA0 A;  2ZIV A;  4XA5 A;  2HBJ A;  1QQ7 A;  3OVA A;  1ED1 A;  2YMQ A;  1J2N A;  4QWC A;  1ZQF A;  4DCC A;  4JB3 A;  3BDP A;  1WOT A;  2B4V A;  4C8O A;  3LVV A;  3MBY A;  1U9L A;  4TQR A;  5KFP A;  5J2A A;  4FO1 A;  4LJX A;  1WCL A;  3IRU A;  2DWQ A;  3PY8 A;  2D8C A;  4WJ3 B;  4X0B A;  2BGW A;  2XGP A;  4BUG A;  1BPY A;  3Q8S B;  2MUT A;  2WFA A;  2FMQ A;  3IM1 A;  1X9X A;  2BHN A;  4KLS A;  4RT2 A;  2Z7J A;  2Y9T A;  5KFR A;  2Q66 A;  4DSF A;  1Z00 B;  4UAY A;  1BGX T;  5J2H A;  2EZX A;  4K99 A;  2ZH5 A;  1ZQY A;  4KLU A;  1ZXI A;  2ZHB A;  4NLK A;  4IRD A;  7ICR A;  4X4S A;  4UD5 A;  2MAX A;  2XID A;  3RB4 A;  4QIW C;  2HHT A;  2D6F C;  5KFV A;  3F2C A;  2F8K A;  1MQ2 A;  4UAS A;  4IR9 A;  3RAX A;  1SZH A;  5AI4 A;  3H8J A;  1LKY A;  4DFD A;  4DL3 A;  4LEY A;  1VJ7 A;  1BNP A;  1RPL A;  1QQ5 A;  1HUZ A;  1SB3 C;  2VA8 A;  1Q8K A;  3K4G A;  8ICN A;  4NJ8 A;  5B5E U;  4NXU A;  1O08 A;  2LMR A;  4RU9 A;  4FHX A;  5B66 U;  2LBO A;  1KFS A;  1ZQI A;  4K97 A;  4DLG A;  4O3O A;  2YN4 A;  2W9B B;  1TAU A;  4F3O A;  1TFW A;  1COK A;  2K8C B;  1RZT A;  3ICX A;  4RPX A;  3K1R B;  5KG5 A;  1L3S A;  2JMG A;  4S3N A;  4R66 A;  5ALF A;  1HEK A;  1ZQK A;  2E8O A;  3RJI A;  4YG2 A;  5KTQ A;  4FZL A;  3KHR A;  2F1I A;  5EWE A;  2A19 A;  1URJ A;  4ECQ A;  4JV0 A;  4QW8 A;  3M7D A;  4ECX A;  5EWG A;  5CB1 A;  5BOL A;  4J9S A;  1D8B A;  1NZB A;  5JTI A;  1MN8 A;  2K89 A;  3CP8 A;  4EX7 A;  5AI6 A;  2ASL A;  5ALP A;  2Y1J A;  2O6K A;  4EEY A;  4WCW A;  4P4M A;  2BE3 A;  2KMD A;  5CJ7 A;  4RPZ A;  2NV3 A;  4I27 A;  4CCH A;  5DEC A;  2M0N A;  4GXJ A;  5J0Q A;  4B9V A;  2K8A A;  3CRX A;  3PSI A;  2VKQ A;  5CFT A;  3H4B A;  5KFI A;  9ICK A;  4UB8 U;  4J9N A;  5FP0 A;  1FEZ A;  5HRK A;  3ISB A;  9ICH A;  4F2R A;  1FFV A;  2JZB A;  3UXO A;  3CNH A;  3WK8 A;  1MA7 A;  4CRX A;  3OWG A;  3PNC A;  3S6J A;  4NXX A;  2ZUB A;  4MFF A;  2LYA A;  4PGX A;  3OGU A;  1X66 A;  4QZ9 A;  5DGA A;  4O67 A;  3M9N B;  1F44 A;  3SV3 A;  1ZJM A;  4FS2 A;  1EXN A;  2VAN A;  1S0N A;  4DQP A;  1TE2 A;  5ALH A;  4KLF A;  1L8L A;  4RQ5 A;  2C2R A;  1SKR A;  2FLP A;  3RR7 A;  2GWS A;  5ALV A;  3Q8Q B;  5AKK A;  2BPF A;  5KT3 A;  4J9R A;  3THV A;  4Y2S A;  1LVH A;  5KFX A;  4DOA A;  2W9M A;  5AKE A;  2FLN A;  2AGP A;  3BQ2 A;  4DQS A;  4RQ6 A;  1MIV A;  1ZRN A;  4XUS A; 
#chains in the Genus database with same CATH homology
 5KFU A;  3EPG A;  4DF4 A;  1KLN A;  1NK7 A;  3ZDC A;  3SYZ A;  1KNY A;  2NRK A;  2ZH6 A;  4DOB A;  1SL2 A;  3JPR A;  4FO6 A;  3PO4 A;  2HHX A;  2DRB A;  2XO7 A;  3HPO A;  4NLG A;  2DPI A;  5IIN A;  9ICJ A;  2O1P A;  9ICP A;  2IMW P;  3AU2 A;  1Z3E B;  2F1J A;  1XC9 A;  2BQR A;  4ELT A;  5HHH A;  5HRB A;  3C2M A;  4F4Y A;  3RB3 A;  3MR3 A;  1NK5 A;  1MSW D;  4TUS A;  1JQR A;  2FPK A;  5IIO A;  5DDM A;  5J2K A;  4ECU A;  1ZQA A;  4DQI A;  4RWO A;  4EBJ A;  4QWE A;  4HYK A;  1MQ3 A;  9ICM A;  7ICL A;  4R64 A;  4J9K A;  4ECY A;  4IG8 A;  4DFP A;  2BDP A;  1D8L A;  3PX6 A;  4RNO A;  2F1H A;  3MGI A;  3T5K A;  5KFF A;  4KN4 A;  3C23 A;  4B9T A;  3M9O B;  4QZD A;  1ZQM A;  1KEJ A;  5J0U A;  7ICE A;  5DBA A;  8ICI A;  2XCP A;  1NK6 A;  2ZH4 A;  5KG1 A;  2UVU A;  4EBK A;  3FYH A;  1TVA A;  7ICI A;  1BPD A;  4C8M A;  4F92 B;  1K1S A;  2LYH A;  2Q0Z X;  4LZD A;  3N97 B;  4YR2 A;  4BXO B;  4YN4 A;  4I28 A;  5HRD A;  4AT8 A;  4O3Q A;  1S0O A;  1QSS A;  4O3N A;  4YXJ A;  1NJX A;  9ICN A;  1K1Q A;  4J9P A;  2AGO A;  5DGB A;  2HW3 A;  3OVB A;  9ICV A;  3V7K A;  2BCQ A;  1B22 A;  2FPL A;  3C21 A;  5KT6 A;  5DB6 A;  4DO9 A;  1T3N A;  1N48 A;  2FMP A;  1NJZ A;  3RAQ A;  4F8R A;  2DRA A;  3ZD8 A;  4KN7 A;  5KT7 A;  4YMO A;  5KFO A;  4IQV A;  4PGY A;  1H38 A;  2ZJ5 A;  1JMS A;  2UVR A;  4B9L A;  4PPX A;  3OUY B;  2DPJ A;  1QLN A;  5J0Y A;  4O0I A;  3BJY A;  2PFO A;  4ECS A;  3TI0 A;  1BPZ A;  4DL2 A;  5IIK A;  4DFM A;  4R8U B;  5DBB A;  2NRZ A;  4RQ0 A;  3V6J A;  2UVW A;  3H40 A;  1ZET A;  2AQ4 A;  1F5A A;  2KZ3 A;  5DQI A;  2ASJ A;  1V4A A;  3OV7 A;  3LQC B;  1BPX A;  4M0A A;  4RQ8 A;  1KFT A;  2AGQ A;  9ICT A;  3PW5 A;  1UEV A;  2A1J A;  3HW8 A;  3JPT A;  4XRH A;  4QWA A;  3GQC A;  2JEF A;  4F4Z A;  4ECR A;  4RQ2 A;  3PVX A;  2OWO A;  3JPS A;  2A1J B;  4YMM A;  4J9O A;  5DG8 A;  3PMN A;  5KFY A;  9ICB A;  3G6X A;  3M9M B;  5D46 A;  4AT9 B;  3M8R A;  2DVI A;  2ZHA A;  8ICE A;  1UT8 A;  3H38 A;  4YVZ A;  4GC7 A;  1ZQH A;  4Q8F A;  2HHS A;  1TAQ A;  2W9C B;  1BPE A;  3AQK A;  5IIM A;  2XY6 A;  4I29 A;  4KLJ A;  9ICW A;  1NK4 A;  2KFZ A;  4Z6D A;  5KFB A;  8ICX A;  4X4P A;  3HX0 A;  5J2E A;  2BCU A;  3H8S A;  4NXZ A;  3JPN A;  3MR6 A;  3Q8M A;  3B0X A;  3JPQ A;  2XCA A;  4J9M A;  4FBT A;  1L3V A;  1DGS A;  1ZQE A;  4B9U A;  4M47 A;  9ICE A;  2H5X A;  3AQM A;  4K4H A;  4C8L A;  4FHV A;  2VA3 A;  3ISD A;  4R63 A;  2RDJ A;  3V72 A;  7ICN A;  2P66 A;  4YQW A;  4M9L A;  2M2U A;  3UPS A;  1Y88 A;  3EYZ A;  4ED3 A;  4ED6 A;  3RR8 A;  3V7J A;  5HR9 A;  4F5P A;  3UXN A;  4F5R A;  4BXO A;  2BKE A;  5CP2 A;  3RH6 A;  4DS4 A;  8ICA A;  4DSJ A;  4LZG A;  2PBE A;  1TK8 A;  4DOC A;  1UT5 A;  1Q79 A;  1NK8 A;  3RTV A;  7ICQ A;  5CHG A;  3WFQ E;  1NJY A;  4E7X A;  4O3P A;  3TFR A;  4I2E A;  1Z00 A;  5EWF A;  2ZTE A;  5KFM A;  3AQL A;  2P6U A;  4UAZ A;  1JXE A;  2FMS A;  4RNM A;  4YXM A;  3Q8K A;  2ZUC A;  3M8S A;  2ZH2 A;  4MF2 A;  1S0M A;  4DL7 A;  5KG7 A;  2HVI A;  4MEY A;  7ICO A;  4RT3 A;  3QZ8 A;  4C8K A;  3GV5 B;  5J2G A;  1SKS A;  8ICW A;  3ETL A;  2J6U A;  3AU6 A;  4QZG A;  5KFD A;  4FHP A;  3C18 A;  1ZQW A;  5J2D A;  1JX4 A;  2R8G A;  3PO5 A;  4UB4 A;  5KT2 A;  5C5J A;  3BQ1 A;  4BGD A;  3OSN A;  5KFS A;  1SZP A;  1TK5 A;  4JV1 A;  4O3S A;  1ZQC A;  5J0O A;  8ICZ A;  4M2Y A;  3OHB A;  4DF8 A;  1MIW A;  5KG0 A;  3K75 D;  3Q8L A;  2DR7 A;  4KLI A;  9ICA A;  3TAP A;  3C66 A;  1LB2 B;  3ORY A;  4DQQ A;  1TFR A;  2KZZ A;  2KZM A;  4RZR A;  1RYR A;  3RJF A;  3PX0 A;  2IA6 A;  4AT8 B;  3C5G A;  3UXP A;  1NK0 A;  2V9W A;  4EZ9 A;  4KLL A;  4E8F A;  5J2I A;  1COO A;  2JEJ A;  1ZQU A;  5J0X A;  4O5C A;  4ECW A;  3LDA A;  4RQ4 A;  4J9Q A;  4MFA A;  3TAR A;  7ICF A;  2HHW A;  5KG6 A;  1ZQP A;  5HHI A;  7ICG A;  4PHA A;  2WTF A;  3MAB A;  3ZDA A;  4NLN A;  2IHN A;  4DSI A;  3HJ1 A;  4XQ8 A;  5J2F A;  3RB6 A;  9ICC A;  3WFR E;  4P2H A;  2PFP A;  5DG7 A;  2W9C A;  4KLM A;  3KHG A;  3PW2 A;  3GIK A;  2NRW A;  1NKB A;  1U45 A;  8ICV A;  4DQR A;  1MIY A;  4B9M A;  2M2V A;  3PML A;  3MGH A;  5J29 A;  2XGQ A;  1SL0 A;  3HP6 A;  1ARO P;  4ATB B;  3Q8P B;  3AUO A;  4I2I A;  3PW0 A;  7ICK A;  4WC2 A;  4M9G A;  4FH5 A;  4ZH4 A;  3C2K A;  1DOQ A;  5DQG A;  5KFK A;  1B43 A;  5KFW A;  5L9X A;  2ZH8 A;  5J0P A;  1SL1 A;  1BPB A;  1XSN A;  4DL5 A;  2FLL A;  4NM2 A;  5DG9 A;  1ZQX A;  1UEU A;  3KHL A;  4B9S A;  1DK2 A;  4YR0 A;  1HJP A;  3EWA A;  5KT4 A;  5DBC A;  7ICP A;  4FHY A;  4E80 A;  2ZH1 A;  4QZ8 A;  4DLE A;  5DB8 A;  8ICQ A;  1XWL A;  4WC3 A;  3HJ4 A;  4EBE A;  1UA0 A;  4JV2 A;  3RB0 A;  2KTQ A;  2AQ0 A;  1Q78 A;  5DQH A;  4QZI A;  2I1Q A;  3PX4 A;  7ICS A;  8ICM A;  3MFI A;  9ICO A;  2BCV A;  4KMU A;  4Z6E A;  3NYB A;  4DFK A;  1XS9 D;  1C7Y A;  1NOM A;  4RWP A;  4IQT A;  8ICR A;  5L1J A;  4O9M A;  4RQ1 A;  8ICS A;  4P4O A;  1PZN A;  1T4G A;  5J2B A;  2KN7 A;  4F5N A;  4UAW A;  4EYH B;  2C2D A;  5J0R A;  1NJW A;  1YLQ A;  5J0T A;  3MR5 A;  3LWM A;  2FPM A;  2XY7 A;  3GIJ A;  4WBY A;  4UB5 A;  1ZQN A;  3H4D A;  2BPC A;  4QWB A;  1ZQT A;  8ICG A;  1BVS A;  1ZYQ A;  3EZ5 A;  1R8A A;  3OUY A;  5KFJ A;  2ID1 A;  4F93 B;  2NRT A;  4ELU A;  4Q44 A;  4UB1 A;  4F50 A;  5HRI A;  2BQ3 A;  1TV9 A;  4MEX A;  4KLG A;  4MFC A;  4X0A A;  1WCN A;  5J0S A;  2HHV A;  1S9F A;  1A77 A;  2BR0 A;  2PXI A;  4TUR A;  4M5D A;  3JZ0 A;  3BQT A;  1RXW A;  1SKW A;  2M2W A;  4K4I A;  4QZF A;  1VFG A;  3PR4 A;  3BQ0 A;  1RYS A;  1S97 A;  2XC9 A;  2ASD A;  3MDC A;  1L5U A;  1S0V A;  4RNN A;  5HP4 A;  1ZQO A;  4YD1 A;  4NLZ A;  4YFK A;  3H37 A;  2DR8 A;  1R8C A;  3C1Z A;  4F5Q A;  1N56 A;  3KHH A;  4UQG A;  1FA0 A;  2NRX A;  4XQ7 A;  3WFS C;  5DDY A;  4J9L A;  4KTQ A;  4XA5 A;  2BQU A;  1R89 A;  3FDS A;  1ZJN A;  3WFP A;  4X5V A;  3OVA A;  1KTQ A;  2XY5 A;  4GC6 A;  3OVS A;  2HHT A;  4X4Q A;  4QWC A;  5DLF A;  5CA7 A;  1ZQF A;  2R8H A;  1ZQJ A;  1ZQB A;  3BDP A;  1WOT A;  4UB3 A;  4C8O A;  4Q45 A;  1QSY A;  4M9J A;  3H7I A;  4EZ6 A;  7ICM A;  4DSL A;  3MFH A;  3ZDB A;  4M6W A;  3MBY A;  1JXL A;  5D4B A;  2C28 A;  2HHP A;  1U9L A;  2B21 A;  4QZE A;  4TQR A;  1RXV A;  5HRG A;  3L9D A;  5DB9 A;  5KFP A;  2JEG A;  5KT5 A;  3T5J A;  5J2A A;  1UET A;  3GV8 B;  1ZQV A;  1R8B A;  1WCL A;  9ICX A;  1ZQZ A;  1X2I A;  4O5E A;  4F4X A;  3T5L A;  3PV8 A;  4DL6 A;  3PY8 A;  1OU5 A;  2M9N A;  4X0B A;  4DEZ A;  4NY8 A;  1A76 A;  1MC8 A;  3C1Y A;  2XGP A;  2BGW A;  3RRH A;  3RRG A;  3EW9 A;  4I2B A;  8ICJ A;  2ALZ A;  1BPY A;  3Q8S B;  3H8W A;  3ZDD A;  2MUT A;  4DSK A;  4O3R A;  4AT9 A;  5DLG A;  3UQ2 A;  4M04 A;  5DKW A;  2FMQ A;  3RJJ A;  5D49 A;  9ICI A;  3IM1 A;  4WC6 A;  2J6S A;  2BHN A;  4KLS A;  4RT2 A;  4JK1 A;  4M9N A;  1NZP A;  2O5A A;  4WC4 A;  4ATB A;  5KFR A;  1ZQD A;  1ZQQ A;  2Q66 A;  8ICT A;  4DSF A;  4ECT A;  4GXI A;  1Z00 B;  4UAY A;  2R8K A;  1BGX T;  5J2H A;  5L1K A;  1XSP A;  3RJG A;  4X4U A;  4PHD A;  4Q43 A;  3C5F A;  1U4B A;  1X9S A;  4YD2 A;  1ZQY A;  3G6V A;  3QEA Z;  1X9M A;  4F2S A;  1KRP A;  2ZH5 A;  4KLU A;  1TK0 A;  3GFK B;  4I2F A;  4Z6F A;  3QE9 Y;  2HHU A;  2ZHB A;  4KLT A;  4I2A A;  4F4K A;  3LWL A;  3NTU A;  4NLK A;  4IRD A;  7ICR A;  4WC1 A;  4X4S A;  3G6Y A;  3AQN A;  4UD5 A;  2MAX A;  4O5K A;  2AU0 A;  3V6K A;  2NRV A;  3T5H A;  3RB4 A;  4I2J A;  5KFV A;  1D8Y A;  2ISO A;  4I2H A;  5HMM A;  2ZJ8 A;  4I2C A;  4QZA A;  2C22 A;  5KFN A;  2PFN A;  4E0D A;  4KLH A;  1TFY A;  1NKC A;  4QZB A;  1MQ2 A;  2BCR A;  4IRK A;  1S10 A;  5HRH A;  5F2V O;  1U47 A;  4IR9 A;  3RAX A;  4UBB A;  2W8K A;  4EYI B;  3PW4 A;  4JWN A;  3E2E A;  3EPI A;  4F5O A;  3QZ7 A;  2I9G A;  3H8J A;  5KFA A;  1CUK A;  4PHP A;  4DL3 A;  4C8N A;  2J6T A;  4BWM A;  5J2J A;  1VJ7 A;  1HUO A;  3LK9 A;  3RJH A;  3N4M B;  1BNP A;  1RPL A;  4FBU A;  3GDX A;  4WC5 A;  4X4R A;  1HUZ A;  2VA8 A;  4PH5 A;  3MR2 A;  3K4G A;  4TUP A;  2RDI A;  4G3I A;  4AT7 A;  1PX5 A;  1X9W A;  8ICN A;  4BWJ A;  4UB2 A;  4RU9 A;  4BDP A;  4FHX A;  4RWQ A;  4NM1 A;  4EBD A;  5CWR A;  3NGD A;  3ISC A;  1KFS A;  1ZQI A;  5KFH A;  1NKE A;  4KLO A;  5KFQ A;  4O3O A;  4PGQ A;  2W9B B;  4DLG A;  1JIH A;  4EBC A;  2UVV A;  1TAU A;  4LT6 A;  3WFO A;  4F3O A;  4I2G A;  4NKT A;  3MDA A;  3UPQ A;  3T3F A;  1TFW A;  4X4V A;  1S76 D;  5KG2 A;  4M9H A;  2DR5 A;  1KDH A;  3RJK A;  1CEZ A;  8ICP A;  2W9B A;  1IM4 A;  5JUM A;  1RZT A;  1XO1 A;  1TKD A;  4RPX A;  5L1I A;  1UA1 A;  5KG5 A;  2PI4 A;  8ICO A;  1L3S A;  2HHQ A;  1L3T A;  5HRE A;  1IXR A;  4DL4 A;  5KG3 A;  4KLE A;  5EOZ A;  4R66 A;  4K4G A;  2M2T A;  4AT7 B;  4S3N A;  2ZH9 A;  4PHE A;  1QTM A;  5J2C A;  5III A;  1ZQK A;  4ECZ A;  5HML A;  3OJS A;  5BPC A;  3RJI A;  1U49 A;  4YCX A;  3RBE A;  4YG2 A;  5KTQ A;  5CR0 A;  2ZTD A;  5HRF A;  3KHR A;  2F1I A;  4F4W A;  3Q8R B;  5EWE A;  4P4P A;  3OJU A;  9ICG A;  8ICH A;  3GII A;  3RBD A;  3UQ0 A;  4ECQ A;  4JV0 A;  5IIJ A;  4QW8 A;  4LVS A;  5KFL A;  1KFD A;  4ECX A;  4IRC A;  5KFC A;  5EWG A;  5CB1 A;  4DWI A;  5BOL A;  4UD4 A;  4J9S A;  8ICK A;  4I2D A;  3IHQ B;  4IQU A;  4MF8 A;  4X4T A;  4JUZ A;  2ASL A;  4WC7 A;  2V4Q A;  2RFF A;  2Y1J A;  4EEY A;  4QZC A;  4M6W B;  9ICU A;  2V4R A;  3JYY A;  5DED A;  4UBC A;  2HVH A;  3H39 A;  4WCW A;  5DB7 A;  4P4M A;  3HWT A;  3KTQ A;  9ICQ A;  1BNO A;  3HT3 A;  4ECV A;  2BE3 A;  3GV7 B;  3V7L A;  5CJ7 A;  4R8U A;  4RPZ A;  1QSL A;  7ICT A;  4WBZ A;  4RUC A;  2KP7 A;  3GIL A;  5HNK A;  2ZH3 A;  1XU4 A;  2ATL A;  4JWM A;  1V9P A;  2ZJA A;  4YMN A;  4GXK A;  4CCH A;  4IR1 A;  4I27 A;  5TZV A;  8ICY A;  1D9D A;  5DEC A;  4RPY A;  1T8E A;  4Q8E A;  4QW9 A;  2BPG A;  5J0Q A;  4Z6C A;  1JN3 A;  5KFG A;  5F9L A;  4GXJ A;  4B9V A;  4QWD A;  4FH3 A;  3ZDE A;  4KIT B;  4YP3 A;  4TUQ A;  5L1L A;  4DSE A;  4DFJ A;  4ELV A;  4NKU A;  3H4B A;  3SZ2 A;  5KFI A;  9ICK A;  3V6H A;  2P6R A;  2MUT B;  4RQ3 A;  3JPP A;  4J9N A;  1L3U A;  5HRK A;  4ED0 A;  4RWN A;  4WC0 A;  3ISB A;  9ICH A;  1ZQG A;  3JPO A;  3UXO A;  2JZB A;  4F2R A;  3RH5 A;  2PFQ A;  4ED7 A;  3PNC A;  2W8L A;  3PW7 A;  2VA2 A;  5HC9 A;  2ZUB A;  2JZB B;  3OSP A;  4MFF A;  3B0Y A;  4PGX A;  5F9N A;  2JEI A;  3OGU A;  4QZH A;  7ICU A;  4X4O A;  2ZTC A;  3HIY A;  2PI5 A;  4QZ9 A;  4FS1 A;  5DGA A;  2IHM A;  8ICB A;  3M9N B;  1T7P A;  4EP7 A;  9ICR A;  3ZD9 A;  2DFL A;  3SV3 A;  1ZJM A;  7ICV A;  8ICF A;  1D9F A;  1U48 A;  4FS2 A;  1EXN A;  2VAN A;  4DS5 A;  1LV5 A;  3QEB Z;  3RH4 A;  1DK3 A;  3PR5 B;  1S0N A;  4DQP A;  1NO5 A;  3H3A A;  5HRL A;  7ICH A;  4TQS A;  4KLF A;  9ICS A;  5KFE A;  3TQ1 A;  1NK9 A;  2BCS A;  2C2E A;  4FHW A;  4YR3 A;  2ISP A;  5J0W A;  3TAN A;  4RQ5 A;  2C2R A;  4ED2 A;  7ICJ A;  1ZQR A;  1SKR A;  5BOM A;  3OHA A;  2FLP A;  2ZH7 A;  3C2L A;  1ZQL A;  2GWS A;  3RR7 A;  1KSP A;  3RJE A;  3Q8Q B;  4ED1 A;  3TFS A;  2BPF A;  4RQ7 A;  4R65 A;  5KT3 A;  4J9R A;  2AJQ A;  1ZQS A;  4F91 B;  3THV A;  1S77 D;  4X4N A;  8ICL A;  2Y1I A;  4B9N A;  5KFX A;  4ED8 A;  3SI8 A;  4DOA A;  4RUA A;  4KLD A;  9ICF A;  2W9M A;  2W9A A;  2FLN A;  2R8I A;  9ICL A;  2AGP A;  3BQ2 A;  3GIM A;  3SV4 A;  4DQS A;  1JAJ A;  2KFN A;  5IIL A;  2DR9 A;  5KFZ A;  8ICC A;  4KLQ A;  4RQ6 A;  4GLX A;  1MIV A;  2ZUD A;  2IBK A;  2R8J A;  5KFT A;  8ICU A;  1XSL A;  4XUS A;  4IQW A;  5KG4 A;  3TAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...