5J0UA

Binary complex crystal structure of dna polymerase beta with g:g mismatch at the primer terminus
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
330
structure length
326
Chain Sequence
APQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of DNA Polymerase Mispaired DNA Termini Transitioning to Pre-catalytic Complexes Support an Induced-Fit Fidelity Mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 107
structure length 326
sequence length 330
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5j0uA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5j0uA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5j0uA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5j0uA03
2BDPA 3PX4A 2VA8A 2PFNA 1WCLA 3MR5A 5J2HA 1KLNA 4BDPA 4DOAA 4DSJA 4F91B 4DFJA 2J6SA 4FHYA 4GLXA 2A1JA 2NRZA 1ZQLA 5HRGA 5HRKA 3OJUA 3GFKB 3JPRA 3Q8MA 2ZH2A 4Z6DA 7ICLA 4Q8EA 3QEBZ 4M9GA 1BPXA 7ICTA 1A76A 1Y88A 4FH3A 3HWTA 3EZ5A 8ICJA 4WC6A 3WFSC 1NJXA 4WBYA 4DLEA 2FPMA 4PH5A 5KFFA 5KFJA 5J2JA 1S0NA 2O1PA 4EBCA 1KFSA 3C1ZA 9ICPA 4UAWA 5HR9A 1ZQTA 4DL7A 3TANA 3TARA 2KP7A 2M2WA 5KT5A 3RRGA 4YCXA 2M2TA 2HHSA 3M8RA 8ICBA 4RZRA 4TUPA 2UVVA 3QZ7A 4PHPA 3GV8B 3C2KA 5D4BA 4YVZA 4F50A 4BXOB 4MEYA 8ICXA 4ATBA 1TAUA 4DOCA 2PFPA 3PNCA 2ZTEA 3WFOA 4YR0A 4QWBA 1ZQWA 4M5DA 3Q8SB 5J2IA 3ISCA 1XWLA 4DL3A 2KFZA 2ASJA 3MR2A 4TUQA 4X4NA 5KT6A 5J29A 4KLLA 3HIYA 2XGPA 5KG7A 4QZEA 3C5FA 4RT3A 4E7XA 2ZTCA 4R64A 5BOMA 4C8MA 4RNOA 2WTFA 1SL1A 4O5KA 2HHUA 9ICFA 1NK5A 8ICHA 4PGXA 1DOQA 1JIHA 4C8NA 4AT9B 4X4UA 3RJHA 7ICMA 7ICRA 2Q66A 1H38A 3H39A 1KRPA 7ICVA 1X9MA 5KFPA 3PW4A 1NO5A 4EBDA 3T5LA 4RQ8A 5DLGA 4QWCA 3OSPA 2XC9A 5HNKA 1COOA 4O3OA 5DDMA 2W8KA 2BR0A 4YR3A 5HRLA 1IM4A 5CHGA 1K1QA 1ZETA 4I2HA 1XS9D 4M9LA 4KITB 3PW2A 8ICEA 3RRHA 9ICLA 1MIVA 4WBZA 4LZGA 4DL5A 3PVXA 1SZPA 2ZH8A 3OJSA 9ICGA 8ICOA 4RPXA 4PGYA 3GDXA 4F5OA 2MUTB 5DQHA 4J9LA 3LWMA 2PBEA 1PZNA 5J2GA 3V6JA 1NZPA 3AQNA 4I27A 1UEVA 3H8WA 2ASLA 5KFIA 4QZDA 3PX6A 1U49A 3KHGA 3G6VA 4B9LA 7ICEA 3RJIA 3M9OB 1DK2A 4HYKA 1ZQBA 4G3IA 5CWRA 4B9NA 4EBKA 4ELTA 3MBYA 3LK9A 3IHQB 4GXJA 5L1KA 3TFRA 2I9GA 4YD2A 4KLFA 2ID1A 4UD5A 5KFBA 4UD4A 4X4QA 4Q43A 4J9MA 1U4BA 4DSIA 8ICMA 5J0PA 3JPTA 5KFZA 1NOMA 3H8SA 1N56A 2JEJA 4M04A 5DG9A 2FMQA 4MFFA 1IXRA 1D8LA 4UB4A 2RDJA 2FMSA 5L1IA 4WC0A 2W8LA 3M9MB 4ECZA 1XSPA 1UT8A 2KFNA 4X4TA 2BPFA 1RZTA 3GIKA 1QSYA 8ICUA 4X0AA 3H3AA 3JYYA 4UQGA 3TI0A 3N97B 4FBUA 3H37A 3C23A 9ICNA 3ZDAA 1BPDA 4ECTA 4DQRA 4DQIA 2W9BA 4JV1A 4RWOA 4YMOA 4KTQA 4RPZA 3GILA 3K75D 3G6XA 3RJGA 4JK1A 2PFOA 2NRTA 5EWFA 5J2EA 4F4WA 7ICQA 9ICHA 2F1HA 3EW9A 2C2DA 2JEGA 2ZUCA 4O5EA 5J0YA 4B9MA 1XC9A 3OUYA 1S0OA 4M9HA 3ISBA 1L3TA 1HUOA 4KN4A 1BVSA 3UXOA 3RR7A 2HHXA 3ZD9A 4AT9A 4DSKA 3RH5A 5L1JA 3H8JA 4J9RA 4O3PA 1R8CA 4NLGA 4IRKA 2W9MA 5IIIA 3ZD8A 2O5AA 9ICAA 9ICMA 2ALZA 4J9KA 4QW9A 5IIMA 4EZ9A 4ECUA 3RJFA 2ZHAA 1TKDA 1T7PA 5KFVA 2GWSA 3GV5B 4NKUA 2Y1JA 2MAXA 2HHWA 9ICJA 8ICSA 1TFYA 4X5VA 3MDCA 9ICUA 4M9JA 3TAQA 1EXNA 4R8UA 4XA5A 4Q45A 4J9SA 4J9OA 4ED7A 1ZQGA 5HREA 2UVUA 2KZ3A 1SKRA 2P66A 2HVIA 3RAQA 1UEUA 4E80A 2ZJ8A 1ZQAA 3ORYA 4Z6CA 4BGDA 4O5CA 2MUTA 4KLJA 1NJYA 3MR3A 3OVSA 3OUYB 5DQIA 3JPNA 4PHDA 4DQSA 1C7YA 4C8OA 4K4HA 5KFOA 4FHPA 9ICKA 1X2IA 3PR5B 2XGQA 3PW5A 2BQUA 1BNOA 4PHEA 3Q8LA 2ISPA 4MFCA 4X4SA 4E8FA 2HHTA 1YLQA 4WC3A 1T8EA 3GIMA 8ICGA 2FPLA 4I2IA 4GXIA 7ICOA 3MFHA 1A77A 5TZVA 4YP3A 1L5UA 5KTQA 4EBEA 5C5JA 1TFRA 4KLUA 5DDYA 5KFQA 4O0IA 3UPQA 3ZDEA 4I2FA 4B9VA 3E2EA 8ICQA 2XCPA 4YMNA 2IHNA 1CEZA 4P4PA 4IQUA 4GC6A 4CCHA 3L9DA 4EP7A 2ZH6A 3QZ8A 1VFGA 4DF4A 5KG4A 2DVIA 4IQTA 1NK8A 4ELVA 9ICOA 2DR5A 5DB7A 3OVAA 1BPEA 1ZQRA 4X4PA 1X9WA 5KFXA 3UXNA 8ICFA 4NM1A 4F5RA 2PI4A 4LVSA 5KFMA 4NLZA 4KLQA 2DRAA 5D46A 3JPSA 5KFYA 4P2HA 4S3NA 4UAZA 7ICPA 1RPLA 3V6KA 3RB6A 2OWOA 9ICBA 1ZQQA 4Z6FA 4RQ0A 5KFKA 2XY7A 4QZ8A 4J9PA 1XO1A 4KMUA 3GIJA 2BGWA 4YMMA 1TVAA 4FHVA 1BGXT 4QZAA 3RR8A 4PHAA 1ZYQA 2VA2A 7ICSA 2BQ3A 5DQGA 2ATLA 2R8IA 2AQ0A 1ZQUA 4KLMA 3HP6A 9ICCA 1R8BA 3AQMA 3JZ0A 2PFQA 4DEZA 4MF8A 4GC7A 4KLIA 4PPXA 1NJZA 5J2CA 5HRBA 1MC8A 4FS2A 4MEXA 3QEAZ 5J2FA 5CJ7A 2Q0ZX 5KFEA 1NK0A 1NKCA 3AUOA 1XU4A 4F93B 1XSNA 2BHNA 7ICFA 2JZBA 4TQSA 1WCNA 2FLPA 5L1LA 2HW3A 3THVA 4DFMA 3LWLA 4P4OA 4QZCA 4IQVA 2BCRA 1ZQHA 4KLTA 2VANA 5IINA 1MSWD 2BQRA 2Y1IA 2ZJ5A 5F9LA 2KN7A 4ED0A 2JEFA 4I2DA 1TK8A 3ZDDA 4FHXA 3SV3A 2AGPA 2C2RA 1VJ7A 1UA0A 2C22A 5KFTA 4I2EA 3PO5A 5KG3A 4ECSA 3C2LA 7ICGA 4QZ9A 1S9FA 2ZUDA 2BCQA 2FLNA 2BE3A 5F2VO 4IRDA 8ICNA 1X9SA 1BPZA 4LZDA 1QSLA 4NY8A 2RDIA 4F5NA 1ZQPA 5DB8A 4TUSA 4XRHA 3EPIA 1NK9A 2M9NA 4DSLA 4DO9A 3SI8A 3UPSA 4WC4A 4ECVA 2BCSA 3FDSA 3AU6A 2BCUA 3OSNA 4DWIA 4WC7A 1ZJNA 3H4DA 2DR8A 2F1IA 5KFSA 3BQ1A 3Q8QB 3V7LA 3HJ1A 4UAYA 3OHAA 2KZZA 8ICTA 3B0YA 5J2KA 4UBBA 2IHMA 1ZQIA 2AGQA 1ZQEA 2DPIA 4ED2A 3NYBA 4DF8A 1V9PA 5KFLA 1QLNA 3N4MB 4QZIA 1HUZA 3C18A 5BPCA 4F5QA 1RXWA 4ED6A 3KTQA 4DS4A 1D8YA 4EYHB 3RH6A 5IIOA 1KSPA 3MGHA 1UETA 3PMNA 4X4VA 5DKWA 4KLDA 4RT2A 4DOBA 4F92B 3ISDA 3LDAA 3SYZA 4DSEA 2AU0A 2HHVA 1BNPA 3ZDCA 4ED1A 4RQ7A 3OGUA 1OU5A 3WFPA 3WFQE 2VA3A 1JXEA 1UA1A 1ZQOA 5J0UA 4RPYA 8ICAA 1U45A 1ZQFA 9ICTA 5DECA 2ZH1A 3RBEA 1ZQNA 4EZ6A 2DR9A 1ZQMA 4IR1A 1RYRA 4BWMA 4UB2A 3RJKA 3BDPA 9ICIA 5HMLA 3RTVA 4F4YA 5IIKA 3V7JA 2HHQA 1XSLA 1D9FA 3EYZA 3V72A 3AQLA 8ICPA 4DFPA 1BPYA 4XQ7A 4DSFA 1JXLA 5DBCA 4F5PA 2LYHA 4ED8A 5HP4A 3PX0A 2F1JA 2PI5A 2ZH5A 3TAPA 1Z00A 8ICRA 5KFWA 1F5AA 4IG8A 5KG1A 3H40A 1NJWA 1U47A 9ICRA 4AT8B 2DFLA 3PR4A 4RQ2A 3H7IA 5J0SA 3SV4A 1R89A 4RQ3A 4I2AA 1BPBA 4O3RA 8ICZA 5DGBA 3M8SA 5BOLA 4K4GA 1DK3A 4JWNA 3NGDA 4YD1A 3B0XA 3BQ0A 7ICHA 3IM1A 4FHWA 3GIIA 4NLNA 5J0XA 8ICWA 2BPGA 4M6WA 5KT7A 4PGQA 2IMWP 4O3SA 4Q44A 5CB1A 9ICQA 1JN3A 5IIJA 1SKWA 4F2RA 4KLHA 5KFRA 3EPGA 1FA0A 3C2MA 1SKSA 2PXIA 3V7KA 4QWDA 4DL4A 3RB0A 1S76D 1KDHA 2FMPA 2DR7A 1V4AA 4C8LA 1TK0A 1S97A 2J6UA 1WOTA 5J2BA 1JAJA 3OVBA 5DBAA 4RQ5A 3T5KA 1HJPA 1ZQJA 4C8KA 5JUMA 3HPOA 1DGSA 5HRHA 2J6TA 4F4XA 8ICLA 4KN7A 5DG8A 3GV7B 4O3NA 3BQ2A 3RAXA 1MQ3A 4B9UA 5HRIA 4TQRA 4RQ4A 4NXZA 2NRWA 2H5XA 4UB5A 3UQ0A 1NKEA 1ZQVA 5KG5A 7ICIA 2XO7A 1Z3EB 9ICWA 3Q8PB 2V4QA 1ZQCA 3H4BA 4NLKA 4NKTA 2I1QA 2ASDA 2BCVA 3KHRA 3NTUA 3BJYA 4B9SA 5D49A 4F8RA 4ZH4A 4ELUA 4M47A 5KT4A 4UB3A 4DL2A 4KLEA 2R8GA 4M6WB 3AU2A 3JPPA 5HHHA 1N48A 4R63A 1U48A 3T3FA 1L3UA 5KFUA 4ECXA 2FLLA 5F9NA 1K1SA 2R8JA 2BKEA 2AGOA 8ICIA 1KNYA 5J0OA 4QWEA 4ECWA 4UB1A 2ZHBA 4FBTA 5KFAA 2XY6A 5DG7A 1R8AA 8ICCA 3T5JA 1ZQDA 5J2AA 4RU9A 5J2DA 4RQ1A 3HX0A 4R65A 1LB2B 1MQ2A 4X4RA 2IA6A 4YQWA 4O3QA 3OV7A 4R8UB 4MFAA 1ZQYA 4DLGA 3H38A 3JPQA 3BQTA 1NKBA 3UQ2A 4J9QA 3RJJA 4FO6A 2HHPA 1KEJA 4GXKA 1D9DA 2ZH7A 2B21A 3KHHA 2ZH9A 4P4MA 2ZUBA 1AROP 4QZHA 3RB3A 1L3VA 2UVWA 3T5HA 3PW0A 5HRFA 4JUZA 4EBJA 4DQPA 5KFGA 4TURA 4LT6A 2V4RA 4M2YA 2AJQA 3AQKA 4ATBB 2V9WA 3HJ4A 5DB9A 3G6YA 4RUCA 2R8KA 5J0RA 4X0BA 5HC9A 1MIWA 3SZ2A 1LV5A 3PY8A 1ZJMA 4I2GA 4YXMA 1TAQA 3OHBA 5DGAA 3ETLA 5KG2A 2ZTDA 3RH4A 2W9AA 8ICYA 1MIYA 4ECYA 3V6HA 3PV8A 1RYSA 4RNNA 1PX5A 5J0QA 4M9NA 1B22A 3PMLA 1ZQSA 4I28A 2FPKA 1SL2A 5DLFA 3TFSA 2NRKA 4YR2A 4EYIB 2IBKA 3GQCA 1ZQKA 1ZQXA 3MABA 1QSSA 4NM2A 4Z6EA 4X4OA 2NRXA 2W9BB 1Q79A 4WC2A 3RB4A 4M0AA 2ISOA 4FH5A 3Q8RB 1RXVA 4KLGA 3ZDBA 2KZMA 2JEIA 2DRBA 1Z00B 2RFFA 5EOZA 4DS5A 1JQRA 1KTQA 2A1JB 4IQWA 5HRDA 3KHLA 3K4GA 4WC5A 4MF2A 4RWQA 5J0WA 2ZH3A 2NRVA 5DEDA 4B9TA 2HVHA 4JV2A 4ECQA 3HT3A 1CUKA 1S10A 2ZH4A 3RJEA 2XCAA 4RUAA 4DQQA 4YXJA 5EWEA 4YFKA 4J9NA 9ICEA 4QZBA 4F4KA 1S77D 4AT7A 4IRCA 5DBBA 5KG0A 1ZQZA 5HHIA 2P6UA 5CA7A 3QE9Y 4R66A 3UXPA 4AT7B 5KT2A 4YN4A 3TQ1A 1KFTA 4I2CA 4I2BA 5CR0A 4WCWA 1T3NA 4XUSA 1NK4A 4JWMA 3C1YA 2R8HA 5HMMA 8ICKA 2KTQA 5EWGA 2JZBB 4QWAA 4ECRA 5IILA 1U9LA 5KFNA 1S0MA 9ICSA 4QW8A 3FYHA 3Q8KA 1SL0A 4F2SA 2C2EA 3M9NB 4O9MA 3WFRE 2W9CB 4F4ZA 2M2VA 3MR6A 7ICKA 1UT5A 4ED3A 2XY5A 2C28A 4I29A 1NK6A 4K4IA 1TK5A 2ZJAA 5KFCA 4AT8A 4DL6A 4BWJA 4XQ8A 4RWNA 2W9CA 4UBCA 1S0VA 5KFHA 9ICXA 2BPCA 4WC1A 4RQ6A 2UVRA 4F3OA 1JMSA 5CP2A 3JPOA 3C5GA 7ICUA 5J0TA 9ICVA 3LQCB 2DPJA 3C21A 2M2UA 7ICJA 1KFDA 5KT3A 4YG2A 1NK7A 3PW7A 1T4GA 3MDAA 3RBDA 4IR9A 4KLSA 8ICVA 3EWAA 1TFWA 4QZGA 1L3SA 5L9XA 4DFKA 4E0DA 4JV0A 1TV9A 2AQ4A 1B43A 5DB6A 4Q8FA 4KLOA 4RNMA 3PO4A 4BXOA 5KFDA 4EEYA 1QTMA 4RWPA 4I2JA 4FS1A 3HW8A 7ICNA 3MFIA 1JX4A 4QZFA 3MGIA 3C66A 2P6RA 1Q78A 5KG6A
chains in the Genus database with same CATH superfamily
3WU2U 2PFNA 2WF6A 2E3TA 4UAUA 1KLNA 4GFJA 4DSJA 1SXDA 3N7RC 2NRZA 1ZQLA 4P0PA 2IOFA 4Q8EA 2HDOA 3ALRA 1BPXA 5AK3A 1Y88A 3HWTA 1NJXA 5B3PA 5KFFA 4NXTA 5ALJA 1Q3UA 4C4RA 2KP7A 4YCXA 3M8RA 4TUPA 1Q46A 2B4VA 3QZ7A 5TISU 4YVZA 4UB6U 1DRGA 4BXOB 2RQ5A 4ATBA 2PFPA 2ZTEA 2H3VA 3HJEA 1ZQWA 5ALTA 4DL3A 2ASJA 4TUQA 4OD0A 3ER8C 2HOQA 4QZEA 4OAHA 2ZTCA 5BOMA 4RNOA 1HEKA 7ICRA 1H38A 5AKJA 2H3IA 1X9MA 3L4PA 2WF8A 1NO5A 3T5LA 2DKXA 2XC9A 2WAQC 5DDMA 5HRLA 1ZETA 9ICLA 1P7DA 2OHFA 3KKAA 4NXVA 2DKZA 3GDXA 4F5OA 1QQ6A 4J9LA 2QB0A 4C0ZA 1NZPA 1UEVA 1TE2A 5ALDA 3A0HU 4HAIA 3RJIA 3M9OB 2HBJA 4HYKA 4EBKA 5CWRA 3MBYA 4GXJA 2W04A 4UD4A 1RM6C 1NOMA 3H8SA 1N56A 4M04A 1D8LA 2RDJA 2FJ6A 4WC0A 2YMLA 2BPFA 2JGAA 2JH7A 1QQ7A 8ICUA 3N97B 3C23A 4DQRA 5J8YA 1FFUA 3GILA 2ZXIA 5J2EA 4JMUA 7ICQA 4F4WA 2HN2A 2EZXA 3EW9A 2JEGA 2ZUCA 5J0YA 1X6JA 1S0OA 3SAGA 4CF5A 1L3TA 3RR7A 3UXOA 5ALHA 3AEVA 3ZD9A 4DSKA 3RH5A 5L1JA 1YZ6A 4O3PA 4IRKA 2O5AA 4J9KA 2EH9A 3RJFA 3QU9A 4NLBA 5AK6A 5KFVA 3K1RB 3GV5B 4EENA 1FO4A 9ICUA 4M9JA 1T94A 2CPRA 3UMCA 1SKRA 2P66A 4E80A 4CF3A 2ZJ8A 1ZQAA 3ORYA 5ALGA 1OW5A 3SAFA 3JPNA 4C8OA 3Q8LA 4X4SA 2BDUA 5ALFA 4E8FA 1T8EA 1L7OA 3WK8A 3MFHA 5TZVA 4EBEA 4KLUA 4BJQA 2E8MA 5KFQA 3UPQA 3ZDEA 4BX9C 2IHNA 5HR7A 4EP7A 3QZ8A 5KG4A 1NK8A 2ZIUB 1C20A 5KFXA 2KKVA 2O6KA 4Y2RA 4NLZA 1LKYB 3JPSA 1V38A 2EZYA 4UAZA 3V6KA 1PK3A 3L3FX 4KMUA 5B5EU 4NWIA 1SGGA 2VA2A 7ICSA 1AQ6A 9ICCA 4U6PA 1MC8A 4FS2A 1NK0A 2DF4B 1NKCA 1XSNA 2JZBA 1WCNA 2FLPA 1F5SA 4KX3A 3THVA 2HW3A 2R18A 3ICXA 5AI4A 5KNIA 4P4OA 4Y2XA 2VANA 2KN7A 2JEFA 4FHXA 1RG6A 3WKBA 1X9SA 4F5NA 1ZQPA 4ZOHC 1NK9A 2M9NA 3UPSA 4DO9A 1Z1VA 3SI8A 2G09A 3FDSA 1ZD2P 3OTQA 5AKLA 4WC7A 3OHAA 1PUZA 3B0YA 3NS1A 3CRXA 3KKAC 2DPIA 3PHZA 4OAIZ 4DF8A 1V9PA 2GA9D 5KFLA 1QLNA 4DS4A 1KSPA 3RH6A 1COKA 4AYBF 5DKWA 1JROA 1HIWA 3SYZA 4DSEA 2AU0A 2HHVA 1SB3C 1SXEA 4RQ7A 3OGUA 1ZQOA 2HMXA 4J03A 1ZQNA 3TADC 3QUCA 4OO1J 4IR1A 1X40A 3EYZA 2KVSA 3QYPA 2KHVA 8ICPA 2KE7A 2LPEA 4DSFA 3AL0B 4XQ7A 4ED8A 2PI5A 2Y9TA 3PX0A 4WJ3B 1Z00A 8ICRA 3H40A 3PR4A 3E58A 4RQ2A 2F76X 2YMPA 3SV4A 2KJ9A 8ICZA 2Y0SC 3NGDA 2BPGA 4M6WA 4Q44A 2K60A 1SKWA 1OXJA 2F2AB 3V7KA 4C8LA 2QARB 1RYUA 1S97A 1WOTA 3OVBA 5HRHA 3T5KA 3HPOA 2J6TA 1B4FA 8ICLA 3GV7B 1MQ3A 4K9AA 4B9UA 5AM0A 7ICIA 1ZQCA 3QU7A 3BZKA 2I1QA 5GTIU 2BCVA 2GO7A 4ELUA 4M47A 5KT4A 4IC9A 3AQFA 2KD1A 3AU2A 3QU5A 3QX7A 3JPPA 4ECXA 2AGOA 1R8AA 2ZIXB 5J2AA 4RU9A 4NL9C 4AYBC 2IA6A 4O3QA 5GTHU 4CGZA 4MFAA 4DLGA 2HHPA 4FO6A 1KEJA 1N5XA 2B21A 2ZH7A 3ED5A 4EEKA 1AROP 1L3VA 3T5HA 3PW0A 5HRFA 4JUZA 3H0RB 5ALRA 3G6YA 2Y9UA 3NVVA 2YMQA 3PY8A 8ICYA 3OHBA 1MIYA 3ETLA 2PMZF 4KMOB 3PV8A 4NJ8A 5J0QA 3PMLA 2FPKA 3TFSA 4YR2A 5D61A 2IBKA 1ZQKA 1QSSA 4NM2A 4Z6EA 4EEBA 3D2SA 4KX5A 3Q8RB 3K7DA 2XICA 1KTQA 4WQKA 4WC5A 3KHLA 4MF2A 4B9TA 4JV2A 4Y2SA 3HT3A 1N60A 2XCAA 2ZXHA 4DQQA 4YXJA 5EWEA 4AT7A 4F4KA 5DBBA 3F53A 4YN4A 1T3NA 2KICA 2R8HA 3SAHA 2KMDA 1CRXA 5IILA 5KFNA 3O0FA 9ICSA 4UARA 3Q8KA 3WFRE 4F4ZA 3MCRA 2XY5A 4AT8A 4XQ8A 2W9CA 1S0VA 2BPCA 4WC1A 2UVRA 1JMSA 3C5GA 7ICUA 5J0TA 2WHEA 3RBDA 4KLSA 3EWAA 3M7DA 1L3SA 4E0DA 4WH5A 4KLOA 4N7RA 5EE3A 1UPHA 2LYBA 4C4TA 1JX4A 2P6RA 2HOFA 1ZD3A 1WCLA 5J2HA 1VLBA 4BDPA 3FM9A 4GLXA 4Y2VA 5HRGA 3OJUA 5ALUA 3JPRA 7ICLA 1LVHA 4OJLA 4M9GA 3EZ5A 2WF5A 4P0PB 8ICJA 4WC6A 3WFSC 2FPMA 5J2JA 2A3VA 2O1PA 4FO1A 4EBCA 2YMMA 3C1ZA 1ZQTA 3QU2A 3TANA 2VJ5A 5ALSA 3F5AA 2M2TA 4OJ5A 4RZRA 3LVVA 3C2KA 5CFUA 3PNCA 1KW4A 2VJ4A 4M5DA 3Q8SB 5J2IA 4OAGA 5KT6A 5J29A 4PZNA 1SL1A 5HR6A 1NK5A 8ICHA 4AT9B 1DOQA 1JIHA 4C8NA 4X4UA 3RJHA 2G07A 3HRDD 1KRPA 5KFPA 2H3QA 3WK4A 5HNKA 1COOA 4O3OA 2W8KA 1IM4A 5CHGA 4M9LA 4O6AA 3PW2A 3RRHA 2W7OA 2MUTB 3RF9A 3LWMA 3V6JA 3AQNA 4EX6A 1SV0A 3H8WA 3TACB 3OPXA 1U49A 5ALPA 3G6VA 1LKYA 4B9LA 7ICEA 3NVOA 1DK2A 1PVRA 4G3IA 4ELTA 3F5EA 4UB8U 3LK9A 2I9GA 5AM2A 3TFRA 4KLFA 4YD2A 3SD7A 5KFBA 4Q43A 4J9MA 2DRBA 5J0PA 4XJEA 2FMQA 1IXRA 4UB4A 3IDWA 2MRLA 4ECZA 2KFNA 3E0FA 1JUDA 2BBHA 1BPDA 4ECTA 3TADA 2W9BA 4YMOA 4KTQA 3K75D 4JK1A 2IOHA 4MKPA 2IUBA 5EE1A 3OUYA 4M9HA 1Q3VA 2HBMA 4KN4A 2A19A 2ZG6A 2HHXA 2A1AA 4J9RA 4K97A 2W9MA 9ICAA 2ALZA 3WK5A 2B0CA 4FZNA 2HHWA 9ICJA 4Q45A 4XA5A 4J9SA 1ZQGA 2Q4TA 2KZ3A 3RAQA 1NJYA 3I76A 3MR3A 3OVSA 3OUYB 4DQSA 4K4HA 4FHPA 5JTIA 5AI8A 2XGQA 1BNOA 3GU3A 4MFCA 5T14A 4CNQA 3H0MB 5ALKA 1YLQA 8ICGA 5AKKA 1A77A 1UQVA 5KTQA 5DDYA 4I2FA 3E2EA 8ICQA 2XCPA 4IQUA 4GC6A 4CCHA 3L9DA 2ZH6A 4DF4A 2D8CA 2OM6A 1ZQRA 4X4PA 3UXNA 8ICFA 2XIDA 4KLQA 4DCCA 2DRAA 5D46A 4CRXA 4P2HA 2OWOA 3RB6A 4Z6FA 5KFKA 2XY7A 4QZ8A 4J9PA 4LEZA 5ALOA 2BGWA 1FEZA 1GO3F 2K8BB 3RR8A 2RLTA 1ZYQA 5DQGA 2R8IA 2AQ0A 3AQMA 3HP6A 1R8BA 2I5HA 4MF8A 4GC7A 4PPXA 5HRBA 1VJ5A 1A0PA 4MEXA 3CW2C 3AUOA 2E8NA 5L1LA 2HCFA 3DDHA 5KL1B 4QZCA 1ZQHA 5G5GA 1MSWD 3ZDDA 1TK8A 1VJ7A 2OYYA 5G5HA 4I2EA 5KG3A 3C2LA 7ICGA 4QZ9A 2BCQA 5H2FU 2FLNA 8ICNA 4KM5A 3QU4A 5DB8A 3D2NA 4WC4A 4G9BA 4ECVA 2Z7JA 3OSNA 5CHEA 1ZJNA 4PJ0U 4UAYA 2JV3A 3NASA 8ICTA 2AGQA 4UAVA 1Z1BA 2KIWA 4Y2PA 5BPCA 3KTQA 1D8YA 4EYHB 2E5SA 3MGHA 2W7PA 4X4VA 3F2BA 3LDAA 3BQ7A 4UATA 5AK4A 5AIAA 1U45A 1ZQFA 9ICTA 5DECA 4PZOA 3RBEA 2DR9A 9ICIA 4BWMA 3RJKA 4RQMA 3RTVA 5IIKA 3V7JA 2QKQA 1S5LU 3V72A 2PKEA 4DFPA 1BPYA 5DBCA 5HP4A 2ZH5A 1SZHA 1NJWA 2ZIVA 1N62A 4AT8B 5L1MA 5J0SA 1R89A 4I2AA 1RQLA 4O3RA 1DK3A 5BOLA 3BQ0A 3CYMA 7ICHA 3IM1A 4NLNA 4O3SA 5CB1A 1JN3A 1UCVA 1O03A 2MU2A 3C2MA 2PXIA 4QWDA 1S76D 2KJ5A 2FMPA 1V4AA 2YQEA 3B9JA 5J2BA 4QIWF 2G5HB 1DGSA 1F44A 4O3NA 4LEYA 4RQ4A 3U26A 3UQ0A 2NRWA 2F77X 1NKEA 1ZQVA 5KG5A 2V4QA 3H4BA 1JRPA 2ASDA 4NXUA 3NTUA 4B9SA 4F8RA 4US9A 2KG5A 3ER9B 2LMRA 3IN5A 5HHHA 2KEYA 4R63A 1N48A 3T3FA 5KFUA 1TAMA 5AHXA 8ICIA 4QWEA 2ZHBA 4FBTA 2XY6A 5DG7A 2CXYA 3NUQA 5KL8B 3T5JA 1ZQDA 4RQ1A 3HX0A 4R65A 3OV7A 1MQ2A 4YQWA 4P0QB 4OJ6A 3H38A 3BQTA 3UQ2A 3RJJA 2RHFA 2ZUBA 1SWWA 2MA1A 3RB3A 2UVWA 1T3QA 4B6JA 5KFGA 4TURA 4ATBB 2AJQA 3IV6A 3HJ4A 5DB9A 2R8KA 1S8OA 1LV5A 1ZJMA 3EF2A 4YXMA 2OEHA 2ZIXA 4QNLA 3NVZA 3V6HA 3RFAA 1PX5A 4RNNA 4JLXA 2HBKA 1ZQSA 1SL2A 5DLFA 2NRKA 5JTGA 2EAOA 2RP5A 2NRXA 2B6GA 1Z19A 1RXVA 1L7NA 1Z00B 3KFUF 2MSNA 1PVQA 5J0WA 2ZH3A 2W03A 1KKXA 4AP9A 4J9NA 1S77D 4IRCA 1ZQZA 4AT7B 3QE9Y 4R66A 5KT2A 4Y2UA 4I2CA 5CR0A 4JWMA 5HMMA 4JB3A 5EWGA 4QWAA 4ECRA 5HR9A 3FYHA 1SL0A 2C2EA 4O9MA 2W9CB 3LVWA 4O3MA 2YN4A 1UT5A 1TK5A 2DUYA 2KOBA 5KFCA 4RWNA 4BWJA 2M0NA 4UBCA 9ICVA 3LQCB 7ICJA 1KFDA 3PW7A 1T4GA 3MDAA 1TFWA 8ICVA 5L9XA 2OH2A 1TV9A 2LM1A 2IHOA 3QUTA 4RNMA 5KFDA 4I2JA 1MN8A 3HW8A 4QZFA 3MGIA 2W3SA 5KG6A 3PSFA 3MR5A 5AI0A 2EQYA 2NO4A 5ALQA 4F91B 4DFJA 3Q8MA 4Z6DA 1QCKA 2AH5A 1A76A 2DBYA 4DLEA 5KFJA 1S0NA 2HOIA 1KFSA 5AKGA 4UAWA 3VC8A 5CRXA 4DL7A 1CI4A 3TARA 3JCFA 3RRGA 2HHSA 1Z4OA 8ICBA 2UVVA 4PHPA 5D4BA 2K4IA 2AXTU 3BS7A 4DOCA 5CFSA 1N5WA 4YR0A 4QWBA 3ISCA 1XWLA 2KFZA 4X4NA 2YB1A 4KLLA 3HIYA 2BBJA 5KG7A 4C7ZA 3C5FA 4RT3A 4R64A 2WTFA 9ICFA 4CE6A 7ICMA 2DQNB 3WK7A 7ICVA 5D62A 2QB1A 5DLGA 3OSPA 2BR0A 4NLKA 3J81j 4YR3A 1K1QA 4I2HA 9ICHA 4WBZA 4KITB 8ICEA 1MIVA 4LZGA 2G06A 3PVXA 1SZPA 2ZH8A 2GLEA 4CDGA 4PGYA 2NYVA 5DQHA 5AKYA 1PZNA 5J2GA 4I27A 2NV3A 2ASLA 2WFAA 5KFIA 4QZDA 3PX6A 3KHGA 2KHQA 3IHQB 5L1KA 2ID1A 4X4QA 5JU5A 1U4BA 5KFZA 4MFFA 2FMSA 5L1IA 5ALZA 2W8LA 1XSPA 1UT8A 2RRDA 1RZTA 1QSYA 4DFDA 3H3AA 4UQGA 2JMGA 3UM9A 4RWOA 3CP8A 3RJGA 5AI6A 2G5IB 5EWFA 2FCLA 2F1HA 4O5EA 4B9MA 1XC9A 3ISBA 2EAMA 5EE9A 3H0LB 4AT9A 3ZD8A 9ICMA 4QW9A 5IIMA 4F72A 3QXGA 2GWSA 2Y1JA 2MAXA 1TFYA 4X5VA 1SWVA 3MDCA 4US8A 4R8UA 4J9OA 5HREA 5KAIU 2HVIA 1UEUA 3D6JA 4BGDA 2MUTA 4KLJA 2CRXA 1MA7A 3SMVA 3PSPA 1C7YA 2F44A 5KFOA 3PR5B 3PW5A 1SV0C 4PHEA 2YY6A 4WQLA 1QH9A 2FPLA 2E8PA 4I2IA 7ICOA 4K96A 1L5UA 3N28A 5C5JA 4Y2YA 4BUGA 4O0IA 1ECWA 4P4PA 3PZPA 5ALYA 4NXWA 2DVIA 4IQTA 2DR5A 5B66U 5DB7A 1BPEA 2OCEA 3D2QA 4NM1A 4F5RA 2PI4A 2P35A 4C80A 4LVSA 2XVTA 5KFYA 3K1ZA 1RPLA 9ICBA 1ZQQA 4NLCA 1XO1A 3KD3A 4YMMA 1TVAA 4FHVA 4QZAA 3ZI4A 3S6JA 1L8LA 4PHAA 2BQ3A 4NXXA 2ATLA 3JZ0A 5C0YA 2PFQA 4DEZA 2KKPA 1NJZA 5J2CA 2ZIVB 3QEAZ 5J2FA 2Q0ZX 5KFEA 5CFTA 3MC1A 1XU4A 4F93B 4Y2JA 4O68A 5AK5A 1RQNA 3LWLA 4IQVA 4KLTA 2Y1IA 5F9LA 4ED0A 3UMBA 4I2DA 3SV3A 2C2RA 1UA0A 5KFTA 3PO5A 4ECSA 5AM4A 4ICAA 5AM1A 5F2VO 4IRDA 1QSLA 4LZDA 4NY8A 5AI5A 4TUSA 4DSLA 1QQ5A 2BCUA 1JALA 2DGZA 5KFSA 3Q8QB 3V7LA 5D63A 1V85A 5J2KA 4UBBA 2IHMA 2W54A 4ED2A 1WUDA 3N4MB 4QZIA 3C18A 1UHUA 3TKAA 5IIOA 3PMNA 5JRTA 4RT2A 4F92B 3ISDA 1M6YA 5AKHA 1BNPA 3ZDCA 1OU5A 3WFPA 2VA3A 2G0AA 1UA1A 3N7SC 1ZOLA 4EZ6A 1ZQMA 3ONNA 3I28A 4WOYA 4K9BA 2HHQA 1XSLA 1D9FA 3AQLA 1JXLA 4F5PA 2LYHA 2F1JA 3TAPA 5KFWA 2H3ZA 4IG8A 5KG1A 2FE9A 9ICRA 3KZXA 4USAA 4RQ3A 3AM9A 3M8SA 4K4GA 4YD1A 3B0XA 1OUQA 4FHWA 5ALWA 3GIIA 5J0XA 8ICWA 2M2WA 5KT7A 4PGQA 2IMWP 9ICQA 5IIJA 4KLHA 4F2RA 2JRZA 5KFRA 1SKSA 2Y0SF 4DL4A 2VIXA 1KDHA 2DR7A 3SR6A 1JAJA 5DBAA 4RQ5A 1V97A 1HJPA 1ZQJA 4C8KA 5JUMA 1A6SA 1D8BA 2LM4A 4F4XA 3AMZA 3BQ2A 1VDVA 5HRIA 4TQRA 4NXZA 2EAPA 4QIWC 2XO7A 4PL1A 4NKTA 1RDFA 4K99A 2NO5A 3KZIU 5D49A 5AICA 4ZH4A 5F3XB 4KLEA 3M6ZA 1U48A 1L3UA 5K4LA 5F9NA 2E1EA 4OCZA 1KNYA 5J0OA 3WK6A 2KK0A 3LYSA 5KFAA 2D3DA 5ALLA 2WB1F 5J2DA 1LB2B 2K4EA 4X4RA 1K5OA 1FFVA 4R8UB 3WKEA 1ZQYA 4J9QA 3KHHA 2ZH9A 4P4MA 4QZHA 4EBJA 4LT6A 2V4RA 4M2YA 3AQKA 4O69A 2V9WA 4RUCA 5J0RA 2W11A 5HC9A 1MIWA 4I2GA 2GAFD 2G08A 1TAQA 5DGAA 2ZTDA 3RH4A 2W9AA 4ECYA 4M9NA 1B22A 1SV4A 5A0LA 3AQEA 2W3RA 4EYIB 3GQCA 3MABA 1URJA 4X4OA 3OWGA 3RB4A 4LEVA 2ISOA 3ZDBA 2JEIA 5ALVA 3UMGA 3WKCA 4DS5A 1JQRA 2JR5A 2DWQA 3BS5A 5HRDA 3K4GA 4QJFB 2NRVA 1CUKA 2N1RA 2GOLA 3VCBA 9ICEA 4QZBA 1N63A 2P6UA 5CA7A 2K4HA 3UXPA 4EEDA 1X9XA 4I2BA 4WCWA 4FE3A 1N61A 3C1YA 2KTQA 2HSZA 2JZBB 4JLZA 4OAFA 1U9LA 2WAQF 3AN1A 1N2XA 3NRZA 1SIJA 2JH1A 3MR6A 7ICKA 4OJPA 4K4IA 2CN1A 9ICXA 3I1YA 4FFDA 3JPOA 4K8VA 2DPJA 3C21A 3PSTA 4YG2A 1KL9A 3A0BU 4F71A 1ZXIA 4QZGA 5CEHA 4JV0A 2YB4A 2KSOB 1L7MA 5AKIA 1B43A 5DB6A 2AQ4A 3PO4A 4EEYA 1QTMA 4RWPA 4FS1A 1X66A 2K4PA 2W55A 3QUBA 1Q78A 5ALIA 2EZZA 2BDPA 3PX4A 2VA8A 5AKEA 4DOAA 1F0MA 3ERCC 2J6SA 4FHYA 4C7YA 2A1JA 1DXSA 3KOOA 5HRKA 3GFKB 2PMZC 2ZH2A 2F3NA 3QEBZ 7ICTA 3QNMA 4FH3A 4I0UA 2FI1A 4WBYA 4PH5A 2KNJA 9ICPA 2ZIWB 2K8AA 2AHOB 3HILA 5KT5A 2B51A 2QLTA 3ETRA 3GV8B 4F50A 4MEYA 4U7CA 8ICXA 1TAUA 2L5YA 3WFOA 3DV9A 2ZIUA 1X42A 3MR2A 2XGPA 2JXJA 3BS5B 4E7XA 4C8MA 4O5KA 2HHUA 5AIBA 4PGXA 1ZQ1C 2Q66A 3H39A 3PW4A 4EGWA 4EBDA 4RQ8A 4RQNA 4QWCA 2BZFA 2E1FA 1XS9D 3T79A 5AI9A 4DL5A 3IG5A 3OJSA 9ICGA 8ICOA 4RPXA 4NL9A 2PBEA 1ZD4A 2KJ8A 1PVPA 1ZQBA 4B9NA 4UD5A 2ZH4A 5AM5A 5ALXA 4MHVA 1FIQA 1KQQA 4DSIA 8ICMA 3JPTA 2JEJA 5DG9A 4PL2A 3M9MB 4X4TA 4O67A 2LKYA 5AKXA 3GIKA 3FC4A 4X0AA 3JYYA 3TI0A 3H37A 4FBUA 2QB0B 9ICNA 3ZDAA 4EV6A 4DQIA 1JI7A 4JV1A 1NI3A 4Y2QA 3F2DA 4RPZA 1IG6A 3G6XA 1ZD5A 2PFOA 2NRTA 1KN5A 2C2DA 1HUOA 5ALEA 1B0XA 1BVSA 3H8JA 1R8CA 4NLGA 5IIIA 2D6FC 4EZ9A 4EX7A 4ECUA 2ZHAA 1TKDA 1T7PA 3NWIA 4NKUA 8ICSA 2F8KA 3TAQA 1EXNA 4ED7A 2UVUA 3L5KA 3WKAA 4Z6CA 4O5CA 5DQIA 3H8MA 4PHDA 1J2NA 2JHDA 9ICKA 1X2IA 2BQUA 2ISPA 2YX8A 3IG8A 2HHTA 4HX0A 4WC3A 2KVCA 3GIMA 4GXIA 1PK1B 4YP3A 1TFRA 3M6KA 4B9VA 1XO0A 4YMNA 1CEZA 1VFGA 5ALNA 5E79U 4A8EA 4ELVA 9ICOA 1J97A 3OVAA 1X9WA 2F8LA 2FDRA 2KV2A 2OXOA 5KFMA 2GH1A 4S3NA 7ICPA 2VKQA 4RQ0A 4C4SA 1J2MA 3GIJA 1NNLA 1BGXT 2EDUA 5B3QA 1PK1A 1ZQUA 4KLMA 4FZMA 4KLIA 1WWUA 3HKZF 3CK6A 4IL6U 5CJ7A 1GPJA 3GZFA 4FZLA 7ICFA 2BHNA 4TQSA 4DFMA 2K8CB 2BCRA 5IINA 1L8OA 2BQRA 2ES6A 2ZJ5A 2AGPA 2C22A 2BE3A 1S9FA 2ZUDA 1BPZA 2RDIA 3WKDA 2ZIWA 4XRHA 3EPIA 1L7PA 5AKZA 2BCSA 3AU6A 4DWIA 3H4DA 2DR8A 3M1YA 2F1IA 4P0QA 3BQ1A 3N7PD 2B56A 3HJ1A 2KZZA 4Y2TA 2LI6A 1ZQIA 1ZQEA 3NYBA 2KIVA 1HUZA 4F5QA 1RXWA 4ED6A 1UETA 3QUQA 4KLDA 4DOBA 3NVWA 2K89A 4LJXA 4ED1A 1WWVA 3WFQE 3SQIA 1JXEA 5J0UA 4RPYA 8ICAA 2ZH1A 1ZRNA 3F2CA 1RYRA 4UB2A 3BDPA 5HMLA 4F4YA 1L6NA 1XNSA 2QARA 1KBUA 2EWRA 4NV0A 1F5AA 1U47A 2DFLA 3H7IA 1BPBA 5DGBA 4JWNA 2W43A 3IRUA 3HKZC 5J8YC 2HBLA 5KAFU 1FA0A 3EPGA 3RB0A 3BZCA 1YT3A 1DGJA 1TK0A 4IS7A 2J6UA 2ESEA 2XI9A 5ALMA 2YTUA 3R9KA 4LEWA 4KN7A 5DG8A 3RAXA 1Z4NA 2H5XA 4UB5A 1Z3EB 9ICWA 3Q8PB 2IOFK 3KHRA 3BJYA 1WG8A 1YZ7A 3C28A 4UB3A 4DL2A 1O08A 1NZBA 2R8GA 4M6WB 4OJOA 2WB1C 4UASA 3C29A 4UW9A 5EE0A 2FLLA 1K1SA 2R8JA 2BKEA 4ECWA 4UB1A 3MGVA 3KBBA 8ICCA 4EELA 2EANA 3FAHA 1WYGA 1Q8KA 3JPQA 1NKBA 2WF7A 1D9DA 4GXKA 3WK9A 3NKUA 3EUB2 4DQPA 4X0BA 2KSOA 1IV8A 2HI0A 3SZ2A 5KG2A 3IP4B 3SEIA 1RYSA 4CF4A 4I28A 1ZQXA 2I6XA 2W9BB 1Q79A 3PSIA 4ACOA 4WC2A 4M0AA 4FH5A 4KLGA 2KZMA 5FP0A 2RFFA 5EOZA 4GIBA 2A1JB 4IQWA 3DEEA 1ED1A 4RWQA 5DEDA 2HVHA 4ECQA 1S10A 1IIPA 3RJEA 4RUAA 2WF9A 4YFKA 5KG0A 5HHIA 1KFTA 3TQ1A 1X6IA 4XUSA 1NK4A 2LBOA 8ICKA 3CNHA 1S0MA 4QW8A 4F2SA 3M9NB 3NRWA 2M2VA 2DL0A 3NVYA 4ED3A 4I29A 2C28A 1NK6A 4KB6A 2ZJAA 4DL6A 5KFHA 3SENA 2LYAA 4RQ6A 4F3OA 2E8OA 5CP2A 5AM3A 2M2UA 2HN1A 5KT3A 1NK7A 2ODGA 4IR9A 4DFKA 4K98A 2LHTA 4Q8FA 4BXOA 7ICNA 3MFIA 1ZRMA 3C66A 2H3FA
chains in the Genus database with same CATH topology
2BDPA 3PX4A 2VA8A 2PFNA 1WCLA 3MR5A 5J2HA 1KLNA 4BDPA 4DOAA 4DSJA 4F91B 4DFJA 2J6SA 4FHYA 4GLXA 2A1JA 2NRZA 1ZQLA 5HRGA 5HRKA 3OJUA 3GFKB 3JPRA 3Q8MA 2ZH2A 4Z6DA 7ICLA 4Q8EA 3QEBZ 4M9GA 1BPXA 7ICTA 1A76A 1Y88A 4FH3A 3HWTA 3EZ5A 8ICJA 4WC6A 3WFSC 1NJXA 4WBYA 4DLEA 2FPMA 4PH5A 5KFFA 5KFJA 5J2JA 1S0NA 2O1PA 4EBCA 1KFSA 3C1ZA 9ICPA 4UAWA 5HR9A 1ZQTA 4DL7A 3TANA 3TARA 2KP7A 2M2WA 5KT5A 3RRGA 4YCXA 2M2TA 2HHSA 3M8RA 8ICBA 4RZRA 4TUPA 2UVVA 3QZ7A 4PHPA 3GV8B 3C2KA 5D4BA 4YVZA 4F50A 4BXOB 4MEYA 8ICXA 4ATBA 1TAUA 4DOCA 2PFPA 3PNCA 2ZTEA 3WFOA 4YR0A 4QWBA 1ZQWA 4M5DA 3Q8SB 5J2IA 3ISCA 1XWLA 4DL3A 2KFZA 2ASJA 3MR2A 4TUQA 4X4NA 5KT6A 5J29A 4KLLA 3HIYA 2XGPA 5KG7A 4QZEA 3C5FA 4RT3A 4E7XA 2ZTCA 4R64A 5BOMA 4C8MA 4RNOA 2WTFA 1SL1A 4O5KA 2HHUA 9ICFA 1NK5A 8ICHA 4PGXA 1DOQA 1JIHA 4C8NA 4AT9B 4X4UA 3RJHA 7ICMA 7ICRA 2Q66A 1H38A 3H39A 1KRPA 7ICVA 1X9MA 5KFPA 3PW4A 1NO5A 4EBDA 3T5LA 4RQ8A 5DLGA 4QWCA 3OSPA 2XC9A 5HNKA 1COOA 4O3OA 5DDMA 2W8KA 2BR0A 4YR3A 5HRLA 1IM4A 5CHGA 1K1QA 1ZETA 4I2HA 1XS9D 4M9LA 4KITB 3PW2A 8ICEA 3RRHA 9ICLA 1MIVA 4WBZA 4LZGA 4DL5A 3PVXA 1SZPA 2ZH8A 3OJSA 9ICGA 8ICOA 4RPXA 4PGYA 3GDXA 4F5OA 2MUTB 5DQHA 4J9LA 3LWMA 2PBEA 1PZNA 5J2GA 3V6JA 1NZPA 3AQNA 4I27A 1UEVA 3H8WA 2ASLA 5KFIA 4QZDA 3PX6A 1U49A 3KHGA 3G6VA 4B9LA 7ICEA 3RJIA 3M9OB 1DK2A 4HYKA 1ZQBA 4G3IA 5CWRA 4B9NA 4EBKA 4ELTA 3MBYA 3LK9A 3IHQB 4GXJA 5L1KA 3TFRA 2I9GA 4YD2A 4KLFA 2ID1A 4UD5A 5KFBA 4UD4A 4X4QA 4Q43A 4J9MA 1U4BA 4DSIA 8ICMA 5J0PA 3JPTA 5KFZA 1NOMA 3H8SA 1N56A 2JEJA 4M04A 5DG9A 2FMQA 4MFFA 1IXRA 1D8LA 4UB4A 2RDJA 2FMSA 5L1IA 4WC0A 2W8LA 3M9MB 4ECZA 1XSPA 1UT8A 2KFNA 4X4TA 2BPFA 1RZTA 3GIKA 1QSYA 8ICUA 4X0AA 3H3AA 3JYYA 4UQGA 3TI0A 3N97B 4FBUA 3H37A 3C23A 9ICNA 3ZDAA 1BPDA 4ECTA 4DQRA 4DQIA 2W9BA 4JV1A 4RWOA 4YMOA 4KTQA 4RPZA 3GILA 3K75D 3G6XA 3RJGA 4JK1A 2PFOA 2NRTA 5EWFA 5J2EA 4F4WA 7ICQA 9ICHA 2F1HA 3EW9A 2C2DA 2JEGA 2ZUCA 4O5EA 5J0YA 4B9MA 1XC9A 3OUYA 1S0OA 4M9HA 3ISBA 1L3TA 1HUOA 4KN4A 1BVSA 3UXOA 3RR7A 2HHXA 3ZD9A 4AT9A 4DSKA 3RH5A 5L1JA 3H8JA 4J9RA 4O3PA 1R8CA 4NLGA 4IRKA 2W9MA 5IIIA 3ZD8A 2O5AA 9ICAA 9ICMA 2ALZA 4J9KA 4QW9A 5IIMA 4EZ9A 4ECUA 3RJFA 2ZHAA 1TKDA 1T7PA 5KFVA 2GWSA 3GV5B 4NKUA 2Y1JA 2MAXA 2HHWA 9ICJA 8ICSA 1TFYA 4X5VA 3MDCA 9ICUA 4M9JA 3TAQA 1EXNA 4R8UA 4XA5A 4Q45A 4J9SA 4J9OA 4ED7A 1ZQGA 5HREA 2UVUA 2KZ3A 1SKRA 2P66A 2HVIA 3RAQA 1UEUA 4E80A 2ZJ8A 1ZQAA 3ORYA 4Z6CA 4BGDA 4O5CA 2MUTA 4KLJA 1NJYA 3MR3A 3OVSA 3OUYB 5DQIA 3JPNA 4PHDA 4DQSA 1C7YA 4C8OA 4K4HA 5KFOA 4FHPA 9ICKA 1X2IA 3PR5B 2XGQA 3PW5A 2BQUA 1BNOA 4PHEA 3Q8LA 2ISPA 4MFCA 4X4SA 4E8FA 2HHTA 1YLQA 4WC3A 1T8EA 3GIMA 8ICGA 2FPLA 4I2IA 4GXIA 7ICOA 3MFHA 1A77A 5TZVA 4YP3A 1L5UA 5KTQA 4EBEA 5C5JA 1TFRA 4KLUA 5DDYA 5KFQA 4O0IA 3UPQA 3ZDEA 4I2FA 4B9VA 3E2EA 8ICQA 2XCPA 4YMNA 2IHNA 1CEZA 4P4PA 4IQUA 4GC6A 4CCHA 3L9DA 4EP7A 2ZH6A 3QZ8A 1VFGA 4DF4A 5KG4A 2DVIA 4IQTA 1NK8A 4ELVA 9ICOA 2DR5A 5DB7A 3OVAA 1BPEA 1ZQRA 4X4PA 1X9WA 5KFXA 3UXNA 8ICFA 4NM1A 4F5RA 2PI4A 4LVSA 5KFMA 4NLZA 4KLQA 2DRAA 5D46A 3JPSA 5KFYA 4P2HA 4S3NA 4UAZA 7ICPA 1RPLA 3V6KA 3RB6A 2OWOA 9ICBA 1ZQQA 4Z6FA 4RQ0A 5KFKA 2XY7A 4QZ8A 4J9PA 1XO1A 4KMUA 3GIJA 2BGWA 4YMMA 1TVAA 4FHVA 1BGXT 4QZAA 3RR8A 4PHAA 1ZYQA 2VA2A 7ICSA 2BQ3A 5DQGA 2ATLA 2R8IA 2AQ0A 1ZQUA 4KLMA 3HP6A 9ICCA 1R8BA 3AQMA 3JZ0A 2PFQA 4DEZA 4MF8A 4GC7A 4KLIA 4PPXA 1NJZA 5J2CA 5HRBA 1MC8A 4FS2A 4MEXA 3QEAZ 5J2FA 5CJ7A 2Q0ZX 5KFEA 1NK0A 1NKCA 3AUOA 1XU4A 4F93B 1XSNA 2BHNA 7ICFA 2JZBA 4TQSA 1WCNA 2FLPA 5L1LA 2HW3A 3THVA 4DFMA 3LWLA 4P4OA 4QZCA 4IQVA 2BCRA 1ZQHA 4KLTA 2VANA 5IINA 1MSWD 2BQRA 2Y1IA 2ZJ5A 5F9LA 2KN7A 4ED0A 2JEFA 4I2DA 1TK8A 3ZDDA 4FHXA 3SV3A 2AGPA 2C2RA 1VJ7A 1UA0A 2C22A 5KFTA 4I2EA 3PO5A 5KG3A 4ECSA 3C2LA 7ICGA 4QZ9A 1S9FA 2ZUDA 2BCQA 2FLNA 2BE3A 5F2VO 4IRDA 8ICNA 1X9SA 1BPZA 4LZDA 1QSLA 4NY8A 2RDIA 4F5NA 1ZQPA 5DB8A 4TUSA 4XRHA 3EPIA 1NK9A 2M9NA 4DSLA 4DO9A 3SI8A 3UPSA 4WC4A 4ECVA 2BCSA 3FDSA 3AU6A 2BCUA 3OSNA 4DWIA 4WC7A 1ZJNA 3H4DA 2DR8A 2F1IA 5KFSA 3BQ1A 3Q8QB 3V7LA 3HJ1A 4UAYA 3OHAA 2KZZA 8ICTA 3B0YA 5J2KA 4UBBA 2IHMA 1ZQIA 2AGQA 1ZQEA 2DPIA 4ED2A 3NYBA 4DF8A 1V9PA 5KFLA 1QLNA 3N4MB 4QZIA 1HUZA 3C18A 5BPCA 4F5QA 1RXWA 4ED6A 3KTQA 4DS4A 1D8YA 4EYHB 3RH6A 5IIOA 1KSPA 3MGHA 1UETA 3PMNA 4X4VA 5DKWA 4KLDA 4RT2A 4DOBA 4F92B 3ISDA 3LDAA 3SYZA 4DSEA 2AU0A 2HHVA 1BNPA 3ZDCA 4ED1A 4RQ7A 3OGUA 1OU5A 3WFPA 3WFQE 2VA3A 1JXEA 1UA1A 1ZQOA 5J0UA 4RPYA 8ICAA 1U45A 1ZQFA 9ICTA 5DECA 2ZH1A 3RBEA 1ZQNA 4EZ6A 2DR9A 1ZQMA 4IR1A 1RYRA 4BWMA 4UB2A 3RJKA 3BDPA 9ICIA 5HMLA 3RTVA 4F4YA 5IIKA 3V7JA 2HHQA 1XSLA 1D9FA 3EYZA 3V72A 3AQLA 8ICPA 4DFPA 1BPYA 4XQ7A 4DSFA 1JXLA 5DBCA 4F5PA 2LYHA 4ED8A 5HP4A 3PX0A 2F1JA 2PI5A 2ZH5A 3TAPA 1Z00A 8ICRA 5KFWA 1F5AA 4IG8A 5KG1A 3H40A 1NJWA 1U47A 9ICRA 4AT8B 2DFLA 3PR4A 4RQ2A 3H7IA 5J0SA 3SV4A 1R89A 4RQ3A 4I2AA 1BPBA 4O3RA 8ICZA 5DGBA 3M8SA 5BOLA 4K4GA 1DK3A 4JWNA 3NGDA 4YD1A 3B0XA 3BQ0A 7ICHA 3IM1A 4FHWA 3GIIA 4NLNA 5J0XA 8ICWA 2BPGA 4M6WA 5KT7A 4PGQA 2IMWP 4O3SA 4Q44A 5CB1A 9ICQA 1JN3A 5IIJA 1SKWA 4F2RA 4KLHA 5KFRA 3EPGA 1FA0A 3C2MA 1SKSA 2PXIA 3V7KA 4QWDA 4DL4A 3RB0A 1S76D 1KDHA 2FMPA 2DR7A 1V4AA 4C8LA 1TK0A 1S97A 2J6UA 1WOTA 5J2BA 1JAJA 3OVBA 5DBAA 4RQ5A 3T5KA 1HJPA 1ZQJA 4C8KA 5JUMA 3HPOA 1DGSA 5HRHA 2J6TA 4F4XA 8ICLA 4KN7A 5DG8A 3GV7B 4O3NA 3BQ2A 3RAXA 1MQ3A 4B9UA 5HRIA 4TQRA 4RQ4A 4NXZA 2NRWA 2H5XA 4UB5A 3UQ0A 1NKEA 1ZQVA 5KG5A 7ICIA 2XO7A 1Z3EB 9ICWA 3Q8PB 2V4QA 1ZQCA 3H4BA 4NLKA 4NKTA 2I1QA 2ASDA 2BCVA 3KHRA 3NTUA 3BJYA 4B9SA 5D49A 4F8RA 4ZH4A 4ELUA 4M47A 5KT4A 4UB3A 4DL2A 4KLEA 2R8GA 4M6WB 3AU2A 3JPPA 5HHHA 1N48A 4R63A 1U48A 3T3FA 1L3UA 5KFUA 4ECXA 2FLLA 5F9NA 1K1SA 2R8JA 2BKEA 2AGOA 8ICIA 1KNYA 5J0OA 4QWEA 4ECWA 4UB1A 2ZHBA 4FBTA 5KFAA 2XY6A 5DG7A 1R8AA 8ICCA 3T5JA 1ZQDA 5J2AA 4RU9A 5J2DA 4RQ1A 3HX0A 4R65A 1LB2B 1MQ2A 4X4RA 2IA6A 4YQWA 4O3QA 3OV7A 4R8UB 4MFAA 1ZQYA 4DLGA 3H38A 3JPQA 3BQTA 1NKBA 3UQ2A 4J9QA 3RJJA 4FO6A 2HHPA 1KEJA 4GXKA 1D9DA 2ZH7A 2B21A 3KHHA 2ZH9A 4P4MA 2ZUBA 1AROP 4QZHA 3RB3A 1L3VA 2UVWA 3T5HA 3PW0A 5HRFA 4JUZA 4EBJA 4DQPA 5KFGA 4TURA 4LT6A 2V4RA 4M2YA 2AJQA 3AQKA 4ATBB 2V9WA 3HJ4A 5DB9A 3G6YA 4RUCA 2R8KA 5J0RA 4X0BA 5HC9A 1MIWA 3SZ2A 1LV5A 3PY8A 1ZJMA 4I2GA 4YXMA 1TAQA 3OHBA 5DGAA 3ETLA 5KG2A 2ZTDA 3RH4A 2W9AA 8ICYA 1MIYA 4ECYA 3V6HA 3PV8A 1RYSA 4RNNA 1PX5A 5J0QA 4M9NA 1B22A 3PMLA 1ZQSA 4I28A 2FPKA 1SL2A 5DLFA 3TFSA 2NRKA 4YR2A 4EYIB 2IBKA 3GQCA 1ZQKA 1ZQXA 3MABA 1QSSA 4NM2A 4Z6EA 4X4OA 2NRXA 2W9BB 1Q79A 4WC2A 3RB4A 4M0AA 2ISOA 4FH5A 3Q8RB 1RXVA 4KLGA 3ZDBA 2KZMA 2JEIA 2DRBA 1Z00B 2RFFA 5EOZA 4DS5A 1JQRA 1KTQA 2A1JB 4IQWA 5HRDA 3KHLA 3K4GA 4WC5A 4MF2A 4RWQA 5J0WA 2ZH3A 2NRVA 5DEDA 4B9TA 2HVHA 4JV2A 4ECQA 3HT3A 1CUKA 1S10A 2ZH4A 3RJEA 2XCAA 4RUAA 4DQQA 4YXJA 5EWEA 4YFKA 4J9NA 9ICEA 4QZBA 4F4KA 1S77D 4AT7A 4IRCA 5DBBA 5KG0A 1ZQZA 5HHIA 2P6UA 5CA7A 3QE9Y 4R66A 3UXPA 4AT7B 5KT2A 4YN4A 3TQ1A 1KFTA 4I2CA 4I2BA 5CR0A 4WCWA 1T3NA 4XUSA 1NK4A 4JWMA 3C1YA 2R8HA 5HMMA 8ICKA 2KTQA 5EWGA 2JZBB 4QWAA 4ECRA 5IILA 1U9LA 5KFNA 1S0MA 9ICSA 4QW8A 3FYHA 3Q8KA 1SL0A 4F2SA 2C2EA 3M9NB 4O9MA 3WFRE 2W9CB 4F4ZA 2M2VA 3MR6A 7ICKA 1UT5A 4ED3A 2XY5A 2C28A 4I29A 1NK6A 4K4IA 1TK5A 2ZJAA 5KFCA 4AT8A 4DL6A 4BWJA 4XQ8A 4RWNA 2W9CA 4UBCA 1S0VA 5KFHA 9ICXA 2BPCA 4WC1A 4RQ6A 2UVRA 4F3OA 1JMSA 5CP2A 3JPOA 3C5GA 7ICUA 5J0TA 9ICVA 3LQCB 2DPJA 3C21A 2M2UA 7ICJA 1KFDA 5KT3A 4YG2A 1NK7A 3PW7A 1T4GA 3MDAA 3RBDA 4IR9A 4KLSA 8ICVA 3EWAA 1TFWA 4QZGA 1L3SA 5L9XA 4DFKA 4E0DA 4JV0A 1TV9A 2AQ4A 1B43A 5DB6A 4Q8FA 4KLOA 4RNMA 3PO4A 4BXOA 5KFDA 4EEYA 1QTMA 4RWPA 4I2JA 4FS1A 3HW8A 7ICNA 3MFIA 1JX4A 4QZFA 3MGIA 3C66A 2P6RA 1Q78A 5KG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BDP A;  3PX4 A;  2VA8 A;  2PFN A;  1WCL A;  3MR5 A;  5J2H A;  1KLN A;  4BDP A;  4DOA A;  4DSJ A;  4F91 B;  4DFJ A;  2J6S A;  4FHY A;  4GLX A;  2A1J A;  2NRZ A;  1ZQL A;  5HRG A;  5HRK A;  3OJU A;  3GFK B;  3JPR A;  3Q8M A;  2ZH2 A;  4Z6D A;  7ICL A;  4Q8E A;  3QEB Z;  4M9G A;  1BPX A;  7ICT A;  1A76 A;  1Y88 A;  4FH3 A;  3HWT A;  3EZ5 A;  8ICJ A;  4WC6 A;  3WFS C;  1NJX A;  4WBY A;  4DLE A;  2FPM A;  4PH5 A;  5KFF A;  5KFJ A;  5J2J A;  1S0N A;  2O1P A;  4EBC A;  1KFS A;  3C1Z A;  9ICP A;  4UAW A;  5HR9 A;  1ZQT A;  4DL7 A;  3TAN A;  3TAR A;  2KP7 A;  2M2W A;  5KT5 A;  3RRG A;  4YCX A;  2M2T A;  2HHS A;  3M8R A;  8ICB A;  4RZR A;  4TUP A;  2UVV A;  3QZ7 A;  4PHP A;  3GV8 B;  3C2K A;  5D4B A;  4YVZ A;  4F50 A;  4BXO B;  4MEY A;  8ICX A;  4ATB A;  1TAU A;  4DOC A;  2PFP A;  3PNC A;  2ZTE A;  3WFO A;  4YR0 A;  4QWB A;  1ZQW A;  4M5D A;  3Q8S B;  5J2I A;  3ISC A;  1XWL A;  4DL3 A;  2KFZ A;  2ASJ A;  3MR2 A;  4TUQ A;  4X4N A;  5KT6 A;  5J29 A;  4KLL A;  3HIY A;  2XGP A;  5KG7 A;  4QZE A;  3C5F A;  4RT3 A;  4E7X A;  2ZTC A;  4R64 A;  5BOM A;  4C8M A;  4RNO A;  2WTF A;  1SL1 A;  4O5K A;  2HHU A;  9ICF A;  1NK5 A;  8ICH A;  4PGX A;  1DOQ A;  1JIH A;  4C8N A;  4AT9 B;  4X4U A;  3RJH A;  7ICM A;  7ICR A;  2Q66 A;  1H38 A;  3H39 A;  1KRP A;  7ICV A;  1X9M A;  5KFP A;  3PW4 A;  1NO5 A;  4EBD A;  3T5L A;  4RQ8 A;  5DLG A;  4QWC A;  3OSP A;  2XC9 A;  5HNK A;  1COO A;  4O3O A;  5DDM A;  2W8K A;  2BR0 A;  4YR3 A;  5HRL A;  1IM4 A;  5CHG A;  1K1Q A;  1ZET A;  4I2H A;  1XS9 D;  4M9L A;  4KIT B;  3PW2 A;  8ICE A;  3RRH A;  9ICL A;  1MIV A;  4WBZ A;  4LZG A;  4DL5 A;  3PVX A;  1SZP A;  2ZH8 A;  3OJS A;  9ICG A;  8ICO A;  4RPX A;  4PGY A;  3GDX A;  4F5O A;  2MUT B;  5DQH A;  4J9L A;  3LWM A;  2PBE A;  1PZN A;  5J2G A;  3V6J A;  1NZP A;  3AQN A;  4I27 A;  1UEV A;  3H8W A;  2ASL A;  5KFI A;  4QZD A;  3PX6 A;  1U49 A;  3KHG A;  3G6V A;  4B9L A;  7ICE A;  3RJI A;  3M9O B;  1DK2 A;  4HYK A;  1ZQB A;  4G3I A;  5CWR A;  4B9N A;  4EBK A;  4ELT A;  3MBY A;  3LK9 A;  3IHQ B;  4GXJ A;  5L1K A;  3TFR A;  2I9G A;  4YD2 A;  4KLF A;  2ID1 A;  4UD5 A;  5KFB A;  4UD4 A;  4X4Q A;  4Q43 A;  4J9M A;  1U4B A;  4DSI A;  8ICM A;  5J0P A;  3JPT A;  5KFZ A;  1NOM A;  3H8S A;  1N56 A;  2JEJ A;  4M04 A;  5DG9 A;  2FMQ A;  4MFF A;  1IXR A;  1D8L A;  4UB4 A;  2RDJ A;  2FMS A;  5L1I A;  4WC0 A;  2W8L A;  3M9M B;  4ECZ A;  1XSP A;  1UT8 A;  2KFN A;  4X4T A;  2BPF A;  1RZT A;  3GIK A;  1QSY A;  8ICU A;  4X0A A;  3H3A A;  3JYY A;  4UQG A;  3TI0 A;  3N97 B;  4FBU A;  3H37 A;  3C23 A;  9ICN A;  3ZDA A;  1BPD A;  4ECT A;  4DQR A;  4DQI A;  2W9B A;  4JV1 A;  4RWO A;  4YMO A;  4KTQ A;  4RPZ A;  3GIL A;  3K75 D;  3G6X A;  3RJG A;  4JK1 A;  2PFO A;  2NRT A;  5EWF A;  5J2E A;  4F4W A;  7ICQ A;  9ICH A;  2F1H A;  3EW9 A;  2C2D A;  2JEG A;  2ZUC A;  4O5E A;  5J0Y A;  4B9M A;  1XC9 A;  3OUY A;  1S0O A;  4M9H A;  3ISB A;  1L3T A;  1HUO A;  4KN4 A;  1BVS A;  3UXO A;  3RR7 A;  2HHX A;  3ZD9 A;  4AT9 A;  4DSK A;  3RH5 A;  5L1J A;  3H8J A;  4J9R A;  4O3P A;  1R8C A;  4NLG A;  4IRK A;  2W9M A;  5III A;  3ZD8 A;  2O5A A;  9ICA A;  9ICM A;  2ALZ A;  4J9K A;  4QW9 A;  5IIM A;  4EZ9 A;  4ECU A;  3RJF A;  2ZHA A;  1TKD A;  1T7P A;  5KFV A;  2GWS A;  3GV5 B;  4NKU A;  2Y1J A;  2MAX A;  2HHW A;  9ICJ A;  8ICS A;  1TFY A;  4X5V A;  3MDC A;  9ICU A;  4M9J A;  3TAQ A;  1EXN A;  4R8U A;  4XA5 A;  4Q45 A;  4J9S A;  4J9O A;  4ED7 A;  1ZQG A;  5HRE A;  2UVU A;  2KZ3 A;  1SKR A;  2P66 A;  2HVI A;  3RAQ A;  1UEU A;  4E80 A;  2ZJ8 A;  1ZQA A;  3ORY A;  4Z6C A;  4BGD A;  4O5C A;  2MUT A;  4KLJ A;  1NJY A;  3MR3 A;  3OVS A;  3OUY B;  5DQI A;  3JPN A;  4PHD A;  4DQS A;  1C7Y A;  4C8O A;  4K4H A;  5KFO A;  4FHP A;  9ICK A;  1X2I A;  3PR5 B;  2XGQ A;  3PW5 A;  2BQU A;  1BNO A;  4PHE A;  3Q8L A;  2ISP A;  4MFC A;  4X4S A;  4E8F A;  2HHT A;  1YLQ A;  4WC3 A;  1T8E A;  3GIM A;  8ICG A;  2FPL A;  4I2I A;  4GXI A;  7ICO A;  3MFH A;  1A77 A;  5TZV A;  4YP3 A;  1L5U A;  5KTQ A;  4EBE A;  5C5J A;  1TFR A;  4KLU A;  5DDY A;  5KFQ A;  4O0I A;  3UPQ A;  3ZDE A;  4I2F A;  4B9V A;  3E2E A;  8ICQ A;  2XCP A;  4YMN A;  2IHN A;  1CEZ A;  4P4P A;  4IQU A;  4GC6 A;  4CCH A;  3L9D A;  4EP7 A;  2ZH6 A;  3QZ8 A;  1VFG A;  4DF4 A;  5KG4 A;  2DVI A;  4IQT A;  1NK8 A;  4ELV A;  9ICO A;  2DR5 A;  5DB7 A;  3OVA A;  1BPE A;  1ZQR A;  4X4P A;  1X9W A;  5KFX A;  3UXN A;  8ICF A;  4NM1 A;  4F5R A;  2PI4 A;  4LVS A;  5KFM A;  4NLZ A;  4KLQ A;  2DRA A;  5D46 A;  3JPS A;  5KFY A;  4P2H A;  4S3N A;  4UAZ A;  7ICP A;  1RPL A;  3V6K A;  3RB6 A;  2OWO A;  9ICB A;  1ZQQ A;  4Z6F A;  4RQ0 A;  5KFK A;  2XY7 A;  4QZ8 A;  4J9P A;  1XO1 A;  4KMU A;  3GIJ A;  2BGW A;  4YMM A;  1TVA A;  4FHV A;  1BGX T;  4QZA A;  3RR8 A;  4PHA A;  1ZYQ A;  2VA2 A;  7ICS A;  2BQ3 A;  5DQG A;  2ATL A;  2R8I A;  2AQ0 A;  1ZQU A;  4KLM A;  3HP6 A;  9ICC A;  1R8B A;  3AQM A;  3JZ0 A;  2PFQ A;  4DEZ A;  4MF8 A;  4GC7 A;  4KLI A;  4PPX A;  1NJZ A;  5J2C A;  5HRB A;  1MC8 A;  4FS2 A;  4MEX A;  3QEA Z;  5J2F A;  5CJ7 A;  2Q0Z X;  5KFE A;  1NK0 A;  1NKC A;  3AUO A;  1XU4 A;  4F93 B;  1XSN A;  2BHN A;  7ICF A;  2JZB A;  4TQS A;  1WCN A;  2FLP A;  5L1L A;  2HW3 A;  3THV A;  4DFM A;  3LWL A;  4P4O A;  4QZC A;  4IQV A;  2BCR A;  1ZQH A;  4KLT A;  2VAN A;  5IIN A;  1MSW D;  2BQR A;  2Y1I A;  2ZJ5 A;  5F9L A;  2KN7 A;  4ED0 A;  2JEF A;  4I2D A;  1TK8 A;  3ZDD A;  4FHX A;  3SV3 A;  2AGP A;  2C2R A;  1VJ7 A;  1UA0 A;  2C22 A;  5KFT A;  4I2E A;  3PO5 A;  5KG3 A;  4ECS A;  3C2L A;  7ICG A;  4QZ9 A;  1S9F A;  2ZUD A;  2BCQ A;  2FLN A;  2BE3 A;  5F2V O;  4IRD A;  8ICN A;  1X9S A;  1BPZ A;  4LZD A;  1QSL A;  4NY8 A;  2RDI A;  4F5N A;  1ZQP A;  5DB8 A;  4TUS A;  4XRH A;  3EPI A;  1NK9 A;  2M9N A;  4DSL A;  4DO9 A;  3SI8 A;  3UPS A;  4WC4 A;  4ECV A;  2BCS A;  3FDS A;  3AU6 A;  2BCU A;  3OSN A;  4DWI A;  4WC7 A;  1ZJN A;  3H4D A;  2DR8 A;  2F1I A;  5KFS A;  3BQ1 A;  3Q8Q B;  3V7L A;  3HJ1 A;  4UAY A;  3OHA A;  2KZZ A;  8ICT A;  3B0Y A;  5J2K A;  4UBB A;  2IHM A;  1ZQI A;  2AGQ A;  1ZQE A;  2DPI A;  4ED2 A;  3NYB A;  4DF8 A;  1V9P A;  5KFL A;  1QLN A;  3N4M B;  4QZI A;  1HUZ A;  3C18 A;  5BPC A;  4F5Q A;  1RXW A;  4ED6 A;  3KTQ A;  4DS4 A;  1D8Y A;  4EYH B;  3RH6 A;  5IIO A;  1KSP A;  3MGH A;  1UET A;  3PMN A;  4X4V A;  5DKW A;  4KLD A;  4RT2 A;  4DOB A;  4F92 B;  3ISD A;  3LDA A;  3SYZ A;  4DSE A;  2AU0 A;  2HHV A;  1BNP A;  3ZDC A;  4ED1 A;  4RQ7 A;  3OGU A;  1OU5 A;  3WFP A;  3WFQ E;  2VA3 A;  1JXE A;  1UA1 A;  1ZQO A;  5J0U A;  4RPY A;  8ICA A;  1U45 A;  1ZQF A;  9ICT A;  5DEC A;  2ZH1 A;  3RBE A;  1ZQN A;  4EZ6 A;  2DR9 A;  1ZQM A;  4IR1 A;  1RYR A;  4BWM A;  4UB2 A;  3RJK A;  3BDP A;  9ICI A;  5HML A;  3RTV A;  4F4Y A;  5IIK A;  3V7J A;  2HHQ A;  1XSL A;  1D9F A;  3EYZ A;  3V72 A;  3AQL A;  8ICP A;  4DFP A;  1BPY A;  4XQ7 A;  4DSF A;  1JXL A;  5DBC A;  4F5P A;  2LYH A;  4ED8 A;  5HP4 A;  3PX0 A;  2F1J A;  2PI5 A;  2ZH5 A;  3TAP A;  1Z00 A;  8ICR A;  5KFW A;  1F5A A;  4IG8 A;  5KG1 A;  3H40 A;  1NJW A;  1U47 A;  9ICR A;  4AT8 B;  2DFL A;  3PR4 A;  4RQ2 A;  3H7I A;  5J0S A;  3SV4 A;  1R89 A;  4RQ3 A;  4I2A A;  1BPB A;  4O3R A;  8ICZ A;  5DGB A;  3M8S A;  5BOL A;  4K4G A;  1DK3 A;  4JWN A;  3NGD A;  4YD1 A;  3B0X A;  3BQ0 A;  7ICH A;  3IM1 A;  4FHW A;  3GII A;  4NLN A;  5J0X A;  8ICW A;  2BPG A;  4M6W A;  5KT7 A;  4PGQ A;  2IMW P;  4O3S A;  4Q44 A;  5CB1 A;  9ICQ A;  1JN3 A;  5IIJ A;  1SKW A;  4F2R A;  4KLH A;  5KFR A;  3EPG A;  1FA0 A;  3C2M A;  1SKS A;  2PXI A;  3V7K A;  4QWD A;  4DL4 A;  3RB0 A;  1S76 D;  1KDH A;  2FMP A;  2DR7 A;  1V4A A;  4C8L A;  1TK0 A;  1S97 A;  2J6U A;  1WOT A;  5J2B A;  1JAJ A;  3OVB A;  5DBA A;  4RQ5 A;  3T5K A;  1HJP A;  1ZQJ A;  4C8K A;  5JUM A;  3HPO A;  1DGS A;  5HRH A;  2J6T A;  4F4X A;  8ICL A;  4KN7 A;  5DG8 A;  3GV7 B;  4O3N A;  3BQ2 A;  3RAX A;  1MQ3 A;  4B9U A;  5HRI A;  4TQR A;  4RQ4 A;  4NXZ A;  2NRW A;  2H5X A;  4UB5 A;  3UQ0 A;  1NKE A;  1ZQV A;  5KG5 A;  7ICI A;  2XO7 A;  1Z3E B;  9ICW A;  3Q8P B;  2V4Q A;  1ZQC A;  3H4B A;  4NLK A;  4NKT A;  2I1Q A;  2ASD A;  2BCV A;  3KHR A;  3NTU A;  3BJY A;  4B9S A;  5D49 A;  4F8R A;  4ZH4 A;  4ELU A;  4M47 A;  5KT4 A;  4UB3 A;  4DL2 A;  4KLE A;  2R8G A;  4M6W B;  3AU2 A;  3JPP A;  5HHH A;  1N48 A;  4R63 A;  1U48 A;  3T3F A;  1L3U A;  5KFU A;  4ECX A;  2FLL A;  5F9N A;  1K1S A;  2R8J A;  2BKE A;  2AGO A;  8ICI A;  1KNY A;  5J0O A;  4QWE A;  4ECW A;  4UB1 A;  2ZHB A;  4FBT A;  5KFA A;  2XY6 A;  5DG7 A;  1R8A A;  8ICC A;  3T5J A;  1ZQD A;  5J2A A;  4RU9 A;  5J2D A;  4RQ1 A;  3HX0 A;  4R65 A;  1LB2 B;  1MQ2 A;  4X4R A;  2IA6 A;  4YQW A;  4O3Q A;  3OV7 A;  4R8U B;  4MFA A;  1ZQY A;  4DLG A;  3H38 A;  3JPQ A;  3BQT A;  1NKB A;  3UQ2 A;  4J9Q A;  3RJJ A;  4FO6 A;  2HHP A;  1KEJ A;  4GXK A;  1D9D A;  2ZH7 A;  2B21 A;  3KHH A;  2ZH9 A;  4P4M A;  2ZUB A;  1ARO P;  4QZH A;  3RB3 A;  1L3V A;  2UVW A;  3T5H A;  3PW0 A;  5HRF A;  4JUZ A;  4EBJ A;  4DQP A;  5KFG A;  4TUR A;  4LT6 A;  2V4R A;  4M2Y A;  2AJQ A;  3AQK A;  4ATB B;  2V9W A;  3HJ4 A;  5DB9 A;  3G6Y A;  4RUC A;  2R8K A;  5J0R A;  4X0B A;  5HC9 A;  1MIW A;  3SZ2 A;  1LV5 A;  3PY8 A;  1ZJM A;  4I2G A;  4YXM A;  1TAQ A;  3OHB A;  5DGA A;  3ETL A;  5KG2 A;  2ZTD A;  3RH4 A;  2W9A A;  8ICY A;  1MIY A;  4ECY A;  3V6H A;  3PV8 A;  1RYS A;  4RNN A;  1PX5 A;  5J0Q A;  4M9N A;  1B22 A;  3PML A;  1ZQS A;  4I28 A;  2FPK A;  1SL2 A;  5DLF A;  3TFS A;  2NRK A;  4YR2 A;  4EYI B;  2IBK A;  3GQC A;  1ZQK A;  1ZQX A;  3MAB A;  1QSS A;  4NM2 A;  4Z6E A;  4X4O A;  2NRX A;  2W9B B;  1Q79 A;  4WC2 A;  3RB4 A;  4M0A A;  2ISO A;  4FH5 A;  3Q8R B;  1RXV A;  4KLG A;  3ZDB A;  2KZM A;  2JEI A;  2DRB A;  1Z00 B;  2RFF A;  5EOZ A;  4DS5 A;  1JQR A;  1KTQ A;  2A1J B;  4IQW A;  5HRD A;  3KHL A;  3K4G A;  4WC5 A;  4MF2 A;  4RWQ A;  5J0W A;  2ZH3 A;  2NRV A;  5DED A;  4B9T A;  2HVH A;  4JV2 A;  4ECQ A;  3HT3 A;  1CUK A;  1S10 A;  2ZH4 A;  3RJE A;  2XCA A;  4RUA A;  4DQQ A;  4YXJ A;  5EWE A;  4YFK A;  4J9N A;  9ICE A;  4QZB A;  4F4K A;  1S77 D;  4AT7 A;  4IRC A;  5DBB A;  5KG0 A;  1ZQZ A;  5HHI A;  2P6U A;  5CA7 A;  3QE9 Y;  4R66 A;  3UXP A;  4AT7 B;  5KT2 A;  4YN4 A;  3TQ1 A;  1KFT A;  4I2C A;  4I2B A;  5CR0 A;  4WCW A;  1T3N A;  4XUS A;  1NK4 A;  4JWM A;  3C1Y A;  2R8H A;  5HMM A;  8ICK A;  2KTQ A;  5EWG A;  2JZB B;  4QWA A;  4ECR A;  5IIL A;  1U9L A;  5KFN A;  1S0M A;  9ICS A;  4QW8 A;  3FYH A;  3Q8K A;  1SL0 A;  4F2S A;  2C2E A;  3M9N B;  4O9M A;  3WFR E;  2W9C B;  4F4Z A;  2M2V A;  3MR6 A;  7ICK A;  1UT5 A;  4ED3 A;  2XY5 A;  2C28 A;  4I29 A;  1NK6 A;  4K4I A;  1TK5 A;  2ZJA A;  5KFC A;  4AT8 A;  4DL6 A;  4BWJ A;  4XQ8 A;  4RWN A;  2W9C A;  4UBC A;  1S0V A;  5KFH A;  9ICX A;  2BPC A;  4WC1 A;  4RQ6 A;  2UVR A;  4F3O A;  1JMS A;  5CP2 A;  3JPO A;  3C5G A;  7ICU A;  5J0T A;  9ICV A;  3LQC B;  2DPJ A;  3C21 A;  2M2U A;  7ICJ A;  1KFD A;  5KT3 A;  4YG2 A;  1NK7 A;  3PW7 A;  1T4G A;  3MDA A;  3RBD A;  4IR9 A;  4KLS A;  8ICV A;  3EWA A;  1TFW A;  4QZG A;  1L3S A;  5L9X A;  4DFK A;  4E0D A;  4JV0 A;  1TV9 A;  2AQ4 A;  1B43 A;  5DB6 A;  4Q8F A;  4KLO A;  4RNM A;  3PO4 A;  4BXO A;  5KFD A;  4EEY A;  1QTM A;  4RWP A;  4I2J A;  4FS1 A;  3HW8 A;  7ICN A;  3MFI A;  1JX4 A;  4QZF A;  3MGI A;  3C66 A;  2P6R A;  1Q78 A;  5KG6 A; 
#chains in the Genus database with same CATH topology
 3WU2 U;  2PFN A;  2WF6 A;  2E3T A;  4UAU A;  1KLN A;  4GFJ A;  4DSJ A;  1SXD A;  3N7R C;  2NRZ A;  1ZQL A;  4P0P A;  2IOF A;  4Q8E A;  2HDO A;  3ALR A;  1BPX A;  5AK3 A;  1Y88 A;  3HWT A;  1NJX A;  5B3P A;  5KFF A;  4NXT A;  5ALJ A;  1Q3U A;  4C4R A;  2KP7 A;  4YCX A;  3M8R A;  4TUP A;  1Q46 A;  2B4V A;  3QZ7 A;  5TIS U;  4YVZ A;  4UB6 U;  1DRG A;  4BXO B;  2RQ5 A;  4ATB A;  2PFP A;  2ZTE A;  2H3V A;  3HJE A;  1ZQW A;  5ALT A;  4DL3 A;  2ASJ A;  4TUQ A;  4OD0 A;  3ER8 C;  2HOQ A;  4QZE A;  4OAH A;  2ZTC A;  5BOM A;  4RNO A;  1HEK A;  7ICR A;  1H38 A;  5AKJ A;  2H3I A;  1X9M A;  3L4P A;  2WF8 A;  1NO5 A;  3T5L A;  2DKX A;  2XC9 A;  2WAQ C;  5DDM A;  5HRL A;  1ZET A;  9ICL A;  1P7D A;  2OHF A;  3KKA A;  4NXV A;  2DKZ A;  3GDX A;  4F5O A;  1QQ6 A;  4J9L A;  2QB0 A;  4C0Z A;  1NZP A;  1UEV A;  1TE2 A;  5ALD A;  3A0H U;  4HAI A;  3RJI A;  3M9O B;  2HBJ A;  4HYK A;  4EBK A;  5CWR A;  3MBY A;  4GXJ A;  2W04 A;  4UD4 A;  1RM6 C;  1NOM A;  3H8S A;  1N56 A;  4M04 A;  1D8L A;  2RDJ A;  2FJ6 A;  4WC0 A;  2YML A;  2BPF A;  2JGA A;  2JH7 A;  1QQ7 A;  8ICU A;  3N97 B;  3C23 A;  4DQR A;  5J8Y A;  1FFU A;  3GIL A;  2ZXI A;  5J2E A;  4JMU A;  7ICQ A;  4F4W A;  2HN2 A;  2EZX A;  3EW9 A;  2JEG A;  2ZUC A;  5J0Y A;  1X6J A;  1S0O A;  3SAG A;  4CF5 A;  1L3T A;  3RR7 A;  3UXO A;  5ALH A;  3AEV A;  3ZD9 A;  4DSK A;  3RH5 A;  5L1J A;  1YZ6 A;  4O3P A;  4IRK A;  2O5A A;  4J9K A;  2EH9 A;  3RJF A;  3QU9 A;  4NLB A;  5AK6 A;  5KFV A;  3K1R B;  3GV5 B;  4EEN A;  1FO4 A;  9ICU A;  4M9J A;  1T94 A;  2CPR A;  3UMC A;  1SKR A;  2P66 A;  4E80 A;  4CF3 A;  2ZJ8 A;  1ZQA A;  3ORY A;  5ALG A;  1OW5 A;  3SAF A;  3JPN A;  4C8O A;  3Q8L A;  4X4S A;  2BDU A;  5ALF A;  4E8F A;  1T8E A;  1L7O A;  3WK8 A;  3MFH A;  5TZV A;  4EBE A;  4KLU A;  4BJQ A;  2E8M A;  5KFQ A;  3UPQ A;  3ZDE A;  4BX9 C;  2IHN A;  5HR7 A;  4EP7 A;  3QZ8 A;  5KG4 A;  1NK8 A;  2ZIU B;  1C20 A;  5KFX A;  2KKV A;  2O6K A;  4Y2R A;  4NLZ A;  1LKY B;  3JPS A;  1V38 A;  2EZY A;  4UAZ A;  3V6K A;  1PK3 A;  3L3F X;  4KMU A;  5B5E U;  4NWI A;  1SGG A;  2VA2 A;  7ICS A;  1AQ6 A;  9ICC A;  4U6P A;  1MC8 A;  4FS2 A;  1NK0 A;  2DF4 B;  1NKC A;  1XSN A;  2JZB A;  1WCN A;  2FLP A;  1F5S A;  4KX3 A;  3THV A;  2HW3 A;  2R18 A;  3ICX A;  5AI4 A;  5KNI A;  4P4O A;  4Y2X A;  2VAN A;  2KN7 A;  2JEF A;  4FHX A;  1RG6 A;  3WKB A;  1X9S A;  4F5N A;  1ZQP A;  4ZOH C;  1NK9 A;  2M9N A;  3UPS A;  4DO9 A;  1Z1V A;  3SI8 A;  2G09 A;  3FDS A;  1ZD2 P;  3OTQ A;  5AKL A;  4WC7 A;  3OHA A;  1PUZ A;  3B0Y A;  3NS1 A;  3CRX A;  3KKA C;  2DPI A;  3PHZ A;  4OAI Z;  4DF8 A;  1V9P A;  2GA9 D;  5KFL A;  1QLN A;  4DS4 A;  1KSP A;  3RH6 A;  1COK A;  4AYB F;  5DKW A;  1JRO A;  1HIW A;  3SYZ A;  4DSE A;  2AU0 A;  2HHV A;  1SB3 C;  1SXE A;  4RQ7 A;  3OGU A;  1ZQO A;  2HMX A;  4J03 A;  1ZQN A;  3TAD C;  3QUC A;  4OO1 J;  4IR1 A;  1X40 A;  3EYZ A;  2KVS A;  3QYP A;  2KHV A;  8ICP A;  2KE7 A;  2LPE A;  4DSF A;  3AL0 B;  4XQ7 A;  4ED8 A;  2PI5 A;  2Y9T A;  3PX0 A;  4WJ3 B;  1Z00 A;  8ICR A;  3H40 A;  3PR4 A;  3E58 A;  4RQ2 A;  2F76 X;  2YMP A;  3SV4 A;  2KJ9 A;  8ICZ A;  2Y0S C;  3NGD A;  2BPG A;  4M6W A;  4Q44 A;  2K60 A;  1SKW A;  1OXJ A;  2F2A B;  3V7K A;  4C8L A;  2QAR B;  1RYU A;  1S97 A;  1WOT A;  3OVB A;  5HRH A;  3T5K A;  3HPO A;  2J6T A;  1B4F A;  8ICL A;  3GV7 B;  1MQ3 A;  4K9A A;  4B9U A;  5AM0 A;  7ICI A;  1ZQC A;  3QU7 A;  3BZK A;  2I1Q A;  5GTI U;  2BCV A;  2GO7 A;  4ELU A;  4M47 A;  5KT4 A;  4IC9 A;  3AQF A;  2KD1 A;  3AU2 A;  3QU5 A;  3QX7 A;  3JPP A;  4ECX A;  2AGO A;  1R8A A;  2ZIX B;  5J2A A;  4RU9 A;  4NL9 C;  4AYB C;  2IA6 A;  4O3Q A;  5GTH U;  4CGZ A;  4MFA A;  4DLG A;  2HHP A;  4FO6 A;  1KEJ A;  1N5X A;  2B21 A;  2ZH7 A;  3ED5 A;  4EEK A;  1ARO P;  1L3V A;  3T5H A;  3PW0 A;  5HRF A;  4JUZ A;  3H0R B;  5ALR A;  3G6Y A;  2Y9U A;  3NVV A;  2YMQ A;  3PY8 A;  8ICY A;  3OHB A;  1MIY A;  3ETL A;  2PMZ F;  4KMO B;  3PV8 A;  4NJ8 A;  5J0Q A;  3PML A;  2FPK A;  3TFS A;  4YR2 A;  5D61 A;  2IBK A;  1ZQK A;  1QSS A;  4NM2 A;  4Z6E A;  4EEB A;  3D2S A;  4KX5 A;  3Q8R B;  3K7D A;  2XIC A;  1KTQ A;  4WQK A;  4WC5 A;  3KHL A;  4MF2 A;  4B9T A;  4JV2 A;  4Y2S A;  3HT3 A;  1N60 A;  2XCA A;  2ZXH A;  4DQQ A;  4YXJ A;  5EWE A;  4AT7 A;  4F4K A;  5DBB A;  3F53 A;  4YN4 A;  1T3N A;  2KIC A;  2R8H A;  3SAH A;  2KMD A;  1CRX A;  5IIL A;  5KFN A;  3O0F A;  9ICS A;  4UAR A;  3Q8K A;  3WFR E;  4F4Z A;  3MCR A;  2XY5 A;  4AT8 A;  4XQ8 A;  2W9C A;  1S0V A;  2BPC A;  4WC1 A;  2UVR A;  1JMS A;  3C5G A;  7ICU A;  5J0T A;  2WHE A;  3RBD A;  4KLS A;  3EWA A;  3M7D A;  1L3S A;  4E0D A;  4WH5 A;  4KLO A;  4N7R A;  5EE3 A;  1UPH A;  2LYB A;  4C4T A;  1JX4 A;  2P6R A;  2HOF A;  1ZD3 A;  1WCL A;  5J2H A;  1VLB A;  4BDP A;  3FM9 A;  4GLX A;  4Y2V A;  5HRG A;  3OJU A;  5ALU A;  3JPR A;  7ICL A;  1LVH A;  4OJL A;  4M9G A;  3EZ5 A;  2WF5 A;  4P0P B;  8ICJ A;  4WC6 A;  3WFS C;  2FPM A;  5J2J A;  2A3V A;  2O1P A;  4FO1 A;  4EBC A;  2YMM A;  3C1Z A;  1ZQT A;  3QU2 A;  3TAN A;  2VJ5 A;  5ALS A;  3F5A A;  2M2T A;  4OJ5 A;  4RZR A;  3LVV A;  3C2K A;  5CFU A;  3PNC A;  1KW4 A;  2VJ4 A;  4M5D A;  3Q8S B;  5J2I A;  4OAG A;  5KT6 A;  5J29 A;  4PZN A;  1SL1 A;  5HR6 A;  1NK5 A;  8ICH A;  4AT9 B;  1DOQ A;  1JIH A;  4C8N A;  4X4U A;  3RJH A;  2G07 A;  3HRD D;  1KRP A;  5KFP A;  2H3Q A;  3WK4 A;  5HNK A;  1COO A;  4O3O A;  2W8K A;  1IM4 A;  5CHG A;  4M9L A;  4O6A A;  3PW2 A;  3RRH A;  2W7O A;  2MUT B;  3RF9 A;  3LWM A;  3V6J A;  3AQN A;  4EX6 A;  1SV0 A;  3H8W A;  3TAC B;  3OPX A;  1U49 A;  5ALP A;  3G6V A;  1LKY A;  4B9L A;  7ICE A;  3NVO A;  1DK2 A;  1PVR A;  4G3I A;  4ELT A;  3F5E A;  4UB8 U;  3LK9 A;  2I9G A;  5AM2 A;  3TFR A;  4KLF A;  4YD2 A;  3SD7 A;  5KFB A;  4Q43 A;  4J9M A;  2DRB A;  5J0P A;  4XJE A;  2FMQ A;  1IXR A;  4UB4 A;  3IDW A;  2MRL A;  4ECZ A;  2KFN A;  3E0F A;  1JUD A;  2BBH A;  1BPD A;  4ECT A;  3TAD A;  2W9B A;  4YMO A;  4KTQ A;  3K75 D;  4JK1 A;  2IOH A;  4MKP A;  2IUB A;  5EE1 A;  3OUY A;  4M9H A;  1Q3V A;  2HBM A;  4KN4 A;  2A19 A;  2ZG6 A;  2HHX A;  2A1A A;  4J9R A;  4K97 A;  2W9M A;  9ICA A;  2ALZ A;  3WK5 A;  2B0C A;  4FZN A;  2HHW A;  9ICJ A;  4Q45 A;  4XA5 A;  4J9S A;  1ZQG A;  2Q4T A;  2KZ3 A;  3RAQ A;  1NJY A;  3I76 A;  3MR3 A;  3OVS A;  3OUY B;  4DQS A;  4K4H A;  4FHP A;  5JTI A;  5AI8 A;  2XGQ A;  1BNO A;  3GU3 A;  4MFC A;  5T14 A;  4CNQ A;  3H0M B;  5ALK A;  1YLQ A;  8ICG A;  5AKK A;  1A77 A;  1UQV A;  5KTQ A;  5DDY A;  4I2F A;  3E2E A;  8ICQ A;  2XCP A;  4IQU A;  4GC6 A;  4CCH A;  3L9D A;  2ZH6 A;  4DF4 A;  2D8C A;  2OM6 A;  1ZQR A;  4X4P A;  3UXN A;  8ICF A;  2XID A;  4KLQ A;  4DCC A;  2DRA A;  5D46 A;  4CRX A;  4P2H A;  2OWO A;  3RB6 A;  4Z6F A;  5KFK A;  2XY7 A;  4QZ8 A;  4J9P A;  4LEZ A;  5ALO A;  2BGW A;  1FEZ A;  1GO3 F;  2K8B B;  3RR8 A;  2RLT A;  1ZYQ A;  5DQG A;  2R8I A;  2AQ0 A;  3AQM A;  3HP6 A;  1R8B A;  2I5H A;  4MF8 A;  4GC7 A;  4PPX A;  5HRB A;  1VJ5 A;  1A0P A;  4MEX A;  3CW2 C;  3AUO A;  2E8N A;  5L1L A;  2HCF A;  3DDH A;  5KL1 B;  4QZC A;  1ZQH A;  5G5G A;  1MSW D;  3ZDD A;  1TK8 A;  1VJ7 A;  2OYY A;  5G5H A;  4I2E A;  5KG3 A;  3C2L A;  7ICG A;  4QZ9 A;  2BCQ A;  5H2F U;  2FLN A;  8ICN A;  4KM5 A;  3QU4 A;  5DB8 A;  3D2N A;  4WC4 A;  4G9B A;  4ECV A;  2Z7J A;  3OSN A;  5CHE A;  1ZJN A;  4PJ0 U;  4UAY A;  2JV3 A;  3NAS A;  8ICT A;  2AGQ A;  4UAV A;  1Z1B A;  2KIW A;  4Y2P A;  5BPC A;  3KTQ A;  1D8Y A;  4EYH B;  2E5S A;  3MGH A;  2W7P A;  4X4V A;  3F2B A;  3LDA A;  3BQ7 A;  4UAT A;  5AK4 A;  5AIA A;  1U45 A;  1ZQF A;  9ICT A;  5DEC A;  4PZO A;  3RBE A;  2DR9 A;  9ICI A;  4BWM A;  3RJK A;  4RQM A;  3RTV A;  5IIK A;  3V7J A;  2QKQ A;  1S5L U;  3V72 A;  2PKE A;  4DFP A;  1BPY A;  5DBC A;  5HP4 A;  2ZH5 A;  1SZH A;  1NJW A;  2ZIV A;  1N62 A;  4AT8 B;  5L1M A;  5J0S A;  1R89 A;  4I2A A;  1RQL A;  4O3R A;  1DK3 A;  5BOL A;  3BQ0 A;  3CYM A;  7ICH A;  3IM1 A;  4NLN A;  4O3S A;  5CB1 A;  1JN3 A;  1UCV A;  1O03 A;  2MU2 A;  3C2M A;  2PXI A;  4QWD A;  1S76 D;  2KJ5 A;  2FMP A;  1V4A A;  2YQE A;  3B9J A;  5J2B A;  4QIW F;  2G5H B;  1DGS A;  1F44 A;  4O3N A;  4LEY A;  4RQ4 A;  3U26 A;  3UQ0 A;  2NRW A;  2F77 X;  1NKE A;  1ZQV A;  5KG5 A;  2V4Q A;  3H4B A;  1JRP A;  2ASD A;  4NXU A;  3NTU A;  4B9S A;  4F8R A;  4US9 A;  2KG5 A;  3ER9 B;  2LMR A;  3IN5 A;  5HHH A;  2KEY A;  4R63 A;  1N48 A;  3T3F A;  5KFU A;  1TAM A;  5AHX A;  8ICI A;  4QWE A;  2ZHB A;  4FBT A;  2XY6 A;  5DG7 A;  2CXY A;  3NUQ A;  5KL8 B;  3T5J A;  1ZQD A;  4RQ1 A;  3HX0 A;  4R65 A;  3OV7 A;  1MQ2 A;  4YQW A;  4P0Q B;  4OJ6 A;  3H38 A;  3BQT A;  3UQ2 A;  3RJJ A;  2RHF A;  2ZUB A;  1SWW A;  2MA1 A;  3RB3 A;  2UVW A;  1T3Q A;  4B6J A;  5KFG A;  4TUR A;  4ATB B;  2AJQ A;  3IV6 A;  3HJ4 A;  5DB9 A;  2R8K A;  1S8O A;  1LV5 A;  1ZJM A;  3EF2 A;  4YXM A;  2OEH A;  2ZIX A;  4QNL A;  3NVZ A;  3V6H A;  3RFA A;  1PX5 A;  4RNN A;  4JLX A;  2HBK A;  1ZQS A;  1SL2 A;  5DLF A;  2NRK A;  5JTG A;  2EAO A;  2RP5 A;  2NRX A;  2B6G A;  1Z19 A;  1RXV A;  1L7N A;  1Z00 B;  3KFU F;  2MSN A;  1PVQ A;  5J0W A;  2ZH3 A;  2W03 A;  1KKX A;  4AP9 A;  4J9N A;  1S77 D;  4IRC A;  1ZQZ A;  4AT7 B;  3QE9 Y;  4R66 A;  5KT2 A;  4Y2U A;  4I2C A;  5CR0 A;  4JWM A;  5HMM A;  4JB3 A;  5EWG A;  4QWA A;  4ECR A;  5HR9 A;  3FYH A;  1SL0 A;  2C2E A;  4O9M A;  2W9C B;  3LVW A;  4O3M A;  2YN4 A;  1UT5 A;  1TK5 A;  2DUY A;  2KOB A;  5KFC A;  4RWN A;  4BWJ A;  2M0N A;  4UBC A;  9ICV A;  3LQC B;  7ICJ A;  1KFD A;  3PW7 A;  1T4G A;  3MDA A;  1TFW A;  8ICV A;  5L9X A;  2OH2 A;  1TV9 A;  2LM1 A;  2IHO A;  3QUT A;  4RNM A;  5KFD A;  4I2J A;  1MN8 A;  3HW8 A;  4QZF A;  3MGI A;  2W3S A;  5KG6 A;  3PSF A;  3MR5 A;  5AI0 A;  2EQY A;  2NO4 A;  5ALQ A;  4F91 B;  4DFJ A;  3Q8M A;  4Z6D A;  1QCK A;  2AH5 A;  1A76 A;  2DBY A;  4DLE A;  5KFJ A;  1S0N A;  2HOI A;  1KFS A;  5AKG A;  4UAW A;  3VC8 A;  5CRX A;  4DL7 A;  1CI4 A;  3TAR A;  3JCF A;  3RRG A;  2HHS A;  1Z4O A;  8ICB A;  2UVV A;  4PHP A;  5D4B A;  2K4I A;  2AXT U;  3BS7 A;  4DOC A;  5CFS A;  1N5W A;  4YR0 A;  4QWB A;  3ISC A;  1XWL A;  2KFZ A;  4X4N A;  2YB1 A;  4KLL A;  3HIY A;  2BBJ A;  5KG7 A;  4C7Z A;  3C5F A;  4RT3 A;  4R64 A;  2WTF A;  9ICF A;  4CE6 A;  7ICM A;  2DQN B;  3WK7 A;  7ICV A;  5D62 A;  2QB1 A;  5DLG A;  3OSP A;  2BR0 A;  4NLK A;  3J81 j;  4YR3 A;  1K1Q A;  4I2H A;  9ICH A;  4WBZ A;  4KIT B;  8ICE A;  1MIV A;  4LZG A;  2G06 A;  3PVX A;  1SZP A;  2ZH8 A;  2GLE A;  4CDG A;  4PGY A;  2NYV A;  5DQH A;  5AKY A;  1PZN A;  5J2G A;  4I27 A;  2NV3 A;  2ASL A;  2WFA A;  5KFI A;  4QZD A;  3PX6 A;  3KHG A;  2KHQ A;  3IHQ B;  5L1K A;  2ID1 A;  4X4Q A;  5JU5 A;  1U4B A;  5KFZ A;  4MFF A;  2FMS A;  5L1I A;  5ALZ A;  2W8L A;  1XSP A;  1UT8 A;  2RRD A;  1RZT A;  1QSY A;  4DFD A;  3H3A A;  4UQG A;  2JMG A;  3UM9 A;  4RWO A;  3CP8 A;  3RJG A;  5AI6 A;  2G5I B;  5EWF A;  2FCL A;  2F1H A;  4O5E A;  4B9M A;  1XC9 A;  3ISB A;  2EAM A;  5EE9 A;  3H0L B;  4AT9 A;  3ZD8 A;  9ICM A;  4QW9 A;  5IIM A;  4F72 A;  3QXG A;  2GWS A;  2Y1J A;  2MAX A;  1TFY A;  4X5V A;  1SWV A;  3MDC A;  4US8 A;  4R8U A;  4J9O A;  5HRE A;  5KAI U;  2HVI A;  1UEU A;  3D6J A;  4BGD A;  2MUT A;  4KLJ A;  2CRX A;  1MA7 A;  3SMV A;  3PSP A;  1C7Y A;  2F44 A;  5KFO A;  3PR5 B;  3PW5 A;  1SV0 C;  4PHE A;  2YY6 A;  4WQL A;  1QH9 A;  2FPL A;  2E8P A;  4I2I A;  7ICO A;  4K96 A;  1L5U A;  3N28 A;  5C5J A;  4Y2Y A;  4BUG A;  4O0I A;  1ECW A;  4P4P A;  3PZP A;  5ALY A;  4NXW A;  2DVI A;  4IQT A;  2DR5 A;  5B66 U;  5DB7 A;  1BPE A;  2OCE A;  3D2Q A;  4NM1 A;  4F5R A;  2PI4 A;  2P35 A;  4C80 A;  4LVS A;  2XVT A;  5KFY A;  3K1Z A;  1RPL A;  9ICB A;  1ZQQ A;  4NLC A;  1XO1 A;  3KD3 A;  4YMM A;  1TVA A;  4FHV A;  4QZA A;  3ZI4 A;  3S6J A;  1L8L A;  4PHA A;  2BQ3 A;  4NXX A;  2ATL A;  3JZ0 A;  5C0Y A;  2PFQ A;  4DEZ A;  2KKP A;  1NJZ A;  5J2C A;  2ZIV B;  3QEA Z;  5J2F A;  2Q0Z X;  5KFE A;  5CFT A;  3MC1 A;  1XU4 A;  4F93 B;  4Y2J A;  4O68 A;  5AK5 A;  1RQN A;  3LWL A;  4IQV A;  4KLT A;  2Y1I A;  5F9L A;  4ED0 A;  3UMB A;  4I2D A;  3SV3 A;  2C2R A;  1UA0 A;  5KFT A;  3PO5 A;  4ECS A;  5AM4 A;  4ICA A;  5AM1 A;  5F2V O;  4IRD A;  1QSL A;  4LZD A;  4NY8 A;  5AI5 A;  4TUS A;  4DSL A;  1QQ5 A;  2BCU A;  1JAL A;  2DGZ A;  5KFS A;  3Q8Q B;  3V7L A;  5D63 A;  1V85 A;  5J2K A;  4UBB A;  2IHM A;  2W54 A;  4ED2 A;  1WUD A;  3N4M B;  4QZI A;  3C18 A;  1UHU A;  3TKA A;  5IIO A;  3PMN A;  5JRT A;  4RT2 A;  4F92 B;  3ISD A;  1M6Y A;  5AKH A;  1BNP A;  3ZDC A;  1OU5 A;  3WFP A;  2VA3 A;  2G0A A;  1UA1 A;  3N7S C;  1ZOL A;  4EZ6 A;  1ZQM A;  3ONN A;  3I28 A;  4WOY A;  4K9B A;  2HHQ A;  1XSL A;  1D9F A;  3AQL A;  1JXL A;  4F5P A;  2LYH A;  2F1J A;  3TAP A;  5KFW A;  2H3Z A;  4IG8 A;  5KG1 A;  2FE9 A;  9ICR A;  3KZX A;  4USA A;  4RQ3 A;  3AM9 A;  3M8S A;  4K4G A;  4YD1 A;  3B0X A;  1OUQ A;  4FHW A;  5ALW A;  3GII A;  5J0X A;  8ICW A;  2M2W A;  5KT7 A;  4PGQ A;  2IMW P;  9ICQ A;  5IIJ A;  4KLH A;  4F2R A;  2JRZ A;  5KFR A;  1SKS A;  2Y0S F;  4DL4 A;  2VIX A;  1KDH A;  2DR7 A;  3SR6 A;  1JAJ A;  5DBA A;  4RQ5 A;  1V97 A;  1HJP A;  1ZQJ A;  4C8K A;  5JUM A;  1A6S A;  1D8B A;  2LM4 A;  4F4X A;  3AMZ A;  3BQ2 A;  1VDV A;  5HRI A;  4TQR A;  4NXZ A;  2EAP A;  4QIW C;  2XO7 A;  4PL1 A;  4NKT A;  1RDF A;  4K99 A;  2NO5 A;  3KZI U;  5D49 A;  5AIC A;  4ZH4 A;  5F3X B;  4KLE A;  3M6Z A;  1U48 A;  1L3U A;  5K4L A;  5F9N A;  2E1E A;  4OCZ A;  1KNY A;  5J0O A;  3WK6 A;  2KK0 A;  3LYS A;  5KFA A;  2D3D A;  5ALL A;  2WB1 F;  5J2D A;  1LB2 B;  2K4E A;  4X4R A;  1K5O A;  1FFV A;  4R8U B;  3WKE A;  1ZQY A;  4J9Q A;  3KHH A;  2ZH9 A;  4P4M A;  4QZH A;  4EBJ A;  4LT6 A;  2V4R A;  4M2Y A;  3AQK A;  4O69 A;  2V9W A;  4RUC A;  5J0R A;  2W11 A;  5HC9 A;  1MIW A;  4I2G A;  2GAF D;  2G08 A;  1TAQ A;  5DGA A;  2ZTD A;  3RH4 A;  2W9A A;  4ECY A;  4M9N A;  1B22 A;  1SV4 A;  5A0L A;  3AQE A;  2W3R A;  4EYI B;  3GQC A;  3MAB A;  1URJ A;  4X4O A;  3OWG A;  3RB4 A;  4LEV A;  2ISO A;  3ZDB A;  2JEI A;  5ALV A;  3UMG A;  3WKC A;  4DS5 A;  1JQR A;  2JR5 A;  2DWQ A;  3BS5 A;  5HRD A;  3K4G A;  4QJF B;  2NRV A;  1CUK A;  2N1R A;  2GOL A;  3VCB A;  9ICE A;  4QZB A;  1N63 A;  2P6U A;  5CA7 A;  2K4H A;  3UXP A;  4EED A;  1X9X A;  4I2B A;  4WCW A;  4FE3 A;  1N61 A;  3C1Y A;  2KTQ A;  2HSZ A;  2JZB B;  4JLZ A;  4OAF A;  1U9L A;  2WAQ F;  3AN1 A;  1N2X A;  3NRZ A;  1SIJ A;  2JH1 A;  3MR6 A;  7ICK A;  4OJP A;  4K4I A;  2CN1 A;  9ICX A;  3I1Y A;  4FFD A;  3JPO A;  4K8V A;  2DPJ A;  3C21 A;  3PST A;  4YG2 A;  1KL9 A;  3A0B U;  4F71 A;  1ZXI A;  4QZG A;  5CEH A;  4JV0 A;  2YB4 A;  2KSO B;  1L7M A;  5AKI A;  1B43 A;  5DB6 A;  2AQ4 A;  3PO4 A;  4EEY A;  1QTM A;  4RWP A;  4FS1 A;  1X66 A;  2K4P A;  2W55 A;  3QUB A;  1Q78 A;  5ALI A;  2EZZ A;  2BDP A;  3PX4 A;  2VA8 A;  5AKE A;  4DOA A;  1F0M A;  3ERC C;  2J6S A;  4FHY A;  4C7Y A;  2A1J A;  1DXS A;  3KOO A;  5HRK A;  3GFK B;  2PMZ C;  2ZH2 A;  2F3N A;  3QEB Z;  7ICT A;  3QNM A;  4FH3 A;  4I0U A;  2FI1 A;  4WBY A;  4PH5 A;  2KNJ A;  9ICP A;  2ZIW B;  2K8A A;  2AHO B;  3HIL A;  5KT5 A;  2B51 A;  2QLT A;  3ETR A;  3GV8 B;  4F50 A;  4MEY A;  4U7C A;  8ICX A;  1TAU A;  2L5Y A;  3WFO A;  3DV9 A;  2ZIU A;  1X42 A;  3MR2 A;  2XGP A;  2JXJ A;  3BS5 B;  4E7X A;  4C8M A;  4O5K A;  2HHU A;  5AIB A;  4PGX A;  1ZQ1 C;  2Q66 A;  3H39 A;  3PW4 A;  4EGW A;  4EBD A;  4RQ8 A;  4RQN A;  4QWC A;  2BZF A;  2E1F A;  1XS9 D;  3T79 A;  5AI9 A;  4DL5 A;  3IG5 A;  3OJS A;  9ICG A;  8ICO A;  4RPX A;  4NL9 A;  2PBE A;  1ZD4 A;  2KJ8 A;  1PVP A;  1ZQB A;  4B9N A;  4UD5 A;  2ZH4 A;  5AM5 A;  5ALX A;  4MHV A;  1FIQ A;  1KQQ A;  4DSI A;  8ICM A;  3JPT A;  2JEJ A;  5DG9 A;  4PL2 A;  3M9M B;  4X4T A;  4O67 A;  2LKY A;  5AKX A;  3GIK A;  3FC4 A;  4X0A A;  3JYY A;  3TI0 A;  3H37 A;  4FBU A;  2QB0 B;  9ICN A;  3ZDA A;  4EV6 A;  4DQI A;  1JI7 A;  4JV1 A;  1NI3 A;  4Y2Q A;  3F2D A;  4RPZ A;  1IG6 A;  3G6X A;  1ZD5 A;  2PFO A;  2NRT A;  1KN5 A;  2C2D A;  1HUO A;  5ALE A;  1B0X A;  1BVS A;  3H8J A;  1R8C A;  4NLG A;  5III A;  2D6F C;  4EZ9 A;  4EX7 A;  4ECU A;  2ZHA A;  1TKD A;  1T7P A;  3NWI A;  4NKU A;  8ICS A;  2F8K A;  3TAQ A;  1EXN A;  4ED7 A;  2UVU A;  3L5K A;  3WKA A;  4Z6C A;  4O5C A;  5DQI A;  3H8M A;  4PHD A;  1J2N A;  2JHD A;  9ICK A;  1X2I A;  2BQU A;  2ISP A;  2YX8 A;  3IG8 A;  2HHT A;  4HX0 A;  4WC3 A;  2KVC A;  3GIM A;  4GXI A;  1PK1 B;  4YP3 A;  1TFR A;  3M6K A;  4B9V A;  1XO0 A;  4YMN A;  1CEZ A;  1VFG A;  5ALN A;  5E79 U;  4A8E A;  4ELV A;  9ICO A;  1J97 A;  3OVA A;  1X9W A;  2F8L A;  2FDR A;  2KV2 A;  2OXO A;  5KFM A;  2GH1 A;  4S3N A;  7ICP A;  2VKQ A;  4RQ0 A;  4C4S A;  1J2M A;  3GIJ A;  1NNL A;  1BGX T;  2EDU A;  5B3Q A;  1PK1 A;  1ZQU A;  4KLM A;  4FZM A;  4KLI A;  1WWU A;  3HKZ F;  3CK6 A;  4IL6 U;  5CJ7 A;  1GPJ A;  3GZF A;  4FZL A;  7ICF A;  2BHN A;  4TQS A;  4DFM A;  2K8C B;  2BCR A;  5IIN A;  1L8O A;  2BQR A;  2ES6 A;  2ZJ5 A;  2AGP A;  2C22 A;  2BE3 A;  1S9F A;  2ZUD A;  1BPZ A;  2RDI A;  3WKD A;  2ZIW A;  4XRH A;  3EPI A;  1L7P A;  5AKZ A;  2BCS A;  3AU6 A;  4DWI A;  3H4D A;  2DR8 A;  3M1Y A;  2F1I A;  4P0Q A;  3BQ1 A;  3N7P D;  2B56 A;  3HJ1 A;  2KZZ A;  4Y2T A;  2LI6 A;  1ZQI A;  1ZQE A;  3NYB A;  2KIV A;  1HUZ A;  4F5Q A;  1RXW A;  4ED6 A;  1UET A;  3QUQ A;  4KLD A;  4DOB A;  3NVW A;  2K89 A;  4LJX A;  4ED1 A;  1WWV A;  3WFQ E;  3SQI A;  1JXE A;  5J0U A;  4RPY A;  8ICA A;  2ZH1 A;  1ZRN A;  3F2C A;  1RYR A;  4UB2 A;  3BDP A;  5HML A;  4F4Y A;  1L6N A;  1XNS A;  2QAR A;  1KBU A;  2EWR A;  4NV0 A;  1F5A A;  1U47 A;  2DFL A;  3H7I A;  1BPB A;  5DGB A;  4JWN A;  2W43 A;  3IRU A;  3HKZ C;  5J8Y C;  2HBL A;  5KAF U;  1FA0 A;  3EPG A;  3RB0 A;  3BZC A;  1YT3 A;  1DGJ A;  1TK0 A;  4IS7 A;  2J6U A;  2ESE A;  2XI9 A;  5ALM A;  2YTU A;  3R9K A;  4LEW A;  4KN7 A;  5DG8 A;  3RAX A;  1Z4N A;  2H5X A;  4UB5 A;  1Z3E B;  9ICW A;  3Q8P B;  2IOF K;  3KHR A;  3BJY A;  1WG8 A;  1YZ7 A;  3C28 A;  4UB3 A;  4DL2 A;  1O08 A;  1NZB A;  2R8G A;  4M6W B;  4OJO A;  2WB1 C;  4UAS A;  3C29 A;  4UW9 A;  5EE0 A;  2FLL A;  1K1S A;  2R8J A;  2BKE A;  4ECW A;  4UB1 A;  3MGV A;  3KBB A;  8ICC A;  4EEL A;  2EAN A;  3FAH A;  1WYG A;  1Q8K A;  3JPQ A;  1NKB A;  2WF7 A;  1D9D A;  4GXK A;  3WK9 A;  3NKU A;  3EUB 2;  4DQP A;  4X0B A;  2KSO A;  1IV8 A;  2HI0 A;  3SZ2 A;  5KG2 A;  3IP4 B;  3SEI A;  1RYS A;  4CF4 A;  4I28 A;  1ZQX A;  2I6X A;  2W9B B;  1Q79 A;  3PSI A;  4ACO A;  4WC2 A;  4M0A A;  4FH5 A;  4KLG A;  2KZM A;  5FP0 A;  2RFF A;  5EOZ A;  4GIB A;  2A1J B;  4IQW A;  3DEE A;  1ED1 A;  4RWQ A;  5DED A;  2HVH A;  4ECQ A;  1S10 A;  1IIP A;  3RJE A;  4RUA A;  2WF9 A;  4YFK A;  5KG0 A;  5HHI A;  1KFT A;  3TQ1 A;  1X6I A;  4XUS A;  1NK4 A;  2LBO A;  8ICK A;  3CNH A;  1S0M A;  4QW8 A;  4F2S A;  3M9N B;  3NRW A;  2M2V A;  2DL0 A;  3NVY A;  4ED3 A;  4I29 A;  2C28 A;  1NK6 A;  4KB6 A;  2ZJA A;  4DL6 A;  5KFH A;  3SEN A;  2LYA A;  4RQ6 A;  4F3O A;  2E8O A;  5CP2 A;  5AM3 A;  2M2U A;  2HN1 A;  5KT3 A;  1NK7 A;  2ODG A;  4IR9 A;  4DFK A;  4K98 A;  2LHT A;  4Q8F A;  4BXO A;  7ICN A;  3MFI A;  1ZRM A;  3C66 A;  2H3F A; 
#chains in the Genus database with same CATH homology
 2BDP A;  3PX4 A;  2VA8 A;  2PFN A;  1WCL A;  3MR5 A;  5J2H A;  1KLN A;  4BDP A;  4DOA A;  4DSJ A;  4F91 B;  4DFJ A;  2J6S A;  4FHY A;  4GLX A;  2A1J A;  2NRZ A;  1ZQL A;  5HRG A;  5HRK A;  3OJU A;  3GFK B;  3JPR A;  3Q8M A;  2ZH2 A;  4Z6D A;  7ICL A;  4Q8E A;  3QEB Z;  4M9G A;  1BPX A;  7ICT A;  1A76 A;  1Y88 A;  4FH3 A;  3HWT A;  3EZ5 A;  8ICJ A;  4WC6 A;  3WFS C;  1NJX A;  4WBY A;  4DLE A;  2FPM A;  4PH5 A;  5KFF A;  5KFJ A;  5J2J A;  1S0N A;  2O1P A;  4EBC A;  1KFS A;  3C1Z A;  9ICP A;  4UAW A;  5HR9 A;  1ZQT A;  4DL7 A;  3TAN A;  3TAR A;  2KP7 A;  2M2W A;  5KT5 A;  3RRG A;  4YCX A;  2M2T A;  2HHS A;  3M8R A;  8ICB A;  4RZR A;  4TUP A;  2UVV A;  3QZ7 A;  4PHP A;  3GV8 B;  3C2K A;  5D4B A;  4YVZ A;  4F50 A;  4BXO B;  4MEY A;  8ICX A;  4ATB A;  1TAU A;  4DOC A;  2PFP A;  3PNC A;  2ZTE A;  3WFO A;  4YR0 A;  4QWB A;  1ZQW A;  4M5D A;  3Q8S B;  5J2I A;  3ISC A;  1XWL A;  4DL3 A;  2KFZ A;  2ASJ A;  3MR2 A;  4TUQ A;  4X4N A;  5KT6 A;  5J29 A;  4KLL A;  3HIY A;  2XGP A;  5KG7 A;  4QZE A;  3C5F A;  4RT3 A;  4E7X A;  2ZTC A;  4R64 A;  5BOM A;  4C8M A;  4RNO A;  2WTF A;  1SL1 A;  4O5K A;  2HHU A;  9ICF A;  1NK5 A;  8ICH A;  4PGX A;  1DOQ A;  1JIH A;  4C8N A;  4AT9 B;  4X4U A;  3RJH A;  7ICM A;  7ICR A;  2Q66 A;  1H38 A;  3H39 A;  1KRP A;  7ICV A;  1X9M A;  5KFP A;  3PW4 A;  1NO5 A;  4EBD A;  3T5L A;  4RQ8 A;  5DLG A;  4QWC A;  3OSP A;  2XC9 A;  5HNK A;  1COO A;  4O3O A;  5DDM A;  2W8K A;  2BR0 A;  4YR3 A;  5HRL A;  1IM4 A;  5CHG A;  1K1Q A;  1ZET A;  4I2H A;  1XS9 D;  4M9L A;  4KIT B;  3PW2 A;  8ICE A;  3RRH A;  9ICL A;  1MIV A;  4WBZ A;  4LZG A;  4DL5 A;  3PVX A;  1SZP A;  2ZH8 A;  3OJS A;  9ICG A;  8ICO A;  4RPX A;  4PGY A;  3GDX A;  4F5O A;  2MUT B;  5DQH A;  4J9L A;  3LWM A;  2PBE A;  1PZN A;  5J2G A;  3V6J A;  1NZP A;  3AQN A;  4I27 A;  1UEV A;  3H8W A;  2ASL A;  5KFI A;  4QZD A;  3PX6 A;  1U49 A;  3KHG A;  3G6V A;  4B9L A;  7ICE A;  3RJI A;  3M9O B;  1DK2 A;  4HYK A;  1ZQB A;  4G3I A;  5CWR A;  4B9N A;  4EBK A;  4ELT A;  3MBY A;  3LK9 A;  3IHQ B;  4GXJ A;  5L1K A;  3TFR A;  2I9G A;  4YD2 A;  4KLF A;  2ID1 A;  4UD5 A;  5KFB A;  4UD4 A;  4X4Q A;  4Q43 A;  4J9M A;  1U4B A;  4DSI A;  8ICM A;  5J0P A;  3JPT A;  5KFZ A;  1NOM A;  3H8S A;  1N56 A;  2JEJ A;  4M04 A;  5DG9 A;  2FMQ A;  4MFF A;  1IXR A;  1D8L A;  4UB4 A;  2RDJ A;  2FMS A;  5L1I A;  4WC0 A;  2W8L A;  3M9M B;  4ECZ A;  1XSP A;  1UT8 A;  2KFN A;  4X4T A;  2BPF A;  1RZT A;  3GIK A;  1QSY A;  8ICU A;  4X0A A;  3H3A A;  3JYY A;  4UQG A;  3TI0 A;  3N97 B;  4FBU A;  3H37 A;  3C23 A;  9ICN A;  3ZDA A;  1BPD A;  4ECT A;  4DQR A;  4DQI A;  2W9B A;  4JV1 A;  4RWO A;  4YMO A;  4KTQ A;  4RPZ A;  3GIL A;  3K75 D;  3G6X A;  3RJG A;  4JK1 A;  2PFO A;  2NRT A;  5EWF A;  5J2E A;  4F4W A;  7ICQ A;  9ICH A;  2F1H A;  3EW9 A;  2C2D A;  2JEG A;  2ZUC A;  4O5E A;  5J0Y A;  4B9M A;  1XC9 A;  3OUY A;  1S0O A;  4M9H A;  3ISB A;  1L3T A;  1HUO A;  4KN4 A;  1BVS A;  3UXO A;  3RR7 A;  2HHX A;  3ZD9 A;  4AT9 A;  4DSK A;  3RH5 A;  5L1J A;  3H8J A;  4J9R A;  4O3P A;  1R8C A;  4NLG A;  4IRK A;  2W9M A;  5III A;  3ZD8 A;  2O5A A;  9ICA A;  9ICM A;  2ALZ A;  4J9K A;  4QW9 A;  5IIM A;  4EZ9 A;  4ECU A;  3RJF A;  2ZHA A;  1TKD A;  1T7P A;  5KFV A;  2GWS A;  3GV5 B;  4NKU A;  2Y1J A;  2MAX A;  2HHW A;  9ICJ A;  8ICS A;  1TFY A;  4X5V A;  3MDC A;  9ICU A;  4M9J A;  3TAQ A;  1EXN A;  4R8U A;  4XA5 A;  4Q45 A;  4J9S A;  4J9O A;  4ED7 A;  1ZQG A;  5HRE A;  2UVU A;  2KZ3 A;  1SKR A;  2P66 A;  2HVI A;  3RAQ A;  1UEU A;  4E80 A;  2ZJ8 A;  1ZQA A;  3ORY A;  4Z6C A;  4BGD A;  4O5C A;  2MUT A;  4KLJ A;  1NJY A;  3MR3 A;  3OVS A;  3OUY B;  5DQI A;  3JPN A;  4PHD A;  4DQS A;  1C7Y A;  4C8O A;  4K4H A;  5KFO A;  4FHP A;  9ICK A;  1X2I A;  3PR5 B;  2XGQ A;  3PW5 A;  2BQU A;  1BNO A;  4PHE A;  3Q8L A;  2ISP A;  4MFC A;  4X4S A;  4E8F A;  2HHT A;  1YLQ A;  4WC3 A;  1T8E A;  3GIM A;  8ICG A;  2FPL A;  4I2I A;  4GXI A;  7ICO A;  3MFH A;  1A77 A;  5TZV A;  4YP3 A;  1L5U A;  5KTQ A;  4EBE A;  5C5J A;  1TFR A;  4KLU A;  5DDY A;  5KFQ A;  4O0I A;  3UPQ A;  3ZDE A;  4I2F A;  4B9V A;  3E2E A;  8ICQ A;  2XCP A;  4YMN A;  2IHN A;  1CEZ A;  4P4P A;  4IQU A;  4GC6 A;  4CCH A;  3L9D A;  4EP7 A;  2ZH6 A;  3QZ8 A;  1VFG A;  4DF4 A;  5KG4 A;  2DVI A;  4IQT A;  1NK8 A;  4ELV A;  9ICO A;  2DR5 A;  5DB7 A;  3OVA A;  1BPE A;  1ZQR A;  4X4P A;  1X9W A;  5KFX A;  3UXN A;  8ICF A;  4NM1 A;  4F5R A;  2PI4 A;  4LVS A;  5KFM A;  4NLZ A;  4KLQ A;  2DRA A;  5D46 A;  3JPS A;  5KFY A;  4P2H A;  4S3N A;  4UAZ A;  7ICP A;  1RPL A;  3V6K A;  3RB6 A;  2OWO A;  9ICB A;  1ZQQ A;  4Z6F A;  4RQ0 A;  5KFK A;  2XY7 A;  4QZ8 A;  4J9P A;  1XO1 A;  4KMU A;  3GIJ A;  2BGW A;  4YMM A;  1TVA A;  4FHV A;  1BGX T;  4QZA A;  3RR8 A;  4PHA A;  1ZYQ A;  2VA2 A;  7ICS A;  2BQ3 A;  5DQG A;  2ATL A;  2R8I A;  2AQ0 A;  1ZQU A;  4KLM A;  3HP6 A;  9ICC A;  1R8B A;  3AQM A;  3JZ0 A;  2PFQ A;  4DEZ A;  4MF8 A;  4GC7 A;  4KLI A;  4PPX A;  1NJZ A;  5J2C A;  5HRB A;  1MC8 A;  4FS2 A;  4MEX A;  3QEA Z;  5J2F A;  5CJ7 A;  2Q0Z X;  5KFE A;  1NK0 A;  1NKC A;  3AUO A;  1XU4 A;  4F93 B;  1XSN A;  2BHN A;  7ICF A;  2JZB A;  4TQS A;  1WCN A;  2FLP A;  5L1L A;  2HW3 A;  3THV A;  4DFM A;  3LWL A;  4P4O A;  4QZC A;  4IQV A;  2BCR A;  1ZQH A;  4KLT A;  2VAN A;  5IIN A;  1MSW D;  2BQR A;  2Y1I A;  2ZJ5 A;  5F9L A;  2KN7 A;  4ED0 A;  2JEF A;  4I2D A;  1TK8 A;  3ZDD A;  4FHX A;  3SV3 A;  2AGP A;  2C2R A;  1VJ7 A;  1UA0 A;  2C22 A;  5KFT A;  4I2E A;  3PO5 A;  5KG3 A;  4ECS A;  3C2L A;  7ICG A;  4QZ9 A;  1S9F A;  2ZUD A;  2BCQ A;  2FLN A;  2BE3 A;  5F2V O;  4IRD A;  8ICN A;  1X9S A;  1BPZ A;  4LZD A;  1QSL A;  4NY8 A;  2RDI A;  4F5N A;  1ZQP A;  5DB8 A;  4TUS A;  4XRH A;  3EPI A;  1NK9 A;  2M9N A;  4DSL A;  4DO9 A;  3SI8 A;  3UPS A;  4WC4 A;  4ECV A;  2BCS A;  3FDS A;  3AU6 A;  2BCU A;  3OSN A;  4DWI A;  4WC7 A;  1ZJN A;  3H4D A;  2DR8 A;  2F1I A;  5KFS A;  3BQ1 A;  3Q8Q B;  3V7L A;  3HJ1 A;  4UAY A;  3OHA A;  2KZZ A;  8ICT A;  3B0Y A;  5J2K A;  4UBB A;  2IHM A;  1ZQI A;  2AGQ A;  1ZQE A;  2DPI A;  4ED2 A;  3NYB A;  4DF8 A;  1V9P A;  5KFL A;  1QLN A;  3N4M B;  4QZI A;  1HUZ A;  3C18 A;  5BPC A;  4F5Q A;  1RXW A;  4ED6 A;  3KTQ A;  4DS4 A;  1D8Y A;  4EYH B;  3RH6 A;  5IIO A;  1KSP A;  3MGH A;  1UET A;  3PMN A;  4X4V A;  5DKW A;  4KLD A;  4RT2 A;  4DOB A;  4F92 B;  3ISD A;  3LDA A;  3SYZ A;  4DSE A;  2AU0 A;  2HHV A;  1BNP A;  3ZDC A;  4ED1 A;  4RQ7 A;  3OGU A;  1OU5 A;  3WFP A;  3WFQ E;  2VA3 A;  1JXE A;  1UA1 A;  1ZQO A;  5J0U A;  4RPY A;  8ICA A;  1U45 A;  1ZQF A;  9ICT A;  5DEC A;  2ZH1 A;  3RBE A;  1ZQN A;  4EZ6 A;  2DR9 A;  1ZQM A;  4IR1 A;  1RYR A;  4BWM A;  4UB2 A;  3RJK A;  3BDP A;  9ICI A;  5HML A;  3RTV A;  4F4Y A;  5IIK A;  3V7J A;  2HHQ A;  1XSL A;  1D9F A;  3EYZ A;  3V72 A;  3AQL A;  8ICP A;  4DFP A;  1BPY A;  4XQ7 A;  4DSF A;  1JXL A;  5DBC A;  4F5P A;  2LYH A;  4ED8 A;  5HP4 A;  3PX0 A;  2F1J A;  2PI5 A;  2ZH5 A;  3TAP A;  1Z00 A;  8ICR A;  5KFW A;  1F5A A;  4IG8 A;  5KG1 A;  3H40 A;  1NJW A;  1U47 A;  9ICR A;  4AT8 B;  2DFL A;  3PR4 A;  4RQ2 A;  3H7I A;  5J0S A;  3SV4 A;  1R89 A;  4RQ3 A;  4I2A A;  1BPB A;  4O3R A;  8ICZ A;  5DGB A;  3M8S A;  5BOL A;  4K4G A;  1DK3 A;  4JWN A;  3NGD A;  4YD1 A;  3B0X A;  3BQ0 A;  7ICH A;  3IM1 A;  4FHW A;  3GII A;  4NLN A;  5J0X A;  8ICW A;  2BPG A;  4M6W A;  5KT7 A;  4PGQ A;  2IMW P;  4O3S A;  4Q44 A;  5CB1 A;  9ICQ A;  1JN3 A;  5IIJ A;  1SKW A;  4F2R A;  4KLH A;  5KFR A;  3EPG A;  1FA0 A;  3C2M A;  1SKS A;  2PXI A;  3V7K A;  4QWD A;  4DL4 A;  3RB0 A;  1S76 D;  1KDH A;  2FMP A;  2DR7 A;  1V4A A;  4C8L A;  1TK0 A;  1S97 A;  2J6U A;  1WOT A;  5J2B A;  1JAJ A;  3OVB A;  5DBA A;  4RQ5 A;  3T5K A;  1HJP A;  1ZQJ A;  4C8K A;  5JUM A;  3HPO A;  1DGS A;  5HRH A;  2J6T A;  4F4X A;  8ICL A;  4KN7 A;  5DG8 A;  3GV7 B;  4O3N A;  3BQ2 A;  3RAX A;  1MQ3 A;  4B9U A;  5HRI A;  4TQR A;  4RQ4 A;  4NXZ A;  2NRW A;  2H5X A;  4UB5 A;  3UQ0 A;  1NKE A;  1ZQV A;  5KG5 A;  7ICI A;  2XO7 A;  1Z3E B;  9ICW A;  3Q8P B;  2V4Q A;  1ZQC A;  3H4B A;  4NLK A;  4NKT A;  2I1Q A;  2ASD A;  2BCV A;  3KHR A;  3NTU A;  3BJY A;  4B9S A;  5D49 A;  4F8R A;  4ZH4 A;  4ELU A;  4M47 A;  5KT4 A;  4UB3 A;  4DL2 A;  4KLE A;  2R8G A;  4M6W B;  3AU2 A;  3JPP A;  5HHH A;  1N48 A;  4R63 A;  1U48 A;  3T3F A;  1L3U A;  5KFU A;  4ECX A;  2FLL A;  5F9N A;  1K1S A;  2R8J A;  2BKE A;  2AGO A;  8ICI A;  1KNY A;  5J0O A;  4QWE A;  4ECW A;  4UB1 A;  2ZHB A;  4FBT A;  5KFA A;  2XY6 A;  5DG7 A;  1R8A A;  8ICC A;  3T5J A;  1ZQD A;  5J2A A;  4RU9 A;  5J2D A;  4RQ1 A;  3HX0 A;  4R65 A;  1LB2 B;  1MQ2 A;  4X4R A;  2IA6 A;  4YQW A;  4O3Q A;  3OV7 A;  4R8U B;  4MFA A;  1ZQY A;  4DLG A;  3H38 A;  3JPQ A;  3BQT A;  1NKB A;  3UQ2 A;  4J9Q A;  3RJJ A;  4FO6 A;  2HHP A;  1KEJ A;  4GXK A;  1D9D A;  2ZH7 A;  2B21 A;  3KHH A;  2ZH9 A;  4P4M A;  2ZUB A;  1ARO P;  4QZH A;  3RB3 A;  1L3V A;  2UVW A;  3T5H A;  3PW0 A;  5HRF A;  4JUZ A;  4EBJ A;  4DQP A;  5KFG A;  4TUR A;  4LT6 A;  2V4R A;  4M2Y A;  2AJQ A;  3AQK A;  4ATB B;  2V9W A;  3HJ4 A;  5DB9 A;  3G6Y A;  4RUC A;  2R8K A;  5J0R A;  4X0B A;  5HC9 A;  1MIW A;  3SZ2 A;  1LV5 A;  3PY8 A;  1ZJM A;  4I2G A;  4YXM A;  1TAQ A;  3OHB A;  5DGA A;  3ETL A;  5KG2 A;  2ZTD A;  3RH4 A;  2W9A A;  8ICY A;  1MIY A;  4ECY A;  3V6H A;  3PV8 A;  1RYS A;  4RNN A;  1PX5 A;  5J0Q A;  4M9N A;  1B22 A;  3PML A;  1ZQS A;  4I28 A;  2FPK A;  1SL2 A;  5DLF A;  3TFS A;  2NRK A;  4YR2 A;  4EYI B;  2IBK A;  3GQC A;  1ZQK A;  1ZQX A;  3MAB A;  1QSS A;  4NM2 A;  4Z6E A;  4X4O A;  2NRX A;  2W9B B;  1Q79 A;  4WC2 A;  3RB4 A;  4M0A A;  2ISO A;  4FH5 A;  3Q8R B;  1RXV A;  4KLG A;  3ZDB A;  2KZM A;  2JEI A;  2DRB A;  1Z00 B;  2RFF A;  5EOZ A;  4DS5 A;  1JQR A;  1KTQ A;  2A1J B;  4IQW A;  5HRD A;  3KHL A;  3K4G A;  4WC5 A;  4MF2 A;  4RWQ A;  5J0W A;  2ZH3 A;  2NRV A;  5DED A;  4B9T A;  2HVH A;  4JV2 A;  4ECQ A;  3HT3 A;  1CUK A;  1S10 A;  2ZH4 A;  3RJE A;  2XCA A;  4RUA A;  4DQQ A;  4YXJ A;  5EWE A;  4YFK A;  4J9N A;  9ICE A;  4QZB A;  4F4K A;  1S77 D;  4AT7 A;  4IRC A;  5DBB A;  5KG0 A;  1ZQZ A;  5HHI A;  2P6U A;  5CA7 A;  3QE9 Y;  4R66 A;  3UXP A;  4AT7 B;  5KT2 A;  4YN4 A;  3TQ1 A;  1KFT A;  4I2C A;  4I2B A;  5CR0 A;  4WCW A;  1T3N A;  4XUS A;  1NK4 A;  4JWM A;  3C1Y A;  2R8H A;  5HMM A;  8ICK A;  2KTQ A;  5EWG A;  2JZB B;  4QWA A;  4ECR A;  5IIL A;  1U9L A;  5KFN A;  1S0M A;  9ICS A;  4QW8 A;  3FYH A;  3Q8K A;  1SL0 A;  4F2S A;  2C2E A;  3M9N B;  4O9M A;  3WFR E;  2W9C B;  4F4Z A;  2M2V A;  3MR6 A;  7ICK A;  1UT5 A;  4ED3 A;  2XY5 A;  2C28 A;  4I29 A;  1NK6 A;  4K4I A;  1TK5 A;  2ZJA A;  5KFC A;  4AT8 A;  4DL6 A;  4BWJ A;  4XQ8 A;  4RWN A;  2W9C A;  4UBC A;  1S0V A;  5KFH A;  9ICX A;  2BPC A;  4WC1 A;  4RQ6 A;  2UVR A;  4F3O A;  1JMS A;  5CP2 A;  3JPO A;  3C5G A;  7ICU A;  5J0T A;  9ICV A;  3LQC B;  2DPJ A;  3C21 A;  2M2U A;  7ICJ A;  1KFD A;  5KT3 A;  4YG2 A;  1NK7 A;  3PW7 A;  1T4G A;  3MDA A;  3RBD A;  4IR9 A;  4KLS A;  8ICV A;  3EWA A;  1TFW A;  4QZG A;  1L3S A;  5L9X A;  4DFK A;  4E0D A;  4JV0 A;  1TV9 A;  2AQ4 A;  1B43 A;  5DB6 A;  4Q8F A;  4KLO A;  4RNM A;  3PO4 A;  4BXO A;  5KFD A;  4EEY A;  1QTM A;  4RWP A;  4I2J A;  4FS1 A;  3HW8 A;  7ICN A;  3MFI A;  1JX4 A;  4QZF A;  3MGI A;  3C66 A;  2P6R A;  1Q78 A;  5KG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...