5J0YA

Binary complex crystal structure of dna polymerase beta with t:t mismatch at the primer terminus
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
330
structure length
327
Chain Sequence
APQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of DNA Polymerase Mispaired DNA Termini Transitioning to Pre-catalytic Complexes Support an Induced-Fit Fidelity Mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 108
structure length 327
sequence length 330
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5j0yA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5j0yA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5j0yA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5j0yA03
4ECTA 4YD2A 4X4OA 5KFJA 5KG6A 2R8JA 4ECQA 2FMQA 2C2DA 4RWPA 1NK6A 1S0OA 4RQ2A 1L5UA 1SKWA 4K4IA 3GIMA 5BOLA 9ICVA 1BGXT 3OVSA 3WFRE 4RWOA 1ZQLA 2PI5A 2HHXA 4F5QA 5KG1A 8ICYA 4IR9A 5DQHA 3UPSA 7ICLA 4UAWA 1Y88A 2XY6A 3RBDA 5J0RA 2I1QA 4EYHB 2MUTB 7ICUA 5BOMA 3JPNA 1IM4A 2W9MA 5KFCA 3RJIA 3TQ1A 1MC8A 4YXJA 3H39A 4NKTA 4O3RA 1UT5A 2FMPA 4KLFA 5KFUA 5L1LA 2BHNA 5KFAA 5L9XA 4EEYA 4O3OA 1ZQFA 2NRXA 7ICHA 2DRAA 4QZBA 5IIJA 1JX4A 1MQ3A 3EPIA 8ICFA 4UBBA 4DS5A 2KN7A 4F91B 3Q8PB 5KG2A 1ZQIA 3OJUA 2H5XA 1ZQWA 4DFMA 2M2TA 4YMNA 4DL3A 4RT2A 5DB9A 1ZQUA 4I2DA 3GV7B 2BDPA 2KZZA 1VJ7A 2F1HA 4R65A 2V4QA 1S77D 1NJXA 4WC3A 4X4SA 2J6SA 3GV8B 4EBDA 2AU0A 3B0YA 3H7IA 2VA8A 4QZGA 4MF2A 4QWBA 1JQRA 2Q66A 5KFLA 3ZDCA 2PI4A 5KFDA 1DK2A 3GIIA 4M04A 3JYYA 4DOAA 1LB2B 2PFPA 4IRDA 2BCUA 4YR3A 1K1QA 4QZHA 3TANA 4JV1A 4XRHA 1COOA 8ICUA 4ECYA 4RQ0A 1SL0A 3RB0A 3KHLA 1TKDA 1ZQMA 4BWMA 1KSPA 4NKUA 4I2EA 4AT8B 4WC6A 2C22A 2AQ4A 3H4DA 1FA0A 4I2CA 9ICQA 5J0SA 8ICOA 3V7JA 4O3PA 1U49A 4E8FA 2XY5A 5DBCA 4QZIA 1F5AA 2ZH9A 3WFOA 3JPSA 2Q0ZX 4YMMA 4DO9A 5IIMA 1RPLA 3MR5A 4I29A 3C2MA 4O3NA 5J2JA 4ELTA 1NK8A 5DGBA 4M9JA 2PXIA 1KFTA 3C21A 4DQSA 1BPZA 3OSPA 1SKSA 3RJEA 2ZHAA 7ICQA 3H40A 4I27A 4NLKA 3ZD9A 3C23A 2J6TA 4F2RA 4X4RA 4FBUA 1TFRA 5J2AA 2DR7A 4EBCA 4RU9A 5DBAA 4C8OA 4I28A 3OJSA 1ZQKA 5DLFA 2ZH8A 5J29A 4WBZA 5CP2A 1ZQOA 4JK1A 3UQ0A 3TARA 4ECWA 5J0PA 3PY8A 4M6WA 3PMNA 3MFHA 3Q8MA 3PMLA 4F4XA 1NJWA 3QEBZ 1L3VA 1UA0A 9ICEA 4RPYA 4ED0A 9ICNA 3JPTA 3KTQA 3LWLA 4PH5A 9ICBA 1XSNA 1ZQHA 4B9NA 2O5AA 3BQ1A 4F5PA 3UXPA 5KFNA 2GWSA 4KTQA 5J2EA 4F93B 5DEDA 4NLZA 1NZPA 1T7PA 2UVUA 4DQRA 3QE9Y 3RRHA 1XC9A 2J6UA 1IXRA 3BQTA 1X2IA 5DQIA 5DKWA 2DPJA 4AT8A 2AGQA 1HUZA 1SL2A 4UAZA 1XU4A 1JXLA 3GIKA 3G6YA 1B22A 7ICMA 9ICWA 2W9CB 4EBEA 1ZQJA 3HWTA 3MDAA 2KFZA 1NKEA 4QZ9A 1ZETA 1DK3A 1ZQSA 2DRBA 3HP6A 4UBCA 5J0OA 4RPXA 3GIJA 4JV2A 4P2HA 2KFNA 3UXNA 2V4RA 4DLEA 2BKEA 3MGIA 3PX6A 1XS9D 3RB6A 1QTMA 2PBEA 3AQMA 1ZQGA 7ICFA 4J9LA 9ICUA 3H3AA 3ISDA 5IINA 4M9HA 4GC6A 1K1SA 4Z6CA 4O5EA 1ZQEA 4ATBB 4DL2A 3OVBA 2HW3A 4EZ9A 4UD4A 1XSPA 2LYHA 4DFPA 7ICPA 4F92B 4FHWA 4Q44A 2FPKA 4BDPA 3AQNA 4QWEA 1QSLA 4QZAA 1KFSA 3WFQE 4GC7A 2DR8A 4YD1A 2BQRA 4RQ7A 1RXWA 2ZH6A 5DG7A 3RH6A 4J9NA 2ZJ5A 3EYZA 5KFYA 5DB7A 5CHGA 2MUTA 4JUZA 5KT7A 3OHBA 1U48A 1TK5A 1ZQQA 4DWIA 1BPYA 1X9MA 4PHAA 7ICKA 1ZQBA 4DEZA 4DS4A 1T8EA 5HRDA 3BQ0A 1JIHA 7ICRA 1Q79A 3PW7A 4J9SA 4DL4A 4DF4A 3SYZA 5KFQA 4LZGA 1V9PA 4DSEA 3RAQA 2PFQA 3EZ5A 3BJYA 5DB8A 4B9UA 2JEJA 9ICLA 1MIVA 2JZBA 7ICIA 4ED6A 4F4YA 3TFRA 4QZEA 5KFIA 1UT8A 4C8LA 4FO6A 1TFYA 5DECA 1JXEA 4QZFA 4GLXA 9ICIA 1MIWA 1V4AA 4Z6EA 4QWAA 2ISPA 2IBKA 3IHQB 4EP7A 4X4TA 1ZQYA 1NK9A 4F8RA 4PHDA 4TUQA 3PNCA 3EPGA 4BWJA 4J9KA 2IHNA 1N48A 4YN4A 1NO5A 4PHPA 5KFFA 5KFZA 4C8NA 3V72A 5IIIA 1NK7A 1Z00B 1NK5A 4M9LA 4UD5A 4MEXA 1ZQRA 1ZQTA 5J0XA 1ZQDA 4BGDA 1QSSA 3TAPA 1B43A 5J0QA 4ED1A 3ZDDA 4EBJA 2ISOA 4C8KA 1D8YA 4F4KA 1WOTA 1AROP 3GQCA 3RJJA 1S97A 4I2HA 1N56A 1NJYA 9ICXA 3OHAA 4QW9A 5DLGA 1A76A 5JUMA 3JPQA 4I2AA 4KLIA 5HHHA 8ICTA 4B9SA 5EWGA 8ICBA 1NJZA 1ZQVA 3RBEA 2ASDA 3HJ4A 3OV7A 2BPGA 3NGDA 3PV8A 9ICFA 5HC9A 4KLSA 2HVHA 1ZYQA 2DPIA 1U9LA 5J2HA 2R8KA 4JV0A 2FPLA 4QWCA 2ZTDA 4E0DA 3V6JA 4CCHA 2FLNA 5KFEA 4RZRA 8ICMA 3PW5A 5HMLA 8ICRA 1TFWA 1WCNA 4B9VA 3UPQA 4ECSA 2ID1A 4DQIA 1S0VA 4IQTA 1WCLA 2A1JA 5EWEA 3OGUA 4MFFA 4JWMA 4KLGA 3T5JA 4J9QA 3C18A 4X5VA 8ICSA 2KP7A 3RJHA 1SL1A 2C2EA 4IQUA 1Z00A 2W9AA 5DG8A 1BNPA 5EWFA 4ECZA 2M2WA 5KFPA 3C66A 5KFXA 4XQ8A 2XO7A 4DLGA 4JWNA 2HHPA 4WC1A 4WC2A 4F2SA 4X4QA 8ICLA 1BPXA 7ICGA 5BPCA 3KHGA 3PVXA 4EYIB 2R8GA 2ZH7A 3PX0A 2ZH5A 3H8JA 1TAQA 1OU5A 3JZ0A 4WCWA 9ICMA 4X0BA 3H8SA 4NY8A 3V6KA 4UB4A 5J2FA 4O9MA 3RH5A 1C7YA 3PW0A 2BCRA 4K4HA 3RB3A 1ZQPA 4DFKA 3K75D 2P6RA 4K4GA 3MR3A 2A1JB 2KZ3A 2UVVA 4Q43A 4FBTA 3UXOA 7ICOA 5EOZA 3QZ7A 1S0NA 4BXOA 3NYBA 5DGAA 2UVWA 4M2YA 5KFRA 3TAQA 3AU6A 1SKRA 2KZMA 3HW8A 8ICXA 2JEIA 4E7XA 3QEAZ 1NKCA 1UEVA 1MQ2A 2AJQA 4FHPA 1BPDA 2F1IA 5D4BA 3AQKA 8ICHA 4O3QA 3EW9A 4DOBA 9ICAA 4KLUA 9ICSA 3HT3A 5CA7A 1S76D 2W9BA 2Y1JA 2DFLA 3H8WA 5KT5A 2DR9A 4LZDA 1S10A 1RZTA 3RR7A 5C5JA 2ZUCA 5J2GA 3PW2A 2M9NA 4UB3A 4ED8A 2BGWA 3MGHA 4KN4A 2BPFA 2HHWA 3OUYA 3SI8A 2WTFA 5HRBA 2VANA 3Q8RB 3M9MB 2ZJAA 3MBYA 1KEJA 2R8HA 1HUOA 4BXOB 4GXJA 4MFCA 4FHYA 1EXNA 1XWLA 2JEFA 1ZQAA 1SZPA 5KG7A 1ZQCA 4B9LA 1CEZA 4TQSA 4P4PA 1XSLA 3HJ1A 1Z3EB 2M2UA 3JPRA 1ZQZA 2NRVA 3BQ2A 2HHUA 4MFAA 4M6WB 4DSIA 9ICPA 3HX0A 4NLNA 3C1ZA 3V7LA 3T3FA 4PGYA 5J0YA 4TQRA 3GILA 1D9FA 4G3IA 3H38A 1PZNA 4FHXA 3LQCB 3JPPA 1VFGA 4FS1A 4I2JA 5KFGA 4HYKA 2HHVA 1UA1A 4KLTA 1TK0A 5HRGA 4KN7A 5KT6A 3RRGA 3C5GA 3ZDAA 4YCXA 2RDJA 2JZBB 4F5RA 9ICCA 5KFVA 4X4VA 1U4BA 4XA5A 4YP3A 4UB2A 3GDXA 2V9WA 2XGQA 3MFIA 2BCSA 8ICGA 4R8UA 2ZTEA 4J9PA 2XGPA 3Q8LA 8ICNA 4DFJA 8ICQA 4F5OA 4NM2A 3AU2A 3M9OB 3V7KA 4IRCA 3ORYA 3T5LA 2HHSA 9ICGA 5KT3A 2W9CA 3G6VA 2RDIA 2IMWP 4M0AA 4FHVA 3B0XA 2XY7A 2W8LA 4I2BA 2BQ3A 5CR0A 1KLNA 2ZH1A 4RQ1A 3ZDEA 1QLNA 2BCQA 2IHMA 5HRKA 2FLPA 4Q8EA 8ICKA 3V6HA 2XCPA 3PX4A 4P4OA 2NRZA 3C5FA 3SV3A 4M9NA 4LT6A 4UB1A 4ZH4A 4M9GA 8ICZA 3E2EA 1R8AA 4J9OA 1TVAA 4ED2A 1L3SA 3PO5A 4ATBA 5J0TA 2FMSA 9ICRA 4I2IA 2NRWA 4I2FA 5KG0A 5DG9A 2FLLA 8ICIA 2W8KA 5HP4A 3OVAA 4IRKA 2BPCA 5J2CA 5HHIA 5KFMA 4UQGA 4O5KA 2RFFA 4C8MA 4R64A 2R8IA 4DL6A 4ECUA 1NKBA 2JEGA 4RT3A 1QSYA 4RQ5A 4QW8A 1T4GA 4QZDA 2ALZA 4EZ6A 1R89A 4RWQA 4QWDA 1RYRA 4WC7A 4F5NA 4ECRA 4NLGA 3PO4A 4DSKA 1NK4A 3FDSA 4RNOA 4M47A 2AGPA 4DSJA 2HHQA 1S0MA 3ZDBA 7ICTA 4FH5A 1A77A 3THVA 3UQ2A 4DQQA 2I9GA 5D46A 4AT9A 4B9TA 1TK8A 1DOQA 8ICCA 5KT2A 3C1YA 1YLQA 7ICVA 8ICAA 2XC9A 4X4NA 3TFSA 4YQWA 3RH4A 1U45A 4RUAA 2ZH4A 4YVZA 1KTQA 4RQ6A 1MIYA 2ZUDA 3IM1A 2VA3A 1D9DA 1KRPA 1KDHA 4R63A 1CUKA 4YR0A 4F3OA 9ICOA 4ED7A 9ICKA 4RNMA 3SV4A 7ICNA 3OUYB 5J2BA 4I2GA 4XQ7A 9ICHA 2IA6A 3G6XA 4KLJA 4QZCA 4PGXA 3KHRA 9ICTA 2F1JA 4NM1A 2MAXA 4ECVA 2VA2A 2FPMA 2W9BB 4DL7A 1PX5A 2ZH2A 4MF8A 2DR5A 4NXZA 4YFKA 4YXMA 3HPOA 2PFOA 8ICEA 2P66A 5D49A 5KT4A 1BVSA 4M5DA 3HIYA 1UEUA 2B21A 4TURA 2P6UA 5HREA 3ISCA 1RYSA 4UB5A 2PFNA 4ED3A 4DSLA 4YR2A 4YMOA 4GXIA 5KTQA 4YG2A 5KFTA 5F9LA 3QZ8A 5HR9A 4X4UA 7ICEA 4ECXA 1NOMA 4RQ3A 5CWRA 5DBBA 2O1PA 5J2DA 4O0IA 2NRTA 1L3TA 4E80A 4UAYA 1XO1A 3SZ2A 3T5HA 1H38A 1KFDA 3Q8QB 3RR8A 4ELVA 5CB1A 1KNYA 2ZJ8A 5KFSA 1L3UA 4R8UB 1JMSA 3LWMA 4LVSA 4O3SA 2UVRA 2M2VA 3OSNA 4KLEA 2ATLA 5DB6A 2BCVA 4EBKA 1ZQNA 5HRHA 2ZTCA 4FS2A 3TI0A 5HMMA 4O5CA 5KFWA 3RTVA 7ICSA 4AT7B 4PGQA 3MR2A 2HHTA 1R8CA 4WC0A 4DOCA 3BDPA 5IIKA 1JAJA 3AQLA 1JN3A 3H37A 3K4GA 4DF8A 5J2IA 5KG5A 3RB4A 1DGSA 4F50A 4R66A 4Q45A 4P4MA 2OWOA 4Z6FA 3ETLA 3RAXA 3NTUA 4F4ZA 3PR5B 2AGOA 4IQWA 3EWAA 3N4MB 4KMUA 4IQVA 4RQ8A 1S9FA 4KLQA 1BPEA 5KFOA 4MEYA 4J9RA 5HRLA 4IG8A 1NK0A 3RJFA 4FH3A 4XUSA 4WC5A 2BQUA 4KLLA 4PHEA 3GFKB 3FYHA 1TAUA 1HJPA 5HRIA 2C2RA 4GXKA 4WBYA 1R8BA 4KITB 2ZUBA 3MABA 5IIOA 3M8RA 4Z6DA 4J9MA 2KTQA 3WFPA 4RNNA 3C2KA 5L1JA 1BNOA 4F4WA 4KLMA 2DVIA 3H4BA 1UETA 2ZH3A 5J0WA 5KFHA 4TUPA 8ICPA 4RWNA 3RJKA 3KHHA 3LK9A 2XCAA 3MDCA 5CJ7A 1TV9A 1X9WA 3Q8SB 3L9DA 4DQPA 4WC4A 3M8SA 4QZ8A 5F2VO 4S3NA 3C2LA 3MR6A 5IILA 5J0UA 3ZD8A 5TZVA 4ELUA 3GV5B 4KLDA 4RQ4A 2ASLA 3PR4A 4TUSA 1T3NA 2BE3A 1BPBA 4RPZA 4KLOA 3N97B 3WFSC 5F9NA 1ZQXA 3Q8KA 3AUOA 4DL5A 3T5KA 4AT9B 4X0AA 5DDYA 3JPOA 4DSFA 4B9MA 5KFKA 5L1IA 4Q8FA 5HRFA 2C28A 5HNKA 4PPXA 4X4PA 1LV5A 7ICJA 5KG4A 3ISBA 5L1KA 1D8LA 5DQGA 1X9SA 3PW4A 8ICJA 9ICJA 4IR1A 5J2KA 8ICWA 1Q78A 2NRKA 1RXVA 2BR0A 3RJGA 5DDMA 4KLHA 5KFBA 1ZJMA 2Y1IA 1MSWD 4RUCA 2HVIA 1U47A 4AT7A 2AQ0A 3M9NB 5KG3A 2ASJA 2ZHBA 3LDAA 8ICVA 1ZJNA
chains in the Genus database with same CATH superfamily
4X4OA 4YD2A 5KG6A 4B6JA 4RQ2A 1ED1A 2HBMA 3GIMA 9ICVA 4F5QA 2CN1A 3UPSA 3FAHA 3VC8A 2IOFK 3AEVA 2LI6A 4KX3A 2GH1A 5AK3A 4O3RA 4KLFA 5L1LA 5L9XA 2VIXA 5TISU 4O3OA 1N61A 4EEYA 1ZQFA 4QZBA 2IHOA 1JX4A 8ICFA 4UW9A 2KN7A 1PK1A 3Q8PB 1F0MA 3K7DA 4JLXA 3OJUA 2H5XA 1ZQWA 2M2TA 2KZZA 1L8OA 1VJ5A 4I2DA 1J2NA 1IIPA 4WC3A 2HBLA 4RQMA 2VA8A 4QZGA 5KFDA 3GIIA 4DOAA 2PFPA 8ICUA 4RQ0A 1KSPA 2HN1A 4WC6A 2AQ4A 2B51A 4E8FA 5DBCA 4QZIA 2HDOA 4DO9A 5IIMA 2NV3A 1RPLA 3MR5A 4O3NA 1RQNA 1RDFA 4ELTA 1KFTA 2FE9A 3C21A 5A0LA 1BPZA 2EDUA 3OSPA 1SKSA 2ZHAA 1N63A 5ALZA 2QB0B 3ZD9A 4FBUA 1TFRA 2AHOB 1Z19A 4I28A 2KHQA 4WBZA 5CP2A 1ZQOA 3UQ0A 1L7PA 2E1FA 2EQYA 2DBYA 2OM6A 3B9JA 3AL0B 4F4XA 1NJWA 3QEBZ 4KMOB 1Q3VA 1Q46A 4FZNA 1J97A 4PH5A 1WUDA 4F5PA 4KTQA 2GWSA 4F93B 3HRDD 1NZPA 1T7PA 1IXRA 2VJ5A 3EUB2 3BQTA 5CFTA 5DQIA 2DPJA 1SGGA 4JMUA 3G6YA 5HR6A 7ICMA 4QZ9A 3L3FX 4UBCA 2WHEA 1QTMA 3AQMA 3N7SC 3ISDA 4Z6CA 4ATBB 1KW4A 4CF5A 4EZ9A 4UD4A 7ICPA 3AMZA 2QARB 4BDPA 3GU3A 1KFSA 1X6JA 4YD1A 4RQ7A 2F3NA 8ICLA 1JQRA 5KT7A 1ZQQA 4CNQA 4KX5A 1ZQBA 2KHVA 4DEZA 4DL4A 1PVPA 3SYZA 1V9PA 4LEZA 3EZ5A 3BJYA 5DB8A 3PSFA 2JZBA 5ALUA 4C8LA 1JXEA 3NVYA 1ZD2P 1V4AA 2F76X 4QIWF 3HKZC 2ISPA 4QWAA 5B5EU 4YN4A 1NK7A 4UD5A 1ZQTA 1ZQDA 1B43A 5H2FU 3R9KA 2ISOA 4C8KA 1D8YA 1WOTA 3WK7A 4P0QB 1AROP 5ALWA 3OHAA 4KLIA 2HOQA 1SB3C 4Y2TA 1ZQVA 3IG8A 2MU2A 9ICFA 2HVHA 1ZYQA 2DPIA 2R8KA 4JV0A 4WJ3B 8ICRA 5HMLA 1WCNA 3SAFA 4B9VA 3UPQA 4HX0A 2ZIXA 4IQTA 5EWEA 2A1JA 3T5JA 3C18A 4X5VA 2GA9D 3RJHA 1SL1A 2C2EA 1N2XA 4US8A 2M2WA 2KV2A 5KFXA 3NRZA 2E8PA 1VDVA 3PVXA 4EYIB 2R8GA 2E3TA 4NY8A 4O9MA 1ZRNA 2BCRA 3RB3A 5ALYA 3MR3A 2KZ3A 4FBTA 3UXOA 1S0NA 3NYBA 5DGAA 8ICXA 5KFRA 1SKRA 2JEIA 4O3MA 5G5HA 5CFSA 1UEVA 3UMGA 1IG6A 1QH9A 5ALLA 5D4BA 3AQKA 1HIWA 4DOBA 3HT3A 1SZHA 1S76D 2Y1JA 3CW2C 5KT5A 2DR9A 2VKQA 2BGWA 3SI8A 2K8CB 1HUOA 3M9MB 5AKZA 5ALHA 4FHYA 4WC1A 1XWLA 1X9XA 4OJOA 1CEZA 3AQEA 4AYBF 3HJ1A 3FM9A 3BQ2A 4MFAA 4M6WB 4DSIA 9ICPA 2Y9TA 3H8MA 3BS5B 4FHXA 3PSIA 3JPPA 5AICA 4FS1A 4I2JA 4EX6A 1UA1A 3C5GA 2RDJA 3NWIA 5ALGA 5HR7A 4PL1A 2V9WA 3WK6A 3M6KA 8ICGA 1MA7A 3KZIU 4R8UA 2FDRA 8ICQA 2EWRA 4NM2A 3M9OB 3V7KA 2LYAA 3B0XA 1KLNA 5AM4A 3S6JA 3UMCA 2BCQA 4J03A 2IHMA 5ALFA 2ZIUA 2XCPA 1ZD4A 4P4OA 3NKUA 4UB1A 4M9GA 1R8AA 2LBOA 1TVAA 1L3SA 2HMXA 1SXEA 2FMSA 4I2FA 2NRWA 5ALRA 5C0YA 5HP4A 1P7DA 5KFMA 4C8MA 4QW8A 2H3IA 2DKZA 4QZDA 4NXWA 2ALZA 4RWQA 2NYVA 4WC7A 4NLGA 1KN5A 4M47A 2HHQA 2HBJA 2M0NA 3UQ2A 3LVVA 4AT9A 4B9TA 1X42A 3PZPA 2XC9A 1B4FA 3RH4A 2ZH4A 4RUAA 1SIJA 1KDHA 4F3OA 9ICOA 4ED7A 4O69A 4RNMA 4EEDA 5J2BA 2KJ9A 4KLJA 9ICTA 2K8BB 2MAXA 2VA2A 1FO4A 2DR5A 4NXZA 2P66A 1BVSA 3HIYA 2ZIUB 3H0RB 3N7RC 1RYSA 4DSLA 4YMOA 4GXIA 4HAIA 5KFTA 3AM9A 7ICEA 1NOMA 4O0IA 3E58A 5KAIU 3Q8QB 3RR8A 5CB1A 1Q3UA 3LVWA 4R8UB 4UAUA 2ATLA 4ICAA 5HRHA 4FS2A 3TI0A 5HMMA 4O5CA 4WOYA 3MR2A 1JN3A 4JLZA 5J2IA 4F50A 3NTUA 4IQWA 4KLQA 2D3DA 4IQVA 1S9FA 2PKEA 5HRLA 4IG8A 4XUSA 1RM6C 4G9BA 3GFKB 1TAUA 5HRIA 2C2RA 2QKQA 4KITB 2ZUBA 3WK5A 2KTQA 3O0FA 1QQ5A 4PL2A 2DVIA 4ZOHC 3F2BA 3D2QA 1TV9A 4OD0A 5CJ7A 3C2LA 4ELUA 3ZD8A 5TZVA 4OJLA 2ASLA 1BPBA 4LJXA 3WFSC 5G5GA 4AT9B 2B0CA 2RQ5A 4N7RA 5DDYA 2C28A 1WWVA 4OJPA 4CF3A 5L1KA 2LM1A 1NNLA 2G08A 8ICWA 5J2KA 3F5AA 5KFBA 1MSWD 2ZHBA 1ZJNA 4ECTA 2R8JA 2C2DA 4O68A 4FZLA 5BOLA 1BGXT 4CRXA 5DQHA 2Y0SC 3RBDA 5J0RA 2BZFA 2K4EA 4NXTA 7ICUA 1Z4OA 2O6KA 3JPNA 1IM4A 3FC4A 5AI4A 1ZD3A 3RJIA 2D8CA 1MC8A 1UT5A 2FMPA 5KFAA 2K4HA 1MQ3A 3EPIA 5AK6A 2CRXA 2ESEA 4YMNA 1O03A 2RP5A 4R65A 2V4QA 1GO3F 1CI4A 4USAA 3GV8B 5KFLA 1DK2A 2H3ZA 4M04A 2BCUA 4UASA 3A0BU 2YMPA 2KEYA 3NRWA 1ZQMA 1TKDA 2AXTU 3M7DA 2DQNB 4BWMA 4I2EA 5D62A 9ICQA 5J0SA 8ICOA 3V7JA 4YMMA 3WK8A 1Q8KA 3SAGA 3SENA 3N7PD 1NK8A 4M9JA 2PXIA 2WFAA 4DQSA 3RJEA 3H40A 4NLKA 2J6TA 5J2AA 4NV0A 4EBCA 4EENA 1ZQKA 2ZH8A 5J29A 4CDGA 3PY8A 3Q8MA 3MGVA 2MSNA 2W43A 1L3VA 1UA0A 4RPYA 4WQKA 3JPTA 2IOHA 2FCLA 1XSNA 3OPXA 3L4PA 5KFNA 3UXPA 5JU5A 1RG6A 3QE9Y 1YZ6A 4AT8A 2AGQA 1HUZA 3L5KA 1XU4A 1JXLA 9ICWA 4EBEA 2F8LA 3MDAA 2LKYA 4I0UA 2DRBA 3KKAA 1DK3A 1ZETA 4BX9C 3GIJA 1ZQSA 5J0OA 4RPXA 4JV2A 4P2HA 8ICKA 4DLEA 2V4RA 3MGIA 3RB6A 4BJQA 1ZQGA 4J9LA 9ICUA 4GC6A 1N60A 5D63A 2LYHA 4F92B 1T3QA 4PZNA 4Q44A 2FPKA 2MRLA 1L8LA 2HI0A 3ONNA 3WFQE 2QLTA 5ALPA 2BQRA 2ZH6A 4C80A 3EYZA 5KFYA 2MUTA 4JUZA 7ICRA 1Q79A 4K96A 3PW7A 4Y2SA 4DSEA 4IS7A 2A3VA 4B9UA 2JEJA 2WB1C 4LEWA 7ICIA 1K5OA 3KOOA 2XIDA 5KFIA 4QZEA 1ZQ1C 3KBBA 2E5SA 9ICIA 4EP7A 2IBKA 4FZMA 3IN5A 4CF4A 2K60A 4X4TA 1ZQYA 4F8RA 2WAQC 3TKAA 5KL1B 4J9KA 2IHNA 5KFFA 1UHUA 5KFZA 3SAHA 1NK5A 1Z00B 4BGDA 5J0QA 3I28A 3ZDDA 4OAHA 4F4KA 8ICTA 4I2AA 5HHHA 2OYYA 4B9SA 1SXDA 3RBEA 3F2DA 2BPGA 4NLBA 2JMGA 1U9LA 2ODGA 2ZTDA 5AI8A 3PW5A 3WKDA 5ALEA 1RYUA 1WCLA 3OGUA 3C29A 8ICSA 2KP7A 5DG8A 5EWFA 5KFPA 2XO7A 3HJEA 2HHPA 4WC2A 3IDWA 4F2SA 4P0QA 7ICGA 5BPCA 2ZH7A 1TAQA 3JZ0A 9ICMA 4X0BA 3H8SA 4UB4A 3RH5A 2XVTA 3PW0A 2Y0SF 4K4HA 4DFKA 5AI9A 4K4GA 7ICOA 3QXGA 2W3RA 3TAQA 2PMZF 2KZMA 3QX7A 1NKCA 5AKYA 4FHPA 1BPDA 2F1IA 3TACB 2HCFA 1KKXA 9ICSA 1AQ6A 5CA7A 2W9BA 3QU5A 1S10A 4WH5A 2W03A 3PW2A 2WTFA 3MBYA 1KEJA 1O08A 3WK4A 2LMRA 1EXNA 2OXOA 4B9LA 4U7CA 4P4PA 1X40A 1XSLA 2M2UA 2HHUA 4TQRA 1D9FA 3H38A 4G3IA 1PZNA 3LQCB 1VFGA 5JRTA 1FFUA 2WF6A 2KVCA 5HRGA 1TK0A 5JTGA 3ED5A 4F5RA 9ICCA 2ZIWA 5KFVA 4X4VA 1YZ7A 4UB2A 3MFIA 4K9AA 2ZH3A 3Q8LA 2XGPA 4F5OA 3H0LB 5JTIA 3ORYA 3CK6A 2W9CA 4MKPA 2RDIA 4M0AA 2OEHA 2XY7A 1LVHA 2W8LA 3SEIA 2BQ3A 4RQ1A 2FLPA 3C5FA 1KL9A 1N5WA 2BDUA 4ED2A 5J0TA 8ICIA 3UM9A 4NL9A 2W55A 3QYPA 4IRKA 4UQGA 2BPCA 5HHIA 2FJ6A 4O5KA 1Z4NA 2RFFA 1V97A 4ECUA 1NKBA 5AKIA 1J2MA 1R89A 2EZYA 2ZXIA 3PO4A 4RNOA 5KL8B 5AM3A 4KB6A 2KMDA 4K98A 1YT3A 1DOQA 5KT2A 5AKJA 8ICAA 3TFSA 4YQWA 4CGZA 4RQ6A 1MIYA 1KRPA 4R63A 1C20A 9ICHA 2F1JA 4NM1A 2KK0A 2ZH2A 2W9BB 3F5EA 1PX5A 3HPOA 5J8YA 1UEUA 2B21A 4AYBC 2P6UA 5HREA 3ISCA 2D6FC 2PFNA 4IL6U 4YR2A 4YG2A 4ECXA 2NRTA 5K4LA 3T5HA 1KFDA 5AKLA 2DWQA 2UVRA 3OSNA 3DV9A 4EBKA 5B3QA 2GO7A 2F77X 5KFWA 4OO1J 5AK4A 2G5HB 4PGQA 1R8CA 3SR6A 3BDPA 3AQLA 4XJEA 3H37A 3K4GA 3PSTA 3IRUA 3QU9A 2OWOA 4R66A 2ZIWB 4Z6FA 4F4ZA 3PR5B 3N4MB 3EWAA 2DF4B 4RQ8A 3DDHA 1BPEA 3BZKA 4WC5A 3J81j 4NXUA 4MHVA 3MABA 5IIOA 3M8RA 4J9MA 5L1JA 4GIBA 1UETA 5J0WA 3RJKA 3KHHA 1PVQA 3LK9A 3NS1A 1X9WA 4WC4A 3M8SA 5AK5A 3MR6A 4KLDA 2LYBA 4RQ4A 3PR4A 4TUSA 3ERCC 4RPZA 2K89A 3N97B 5F9NA 3Q8KA 4X0AA 3JPOA 4B9MA 3QUCA 2KICA 4Q8FA 2KVSA 5HNKA 4PPXA 4X4PA 1TFWA 5DQGA 9ICJA 3PW4A 4RQNA 1RXVA 4KLHA 2KD1A 4AT7A 1QQ6A 3M9NB 4M5DA 2ASJA 4LEVA 1QCKA 5KFJA 4RWPA 4ECQA 2FMQA 1NK6A 1L5UA 1FEZA 3OVSA 4RWOA 2PI5A 5KG1A 4IR9A 2JRZA 1Y88A 2I1QA 4OJ5A 2QARA 5BOMA 2QB0A 4C4SA 2W9MA 4YXJA 3H39A 4NKTA 5KFUA 4C7ZA 2NRXA 4US9A 4UBBA 4DS5A 4DFMA 3LYSA 2YQEA 2BDPA 3GV7B 2F1HA 4X4SA 3B0YA 3H7IA 4QWBA 2XICA 2Q66A 3JYYA 1LB2B 2CXYA 4IRDA 4YR3A 4QZHA 4ECYA 5ALMA 3KHLA 4AT8B 2C22A 5CFUA 3H4DA 1FA0A 1JUDA 4I2CA 4O3PA 1U49A 2XY5A 3ICXA 1F5AA 2ZH9A 3JPSA 4I29A 2OCEA 2W11A 5DGBA 1PVRA 4QNLA 2E8MA 4DFDA 4F2RA 3C23A 3WKBA 4RU9A 5DBAA 2B56A 5DLFA 5ALVA 3TARA 4ECWA 2JH7A 4Y2JA 9ICNA 5AKEA 4ED0A 2KSOA 9ICBA 5AM1A 3BQ1A 4GFJA 2UVUA 4DQRA 3RRHA 2J6UA 3I1YA 2K4IA 1X2IA 5DKWA 1CRXA 4ACOA 4Y2VA 3GIKA 2W9CB 1ZQJA 1ZD5A 3HP6A 3UXNA 1XS9D 2PBEA 2WF9A 1X66A 3H3AA 3F53A 2R18A 1ZQEA 3OVBA 2HW3A 1XSPA 2YMLA 3E0FA 3AQNA 3NVWA 2BBJA 4GC7A 2IUBA 2DR8A 1RXWA 1LKYA 3RH6A 3ALRA 4J9NA 1U48A 5E79U 3OHBA 1TK5A 4DWIA 5CRXA 5AIAA 1T8EA 4DS4A 3BQ0A 2ZIXB 5ALOA 3C28A 2HOFA 4O67A 3BS7A 1MIVA 5L1MA 3TFRA 4WQLA 1DRGA 1TFYA 4GLXA 4Z6EA 3F2CA 3VCBA 1NK9A 4EV6A 3DEEA 3EPGA 4BWJA 1NO5A 1N48A 3AN1A 4C8NA 4M9LA 4MEXA 5J0XA 2YTUA 2YN4A 3GQCA 9ICXA 1TE2A 2F2AB 1NJYA 3JPQA 2A19A 5T14A 5EWGA 2ASDA 2ZG6A 3NVZA 3OV7A 3PV8A 5HC9A 2ES6A 4KLSA 3BQ7A 5J2HA 2FPLA 1JRPA 4QWCA 2HOIA 4E0DA 4CCHA 2RLTA 5FP0A 2ID1A 1S0VA 4MFFA 2KSOB 4J9QA 2JR5A 3NVOA 3D2SA 2JHDA 3KD3A 4IQUA 1Z00A 4FE3A 1BNPA 4ECZA 3C66A 4OAGA 2OH2A 3WU2U 4X4QA 1BPXA 2ZIVB 3KHGA 3PX0A 3H8JA 3NUQA 5J2FA 3EF2A 1ZQPA 1LKYB 4Y2YA 4Q43A 2LHTA 2WF5A 2EZZA 4BXOA 2UVWA 3AU6A 3HKZF 3HW8A 3QU4A 2YX8A 2AJQA 4O3QA 3EW9A 3SMVA 2YB1A 4KLUA 3H8WA 3RR7A 5C5JA 2BPFA 4UB3A 2HHWA 3MGHA 4KN4A 5HRBA 2VANA 2R8HA 4MFCA 5AKGA 4C7YA 2JEFA 4EEBA 5KG7A 1ZQCA 4TQSA 1ZRMA 3WKEA 5EE3A 3JPRA 4NLNA 3C1ZA 3V7LA 4PGYA 3GILA 4BUGA 5KFGA 2HHVA 1SWVA 3NASA 4KLTA 4KN7A 3ZDAA 4YCXA 4P0PA 2KJ5A 2A1AA 1U4BA 4XA5A 3QUTA 4YP3A 2BCSA 2ZTEA 8ICNA 2W3SA 3AU2A 3T5LA 2HHSA 9ICGA 3G6VA 2IMWP 4K8VA 4FHVA 4I2BA 5CR0A 5HRKA 2KIWA 4Q8EA 4M9NA 4EX7A 4ZH4A 2HSZA 4J9OA 3PO5A 4NJ8A 4I2IA 3I76A 2FLLA 2EH9A 5J2CA 2KOBA 2W54A 3BZCA 3M1YA 4R64A 2Q4TA 2JEGA 1ZOLA 2JV3A 4RT3A 1QSYA 4RQ5A 1T4GA 4Y2RA 3QU7A 2EANA 4QWDA 1RYRA 2W04A 4ECRA 3FDSA 3IV6A 4QJFB 3ZDBA 4FH5A 4Y2QA 4DQQA 2I9GA 8ICCA 3C1YA 7ICVA 4X4NA 1KTQA 2VA3A 1D9DA 2I6XA 1CUKA 4YR0A 2YY6A 3SV4A 3AQFA 7ICNA 3KKAC 1A0PA 3U26A 5ALDA 4QZCA 4K9BA 3KHRA 2KIVA 4ECVA 2FPMA 4F72A 4DL7A 2PFOA 5AKXA 5D49A 1DXSA 4NXVA 5F9LA 3QZ8A 5HR9A 4X4UA 2NO4A 4RQ3A 5CWRA 2O1PA 5J2DA 4UATA 4UB8U 3RFAA 1XO1A 4UAYA 3SZ2A 1B0XA 4ELVA 2ZJ8A 5KFSA 1L3UA 3LWMA 4LVSA 4O3SA 2M2VA 5ALNA 2F44A 5DB6A 2BCVA 1ZQNA 4C4TA 1SV0A 2ZTCA 7ICSA 4NXXA 3ETRA 2HHTA 4DOCA 1JAJA 4DF8A 1DGSA 2GLEA 4P4MA 1M6YA 3ETLA 3RAXA 2DGZA 4KMUA 5KFOA 2LPEA 4FH3A 4KLLA 2H3FA 3FYHA 1HJPA 4UAVA 2CPRA 2ZXHA 2KG5A 1R8BA 4WBYA 2EAMA 3PSPA 3D2NA 3H4BA 4A8EA 5KFHA 4U6PA 8ICPA 5KNIA 4RWNA 3MDCA 2XCAA 3Q8SB 4DQPA 3MCRA 4S3NA 1JALA 5IILA 5J0UA 1T3NA 2BE3A 5AKKA 4JB3A 3GZFA 2H3QA 4DSFA 5KFKA 1ZXIA 5ALTA 1NZBA 1LV5A 1KBUA 5KG4A 2NO5A 1X9SA 1KNYA 4IR1A 2NRKA 3RJGA 1ZJMA 5ALKA 1U47A 2HVIA 2AQ0A 3LDAA 4EZ6A 3D6JA 3MC1A 1S0OA 4K4IA 1SKWA 3WFRE 1ZQLA 5AM5A 2HHXA 8ICYA 7ICLA 4UAWA 4FFDA 2XY6A 4EYHB 1URJA 2MUTB 5KFCA 3TQ1A 2B6GA 5EE1A 4OJ6A 2BHNA 1T94A 2EZXA 2DRAA 7ICHA 5IIJA 3NVVA 4PZOA 2KKVA 5ALIA 4F91B 5KG2A 1ZQIA 5ALSA 3SD7A 2QB1A 4DL3A 4RT2A 5DB9A 1ZQUA 3WFOA 1VJ7A 1S77D 1NJXA 2J6SA 4EBDA 2AU0A 4MF2A 1FIQA 2G07A 3H0MB 4C0ZA 4DCCA 3ZDCA 2PI4A 1V85A 4JV1A 3TANA 1K1QA 1S8OA 3JCFA 2F8KA 4XRHA 1COOA 1SL0A 3RB0A 4QIWC 2RRDA 4LEYA 2Q0ZX 1V38A 3C2MA 5J2JA 2WB1F 7ICQA 4I27A 4X4RA 2DR7A 4C8OA 2MA1A 3OJSA 4JK1A 2WAQF 2KE7A 3PHZA 5J0PA 4M6WA 3PMNA 3MFHA 3HILA 3PMLA 2LM4A 9ICEA 3KTQA 3LWLA 1DGJA 1ZQHA 1MN8A 1WG8A 4B9NA 2O5AA 5J2EA 5B3PA 5DEDA 4NLZA 1XC9A 1SL2A 4UAZA 1JI7A 2KJ8A 3CP8A 1B22A 3HWTA 2KFZA 1NKEA 2E8NA 2KFNA 5D61A 3SQIA 8ICJA 2ZH5A 1WYGA 3TADC 2BKEA 3CYMA 5EE0A 3PX6A 7ICFA 5IINA 4M9HA 1K1SA 1UPHA 4O5EA 4NKUA 4Y2PA 4DL2A 4DFPA 4O6AA 2DUYA 4FHWA 4QWEA 1QSLA 4QZAA 4PJ0U 4NWIA 1HEKA 2YMQA 3A0HU 5DG7A 2ZJ5A 5DB7A 5CHGA 3OVAA 2RHFA 7ICKA 1BPYA 1X9MA 4PHAA 5HRDA 1JIHA 1NI3A 1SV4A 4J9SA 4DF4A 5KFQA 4LZGA 4EELA 2PFQA 3RAQA 9ICLA 1SV0C 4ED6A 3QUQA 4F4YA 1UT8A 4FO6A 5DECA 4QZFA 1MIWA 2E8OA 5AIBA 3IP4B 3IHQB 5ALXA 4PHDA 4TUQA 1D8BA 3PNCA 4PHPA 3V72A 5IIIA 1ZQRA 1QSSA 4EBJA 2G06A 3TAPA 4ED1A 5AKHA 3UMBA 3RJJA 4I2HA 1S97A 1N56A 4QW9A 5DLGA 1A76A 5JUMA 1L7OA 5ALJA 1OXJA 2XI9A 8ICBA 1NJZA 3HJ4A 3NGDA 1RQLA 2VJ4A 3RF9A 3V6JA 3CRXA 2FLNA 5KFEA 4RZRA 8ICMA 2GAFD 4ECSA 4DQIA 4JWMA 4KLGA 2E1EA 2H3VA 2W9AA 4EGWA 5GTIU 4XQ8A 4JWNA 4DLGA 1X6IA 1PUZA 5AI6A 1GPJA 1OU5A 4OCZA 4WCWA 3V6KA 1UCVA 1C7YA 3K75D 1F44A 2P6RA 2A1JB 2UVVA 5EOZA 3QZ7A 2IOFA 5EE9A 4M2YA 2EAOA 4E7XA 3QEAZ 1MQ2A 5CHEA 8ICHA 2YB4A 9ICAA 3TADA 2DFLA 2Z7JA 4LZDA 1RZTA 1ECWA 2ZUCA 5J2GA 2M9NA 2JGAA 1L7NA 4ED8A 3OUYA 2I5HA 2WF7A 3Q8RB 2ZJAA 2YMMA 4BXOB 4GXJA 1ZQAA 5CEHA 1SZPA 3BS5A 1Z3EB 1ZQZA 2NRVA 2HN2A 3HX0A 2DL0A 3T3FA 4EEKA 5J0YA 3OWGA 3T79A 4HYKA 5KT6A 3RRGA 3QU2A 2JZBB 2W7PA 3GDXA 1UQVA 2XGQA 1JROA 4J9PA 3OTQA 4DFJA 5J8YC 5AM2A 2K8AA 1Z1BA 4IRCA 1OUQA 1TAMA 5KT3A 1S5LU 2KKPA 4Y2UA 2ZH1A 1QLNA 3ZDEA 2GOLA 2DKXA 3V6HA 3PX4A 4LT6A 2NRZA 3SV3A 8ICZA 3E2EA 1XO0A 3ER8C 4ATBA 2PMZC 9ICRA 5KG0A 5DG9A 1A6SA 4OAFA 2W8KA 2K4PA 4Y2XA 5F3XB 2R8IA 4DL6A 4NLCA 3ZI4A 2FI1A 4NL9C 4FO1A 2B4VA 1F5SA 4UB6U 1IV8A 1VLBA 4F5NA 4CE6A 4DSKA 1NK4A 4KM5A 2AGPA 3CNHA 4DSJA 1S0MA 3M6ZA 7ICTA 1A77A 3THVA 2AH5A 5D46A 1N5XA 1TK8A 4OAIZ 3WKAA 1YLQA 1QQ7A 2OHFA 2N1RA 1U45A 4YVZA 2ZUDA 3IM1A 2EAPA 4K97A 3IG5A 9ICKA 3OUYB 4I2GA 4XQ7A 2IA6A 3G6XA 4PGXA 2G09A 2P35A 3K1ZA 5AM0A 2G5IB 4MF8A 4YFKA 4YXMA 8ICEA 5B66U 4IC9A 5KT4A 4TURA 2BBHA 3WKCA 4UB5A 4ED3A 3K1RB 5KTQA 1PK1B 5DBBA 3QUBA 3N28A 4E80A 2JXJA 2JH1A 1L3TA 1Z1VA 1H38A 2Y9UA 2L5YA 2ZIVA 1JMSA 3KZXA 4KLEA 2KNJA 5ALQA 4K99A 3RTVA 4AT7B 4WC0A 5IIKA 5AI5A 5KG5A 3RB4A 4Q45A 4F71A 2AGOA 4MEYA 4J9RA 1NK0A 3RJFA 2BQUA 4PHEA 3WK9A 4GXKA 4P0PB 1PK3A 4UARA 4Z6DA 3WFPA 4RNNA 3C2KA 1COKA 1BNOA 4F4WA 4KLMA 1FFVA 2G0AA 1OW5A 4TUPA 5AHXA 3ER9B 5KAFU 3KFUF 2WF8A 5GTHU 3L9DA 5F2VO 4QZ8A 1SWWA 5AI0A 3GV5B 1L6NA 4KLOA 1L7MA 1XNSA 1ZQXA 3AUOA 4DL5A 3T5KA 5L1IA 5HRFA 1N62A 4AP9A 7ICJA 3ISBA 2W7OA 1D8LA 4C4RA 3QNMA 1Q78A 2HBKA 2BR0A 5DDMA 2Y1IA 4RUCA 1WWUA 1KQQA 5KG3A 8ICVA
chains in the Genus database with same CATH topology
4ECTA 4YD2A 4X4OA 5KFJA 5KG6A 2R8JA 4ECQA 2FMQA 2C2DA 4RWPA 1NK6A 1S0OA 4RQ2A 1L5UA 1SKWA 4K4IA 3GIMA 5BOLA 9ICVA 1BGXT 3OVSA 3WFRE 4RWOA 1ZQLA 2PI5A 2HHXA 4F5QA 5KG1A 8ICYA 4IR9A 5DQHA 3UPSA 7ICLA 4UAWA 1Y88A 2XY6A 3RBDA 5J0RA 2I1QA 4EYHB 2MUTB 7ICUA 5BOMA 3JPNA 1IM4A 2W9MA 5KFCA 3RJIA 3TQ1A 1MC8A 4YXJA 3H39A 4NKTA 4O3RA 1UT5A 2FMPA 4KLFA 5KFUA 5L1LA 2BHNA 5KFAA 5L9XA 4EEYA 4O3OA 1ZQFA 2NRXA 7ICHA 2DRAA 4QZBA 5IIJA 1JX4A 1MQ3A 3EPIA 8ICFA 4UBBA 4DS5A 2KN7A 4F91B 3Q8PB 5KG2A 1ZQIA 3OJUA 2H5XA 1ZQWA 4DFMA 2M2TA 4YMNA 4DL3A 4RT2A 5DB9A 1ZQUA 4I2DA 3GV7B 2BDPA 2KZZA 1VJ7A 2F1HA 4R65A 2V4QA 1S77D 1NJXA 4WC3A 4X4SA 2J6SA 3GV8B 4EBDA 2AU0A 3B0YA 3H7IA 2VA8A 4QZGA 4MF2A 4QWBA 1JQRA 2Q66A 5KFLA 3ZDCA 2PI4A 5KFDA 1DK2A 3GIIA 4M04A 3JYYA 4DOAA 1LB2B 2PFPA 4IRDA 2BCUA 4YR3A 1K1QA 4QZHA 3TANA 4JV1A 4XRHA 1COOA 8ICUA 4ECYA 4RQ0A 1SL0A 3RB0A 3KHLA 1TKDA 1ZQMA 4BWMA 1KSPA 4NKUA 4I2EA 4AT8B 4WC6A 2C22A 2AQ4A 3H4DA 1FA0A 4I2CA 9ICQA 5J0SA 8ICOA 3V7JA 4O3PA 1U49A 4E8FA 2XY5A 5DBCA 4QZIA 1F5AA 2ZH9A 3WFOA 3JPSA 2Q0ZX 4YMMA 4DO9A 5IIMA 1RPLA 3MR5A 4I29A 3C2MA 4O3NA 5J2JA 4ELTA 1NK8A 5DGBA 4M9JA 2PXIA 1KFTA 3C21A 4DQSA 1BPZA 3OSPA 1SKSA 3RJEA 2ZHAA 7ICQA 3H40A 4I27A 4NLKA 3ZD9A 3C23A 2J6TA 4F2RA 4X4RA 4FBUA 1TFRA 5J2AA 2DR7A 4EBCA 4RU9A 5DBAA 4C8OA 4I28A 3OJSA 1ZQKA 5DLFA 2ZH8A 5J29A 4WBZA 5CP2A 1ZQOA 4JK1A 3UQ0A 3TARA 4ECWA 5J0PA 3PY8A 4M6WA 3PMNA 3MFHA 3Q8MA 3PMLA 4F4XA 1NJWA 3QEBZ 1L3VA 1UA0A 9ICEA 4RPYA 4ED0A 9ICNA 3JPTA 3KTQA 3LWLA 4PH5A 9ICBA 1XSNA 1ZQHA 4B9NA 2O5AA 3BQ1A 4F5PA 3UXPA 5KFNA 2GWSA 4KTQA 5J2EA 4F93B 5DEDA 4NLZA 1NZPA 1T7PA 2UVUA 4DQRA 3QE9Y 3RRHA 1XC9A 2J6UA 1IXRA 3BQTA 1X2IA 5DQIA 5DKWA 2DPJA 4AT8A 2AGQA 1HUZA 1SL2A 4UAZA 1XU4A 1JXLA 3GIKA 3G6YA 1B22A 7ICMA 9ICWA 2W9CB 4EBEA 1ZQJA 3HWTA 3MDAA 2KFZA 1NKEA 4QZ9A 1ZETA 1DK3A 1ZQSA 2DRBA 3HP6A 4UBCA 5J0OA 4RPXA 3GIJA 4JV2A 4P2HA 2KFNA 3UXNA 2V4RA 4DLEA 2BKEA 3MGIA 3PX6A 1XS9D 3RB6A 1QTMA 2PBEA 3AQMA 1ZQGA 7ICFA 4J9LA 9ICUA 3H3AA 3ISDA 5IINA 4M9HA 4GC6A 1K1SA 4Z6CA 4O5EA 1ZQEA 4ATBB 4DL2A 3OVBA 2HW3A 4EZ9A 4UD4A 1XSPA 2LYHA 4DFPA 7ICPA 4F92B 4FHWA 4Q44A 2FPKA 4BDPA 3AQNA 4QWEA 1QSLA 4QZAA 1KFSA 3WFQE 4GC7A 2DR8A 4YD1A 2BQRA 4RQ7A 1RXWA 2ZH6A 5DG7A 3RH6A 4J9NA 2ZJ5A 3EYZA 5KFYA 5DB7A 5CHGA 2MUTA 4JUZA 5KT7A 3OHBA 1U48A 1TK5A 1ZQQA 4DWIA 1BPYA 1X9MA 4PHAA 7ICKA 1ZQBA 4DEZA 4DS4A 1T8EA 5HRDA 3BQ0A 1JIHA 7ICRA 1Q79A 3PW7A 4J9SA 4DL4A 4DF4A 3SYZA 5KFQA 4LZGA 1V9PA 4DSEA 3RAQA 2PFQA 3EZ5A 3BJYA 5DB8A 4B9UA 2JEJA 9ICLA 1MIVA 2JZBA 7ICIA 4ED6A 4F4YA 3TFRA 4QZEA 5KFIA 1UT8A 4C8LA 4FO6A 1TFYA 5DECA 1JXEA 4QZFA 4GLXA 9ICIA 1MIWA 1V4AA 4Z6EA 4QWAA 2ISPA 2IBKA 3IHQB 4EP7A 4X4TA 1ZQYA 1NK9A 4F8RA 4PHDA 4TUQA 3PNCA 3EPGA 4BWJA 4J9KA 2IHNA 1N48A 4YN4A 1NO5A 4PHPA 5KFFA 5KFZA 4C8NA 3V72A 5IIIA 1NK7A 1Z00B 1NK5A 4M9LA 4UD5A 4MEXA 1ZQRA 1ZQTA 5J0XA 1ZQDA 4BGDA 1QSSA 3TAPA 1B43A 5J0QA 4ED1A 3ZDDA 4EBJA 2ISOA 4C8KA 1D8YA 4F4KA 1WOTA 1AROP 3GQCA 3RJJA 1S97A 4I2HA 1N56A 1NJYA 9ICXA 3OHAA 4QW9A 5DLGA 1A76A 5JUMA 3JPQA 4I2AA 4KLIA 5HHHA 8ICTA 4B9SA 5EWGA 8ICBA 1NJZA 1ZQVA 3RBEA 2ASDA 3HJ4A 3OV7A 2BPGA 3NGDA 3PV8A 9ICFA 5HC9A 4KLSA 2HVHA 1ZYQA 2DPIA 1U9LA 5J2HA 2R8KA 4JV0A 2FPLA 4QWCA 2ZTDA 4E0DA 3V6JA 4CCHA 2FLNA 5KFEA 4RZRA 8ICMA 3PW5A 5HMLA 8ICRA 1TFWA 1WCNA 4B9VA 3UPQA 4ECSA 2ID1A 4DQIA 1S0VA 4IQTA 1WCLA 2A1JA 5EWEA 3OGUA 4MFFA 4JWMA 4KLGA 3T5JA 4J9QA 3C18A 4X5VA 8ICSA 2KP7A 3RJHA 1SL1A 2C2EA 4IQUA 1Z00A 2W9AA 5DG8A 1BNPA 5EWFA 4ECZA 2M2WA 5KFPA 3C66A 5KFXA 4XQ8A 2XO7A 4DLGA 4JWNA 2HHPA 4WC1A 4WC2A 4F2SA 4X4QA 8ICLA 1BPXA 7ICGA 5BPCA 3KHGA 3PVXA 4EYIB 2R8GA 2ZH7A 3PX0A 2ZH5A 3H8JA 1TAQA 1OU5A 3JZ0A 4WCWA 9ICMA 4X0BA 3H8SA 4NY8A 3V6KA 4UB4A 5J2FA 4O9MA 3RH5A 1C7YA 3PW0A 2BCRA 4K4HA 3RB3A 1ZQPA 4DFKA 3K75D 2P6RA 4K4GA 3MR3A 2A1JB 2KZ3A 2UVVA 4Q43A 4FBTA 3UXOA 7ICOA 5EOZA 3QZ7A 1S0NA 4BXOA 3NYBA 5DGAA 2UVWA 4M2YA 5KFRA 3TAQA 3AU6A 1SKRA 2KZMA 3HW8A 8ICXA 2JEIA 4E7XA 3QEAZ 1NKCA 1UEVA 1MQ2A 2AJQA 4FHPA 1BPDA 2F1IA 5D4BA 3AQKA 8ICHA 4O3QA 3EW9A 4DOBA 9ICAA 4KLUA 9ICSA 3HT3A 5CA7A 1S76D 2W9BA 2Y1JA 2DFLA 3H8WA 5KT5A 2DR9A 4LZDA 1S10A 1RZTA 3RR7A 5C5JA 2ZUCA 5J2GA 3PW2A 2M9NA 4UB3A 4ED8A 2BGWA 3MGHA 4KN4A 2BPFA 2HHWA 3OUYA 3SI8A 2WTFA 5HRBA 2VANA 3Q8RB 3M9MB 2ZJAA 3MBYA 1KEJA 2R8HA 1HUOA 4BXOB 4GXJA 4MFCA 4FHYA 1EXNA 1XWLA 2JEFA 1ZQAA 1SZPA 5KG7A 1ZQCA 4B9LA 1CEZA 4TQSA 4P4PA 1XSLA 3HJ1A 1Z3EB 2M2UA 3JPRA 1ZQZA 2NRVA 3BQ2A 2HHUA 4MFAA 4M6WB 4DSIA 9ICPA 3HX0A 4NLNA 3C1ZA 3V7LA 3T3FA 4PGYA 5J0YA 4TQRA 3GILA 1D9FA 4G3IA 3H38A 1PZNA 4FHXA 3LQCB 3JPPA 1VFGA 4FS1A 4I2JA 5KFGA 4HYKA 2HHVA 1UA1A 4KLTA 1TK0A 5HRGA 4KN7A 5KT6A 3RRGA 3C5GA 3ZDAA 4YCXA 2RDJA 2JZBB 4F5RA 9ICCA 5KFVA 4X4VA 1U4BA 4XA5A 4YP3A 4UB2A 3GDXA 2V9WA 2XGQA 3MFIA 2BCSA 8ICGA 4R8UA 2ZTEA 4J9PA 2XGPA 3Q8LA 8ICNA 4DFJA 8ICQA 4F5OA 4NM2A 3AU2A 3M9OB 3V7KA 4IRCA 3ORYA 3T5LA 2HHSA 9ICGA 5KT3A 2W9CA 3G6VA 2RDIA 2IMWP 4M0AA 4FHVA 3B0XA 2XY7A 2W8LA 4I2BA 2BQ3A 5CR0A 1KLNA 2ZH1A 4RQ1A 3ZDEA 1QLNA 2BCQA 2IHMA 5HRKA 2FLPA 4Q8EA 8ICKA 3V6HA 2XCPA 3PX4A 4P4OA 2NRZA 3C5FA 3SV3A 4M9NA 4LT6A 4UB1A 4ZH4A 4M9GA 8ICZA 3E2EA 1R8AA 4J9OA 1TVAA 4ED2A 1L3SA 3PO5A 4ATBA 5J0TA 2FMSA 9ICRA 4I2IA 2NRWA 4I2FA 5KG0A 5DG9A 2FLLA 8ICIA 2W8KA 5HP4A 3OVAA 4IRKA 2BPCA 5J2CA 5HHIA 5KFMA 4UQGA 4O5KA 2RFFA 4C8MA 4R64A 2R8IA 4DL6A 4ECUA 1NKBA 2JEGA 4RT3A 1QSYA 4RQ5A 4QW8A 1T4GA 4QZDA 2ALZA 4EZ6A 1R89A 4RWQA 4QWDA 1RYRA 4WC7A 4F5NA 4ECRA 4NLGA 3PO4A 4DSKA 1NK4A 3FDSA 4RNOA 4M47A 2AGPA 4DSJA 2HHQA 1S0MA 3ZDBA 7ICTA 4FH5A 1A77A 3THVA 3UQ2A 4DQQA 2I9GA 5D46A 4AT9A 4B9TA 1TK8A 1DOQA 8ICCA 5KT2A 3C1YA 1YLQA 7ICVA 8ICAA 2XC9A 4X4NA 3TFSA 4YQWA 3RH4A 1U45A 4RUAA 2ZH4A 4YVZA 1KTQA 4RQ6A 1MIYA 2ZUDA 3IM1A 2VA3A 1D9DA 1KRPA 1KDHA 4R63A 1CUKA 4YR0A 4F3OA 9ICOA 4ED7A 9ICKA 4RNMA 3SV4A 7ICNA 3OUYB 5J2BA 4I2GA 4XQ7A 9ICHA 2IA6A 3G6XA 4KLJA 4QZCA 4PGXA 3KHRA 9ICTA 2F1JA 4NM1A 2MAXA 4ECVA 2VA2A 2FPMA 2W9BB 4DL7A 1PX5A 2ZH2A 4MF8A 2DR5A 4NXZA 4YFKA 4YXMA 3HPOA 2PFOA 8ICEA 2P66A 5D49A 5KT4A 1BVSA 4M5DA 3HIYA 1UEUA 2B21A 4TURA 2P6UA 5HREA 3ISCA 1RYSA 4UB5A 2PFNA 4ED3A 4DSLA 4YR2A 4YMOA 4GXIA 5KTQA 4YG2A 5KFTA 5F9LA 3QZ8A 5HR9A 4X4UA 7ICEA 4ECXA 1NOMA 4RQ3A 5CWRA 5DBBA 2O1PA 5J2DA 4O0IA 2NRTA 1L3TA 4E80A 4UAYA 1XO1A 3SZ2A 3T5HA 1H38A 1KFDA 3Q8QB 3RR8A 4ELVA 5CB1A 1KNYA 2ZJ8A 5KFSA 1L3UA 4R8UB 1JMSA 3LWMA 4LVSA 4O3SA 2UVRA 2M2VA 3OSNA 4KLEA 2ATLA 5DB6A 2BCVA 4EBKA 1ZQNA 5HRHA 2ZTCA 4FS2A 3TI0A 5HMMA 4O5CA 5KFWA 3RTVA 7ICSA 4AT7B 4PGQA 3MR2A 2HHTA 1R8CA 4WC0A 4DOCA 3BDPA 5IIKA 1JAJA 3AQLA 1JN3A 3H37A 3K4GA 4DF8A 5J2IA 5KG5A 3RB4A 1DGSA 4F50A 4R66A 4Q45A 4P4MA 2OWOA 4Z6FA 3ETLA 3RAXA 3NTUA 4F4ZA 3PR5B 2AGOA 4IQWA 3EWAA 3N4MB 4KMUA 4IQVA 4RQ8A 1S9FA 4KLQA 1BPEA 5KFOA 4MEYA 4J9RA 5HRLA 4IG8A 1NK0A 3RJFA 4FH3A 4XUSA 4WC5A 2BQUA 4KLLA 4PHEA 3GFKB 3FYHA 1TAUA 1HJPA 5HRIA 2C2RA 4GXKA 4WBYA 1R8BA 4KITB 2ZUBA 3MABA 5IIOA 3M8RA 4Z6DA 4J9MA 2KTQA 3WFPA 4RNNA 3C2KA 5L1JA 1BNOA 4F4WA 4KLMA 2DVIA 3H4BA 1UETA 2ZH3A 5J0WA 5KFHA 4TUPA 8ICPA 4RWNA 3RJKA 3KHHA 3LK9A 2XCAA 3MDCA 5CJ7A 1TV9A 1X9WA 3Q8SB 3L9DA 4DQPA 4WC4A 3M8SA 4QZ8A 5F2VO 4S3NA 3C2LA 3MR6A 5IILA 5J0UA 3ZD8A 5TZVA 4ELUA 3GV5B 4KLDA 4RQ4A 2ASLA 3PR4A 4TUSA 1T3NA 2BE3A 1BPBA 4RPZA 4KLOA 3N97B 3WFSC 5F9NA 1ZQXA 3Q8KA 3AUOA 4DL5A 3T5KA 4AT9B 4X0AA 5DDYA 3JPOA 4DSFA 4B9MA 5KFKA 5L1IA 4Q8FA 5HRFA 2C28A 5HNKA 4PPXA 4X4PA 1LV5A 7ICJA 5KG4A 3ISBA 5L1KA 1D8LA 5DQGA 1X9SA 3PW4A 8ICJA 9ICJA 4IR1A 5J2KA 8ICWA 1Q78A 2NRKA 1RXVA 2BR0A 3RJGA 5DDMA 4KLHA 5KFBA 1ZJMA 2Y1IA 1MSWD 4RUCA 2HVIA 1U47A 4AT7A 2AQ0A 3M9NB 5KG3A 2ASJA 2ZHBA 3LDAA 8ICVA 1ZJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ECT A;  4YD2 A;  4X4O A;  5KFJ A;  5KG6 A;  2R8J A;  4ECQ A;  2FMQ A;  2C2D A;  4RWP A;  1NK6 A;  1S0O A;  4RQ2 A;  1L5U A;  1SKW A;  4K4I A;  3GIM A;  5BOL A;  9ICV A;  1BGX T;  3OVS A;  3WFR E;  4RWO A;  1ZQL A;  2PI5 A;  2HHX A;  4F5Q A;  5KG1 A;  8ICY A;  4IR9 A;  5DQH A;  3UPS A;  7ICL A;  4UAW A;  1Y88 A;  2XY6 A;  3RBD A;  5J0R A;  2I1Q A;  4EYH B;  2MUT B;  7ICU A;  5BOM A;  3JPN A;  1IM4 A;  2W9M A;  5KFC A;  3RJI A;  3TQ1 A;  1MC8 A;  4YXJ A;  3H39 A;  4NKT A;  4O3R A;  1UT5 A;  2FMP A;  4KLF A;  5KFU A;  5L1L A;  2BHN A;  5KFA A;  5L9X A;  4EEY A;  4O3O A;  1ZQF A;  2NRX A;  7ICH A;  2DRA A;  4QZB A;  5IIJ A;  1JX4 A;  1MQ3 A;  3EPI A;  8ICF A;  4UBB A;  4DS5 A;  2KN7 A;  4F91 B;  3Q8P B;  5KG2 A;  1ZQI A;  3OJU A;  2H5X A;  1ZQW A;  4DFM A;  2M2T A;  4YMN A;  4DL3 A;  4RT2 A;  5DB9 A;  1ZQU A;  4I2D A;  3GV7 B;  2BDP A;  2KZZ A;  1VJ7 A;  2F1H A;  4R65 A;  2V4Q A;  1S77 D;  1NJX A;  4WC3 A;  4X4S A;  2J6S A;  3GV8 B;  4EBD A;  2AU0 A;  3B0Y A;  3H7I A;  2VA8 A;  4QZG A;  4MF2 A;  4QWB A;  1JQR A;  2Q66 A;  5KFL A;  3ZDC A;  2PI4 A;  5KFD A;  1DK2 A;  3GII A;  4M04 A;  3JYY A;  4DOA A;  1LB2 B;  2PFP A;  4IRD A;  2BCU A;  4YR3 A;  1K1Q A;  4QZH A;  3TAN A;  4JV1 A;  4XRH A;  1COO A;  8ICU A;  4ECY A;  4RQ0 A;  1SL0 A;  3RB0 A;  3KHL A;  1TKD A;  1ZQM A;  4BWM A;  1KSP A;  4NKU A;  4I2E A;  4AT8 B;  4WC6 A;  2C22 A;  2AQ4 A;  3H4D A;  1FA0 A;  4I2C A;  9ICQ A;  5J0S A;  8ICO A;  3V7J A;  4O3P A;  1U49 A;  4E8F A;  2XY5 A;  5DBC A;  4QZI A;  1F5A A;  2ZH9 A;  3WFO A;  3JPS A;  2Q0Z X;  4YMM A;  4DO9 A;  5IIM A;  1RPL A;  3MR5 A;  4I29 A;  3C2M A;  4O3N A;  5J2J A;  4ELT A;  1NK8 A;  5DGB A;  4M9J A;  2PXI A;  1KFT A;  3C21 A;  4DQS A;  1BPZ A;  3OSP A;  1SKS A;  3RJE A;  2ZHA A;  7ICQ A;  3H40 A;  4I27 A;  4NLK A;  3ZD9 A;  3C23 A;  2J6T A;  4F2R A;  4X4R A;  4FBU A;  1TFR A;  5J2A A;  2DR7 A;  4EBC A;  4RU9 A;  5DBA A;  4C8O A;  4I28 A;  3OJS A;  1ZQK A;  5DLF A;  2ZH8 A;  5J29 A;  4WBZ A;  5CP2 A;  1ZQO A;  4JK1 A;  3UQ0 A;  3TAR A;  4ECW A;  5J0P A;  3PY8 A;  4M6W A;  3PMN A;  3MFH A;  3Q8M A;  3PML A;  4F4X A;  1NJW A;  3QEB Z;  1L3V A;  1UA0 A;  9ICE A;  4RPY A;  4ED0 A;  9ICN A;  3JPT A;  3KTQ A;  3LWL A;  4PH5 A;  9ICB A;  1XSN A;  1ZQH A;  4B9N A;  2O5A A;  3BQ1 A;  4F5P A;  3UXP A;  5KFN A;  2GWS A;  4KTQ A;  5J2E A;  4F93 B;  5DED A;  4NLZ A;  1NZP A;  1T7P A;  2UVU A;  4DQR A;  3QE9 Y;  3RRH A;  1XC9 A;  2J6U A;  1IXR A;  3BQT A;  1X2I A;  5DQI A;  5DKW A;  2DPJ A;  4AT8 A;  2AGQ A;  1HUZ A;  1SL2 A;  4UAZ A;  1XU4 A;  1JXL A;  3GIK A;  3G6Y A;  1B22 A;  7ICM A;  9ICW A;  2W9C B;  4EBE A;  1ZQJ A;  3HWT A;  3MDA A;  2KFZ A;  1NKE A;  4QZ9 A;  1ZET A;  1DK3 A;  1ZQS A;  2DRB A;  3HP6 A;  4UBC A;  5J0O A;  4RPX A;  3GIJ A;  4JV2 A;  4P2H A;  2KFN A;  3UXN A;  2V4R A;  4DLE A;  2BKE A;  3MGI A;  3PX6 A;  1XS9 D;  3RB6 A;  1QTM A;  2PBE A;  3AQM A;  1ZQG A;  7ICF A;  4J9L A;  9ICU A;  3H3A A;  3ISD A;  5IIN A;  4M9H A;  4GC6 A;  1K1S A;  4Z6C A;  4O5E A;  1ZQE A;  4ATB B;  4DL2 A;  3OVB A;  2HW3 A;  4EZ9 A;  4UD4 A;  1XSP A;  2LYH A;  4DFP A;  7ICP A;  4F92 B;  4FHW A;  4Q44 A;  2FPK A;  4BDP A;  3AQN A;  4QWE A;  1QSL A;  4QZA A;  1KFS A;  3WFQ E;  4GC7 A;  2DR8 A;  4YD1 A;  2BQR A;  4RQ7 A;  1RXW A;  2ZH6 A;  5DG7 A;  3RH6 A;  4J9N A;  2ZJ5 A;  3EYZ A;  5KFY A;  5DB7 A;  5CHG A;  2MUT A;  4JUZ A;  5KT7 A;  3OHB A;  1U48 A;  1TK5 A;  1ZQQ A;  4DWI A;  1BPY A;  1X9M A;  4PHA A;  7ICK A;  1ZQB A;  4DEZ A;  4DS4 A;  1T8E A;  5HRD A;  3BQ0 A;  1JIH A;  7ICR A;  1Q79 A;  3PW7 A;  4J9S A;  4DL4 A;  4DF4 A;  3SYZ A;  5KFQ A;  4LZG A;  1V9P A;  4DSE A;  3RAQ A;  2PFQ A;  3EZ5 A;  3BJY A;  5DB8 A;  4B9U A;  2JEJ A;  9ICL A;  1MIV A;  2JZB A;  7ICI A;  4ED6 A;  4F4Y A;  3TFR A;  4QZE A;  5KFI A;  1UT8 A;  4C8L A;  4FO6 A;  1TFY A;  5DEC A;  1JXE A;  4QZF A;  4GLX A;  9ICI A;  1MIW A;  1V4A A;  4Z6E A;  4QWA A;  2ISP A;  2IBK A;  3IHQ B;  4EP7 A;  4X4T A;  1ZQY A;  1NK9 A;  4F8R A;  4PHD A;  4TUQ A;  3PNC A;  3EPG A;  4BWJ A;  4J9K A;  2IHN A;  1N48 A;  4YN4 A;  1NO5 A;  4PHP A;  5KFF A;  5KFZ A;  4C8N A;  3V72 A;  5III A;  1NK7 A;  1Z00 B;  1NK5 A;  4M9L A;  4UD5 A;  4MEX A;  1ZQR A;  1ZQT A;  5J0X A;  1ZQD A;  4BGD A;  1QSS A;  3TAP A;  1B43 A;  5J0Q A;  4ED1 A;  3ZDD A;  4EBJ A;  2ISO A;  4C8K A;  1D8Y A;  4F4K A;  1WOT A;  1ARO P;  3GQC A;  3RJJ A;  1S97 A;  4I2H A;  1N56 A;  1NJY A;  9ICX A;  3OHA A;  4QW9 A;  5DLG A;  1A76 A;  5JUM A;  3JPQ A;  4I2A A;  4KLI A;  5HHH A;  8ICT A;  4B9S A;  5EWG A;  8ICB A;  1NJZ A;  1ZQV A;  3RBE A;  2ASD A;  3HJ4 A;  3OV7 A;  2BPG A;  3NGD A;  3PV8 A;  9ICF A;  5HC9 A;  4KLS A;  2HVH A;  1ZYQ A;  2DPI A;  1U9L A;  5J2H A;  2R8K A;  4JV0 A;  2FPL A;  4QWC A;  2ZTD A;  4E0D A;  3V6J A;  4CCH A;  2FLN A;  5KFE A;  4RZR A;  8ICM A;  3PW5 A;  5HML A;  8ICR A;  1TFW A;  1WCN A;  4B9V A;  3UPQ A;  4ECS A;  2ID1 A;  4DQI A;  1S0V A;  4IQT A;  1WCL A;  2A1J A;  5EWE A;  3OGU A;  4MFF A;  4JWM A;  4KLG A;  3T5J A;  4J9Q A;  3C18 A;  4X5V A;  8ICS A;  2KP7 A;  3RJH A;  1SL1 A;  2C2E A;  4IQU A;  1Z00 A;  2W9A A;  5DG8 A;  1BNP A;  5EWF A;  4ECZ A;  2M2W A;  5KFP A;  3C66 A;  5KFX A;  4XQ8 A;  2XO7 A;  4DLG A;  4JWN A;  2HHP A;  4WC1 A;  4WC2 A;  4F2S A;  4X4Q A;  8ICL A;  1BPX A;  7ICG A;  5BPC A;  3KHG A;  3PVX A;  4EYI B;  2R8G A;  2ZH7 A;  3PX0 A;  2ZH5 A;  3H8J A;  1TAQ A;  1OU5 A;  3JZ0 A;  4WCW A;  9ICM A;  4X0B A;  3H8S A;  4NY8 A;  3V6K A;  4UB4 A;  5J2F A;  4O9M A;  3RH5 A;  1C7Y A;  3PW0 A;  2BCR A;  4K4H A;  3RB3 A;  1ZQP A;  4DFK A;  3K75 D;  2P6R A;  4K4G A;  3MR3 A;  2A1J B;  2KZ3 A;  2UVV A;  4Q43 A;  4FBT A;  3UXO A;  7ICO A;  5EOZ A;  3QZ7 A;  1S0N A;  4BXO A;  3NYB A;  5DGA A;  2UVW A;  4M2Y A;  5KFR A;  3TAQ A;  3AU6 A;  1SKR A;  2KZM A;  3HW8 A;  8ICX A;  2JEI A;  4E7X A;  3QEA Z;  1NKC A;  1UEV A;  1MQ2 A;  2AJQ A;  4FHP A;  1BPD A;  2F1I A;  5D4B A;  3AQK A;  8ICH A;  4O3Q A;  3EW9 A;  4DOB A;  9ICA A;  4KLU A;  9ICS A;  3HT3 A;  5CA7 A;  1S76 D;  2W9B A;  2Y1J A;  2DFL A;  3H8W A;  5KT5 A;  2DR9 A;  4LZD A;  1S10 A;  1RZT A;  3RR7 A;  5C5J A;  2ZUC A;  5J2G A;  3PW2 A;  2M9N A;  4UB3 A;  4ED8 A;  2BGW A;  3MGH A;  4KN4 A;  2BPF A;  2HHW A;  3OUY A;  3SI8 A;  2WTF A;  5HRB A;  2VAN A;  3Q8R B;  3M9M B;  2ZJA A;  3MBY A;  1KEJ A;  2R8H A;  1HUO A;  4BXO B;  4GXJ A;  4MFC A;  4FHY A;  1EXN A;  1XWL A;  2JEF A;  1ZQA A;  1SZP A;  5KG7 A;  1ZQC A;  4B9L A;  1CEZ A;  4TQS A;  4P4P A;  1XSL A;  3HJ1 A;  1Z3E B;  2M2U A;  3JPR A;  1ZQZ A;  2NRV A;  3BQ2 A;  2HHU A;  4MFA A;  4M6W B;  4DSI A;  9ICP A;  3HX0 A;  4NLN A;  3C1Z A;  3V7L A;  3T3F A;  4PGY A;  5J0Y A;  4TQR A;  3GIL A;  1D9F A;  4G3I A;  3H38 A;  1PZN A;  4FHX A;  3LQC B;  3JPP A;  1VFG A;  4FS1 A;  4I2J A;  5KFG A;  4HYK A;  2HHV A;  1UA1 A;  4KLT A;  1TK0 A;  5HRG A;  4KN7 A;  5KT6 A;  3RRG A;  3C5G A;  3ZDA A;  4YCX A;  2RDJ A;  2JZB B;  4F5R A;  9ICC A;  5KFV A;  4X4V A;  1U4B A;  4XA5 A;  4YP3 A;  4UB2 A;  3GDX A;  2V9W A;  2XGQ A;  3MFI A;  2BCS A;  8ICG A;  4R8U A;  2ZTE A;  4J9P A;  2XGP A;  3Q8L A;  8ICN A;  4DFJ A;  8ICQ A;  4F5O A;  4NM2 A;  3AU2 A;  3M9O B;  3V7K A;  4IRC A;  3ORY A;  3T5L A;  2HHS A;  9ICG A;  5KT3 A;  2W9C A;  3G6V A;  2RDI A;  2IMW P;  4M0A A;  4FHV A;  3B0X A;  2XY7 A;  2W8L A;  4I2B A;  2BQ3 A;  5CR0 A;  1KLN A;  2ZH1 A;  4RQ1 A;  3ZDE A;  1QLN A;  2BCQ A;  2IHM A;  5HRK A;  2FLP A;  4Q8E A;  8ICK A;  3V6H A;  2XCP A;  3PX4 A;  4P4O A;  2NRZ A;  3C5F A;  3SV3 A;  4M9N A;  4LT6 A;  4UB1 A;  4ZH4 A;  4M9G A;  8ICZ A;  3E2E A;  1R8A A;  4J9O A;  1TVA A;  4ED2 A;  1L3S A;  3PO5 A;  4ATB A;  5J0T A;  2FMS A;  9ICR A;  4I2I A;  2NRW A;  4I2F A;  5KG0 A;  5DG9 A;  2FLL A;  8ICI A;  2W8K A;  5HP4 A;  3OVA A;  4IRK A;  2BPC A;  5J2C A;  5HHI A;  5KFM A;  4UQG A;  4O5K A;  2RFF A;  4C8M A;  4R64 A;  2R8I A;  4DL6 A;  4ECU A;  1NKB A;  2JEG A;  4RT3 A;  1QSY A;  4RQ5 A;  4QW8 A;  1T4G A;  4QZD A;  2ALZ A;  4EZ6 A;  1R89 A;  4RWQ A;  4QWD A;  1RYR A;  4WC7 A;  4F5N A;  4ECR A;  4NLG A;  3PO4 A;  4DSK A;  1NK4 A;  3FDS A;  4RNO A;  4M47 A;  2AGP A;  4DSJ A;  2HHQ A;  1S0M A;  3ZDB A;  7ICT A;  4FH5 A;  1A77 A;  3THV A;  3UQ2 A;  4DQQ A;  2I9G A;  5D46 A;  4AT9 A;  4B9T A;  1TK8 A;  1DOQ A;  8ICC A;  5KT2 A;  3C1Y A;  1YLQ A;  7ICV A;  8ICA A;  2XC9 A;  4X4N A;  3TFS A;  4YQW A;  3RH4 A;  1U45 A;  4RUA A;  2ZH4 A;  4YVZ A;  1KTQ A;  4RQ6 A;  1MIY A;  2ZUD A;  3IM1 A;  2VA3 A;  1D9D A;  1KRP A;  1KDH A;  4R63 A;  1CUK A;  4YR0 A;  4F3O A;  9ICO A;  4ED7 A;  9ICK A;  4RNM A;  3SV4 A;  7ICN A;  3OUY B;  5J2B A;  4I2G A;  4XQ7 A;  9ICH A;  2IA6 A;  3G6X A;  4KLJ A;  4QZC A;  4PGX A;  3KHR A;  9ICT A;  2F1J A;  4NM1 A;  2MAX A;  4ECV A;  2VA2 A;  2FPM A;  2W9B B;  4DL7 A;  1PX5 A;  2ZH2 A;  4MF8 A;  2DR5 A;  4NXZ A;  4YFK A;  4YXM A;  3HPO A;  2PFO A;  8ICE A;  2P66 A;  5D49 A;  5KT4 A;  1BVS A;  4M5D A;  3HIY A;  1UEU A;  2B21 A;  4TUR A;  2P6U A;  5HRE A;  3ISC A;  1RYS A;  4UB5 A;  2PFN A;  4ED3 A;  4DSL A;  4YR2 A;  4YMO A;  4GXI A;  5KTQ A;  4YG2 A;  5KFT A;  5F9L A;  3QZ8 A;  5HR9 A;  4X4U A;  7ICE A;  4ECX A;  1NOM A;  4RQ3 A;  5CWR A;  5DBB A;  2O1P A;  5J2D A;  4O0I A;  2NRT A;  1L3T A;  4E80 A;  4UAY A;  1XO1 A;  3SZ2 A;  3T5H A;  1H38 A;  1KFD A;  3Q8Q B;  3RR8 A;  4ELV A;  5CB1 A;  1KNY A;  2ZJ8 A;  5KFS A;  1L3U A;  4R8U B;  1JMS A;  3LWM A;  4LVS A;  4O3S A;  2UVR A;  2M2V A;  3OSN A;  4KLE A;  2ATL A;  5DB6 A;  2BCV A;  4EBK A;  1ZQN A;  5HRH A;  2ZTC A;  4FS2 A;  3TI0 A;  5HMM A;  4O5C A;  5KFW A;  3RTV A;  7ICS A;  4AT7 B;  4PGQ A;  3MR2 A;  2HHT A;  1R8C A;  4WC0 A;  4DOC A;  3BDP A;  5IIK A;  1JAJ A;  3AQL A;  1JN3 A;  3H37 A;  3K4G A;  4DF8 A;  5J2I A;  5KG5 A;  3RB4 A;  1DGS A;  4F50 A;  4R66 A;  4Q45 A;  4P4M A;  2OWO A;  4Z6F A;  3ETL A;  3RAX A;  3NTU A;  4F4Z A;  3PR5 B;  2AGO A;  4IQW A;  3EWA A;  3N4M B;  4KMU A;  4IQV A;  4RQ8 A;  1S9F A;  4KLQ A;  1BPE A;  5KFO A;  4MEY A;  4J9R A;  5HRL A;  4IG8 A;  1NK0 A;  3RJF A;  4FH3 A;  4XUS A;  4WC5 A;  2BQU A;  4KLL A;  4PHE A;  3GFK B;  3FYH A;  1TAU A;  1HJP A;  5HRI A;  2C2R A;  4GXK A;  4WBY A;  1R8B A;  4KIT B;  2ZUB A;  3MAB A;  5IIO A;  3M8R A;  4Z6D A;  4J9M A;  2KTQ A;  3WFP A;  4RNN A;  3C2K A;  5L1J A;  1BNO A;  4F4W A;  4KLM A;  2DVI A;  3H4B A;  1UET A;  2ZH3 A;  5J0W A;  5KFH A;  4TUP A;  8ICP A;  4RWN A;  3RJK A;  3KHH A;  3LK9 A;  2XCA A;  3MDC A;  5CJ7 A;  1TV9 A;  1X9W A;  3Q8S B;  3L9D A;  4DQP A;  4WC4 A;  3M8S A;  4QZ8 A;  5F2V O;  4S3N A;  3C2L A;  3MR6 A;  5IIL A;  5J0U A;  3ZD8 A;  5TZV A;  4ELU A;  3GV5 B;  4KLD A;  4RQ4 A;  2ASL A;  3PR4 A;  4TUS A;  1T3N A;  2BE3 A;  1BPB A;  4RPZ A;  4KLO A;  3N97 B;  3WFS C;  5F9N A;  1ZQX A;  3Q8K A;  3AUO A;  4DL5 A;  3T5K A;  4AT9 B;  4X0A A;  5DDY A;  3JPO A;  4DSF A;  4B9M A;  5KFK A;  5L1I A;  4Q8F A;  5HRF A;  2C28 A;  5HNK A;  4PPX A;  4X4P A;  1LV5 A;  7ICJ A;  5KG4 A;  3ISB A;  5L1K A;  1D8L A;  5DQG A;  1X9S A;  3PW4 A;  8ICJ A;  9ICJ A;  4IR1 A;  5J2K A;  8ICW A;  1Q78 A;  2NRK A;  1RXV A;  2BR0 A;  3RJG A;  5DDM A;  4KLH A;  5KFB A;  1ZJM A;  2Y1I A;  1MSW D;  4RUC A;  2HVI A;  1U47 A;  4AT7 A;  2AQ0 A;  3M9N B;  5KG3 A;  2ASJ A;  2ZHB A;  3LDA A;  8ICV A;  1ZJN A; 
#chains in the Genus database with same CATH topology
 4X4O A;  4YD2 A;  5KG6 A;  4B6J A;  4RQ2 A;  1ED1 A;  2HBM A;  3GIM A;  9ICV A;  4F5Q A;  2CN1 A;  3UPS A;  3FAH A;  3VC8 A;  2IOF K;  3AEV A;  2LI6 A;  4KX3 A;  2GH1 A;  5AK3 A;  4O3R A;  4KLF A;  5L1L A;  5L9X A;  2VIX A;  5TIS U;  4O3O A;  1N61 A;  4EEY A;  1ZQF A;  4QZB A;  2IHO A;  1JX4 A;  8ICF A;  4UW9 A;  2KN7 A;  1PK1 A;  3Q8P B;  1F0M A;  3K7D A;  4JLX A;  3OJU A;  2H5X A;  1ZQW A;  2M2T A;  2KZZ A;  1L8O A;  1VJ5 A;  4I2D A;  1J2N A;  1IIP A;  4WC3 A;  2HBL A;  4RQM A;  2VA8 A;  4QZG A;  5KFD A;  3GII A;  4DOA A;  2PFP A;  8ICU A;  4RQ0 A;  1KSP A;  2HN1 A;  4WC6 A;  2AQ4 A;  2B51 A;  4E8F A;  5DBC A;  4QZI A;  2HDO A;  4DO9 A;  5IIM A;  2NV3 A;  1RPL A;  3MR5 A;  4O3N A;  1RQN A;  1RDF A;  4ELT A;  1KFT A;  2FE9 A;  3C21 A;  5A0L A;  1BPZ A;  2EDU A;  3OSP A;  1SKS A;  2ZHA A;  1N63 A;  5ALZ A;  2QB0 B;  3ZD9 A;  4FBU A;  1TFR A;  2AHO B;  1Z19 A;  4I28 A;  2KHQ A;  4WBZ A;  5CP2 A;  1ZQO A;  3UQ0 A;  1L7P A;  2E1F A;  2EQY A;  2DBY A;  2OM6 A;  3B9J A;  3AL0 B;  4F4X A;  1NJW A;  3QEB Z;  4KMO B;  1Q3V A;  1Q46 A;  4FZN A;  1J97 A;  4PH5 A;  1WUD A;  4F5P A;  4KTQ A;  2GWS A;  4F93 B;  3HRD D;  1NZP A;  1T7P A;  1IXR A;  2VJ5 A;  3EUB 2;  3BQT A;  5CFT A;  5DQI A;  2DPJ A;  1SGG A;  4JMU A;  3G6Y A;  5HR6 A;  7ICM A;  4QZ9 A;  3L3F X;  4UBC A;  2WHE A;  1QTM A;  3AQM A;  3N7S C;  3ISD A;  4Z6C A;  4ATB B;  1KW4 A;  4CF5 A;  4EZ9 A;  4UD4 A;  7ICP A;  3AMZ A;  2QAR B;  4BDP A;  3GU3 A;  1KFS A;  1X6J A;  4YD1 A;  4RQ7 A;  2F3N A;  8ICL A;  1JQR A;  5KT7 A;  1ZQQ A;  4CNQ A;  4KX5 A;  1ZQB A;  2KHV A;  4DEZ A;  4DL4 A;  1PVP A;  3SYZ A;  1V9P A;  4LEZ A;  3EZ5 A;  3BJY A;  5DB8 A;  3PSF A;  2JZB A;  5ALU A;  4C8L A;  1JXE A;  3NVY A;  1ZD2 P;  1V4A A;  2F76 X;  4QIW F;  3HKZ C;  2ISP A;  4QWA A;  5B5E U;  4YN4 A;  1NK7 A;  4UD5 A;  1ZQT A;  1ZQD A;  1B43 A;  5H2F U;  3R9K A;  2ISO A;  4C8K A;  1D8Y A;  1WOT A;  3WK7 A;  4P0Q B;  1ARO P;  5ALW A;  3OHA A;  4KLI A;  2HOQ A;  1SB3 C;  4Y2T A;  1ZQV A;  3IG8 A;  2MU2 A;  9ICF A;  2HVH A;  1ZYQ A;  2DPI A;  2R8K A;  4JV0 A;  4WJ3 B;  8ICR A;  5HML A;  1WCN A;  3SAF A;  4B9V A;  3UPQ A;  4HX0 A;  2ZIX A;  4IQT A;  5EWE A;  2A1J A;  3T5J A;  3C18 A;  4X5V A;  2GA9 D;  3RJH A;  1SL1 A;  2C2E A;  1N2X A;  4US8 A;  2M2W A;  2KV2 A;  5KFX A;  3NRZ A;  2E8P A;  1VDV A;  3PVX A;  4EYI B;  2R8G A;  2E3T A;  4NY8 A;  4O9M A;  1ZRN A;  2BCR A;  3RB3 A;  5ALY A;  3MR3 A;  2KZ3 A;  4FBT A;  3UXO A;  1S0N A;  3NYB A;  5DGA A;  8ICX A;  5KFR A;  1SKR A;  2JEI A;  4O3M A;  5G5H A;  5CFS A;  1UEV A;  3UMG A;  1IG6 A;  1QH9 A;  5ALL A;  5D4B A;  3AQK A;  1HIW A;  4DOB A;  3HT3 A;  1SZH A;  1S76 D;  2Y1J A;  3CW2 C;  5KT5 A;  2DR9 A;  2VKQ A;  2BGW A;  3SI8 A;  2K8C B;  1HUO A;  3M9M B;  5AKZ A;  5ALH A;  4FHY A;  4WC1 A;  1XWL A;  1X9X A;  4OJO A;  1CEZ A;  3AQE A;  4AYB F;  3HJ1 A;  3FM9 A;  3BQ2 A;  4MFA A;  4M6W B;  4DSI A;  9ICP A;  2Y9T A;  3H8M A;  3BS5 B;  4FHX A;  3PSI A;  3JPP A;  5AIC A;  4FS1 A;  4I2J A;  4EX6 A;  1UA1 A;  3C5G A;  2RDJ A;  3NWI A;  5ALG A;  5HR7 A;  4PL1 A;  2V9W A;  3WK6 A;  3M6K A;  8ICG A;  1MA7 A;  3KZI U;  4R8U A;  2FDR A;  8ICQ A;  2EWR A;  4NM2 A;  3M9O B;  3V7K A;  2LYA A;  3B0X A;  1KLN A;  5AM4 A;  3S6J A;  3UMC A;  2BCQ A;  4J03 A;  2IHM A;  5ALF A;  2ZIU A;  2XCP A;  1ZD4 A;  4P4O A;  3NKU A;  4UB1 A;  4M9G A;  1R8A A;  2LBO A;  1TVA A;  1L3S A;  2HMX A;  1SXE A;  2FMS A;  4I2F A;  2NRW A;  5ALR A;  5C0Y A;  5HP4 A;  1P7D A;  5KFM A;  4C8M A;  4QW8 A;  2H3I A;  2DKZ A;  4QZD A;  4NXW A;  2ALZ A;  4RWQ A;  2NYV A;  4WC7 A;  4NLG A;  1KN5 A;  4M47 A;  2HHQ A;  2HBJ A;  2M0N A;  3UQ2 A;  3LVV A;  4AT9 A;  4B9T A;  1X42 A;  3PZP A;  2XC9 A;  1B4F A;  3RH4 A;  2ZH4 A;  4RUA A;  1SIJ A;  1KDH A;  4F3O A;  9ICO A;  4ED7 A;  4O69 A;  4RNM A;  4EED A;  5J2B A;  2KJ9 A;  4KLJ A;  9ICT A;  2K8B B;  2MAX A;  2VA2 A;  1FO4 A;  2DR5 A;  4NXZ A;  2P66 A;  1BVS A;  3HIY A;  2ZIU B;  3H0R B;  3N7R C;  1RYS A;  4DSL A;  4YMO A;  4GXI A;  4HAI A;  5KFT A;  3AM9 A;  7ICE A;  1NOM A;  4O0I A;  3E58 A;  5KAI U;  3Q8Q B;  3RR8 A;  5CB1 A;  1Q3U A;  3LVW A;  4R8U B;  4UAU A;  2ATL A;  4ICA A;  5HRH A;  4FS2 A;  3TI0 A;  5HMM A;  4O5C A;  4WOY A;  3MR2 A;  1JN3 A;  4JLZ A;  5J2I A;  4F50 A;  3NTU A;  4IQW A;  4KLQ A;  2D3D A;  4IQV A;  1S9F A;  2PKE A;  5HRL A;  4IG8 A;  4XUS A;  1RM6 C;  4G9B A;  3GFK B;  1TAU A;  5HRI A;  2C2R A;  2QKQ A;  4KIT B;  2ZUB A;  3WK5 A;  2KTQ A;  3O0F A;  1QQ5 A;  4PL2 A;  2DVI A;  4ZOH C;  3F2B A;  3D2Q A;  1TV9 A;  4OD0 A;  5CJ7 A;  3C2L A;  4ELU A;  3ZD8 A;  5TZV A;  4OJL A;  2ASL A;  1BPB A;  4LJX A;  3WFS C;  5G5G A;  4AT9 B;  2B0C A;  2RQ5 A;  4N7R A;  5DDY A;  2C28 A;  1WWV A;  4OJP A;  4CF3 A;  5L1K A;  2LM1 A;  1NNL A;  2G08 A;  8ICW A;  5J2K A;  3F5A A;  5KFB A;  1MSW D;  2ZHB A;  1ZJN A;  4ECT A;  2R8J A;  2C2D A;  4O68 A;  4FZL A;  5BOL A;  1BGX T;  4CRX A;  5DQH A;  2Y0S C;  3RBD A;  5J0R A;  2BZF A;  2K4E A;  4NXT A;  7ICU A;  1Z4O A;  2O6K A;  3JPN A;  1IM4 A;  3FC4 A;  5AI4 A;  1ZD3 A;  3RJI A;  2D8C A;  1MC8 A;  1UT5 A;  2FMP A;  5KFA A;  2K4H A;  1MQ3 A;  3EPI A;  5AK6 A;  2CRX A;  2ESE A;  4YMN A;  1O03 A;  2RP5 A;  4R65 A;  2V4Q A;  1GO3 F;  1CI4 A;  4USA A;  3GV8 B;  5KFL A;  1DK2 A;  2H3Z A;  4M04 A;  2BCU A;  4UAS A;  3A0B U;  2YMP A;  2KEY A;  3NRW A;  1ZQM A;  1TKD A;  2AXT U;  3M7D A;  2DQN B;  4BWM A;  4I2E A;  5D62 A;  9ICQ A;  5J0S A;  8ICO A;  3V7J A;  4YMM A;  3WK8 A;  1Q8K A;  3SAG A;  3SEN A;  3N7P D;  1NK8 A;  4M9J A;  2PXI A;  2WFA A;  4DQS A;  3RJE A;  3H40 A;  4NLK A;  2J6T A;  5J2A A;  4NV0 A;  4EBC A;  4EEN A;  1ZQK A;  2ZH8 A;  5J29 A;  4CDG A;  3PY8 A;  3Q8M A;  3MGV A;  2MSN A;  2W43 A;  1L3V A;  1UA0 A;  4RPY A;  4WQK A;  3JPT A;  2IOH A;  2FCL A;  1XSN A;  3OPX A;  3L4P A;  5KFN A;  3UXP A;  5JU5 A;  1RG6 A;  3QE9 Y;  1YZ6 A;  4AT8 A;  2AGQ A;  1HUZ A;  3L5K A;  1XU4 A;  1JXL A;  9ICW A;  4EBE A;  2F8L A;  3MDA A;  2LKY A;  4I0U A;  2DRB A;  3KKA A;  1DK3 A;  1ZET A;  4BX9 C;  3GIJ A;  1ZQS A;  5J0O A;  4RPX A;  4JV2 A;  4P2H A;  8ICK A;  4DLE A;  2V4R A;  3MGI A;  3RB6 A;  4BJQ A;  1ZQG A;  4J9L A;  9ICU A;  4GC6 A;  1N60 A;  5D63 A;  2LYH A;  4F92 B;  1T3Q A;  4PZN A;  4Q44 A;  2FPK A;  2MRL A;  1L8L A;  2HI0 A;  3ONN A;  3WFQ E;  2QLT A;  5ALP A;  2BQR A;  2ZH6 A;  4C80 A;  3EYZ A;  5KFY A;  2MUT A;  4JUZ A;  7ICR A;  1Q79 A;  4K96 A;  3PW7 A;  4Y2S A;  4DSE A;  4IS7 A;  2A3V A;  4B9U A;  2JEJ A;  2WB1 C;  4LEW A;  7ICI A;  1K5O A;  3KOO A;  2XID A;  5KFI A;  4QZE A;  1ZQ1 C;  3KBB A;  2E5S A;  9ICI A;  4EP7 A;  2IBK A;  4FZM A;  3IN5 A;  4CF4 A;  2K60 A;  4X4T A;  1ZQY A;  4F8R A;  2WAQ C;  3TKA A;  5KL1 B;  4J9K A;  2IHN A;  5KFF A;  1UHU A;  5KFZ A;  3SAH A;  1NK5 A;  1Z00 B;  4BGD A;  5J0Q A;  3I28 A;  3ZDD A;  4OAH A;  4F4K A;  8ICT A;  4I2A A;  5HHH A;  2OYY A;  4B9S A;  1SXD A;  3RBE A;  3F2D A;  2BPG A;  4NLB A;  2JMG A;  1U9L A;  2ODG A;  2ZTD A;  5AI8 A;  3PW5 A;  3WKD A;  5ALE A;  1RYU A;  1WCL A;  3OGU A;  3C29 A;  8ICS A;  2KP7 A;  5DG8 A;  5EWF A;  5KFP A;  2XO7 A;  3HJE A;  2HHP A;  4WC2 A;  3IDW A;  4F2S A;  4P0Q A;  7ICG A;  5BPC A;  2ZH7 A;  1TAQ A;  3JZ0 A;  9ICM A;  4X0B A;  3H8S A;  4UB4 A;  3RH5 A;  2XVT A;  3PW0 A;  2Y0S F;  4K4H A;  4DFK A;  5AI9 A;  4K4G A;  7ICO A;  3QXG A;  2W3R A;  3TAQ A;  2PMZ F;  2KZM A;  3QX7 A;  1NKC A;  5AKY A;  4FHP A;  1BPD A;  2F1I A;  3TAC B;  2HCF A;  1KKX A;  9ICS A;  1AQ6 A;  5CA7 A;  2W9B A;  3QU5 A;  1S10 A;  4WH5 A;  2W03 A;  3PW2 A;  2WTF A;  3MBY A;  1KEJ A;  1O08 A;  3WK4 A;  2LMR A;  1EXN A;  2OXO A;  4B9L A;  4U7C A;  4P4P A;  1X40 A;  1XSL A;  2M2U A;  2HHU A;  4TQR A;  1D9F A;  3H38 A;  4G3I A;  1PZN A;  3LQC B;  1VFG A;  5JRT A;  1FFU A;  2WF6 A;  2KVC A;  5HRG A;  1TK0 A;  5JTG A;  3ED5 A;  4F5R A;  9ICC A;  2ZIW A;  5KFV A;  4X4V A;  1YZ7 A;  4UB2 A;  3MFI A;  4K9A A;  2ZH3 A;  3Q8L A;  2XGP A;  4F5O A;  3H0L B;  5JTI A;  3ORY A;  3CK6 A;  2W9C A;  4MKP A;  2RDI A;  4M0A A;  2OEH A;  2XY7 A;  1LVH A;  2W8L A;  3SEI A;  2BQ3 A;  4RQ1 A;  2FLP A;  3C5F A;  1KL9 A;  1N5W A;  2BDU A;  4ED2 A;  5J0T A;  8ICI A;  3UM9 A;  4NL9 A;  2W55 A;  3QYP A;  4IRK A;  4UQG A;  2BPC A;  5HHI A;  2FJ6 A;  4O5K A;  1Z4N A;  2RFF A;  1V97 A;  4ECU A;  1NKB A;  5AKI A;  1J2M A;  1R89 A;  2EZY A;  2ZXI A;  3PO4 A;  4RNO A;  5KL8 B;  5AM3 A;  4KB6 A;  2KMD A;  4K98 A;  1YT3 A;  1DOQ A;  5KT2 A;  5AKJ A;  8ICA A;  3TFS A;  4YQW A;  4CGZ A;  4RQ6 A;  1MIY A;  1KRP A;  4R63 A;  1C20 A;  9ICH A;  2F1J A;  4NM1 A;  2KK0 A;  2ZH2 A;  2W9B B;  3F5E A;  1PX5 A;  3HPO A;  5J8Y A;  1UEU A;  2B21 A;  4AYB C;  2P6U A;  5HRE A;  3ISC A;  2D6F C;  2PFN A;  4IL6 U;  4YR2 A;  4YG2 A;  4ECX A;  2NRT A;  5K4L A;  3T5H A;  1KFD A;  5AKL A;  2DWQ A;  2UVR A;  3OSN A;  3DV9 A;  4EBK A;  5B3Q A;  2GO7 A;  2F77 X;  5KFW A;  4OO1 J;  5AK4 A;  2G5H B;  4PGQ A;  1R8C A;  3SR6 A;  3BDP A;  3AQL A;  4XJE A;  3H37 A;  3K4G A;  3PST A;  3IRU A;  3QU9 A;  2OWO A;  4R66 A;  2ZIW B;  4Z6F A;  4F4Z A;  3PR5 B;  3N4M B;  3EWA A;  2DF4 B;  4RQ8 A;  3DDH A;  1BPE A;  3BZK A;  4WC5 A;  3J81 j;  4NXU A;  4MHV A;  3MAB A;  5IIO A;  3M8R A;  4J9M A;  5L1J A;  4GIB A;  1UET A;  5J0W A;  3RJK A;  3KHH A;  1PVQ A;  3LK9 A;  3NS1 A;  1X9W A;  4WC4 A;  3M8S A;  5AK5 A;  3MR6 A;  4KLD A;  2LYB A;  4RQ4 A;  3PR4 A;  4TUS A;  3ERC C;  4RPZ A;  2K89 A;  3N97 B;  5F9N A;  3Q8K A;  4X0A A;  3JPO A;  4B9M A;  3QUC A;  2KIC A;  4Q8F A;  2KVS A;  5HNK A;  4PPX A;  4X4P A;  1TFW A;  5DQG A;  9ICJ A;  3PW4 A;  4RQN A;  1RXV A;  4KLH A;  2KD1 A;  4AT7 A;  1QQ6 A;  3M9N B;  4M5D A;  2ASJ A;  4LEV A;  1QCK A;  5KFJ A;  4RWP A;  4ECQ A;  2FMQ A;  1NK6 A;  1L5U A;  1FEZ A;  3OVS A;  4RWO A;  2PI5 A;  5KG1 A;  4IR9 A;  2JRZ A;  1Y88 A;  2I1Q A;  4OJ5 A;  2QAR A;  5BOM A;  2QB0 A;  4C4S A;  2W9M A;  4YXJ A;  3H39 A;  4NKT A;  5KFU A;  4C7Z A;  2NRX A;  4US9 A;  4UBB A;  4DS5 A;  4DFM A;  3LYS A;  2YQE A;  2BDP A;  3GV7 B;  2F1H A;  4X4S A;  3B0Y A;  3H7I A;  4QWB A;  2XIC A;  2Q66 A;  3JYY A;  1LB2 B;  2CXY A;  4IRD A;  4YR3 A;  4QZH A;  4ECY A;  5ALM A;  3KHL A;  4AT8 B;  2C22 A;  5CFU A;  3H4D A;  1FA0 A;  1JUD A;  4I2C A;  4O3P A;  1U49 A;  2XY5 A;  3ICX A;  1F5A A;  2ZH9 A;  3JPS A;  4I29 A;  2OCE A;  2W11 A;  5DGB A;  1PVR A;  4QNL A;  2E8M A;  4DFD A;  4F2R A;  3C23 A;  3WKB A;  4RU9 A;  5DBA A;  2B56 A;  5DLF A;  5ALV A;  3TAR A;  4ECW A;  2JH7 A;  4Y2J A;  9ICN A;  5AKE A;  4ED0 A;  2KSO A;  9ICB A;  5AM1 A;  3BQ1 A;  4GFJ A;  2UVU A;  4DQR A;  3RRH A;  2J6U A;  3I1Y A;  2K4I A;  1X2I A;  5DKW A;  1CRX A;  4ACO A;  4Y2V A;  3GIK A;  2W9C B;  1ZQJ A;  1ZD5 A;  3HP6 A;  3UXN A;  1XS9 D;  2PBE A;  2WF9 A;  1X66 A;  3H3A A;  3F53 A;  2R18 A;  1ZQE A;  3OVB A;  2HW3 A;  1XSP A;  2YML A;  3E0F A;  3AQN A;  3NVW A;  2BBJ A;  4GC7 A;  2IUB A;  2DR8 A;  1RXW A;  1LKY A;  3RH6 A;  3ALR A;  4J9N A;  1U48 A;  5E79 U;  3OHB A;  1TK5 A;  4DWI A;  5CRX A;  5AIA A;  1T8E A;  4DS4 A;  3BQ0 A;  2ZIX B;  5ALO A;  3C28 A;  2HOF A;  4O67 A;  3BS7 A;  1MIV A;  5L1M A;  3TFR A;  4WQL A;  1DRG A;  1TFY A;  4GLX A;  4Z6E A;  3F2C A;  3VCB A;  1NK9 A;  4EV6 A;  3DEE A;  3EPG A;  4BWJ A;  1NO5 A;  1N48 A;  3AN1 A;  4C8N A;  4M9L A;  4MEX A;  5J0X A;  2YTU A;  2YN4 A;  3GQC A;  9ICX A;  1TE2 A;  2F2A B;  1NJY A;  3JPQ A;  2A19 A;  5T14 A;  5EWG A;  2ASD A;  2ZG6 A;  3NVZ A;  3OV7 A;  3PV8 A;  5HC9 A;  2ES6 A;  4KLS A;  3BQ7 A;  5J2H A;  2FPL A;  1JRP A;  4QWC A;  2HOI A;  4E0D A;  4CCH A;  2RLT A;  5FP0 A;  2ID1 A;  1S0V A;  4MFF A;  2KSO B;  4J9Q A;  2JR5 A;  3NVO A;  3D2S A;  2JHD A;  3KD3 A;  4IQU A;  1Z00 A;  4FE3 A;  1BNP A;  4ECZ A;  3C66 A;  4OAG A;  2OH2 A;  3WU2 U;  4X4Q A;  1BPX A;  2ZIV B;  3KHG A;  3PX0 A;  3H8J A;  3NUQ A;  5J2F A;  3EF2 A;  1ZQP A;  1LKY B;  4Y2Y A;  4Q43 A;  2LHT A;  2WF5 A;  2EZZ A;  4BXO A;  2UVW A;  3AU6 A;  3HKZ F;  3HW8 A;  3QU4 A;  2YX8 A;  2AJQ A;  4O3Q A;  3EW9 A;  3SMV A;  2YB1 A;  4KLU A;  3H8W A;  3RR7 A;  5C5J A;  2BPF A;  4UB3 A;  2HHW A;  3MGH A;  4KN4 A;  5HRB A;  2VAN A;  2R8H A;  4MFC A;  5AKG A;  4C7Y A;  2JEF A;  4EEB A;  5KG7 A;  1ZQC A;  4TQS A;  1ZRM A;  3WKE A;  5EE3 A;  3JPR A;  4NLN A;  3C1Z A;  3V7L A;  4PGY A;  3GIL A;  4BUG A;  5KFG A;  2HHV A;  1SWV A;  3NAS A;  4KLT A;  4KN7 A;  3ZDA A;  4YCX A;  4P0P A;  2KJ5 A;  2A1A A;  1U4B A;  4XA5 A;  3QUT A;  4YP3 A;  2BCS A;  2ZTE A;  8ICN A;  2W3S A;  3AU2 A;  3T5L A;  2HHS A;  9ICG A;  3G6V A;  2IMW P;  4K8V A;  4FHV A;  4I2B A;  5CR0 A;  5HRK A;  2KIW A;  4Q8E A;  4M9N A;  4EX7 A;  4ZH4 A;  2HSZ A;  4J9O A;  3PO5 A;  4NJ8 A;  4I2I A;  3I76 A;  2FLL A;  2EH9 A;  5J2C A;  2KOB A;  2W54 A;  3BZC A;  3M1Y A;  4R64 A;  2Q4T A;  2JEG A;  1ZOL A;  2JV3 A;  4RT3 A;  1QSY A;  4RQ5 A;  1T4G A;  4Y2R A;  3QU7 A;  2EAN A;  4QWD A;  1RYR A;  2W04 A;  4ECR A;  3FDS A;  3IV6 A;  4QJF B;  3ZDB A;  4FH5 A;  4Y2Q A;  4DQQ A;  2I9G A;  8ICC A;  3C1Y A;  7ICV A;  4X4N A;  1KTQ A;  2VA3 A;  1D9D A;  2I6X A;  1CUK A;  4YR0 A;  2YY6 A;  3SV4 A;  3AQF A;  7ICN A;  3KKA C;  1A0P A;  3U26 A;  5ALD A;  4QZC A;  4K9B A;  3KHR A;  2KIV A;  4ECV A;  2FPM A;  4F72 A;  4DL7 A;  2PFO A;  5AKX A;  5D49 A;  1DXS A;  4NXV A;  5F9L A;  3QZ8 A;  5HR9 A;  4X4U A;  2NO4 A;  4RQ3 A;  5CWR A;  2O1P A;  5J2D A;  4UAT A;  4UB8 U;  3RFA A;  1XO1 A;  4UAY A;  3SZ2 A;  1B0X A;  4ELV A;  2ZJ8 A;  5KFS A;  1L3U A;  3LWM A;  4LVS A;  4O3S A;  2M2V A;  5ALN A;  2F44 A;  5DB6 A;  2BCV A;  1ZQN A;  4C4T A;  1SV0 A;  2ZTC A;  7ICS A;  4NXX A;  3ETR A;  2HHT A;  4DOC A;  1JAJ A;  4DF8 A;  1DGS A;  2GLE A;  4P4M A;  1M6Y A;  3ETL A;  3RAX A;  2DGZ A;  4KMU A;  5KFO A;  2LPE A;  4FH3 A;  4KLL A;  2H3F A;  3FYH A;  1HJP A;  4UAV A;  2CPR A;  2ZXH A;  2KG5 A;  1R8B A;  4WBY A;  2EAM A;  3PSP A;  3D2N A;  3H4B A;  4A8E A;  5KFH A;  4U6P A;  8ICP A;  5KNI A;  4RWN A;  3MDC A;  2XCA A;  3Q8S B;  4DQP A;  3MCR A;  4S3N A;  1JAL A;  5IIL A;  5J0U A;  1T3N A;  2BE3 A;  5AKK A;  4JB3 A;  3GZF A;  2H3Q A;  4DSF A;  5KFK A;  1ZXI A;  5ALT A;  1NZB A;  1LV5 A;  1KBU A;  5KG4 A;  2NO5 A;  1X9S A;  1KNY A;  4IR1 A;  2NRK A;  3RJG A;  1ZJM A;  5ALK A;  1U47 A;  2HVI A;  2AQ0 A;  3LDA A;  4EZ6 A;  3D6J A;  3MC1 A;  1S0O A;  4K4I A;  1SKW A;  3WFR E;  1ZQL A;  5AM5 A;  2HHX A;  8ICY A;  7ICL A;  4UAW A;  4FFD A;  2XY6 A;  4EYH B;  1URJ A;  2MUT B;  5KFC A;  3TQ1 A;  2B6G A;  5EE1 A;  4OJ6 A;  2BHN A;  1T94 A;  2EZX A;  2DRA A;  7ICH A;  5IIJ A;  3NVV A;  4PZO A;  2KKV A;  5ALI A;  4F91 B;  5KG2 A;  1ZQI A;  5ALS A;  3SD7 A;  2QB1 A;  4DL3 A;  4RT2 A;  5DB9 A;  1ZQU A;  3WFO A;  1VJ7 A;  1S77 D;  1NJX A;  2J6S A;  4EBD A;  2AU0 A;  4MF2 A;  1FIQ A;  2G07 A;  3H0M B;  4C0Z A;  4DCC A;  3ZDC A;  2PI4 A;  1V85 A;  4JV1 A;  3TAN A;  1K1Q A;  1S8O A;  3JCF A;  2F8K A;  4XRH A;  1COO A;  1SL0 A;  3RB0 A;  4QIW C;  2RRD A;  4LEY A;  2Q0Z X;  1V38 A;  3C2M A;  5J2J A;  2WB1 F;  7ICQ A;  4I27 A;  4X4R A;  2DR7 A;  4C8O A;  2MA1 A;  3OJS A;  4JK1 A;  2WAQ F;  2KE7 A;  3PHZ A;  5J0P A;  4M6W A;  3PMN A;  3MFH A;  3HIL A;  3PML A;  2LM4 A;  9ICE A;  3KTQ A;  3LWL A;  1DGJ A;  1ZQH A;  1MN8 A;  1WG8 A;  4B9N A;  2O5A A;  5J2E A;  5B3P A;  5DED A;  4NLZ A;  1XC9 A;  1SL2 A;  4UAZ A;  1JI7 A;  2KJ8 A;  3CP8 A;  1B22 A;  3HWT A;  2KFZ A;  1NKE A;  2E8N A;  2KFN A;  5D61 A;  3SQI A;  8ICJ A;  2ZH5 A;  1WYG A;  3TAD C;  2BKE A;  3CYM A;  5EE0 A;  3PX6 A;  7ICF A;  5IIN A;  4M9H A;  1K1S A;  1UPH A;  4O5E A;  4NKU A;  4Y2P A;  4DL2 A;  4DFP A;  4O6A A;  2DUY A;  4FHW A;  4QWE A;  1QSL A;  4QZA A;  4PJ0 U;  4NWI A;  1HEK A;  2YMQ A;  3A0H U;  5DG7 A;  2ZJ5 A;  5DB7 A;  5CHG A;  3OVA A;  2RHF A;  7ICK A;  1BPY A;  1X9M A;  4PHA A;  5HRD A;  1JIH A;  1NI3 A;  1SV4 A;  4J9S A;  4DF4 A;  5KFQ A;  4LZG A;  4EEL A;  2PFQ A;  3RAQ A;  9ICL A;  1SV0 C;  4ED6 A;  3QUQ A;  4F4Y A;  1UT8 A;  4FO6 A;  5DEC A;  4QZF A;  1MIW A;  2E8O A;  5AIB A;  3IP4 B;  3IHQ B;  5ALX A;  4PHD A;  4TUQ A;  1D8B A;  3PNC A;  4PHP A;  3V72 A;  5III A;  1ZQR A;  1QSS A;  4EBJ A;  2G06 A;  3TAP A;  4ED1 A;  5AKH A;  3UMB A;  3RJJ A;  4I2H A;  1S97 A;  1N56 A;  4QW9 A;  5DLG A;  1A76 A;  5JUM A;  1L7O A;  5ALJ A;  1OXJ A;  2XI9 A;  8ICB A;  1NJZ A;  3HJ4 A;  3NGD A;  1RQL A;  2VJ4 A;  3RF9 A;  3V6J A;  3CRX A;  2FLN A;  5KFE A;  4RZR A;  8ICM A;  2GAF D;  4ECS A;  4DQI A;  4JWM A;  4KLG A;  2E1E A;  2H3V A;  2W9A A;  4EGW A;  5GTI U;  4XQ8 A;  4JWN A;  4DLG A;  1X6I A;  1PUZ A;  5AI6 A;  1GPJ A;  1OU5 A;  4OCZ A;  4WCW A;  3V6K A;  1UCV A;  1C7Y A;  3K75 D;  1F44 A;  2P6R A;  2A1J B;  2UVV A;  5EOZ A;  3QZ7 A;  2IOF A;  5EE9 A;  4M2Y A;  2EAO A;  4E7X A;  3QEA Z;  1MQ2 A;  5CHE A;  8ICH A;  2YB4 A;  9ICA A;  3TAD A;  2DFL A;  2Z7J A;  4LZD A;  1RZT A;  1ECW A;  2ZUC A;  5J2G A;  2M9N A;  2JGA A;  1L7N A;  4ED8 A;  3OUY A;  2I5H A;  2WF7 A;  3Q8R B;  2ZJA A;  2YMM A;  4BXO B;  4GXJ A;  1ZQA A;  5CEH A;  1SZP A;  3BS5 A;  1Z3E B;  1ZQZ A;  2NRV A;  2HN2 A;  3HX0 A;  2DL0 A;  3T3F A;  4EEK A;  5J0Y A;  3OWG A;  3T79 A;  4HYK A;  5KT6 A;  3RRG A;  3QU2 A;  2JZB B;  2W7P A;  3GDX A;  1UQV A;  2XGQ A;  1JRO A;  4J9P A;  3OTQ A;  4DFJ A;  5J8Y C;  5AM2 A;  2K8A A;  1Z1B A;  4IRC A;  1OUQ A;  1TAM A;  5KT3 A;  1S5L U;  2KKP A;  4Y2U A;  2ZH1 A;  1QLN A;  3ZDE A;  2GOL A;  2DKX A;  3V6H A;  3PX4 A;  4LT6 A;  2NRZ A;  3SV3 A;  8ICZ A;  3E2E A;  1XO0 A;  3ER8 C;  4ATB A;  2PMZ C;  9ICR A;  5KG0 A;  5DG9 A;  1A6S A;  4OAF A;  2W8K A;  2K4P A;  4Y2X A;  5F3X B;  2R8I A;  4DL6 A;  4NLC A;  3ZI4 A;  2FI1 A;  4NL9 C;  4FO1 A;  2B4V A;  1F5S A;  4UB6 U;  1IV8 A;  1VLB A;  4F5N A;  4CE6 A;  4DSK A;  1NK4 A;  4KM5 A;  2AGP A;  3CNH A;  4DSJ A;  1S0M A;  3M6Z A;  7ICT A;  1A77 A;  3THV A;  2AH5 A;  5D46 A;  1N5X A;  1TK8 A;  4OAI Z;  3WKA A;  1YLQ A;  1QQ7 A;  2OHF A;  2N1R A;  1U45 A;  4YVZ A;  2ZUD A;  3IM1 A;  2EAP A;  4K97 A;  3IG5 A;  9ICK A;  3OUY B;  4I2G A;  4XQ7 A;  2IA6 A;  3G6X A;  4PGX A;  2G09 A;  2P35 A;  3K1Z A;  5AM0 A;  2G5I B;  4MF8 A;  4YFK A;  4YXM A;  8ICE A;  5B66 U;  4IC9 A;  5KT4 A;  4TUR A;  2BBH A;  3WKC A;  4UB5 A;  4ED3 A;  3K1R B;  5KTQ A;  1PK1 B;  5DBB A;  3QUB A;  3N28 A;  4E80 A;  2JXJ A;  2JH1 A;  1L3T A;  1Z1V A;  1H38 A;  2Y9U A;  2L5Y A;  2ZIV A;  1JMS A;  3KZX A;  4KLE A;  2KNJ A;  5ALQ A;  4K99 A;  3RTV A;  4AT7 B;  4WC0 A;  5IIK A;  5AI5 A;  5KG5 A;  3RB4 A;  4Q45 A;  4F71 A;  2AGO A;  4MEY A;  4J9R A;  1NK0 A;  3RJF A;  2BQU A;  4PHE A;  3WK9 A;  4GXK A;  4P0P B;  1PK3 A;  4UAR A;  4Z6D A;  3WFP A;  4RNN A;  3C2K A;  1COK A;  1BNO A;  4F4W A;  4KLM A;  1FFV A;  2G0A A;  1OW5 A;  4TUP A;  5AHX A;  3ER9 B;  5KAF U;  3KFU F;  2WF8 A;  5GTH U;  3L9D A;  5F2V O;  4QZ8 A;  1SWW A;  5AI0 A;  3GV5 B;  1L6N A;  4KLO A;  1L7M A;  1XNS A;  1ZQX A;  3AUO A;  4DL5 A;  3T5K A;  5L1I A;  5HRF A;  1N62 A;  4AP9 A;  7ICJ A;  3ISB A;  2W7O A;  1D8L A;  4C4R A;  3QNM A;  1Q78 A;  2HBK A;  2BR0 A;  5DDM A;  2Y1I A;  4RUC A;  1WWU A;  1KQQ A;  5KG3 A;  8ICV A; 
#chains in the Genus database with same CATH homology
 4ECT A;  4YD2 A;  4X4O A;  5KFJ A;  5KG6 A;  2R8J A;  4ECQ A;  2FMQ A;  2C2D A;  4RWP A;  1NK6 A;  1S0O A;  4RQ2 A;  1L5U A;  1SKW A;  4K4I A;  3GIM A;  5BOL A;  9ICV A;  1BGX T;  3OVS A;  3WFR E;  4RWO A;  1ZQL A;  2PI5 A;  2HHX A;  4F5Q A;  5KG1 A;  8ICY A;  4IR9 A;  5DQH A;  3UPS A;  7ICL A;  4UAW A;  1Y88 A;  2XY6 A;  3RBD A;  5J0R A;  2I1Q A;  4EYH B;  2MUT B;  7ICU A;  5BOM A;  3JPN A;  1IM4 A;  2W9M A;  5KFC A;  3RJI A;  3TQ1 A;  1MC8 A;  4YXJ A;  3H39 A;  4NKT A;  4O3R A;  1UT5 A;  2FMP A;  4KLF A;  5KFU A;  5L1L A;  2BHN A;  5KFA A;  5L9X A;  4EEY A;  4O3O A;  1ZQF A;  2NRX A;  7ICH A;  2DRA A;  4QZB A;  5IIJ A;  1JX4 A;  1MQ3 A;  3EPI A;  8ICF A;  4UBB A;  4DS5 A;  2KN7 A;  4F91 B;  3Q8P B;  5KG2 A;  1ZQI A;  3OJU A;  2H5X A;  1ZQW A;  4DFM A;  2M2T A;  4YMN A;  4DL3 A;  4RT2 A;  5DB9 A;  1ZQU A;  4I2D A;  3GV7 B;  2BDP A;  2KZZ A;  1VJ7 A;  2F1H A;  4R65 A;  2V4Q A;  1S77 D;  1NJX A;  4WC3 A;  4X4S A;  2J6S A;  3GV8 B;  4EBD A;  2AU0 A;  3B0Y A;  3H7I A;  2VA8 A;  4QZG A;  4MF2 A;  4QWB A;  1JQR A;  2Q66 A;  5KFL A;  3ZDC A;  2PI4 A;  5KFD A;  1DK2 A;  3GII A;  4M04 A;  3JYY A;  4DOA A;  1LB2 B;  2PFP A;  4IRD A;  2BCU A;  4YR3 A;  1K1Q A;  4QZH A;  3TAN A;  4JV1 A;  4XRH A;  1COO A;  8ICU A;  4ECY A;  4RQ0 A;  1SL0 A;  3RB0 A;  3KHL A;  1TKD A;  1ZQM A;  4BWM A;  1KSP A;  4NKU A;  4I2E A;  4AT8 B;  4WC6 A;  2C22 A;  2AQ4 A;  3H4D A;  1FA0 A;  4I2C A;  9ICQ A;  5J0S A;  8ICO A;  3V7J A;  4O3P A;  1U49 A;  4E8F A;  2XY5 A;  5DBC A;  4QZI A;  1F5A A;  2ZH9 A;  3WFO A;  3JPS A;  2Q0Z X;  4YMM A;  4DO9 A;  5IIM A;  1RPL A;  3MR5 A;  4I29 A;  3C2M A;  4O3N A;  5J2J A;  4ELT A;  1NK8 A;  5DGB A;  4M9J A;  2PXI A;  1KFT A;  3C21 A;  4DQS A;  1BPZ A;  3OSP A;  1SKS A;  3RJE A;  2ZHA A;  7ICQ A;  3H40 A;  4I27 A;  4NLK A;  3ZD9 A;  3C23 A;  2J6T A;  4F2R A;  4X4R A;  4FBU A;  1TFR A;  5J2A A;  2DR7 A;  4EBC A;  4RU9 A;  5DBA A;  4C8O A;  4I28 A;  3OJS A;  1ZQK A;  5DLF A;  2ZH8 A;  5J29 A;  4WBZ A;  5CP2 A;  1ZQO A;  4JK1 A;  3UQ0 A;  3TAR A;  4ECW A;  5J0P A;  3PY8 A;  4M6W A;  3PMN A;  3MFH A;  3Q8M A;  3PML A;  4F4X A;  1NJW A;  3QEB Z;  1L3V A;  1UA0 A;  9ICE A;  4RPY A;  4ED0 A;  9ICN A;  3JPT A;  3KTQ A;  3LWL A;  4PH5 A;  9ICB A;  1XSN A;  1ZQH A;  4B9N A;  2O5A A;  3BQ1 A;  4F5P A;  3UXP A;  5KFN A;  2GWS A;  4KTQ A;  5J2E A;  4F93 B;  5DED A;  4NLZ A;  1NZP A;  1T7P A;  2UVU A;  4DQR A;  3QE9 Y;  3RRH A;  1XC9 A;  2J6U A;  1IXR A;  3BQT A;  1X2I A;  5DQI A;  5DKW A;  2DPJ A;  4AT8 A;  2AGQ A;  1HUZ A;  1SL2 A;  4UAZ A;  1XU4 A;  1JXL A;  3GIK A;  3G6Y A;  1B22 A;  7ICM A;  9ICW A;  2W9C B;  4EBE A;  1ZQJ A;  3HWT A;  3MDA A;  2KFZ A;  1NKE A;  4QZ9 A;  1ZET A;  1DK3 A;  1ZQS A;  2DRB A;  3HP6 A;  4UBC A;  5J0O A;  4RPX A;  3GIJ A;  4JV2 A;  4P2H A;  2KFN A;  3UXN A;  2V4R A;  4DLE A;  2BKE A;  3MGI A;  3PX6 A;  1XS9 D;  3RB6 A;  1QTM A;  2PBE A;  3AQM A;  1ZQG A;  7ICF A;  4J9L A;  9ICU A;  3H3A A;  3ISD A;  5IIN A;  4M9H A;  4GC6 A;  1K1S A;  4Z6C A;  4O5E A;  1ZQE A;  4ATB B;  4DL2 A;  3OVB A;  2HW3 A;  4EZ9 A;  4UD4 A;  1XSP A;  2LYH A;  4DFP A;  7ICP A;  4F92 B;  4FHW A;  4Q44 A;  2FPK A;  4BDP A;  3AQN A;  4QWE A;  1QSL A;  4QZA A;  1KFS A;  3WFQ E;  4GC7 A;  2DR8 A;  4YD1 A;  2BQR A;  4RQ7 A;  1RXW A;  2ZH6 A;  5DG7 A;  3RH6 A;  4J9N A;  2ZJ5 A;  3EYZ A;  5KFY A;  5DB7 A;  5CHG A;  2MUT A;  4JUZ A;  5KT7 A;  3OHB A;  1U48 A;  1TK5 A;  1ZQQ A;  4DWI A;  1BPY A;  1X9M A;  4PHA A;  7ICK A;  1ZQB A;  4DEZ A;  4DS4 A;  1T8E A;  5HRD A;  3BQ0 A;  1JIH A;  7ICR A;  1Q79 A;  3PW7 A;  4J9S A;  4DL4 A;  4DF4 A;  3SYZ A;  5KFQ A;  4LZG A;  1V9P A;  4DSE A;  3RAQ A;  2PFQ A;  3EZ5 A;  3BJY A;  5DB8 A;  4B9U A;  2JEJ A;  9ICL A;  1MIV A;  2JZB A;  7ICI A;  4ED6 A;  4F4Y A;  3TFR A;  4QZE A;  5KFI A;  1UT8 A;  4C8L A;  4FO6 A;  1TFY A;  5DEC A;  1JXE A;  4QZF A;  4GLX A;  9ICI A;  1MIW A;  1V4A A;  4Z6E A;  4QWA A;  2ISP A;  2IBK A;  3IHQ B;  4EP7 A;  4X4T A;  1ZQY A;  1NK9 A;  4F8R A;  4PHD A;  4TUQ A;  3PNC A;  3EPG A;  4BWJ A;  4J9K A;  2IHN A;  1N48 A;  4YN4 A;  1NO5 A;  4PHP A;  5KFF A;  5KFZ A;  4C8N A;  3V72 A;  5III A;  1NK7 A;  1Z00 B;  1NK5 A;  4M9L A;  4UD5 A;  4MEX A;  1ZQR A;  1ZQT A;  5J0X A;  1ZQD A;  4BGD A;  1QSS A;  3TAP A;  1B43 A;  5J0Q A;  4ED1 A;  3ZDD A;  4EBJ A;  2ISO A;  4C8K A;  1D8Y A;  4F4K A;  1WOT A;  1ARO P;  3GQC A;  3RJJ A;  1S97 A;  4I2H A;  1N56 A;  1NJY A;  9ICX A;  3OHA A;  4QW9 A;  5DLG A;  1A76 A;  5JUM A;  3JPQ A;  4I2A A;  4KLI A;  5HHH A;  8ICT A;  4B9S A;  5EWG A;  8ICB A;  1NJZ A;  1ZQV A;  3RBE A;  2ASD A;  3HJ4 A;  3OV7 A;  2BPG A;  3NGD A;  3PV8 A;  9ICF A;  5HC9 A;  4KLS A;  2HVH A;  1ZYQ A;  2DPI A;  1U9L A;  5J2H A;  2R8K A;  4JV0 A;  2FPL A;  4QWC A;  2ZTD A;  4E0D A;  3V6J A;  4CCH A;  2FLN A;  5KFE A;  4RZR A;  8ICM A;  3PW5 A;  5HML A;  8ICR A;  1TFW A;  1WCN A;  4B9V A;  3UPQ A;  4ECS A;  2ID1 A;  4DQI A;  1S0V A;  4IQT A;  1WCL A;  2A1J A;  5EWE A;  3OGU A;  4MFF A;  4JWM A;  4KLG A;  3T5J A;  4J9Q A;  3C18 A;  4X5V A;  8ICS A;  2KP7 A;  3RJH A;  1SL1 A;  2C2E A;  4IQU A;  1Z00 A;  2W9A A;  5DG8 A;  1BNP A;  5EWF A;  4ECZ A;  2M2W A;  5KFP A;  3C66 A;  5KFX A;  4XQ8 A;  2XO7 A;  4DLG A;  4JWN A;  2HHP A;  4WC1 A;  4WC2 A;  4F2S A;  4X4Q A;  8ICL A;  1BPX A;  7ICG A;  5BPC A;  3KHG A;  3PVX A;  4EYI B;  2R8G A;  2ZH7 A;  3PX0 A;  2ZH5 A;  3H8J A;  1TAQ A;  1OU5 A;  3JZ0 A;  4WCW A;  9ICM A;  4X0B A;  3H8S A;  4NY8 A;  3V6K A;  4UB4 A;  5J2F A;  4O9M A;  3RH5 A;  1C7Y A;  3PW0 A;  2BCR A;  4K4H A;  3RB3 A;  1ZQP A;  4DFK A;  3K75 D;  2P6R A;  4K4G A;  3MR3 A;  2A1J B;  2KZ3 A;  2UVV A;  4Q43 A;  4FBT A;  3UXO A;  7ICO A;  5EOZ A;  3QZ7 A;  1S0N A;  4BXO A;  3NYB A;  5DGA A;  2UVW A;  4M2Y A;  5KFR A;  3TAQ A;  3AU6 A;  1SKR A;  2KZM A;  3HW8 A;  8ICX A;  2JEI A;  4E7X A;  3QEA Z;  1NKC A;  1UEV A;  1MQ2 A;  2AJQ A;  4FHP A;  1BPD A;  2F1I A;  5D4B A;  3AQK A;  8ICH A;  4O3Q A;  3EW9 A;  4DOB A;  9ICA A;  4KLU A;  9ICS A;  3HT3 A;  5CA7 A;  1S76 D;  2W9B A;  2Y1J A;  2DFL A;  3H8W A;  5KT5 A;  2DR9 A;  4LZD A;  1S10 A;  1RZT A;  3RR7 A;  5C5J A;  2ZUC A;  5J2G A;  3PW2 A;  2M9N A;  4UB3 A;  4ED8 A;  2BGW A;  3MGH A;  4KN4 A;  2BPF A;  2HHW A;  3OUY A;  3SI8 A;  2WTF A;  5HRB A;  2VAN A;  3Q8R B;  3M9M B;  2ZJA A;  3MBY A;  1KEJ A;  2R8H A;  1HUO A;  4BXO B;  4GXJ A;  4MFC A;  4FHY A;  1EXN A;  1XWL A;  2JEF A;  1ZQA A;  1SZP A;  5KG7 A;  1ZQC A;  4B9L A;  1CEZ A;  4TQS A;  4P4P A;  1XSL A;  3HJ1 A;  1Z3E B;  2M2U A;  3JPR A;  1ZQZ A;  2NRV A;  3BQ2 A;  2HHU A;  4MFA A;  4M6W B;  4DSI A;  9ICP A;  3HX0 A;  4NLN A;  3C1Z A;  3V7L A;  3T3F A;  4PGY A;  5J0Y A;  4TQR A;  3GIL A;  1D9F A;  4G3I A;  3H38 A;  1PZN A;  4FHX A;  3LQC B;  3JPP A;  1VFG A;  4FS1 A;  4I2J A;  5KFG A;  4HYK A;  2HHV A;  1UA1 A;  4KLT A;  1TK0 A;  5HRG A;  4KN7 A;  5KT6 A;  3RRG A;  3C5G A;  3ZDA A;  4YCX A;  2RDJ A;  2JZB B;  4F5R A;  9ICC A;  5KFV A;  4X4V A;  1U4B A;  4XA5 A;  4YP3 A;  4UB2 A;  3GDX A;  2V9W A;  2XGQ A;  3MFI A;  2BCS A;  8ICG A;  4R8U A;  2ZTE A;  4J9P A;  2XGP A;  3Q8L A;  8ICN A;  4DFJ A;  8ICQ A;  4F5O A;  4NM2 A;  3AU2 A;  3M9O B;  3V7K A;  4IRC A;  3ORY A;  3T5L A;  2HHS A;  9ICG A;  5KT3 A;  2W9C A;  3G6V A;  2RDI A;  2IMW P;  4M0A A;  4FHV A;  3B0X A;  2XY7 A;  2W8L A;  4I2B A;  2BQ3 A;  5CR0 A;  1KLN A;  2ZH1 A;  4RQ1 A;  3ZDE A;  1QLN A;  2BCQ A;  2IHM A;  5HRK A;  2FLP A;  4Q8E A;  8ICK A;  3V6H A;  2XCP A;  3PX4 A;  4P4O A;  2NRZ A;  3C5F A;  3SV3 A;  4M9N A;  4LT6 A;  4UB1 A;  4ZH4 A;  4M9G A;  8ICZ A;  3E2E A;  1R8A A;  4J9O A;  1TVA A;  4ED2 A;  1L3S A;  3PO5 A;  4ATB A;  5J0T A;  2FMS A;  9ICR A;  4I2I A;  2NRW A;  4I2F A;  5KG0 A;  5DG9 A;  2FLL A;  8ICI A;  2W8K A;  5HP4 A;  3OVA A;  4IRK A;  2BPC A;  5J2C A;  5HHI A;  5KFM A;  4UQG A;  4O5K A;  2RFF A;  4C8M A;  4R64 A;  2R8I A;  4DL6 A;  4ECU A;  1NKB A;  2JEG A;  4RT3 A;  1QSY A;  4RQ5 A;  4QW8 A;  1T4G A;  4QZD A;  2ALZ A;  4EZ6 A;  1R89 A;  4RWQ A;  4QWD A;  1RYR A;  4WC7 A;  4F5N A;  4ECR A;  4NLG A;  3PO4 A;  4DSK A;  1NK4 A;  3FDS A;  4RNO A;  4M47 A;  2AGP A;  4DSJ A;  2HHQ A;  1S0M A;  3ZDB A;  7ICT A;  4FH5 A;  1A77 A;  3THV A;  3UQ2 A;  4DQQ A;  2I9G A;  5D46 A;  4AT9 A;  4B9T A;  1TK8 A;  1DOQ A;  8ICC A;  5KT2 A;  3C1Y A;  1YLQ A;  7ICV A;  8ICA A;  2XC9 A;  4X4N A;  3TFS A;  4YQW A;  3RH4 A;  1U45 A;  4RUA A;  2ZH4 A;  4YVZ A;  1KTQ A;  4RQ6 A;  1MIY A;  2ZUD A;  3IM1 A;  2VA3 A;  1D9D A;  1KRP A;  1KDH A;  4R63 A;  1CUK A;  4YR0 A;  4F3O A;  9ICO A;  4ED7 A;  9ICK A;  4RNM A;  3SV4 A;  7ICN A;  3OUY B;  5J2B A;  4I2G A;  4XQ7 A;  9ICH A;  2IA6 A;  3G6X A;  4KLJ A;  4QZC A;  4PGX A;  3KHR A;  9ICT A;  2F1J A;  4NM1 A;  2MAX A;  4ECV A;  2VA2 A;  2FPM A;  2W9B B;  4DL7 A;  1PX5 A;  2ZH2 A;  4MF8 A;  2DR5 A;  4NXZ A;  4YFK A;  4YXM A;  3HPO A;  2PFO A;  8ICE A;  2P66 A;  5D49 A;  5KT4 A;  1BVS A;  4M5D A;  3HIY A;  1UEU A;  2B21 A;  4TUR A;  2P6U A;  5HRE A;  3ISC A;  1RYS A;  4UB5 A;  2PFN A;  4ED3 A;  4DSL A;  4YR2 A;  4YMO A;  4GXI A;  5KTQ A;  4YG2 A;  5KFT A;  5F9L A;  3QZ8 A;  5HR9 A;  4X4U A;  7ICE A;  4ECX A;  1NOM A;  4RQ3 A;  5CWR A;  5DBB A;  2O1P A;  5J2D A;  4O0I A;  2NRT A;  1L3T A;  4E80 A;  4UAY A;  1XO1 A;  3SZ2 A;  3T5H A;  1H38 A;  1KFD A;  3Q8Q B;  3RR8 A;  4ELV A;  5CB1 A;  1KNY A;  2ZJ8 A;  5KFS A;  1L3U A;  4R8U B;  1JMS A;  3LWM A;  4LVS A;  4O3S A;  2UVR A;  2M2V A;  3OSN A;  4KLE A;  2ATL A;  5DB6 A;  2BCV A;  4EBK A;  1ZQN A;  5HRH A;  2ZTC A;  4FS2 A;  3TI0 A;  5HMM A;  4O5C A;  5KFW A;  3RTV A;  7ICS A;  4AT7 B;  4PGQ A;  3MR2 A;  2HHT A;  1R8C A;  4WC0 A;  4DOC A;  3BDP A;  5IIK A;  1JAJ A;  3AQL A;  1JN3 A;  3H37 A;  3K4G A;  4DF8 A;  5J2I A;  5KG5 A;  3RB4 A;  1DGS A;  4F50 A;  4R66 A;  4Q45 A;  4P4M A;  2OWO A;  4Z6F A;  3ETL A;  3RAX A;  3NTU A;  4F4Z A;  3PR5 B;  2AGO A;  4IQW A;  3EWA A;  3N4M B;  4KMU A;  4IQV A;  4RQ8 A;  1S9F A;  4KLQ A;  1BPE A;  5KFO A;  4MEY A;  4J9R A;  5HRL A;  4IG8 A;  1NK0 A;  3RJF A;  4FH3 A;  4XUS A;  4WC5 A;  2BQU A;  4KLL A;  4PHE A;  3GFK B;  3FYH A;  1TAU A;  1HJP A;  5HRI A;  2C2R A;  4GXK A;  4WBY A;  1R8B A;  4KIT B;  2ZUB A;  3MAB A;  5IIO A;  3M8R A;  4Z6D A;  4J9M A;  2KTQ A;  3WFP A;  4RNN A;  3C2K A;  5L1J A;  1BNO A;  4F4W A;  4KLM A;  2DVI A;  3H4B A;  1UET A;  2ZH3 A;  5J0W A;  5KFH A;  4TUP A;  8ICP A;  4RWN A;  3RJK A;  3KHH A;  3LK9 A;  2XCA A;  3MDC A;  5CJ7 A;  1TV9 A;  1X9W A;  3Q8S B;  3L9D A;  4DQP A;  4WC4 A;  3M8S A;  4QZ8 A;  5F2V O;  4S3N A;  3C2L A;  3MR6 A;  5IIL A;  5J0U A;  3ZD8 A;  5TZV A;  4ELU A;  3GV5 B;  4KLD A;  4RQ4 A;  2ASL A;  3PR4 A;  4TUS A;  1T3N A;  2BE3 A;  1BPB A;  4RPZ A;  4KLO A;  3N97 B;  3WFS C;  5F9N A;  1ZQX A;  3Q8K A;  3AUO A;  4DL5 A;  3T5K A;  4AT9 B;  4X0A A;  5DDY A;  3JPO A;  4DSF A;  4B9M A;  5KFK A;  5L1I A;  4Q8F A;  5HRF A;  2C28 A;  5HNK A;  4PPX A;  4X4P A;  1LV5 A;  7ICJ A;  5KG4 A;  3ISB A;  5L1K A;  1D8L A;  5DQG A;  1X9S A;  3PW4 A;  8ICJ A;  9ICJ A;  4IR1 A;  5J2K A;  8ICW A;  1Q78 A;  2NRK A;  1RXV A;  2BR0 A;  3RJG A;  5DDM A;  4KLH A;  5KFB A;  1ZJM A;  2Y1I A;  1MSW D;  4RUC A;  2HVI A;  1U47 A;  4AT7 A;  2AQ0 A;  3M9N B;  5KG3 A;  2ASJ A;  2ZHB A;  3LDA A;  8ICV A;  1ZJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...