5J0YA

Binary complex crystal structure of dna polymerase beta with t:t mismatch at the primer terminus
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
330
structure length
327
Chain Sequence
b'APQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structures of DNA Polymerase Mispaired DNA Termini Transitioning to Pre-catalytic Complexes Support an Induced-Fit Fidelity Mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 108
structure length 327
sequence length 330
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5j0yA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5j0yA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5j0yA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5j0yA03
4RQ3A 2J6UA 4KLGA 9ICEA 4EYIB 4ECYA 1KLNA 8ICPA 3ISCA 3PO5A 9ICCA 1S0OA 3H37A 4IRCA 1T4GA 1WCLA 5DB7A 3ZDBA 4PHEA 5EOZA 2OWOA 4J9OA 3H4DA 4J9PA 4ED3A 8ICQA 5BOMA 2NRXA 2ZUBA 3RTVA 1MSWD 1V9PA 4QW8A 5C5JA 5CP2A 9ICQA 3TAPA 2R8IA 2ZJ5A 3V7KA 2VA8A 2A1JB 5J0OA 1XSLA 3ZDCA 4DSJA 5DB9A 3JPQA 4TUSA 2PFNA 8ICZA 4JWNA 3OVSA 3B0XA 3OHBA 1YLQA 7ICPA 2ZTDA 4ATBA 2W9CB 4WC4A 1XSPA 1MIYA 5KG1A 3ZD8A 7ICIA 2HVHA 1ZQVA 2I1QA 4NM1A 4X4PA 4UAWA 2P66A 4ED2A 4UB2A 4EEYA 2LYHA 1QLNA 4WC5A 1TK5A 4DO9A 2FLPA 8ICVA 4YVZA 5HRBA 2DRBA 2DRAA 3RB6A 4PHPA 4J9RA 3QEAZ 9ICNA 1A76A 3FDSA 4DSFA 2IMWP 5CA7A 3M8SA 4F4YA 4X5VA 3C1ZA 1ZQKA 2I9GA 2NRWA 1JIHA 5J2FA 1SL1A 3WFSC 4RZRA 2JZBA 5KT4A 4R63A 4J9NA 4FS2A 2HHWA 1NKBA 5IIKA 2HHVA 3QE9Y 2BCSA 1XS9D 4M9HA 4NLZA 3HJ1A 2R8HA 2ZH4A 4QZCA 1B22A 1N56A 1F5AA 4UB1A 4IG8A 5DKWA 4ECXA 3GQCA 1QTMA 5DB8A 5DQIA 3TARA 9ICKA 5HRIA 5KFWA 3MR6A 9ICSA 1L3VA 2HW3A 1UEUA 2DR5A 3M9NB 3PNCA 7ICNA 4FH3A 1TFWA 4I2AA 4X4QA 4X0BA 3OUYA 5KFUA 5D4BA 4WBYA 1BPBA 2KZZA 4O3PA 4X0AA 1DOQA 5KFIA 3GIJA 2RDIA 2ASJA 1KRPA 4NLNA 4O3RA 5J0YA 5KFZA 1B43A 1X9WA 1NK9A 4P4OA 3HX0A 2C22A 3UPSA 4F92B 2C2RA 2HHTA 3KHLA 2FLNA 9ICVA 4Z6DA 1SKRA 4ECSA 3RJEA 3MFIA 4KLUA 4QZBA 1UT5A 4QZFA 3TI0A 4YMOA 3TFSA 4EBKA 2KFNA 5HRDA 3WFRE 2UVRA 7ICRA 4ZH4A 4DL3A 5DG7A 5KFTA 4YXJA 3E2EA 1Q79A 1X2IA 5HR9A 4KLQA 3RBEA 2RDJA 3GV7B 1PX5A 4DSIA 2ZUCA 5KFQA 2KTQA 3T5KA 9ICTA 1RXVA 3LQCB 4J9KA 4ED1A 2PXIA 4DSEA 2P6UA 3ZD9A 4RQ7A 3HT3A 1JX4A 1BPZA 5HRGA 3JZ0A 1KFDA 3Q8QB 4RNMA 3PR5B 2ISOA 4I29A 5D46A 1SL2A 1DK2A 4ECUA 1UA1A 2PFQA 4JV1A 4NKUA 4B9TA 4EZ9A 1Q78A 2FPKA 1ZETA 2ISPA 4E8FA 4F2RA 3AQLA 5DDMA 5BOLA 1MIWA 4XA5A 4YR2A 2BE3A 2PFOA 2DFLA 4IQVA 4UAYA 2WTFA 4R8UB 4F5QA 7ICFA 3V6KA 4YR0A 2JEJA 3PV8A 2PI5A 3UQ0A 4ELTA 4E0DA 1ZQRA 2UVUA 2M2TA 9ICJA 3C23A 3TQ1A 3Q8SB 3T5JA 4F2SA 5KFGA 2PBEA 1ZQPA 5KTQA 1U49A 2HHUA 2ZHBA 2A1JA 4PHDA 3Q8RB 3T3FA 1MQ2A 2FPMA 7ICKA 4M0AA 5IINA 4KLMA 4G3IA 2BCQA 3OJSA 4NLKA 3RB4A 4Q44A 4PGXA 2W9CA 1H38A 4M9GA 2ALZA 4UD5A 3V72A 1ZQCA 2ZTCA 1ZQMA 4GXKA 1L3SA 4F50A 3PW4A 4B9LA 1TAQA 4F8RA 9ICPA 3V7JA 1S97A 3V6HA 2BCRA 7ICMA 5BPCA 4EYHB 1DK3A 1TK0A 4RNNA 1TKDA 3H7IA 1ZQDA 4LVSA 4WCWA 9ICFA 4F4XA 4C8OA 5KFVA 4JV0A 2BHNA 5KFBA 4DQSA 4RWOA 4I28A 2UVVA 2JEIA 3MABA 4ECQA 4DF8A 3OVBA 3GILA 3H8WA 4F4WA 1D9DA 4PGYA 3Q8PB 3WFOA 4DFKA 3SV4A 1KSPA 4TQRA 4TUPA 4DLEA 4I2HA 4RQ8A 4DOBA 4EBCA 3QZ8A 3BQ1A 4X4RA 5DEDA 4QZAA 7ICQA 5DECA 2ZTEA 4M9LA 4FO6A 2XO7A 1NO5A 2MUTB 2R8JA 4EZ6A 3PW0A 3ZDEA 3RH5A 2ZH1A 4RQ5A 9ICXA 4QZ9A 2XGPA 5HMLA 3PMLA 3C18A 5J2BA 4YXMA 4UBBA 5L1LA 3AU6A 3UPQA 4DS5A 3PX6A 1LV5A 5J0SA 9ICRA 5HC9A 5J2IA 2BR0A 4AT8B 4C8LA 4LZDA 1IM4A 3K4GA 3C21A 2W8KA 4YD1A 4KLTA 1L5UA 1TV9A 4F5PA 4X4VA 4F4KA 4GC6A 4M2YA 1NJWA 3MR5A 2AGOA 3SZ2A 3RRHA 4C8NA 8ICCA 5HREA 4IQUA 3ISBA 4KN4A 2KZMA 5KFRA 5KFCA 2V4RA 4M6WB 4RWPA 5DB6A 3C2MA 3OSPA 1BPEA 3EWAA 5CR0A 4F5OA 4KLIA 2AJQA 1MIVA 4RPXA 2IHNA 4KLEA 4DQQA 4FH5A 5HRKA 1COOA 1DGSA 2HHPA 2W9MA 3EW9A 1WOTA 3HP6A 1QSSA 9ICAA 7ICJA 5KT7A 3AQNA 1PZNA 4J9QA 4WC6A 3H8SA 4RQ1A 2AGPA 2W9BB 1NJXA 3M8RA 4FBUA 4F3OA 4WC0A 4X4NA 4O5KA 5L1JA 3HIYA 4DQPA 1ZQEA 8ICXA 3GFKB 4YR3A 4ECRA 9ICMA 1JMSA 8ICFA 5KFLA 1S0NA 1AROP 4KITB 5KG0A 4YD2A 2XCPA 7ICHA 4FHVA 3BQTA 4PPXA 1JXEA 1A77A 4Q45A 2R8GA 2FMSA 4ELVA 3G6VA 1TFRA 1ZJMA 4M04A 7ICOA 3FYHA 1NJZA 4BXOB 4MFAA 8ICAA 4M5DA 4QWAA 4UBCA 4GXIA 8ICBA 5EWGA 4Q8EA 2W8LA 4EBJA 2XY7A 1UEVA 2Y1IA 1NK4A 1TFYA 1ZQXA 5KT3A 8ICKA 5F9LA 5IIIA 1NK6A 1R89A 3T5HA 1BVSA 3WFPA 4DFPA 1S0MA 4I2IA 5DGAA 1BPYA 3UXOA 1UT8A 4IRKA 4IR1A 1VFGA 4R8UA 3QZ7A 4YQWA 4QWCA 3NGDA 5J2DA 5KFSA 3RH6A 4AT9B 3L9DA 3PW7A 4MFCA 2BPFA 5L1IA 1D8YA 5KFPA 4I27A 1UETA 1X9MA 4ELUA 4WC2A 5J2HA 4IQTA 2ZH8A 4O3OA 5J0QA 4IQWA 8ICTA 4EBEA 3ORYA 5J2JA 1ZQWA 3RB3A 4QZEA 1U48A 3OJUA 4QW9A 4X4OA 1WCNA 4DL4A 3MFHA 3MDAA 8ICIA 1XC9A 4RQ4A 1ZQLA 3AQMA 5J2AA 4RNOA 3RJIA 3BQ2A 3LWMA 5CHGA 4MF2A 2M2WA 5J0XA 4E7XA 4X4SA 5J2EA 4JK1A 5DLGA 3MR3A 2V4QA 3NYBA 3H39A 1U4BA 4JUZA 4BGDA 4HYKA 2ZJ8A 4P4PA 1ZQUA 5DQHA 5DBBA 5J0PA 3IM1A 5KG4A 3OSNA 2C2EA 1D9FA 5KFFA 3Q8KA 4KN7A 4IR9A 1IXRA 4P4MA 4GC7A 4BWMA 3N4MB 4DQRA 2AQ0A 9ICBA 1ZQYA 8ICJA 4RQ6A 4RWNA 2BKEA 9ICIA 2Q66A 5EWFA 3JPRA 3RJGA 4B9SA 8ICWA 4QZIA 2MUTA 2ZH9A 4YMNA 1ZQBA 3PO4A 4GXJA 3OVAA 4P2HA 4FS1A 2JEGA 4I2EA 1KFTA 4WC3A 5CWRA 4F5NA 3PX4A 3B0YA 4DLGA 2AGQA 1RYRA 1HUOA 5KFAA 4UD4A 4MEYA 4NM2A 3MR2A 3Q8LA 3THVA 3RB0A 1S9FA 3RRGA 8ICHA 1HUZA 9ICUA 3TFRA 2XY6A 7ICLA 5KFKA 4I2FA 3RH4A 4NLGA 4PGQA 4FHYA 2ZHAA 1T8EA 3GIMA 5EWEA 2FPLA 4QZGA 4O9MA 1KTQA 3MGIA 5HMMA 5KFEA 1ZQJA 4ED0A 1NK5A 3PW5A 8ICYA 4Q43A 4DL2A 1U47A 4M6WA 4F91B 1NK0A 1R8CA 4AT7B 3V7LA 4KMUA 2BGWA 4PHAA 3JPTA 1KEJA 5HRHA 1KNYA 3AU2A 3OV7A 4I2JA 4M9JA 5DG8A 2DR9A 1VJ7A 2ID1A 5KG6A 4O3QA 1T7PA 4DSLA 4EP7A 2KFZA 3SYZA 3C2KA 4M9NA 2W9BA 4JV2A 4J9MA 4F4ZA 1QSLA 3SV3A 4FBTA 1Z00B 3BDPA 4YFKA 1U9LA 5IIMA 2JEFA 4ED7A 3RJHA 1S0VA 3MGHA 4DFMA 5KFHA 1UA0A 3RJJA 4KLDA 5DGBA 5KFOA 2MAXA 1LB2B 3JYYA 4NKTA 4DL5A 7ICEA 3C5FA 2ATLA 2DVIA 4BXOA 1ZQTA 4DOCA 2J6SA 3EPGA 3GV5B 1T3NA 4DF4A 2ZH2A 7ICVA 5KT6A 4PH5A 5J2CA 1MQ3A 1V4AA 2ZH7A 2W9AA 2M2VA 3PX0A 8ICUA 5F9NA 1BGXT 3K75D 1JXLA 1ZQGA 2GWSA 4DWIA 4Q8FA 4AT9A 5KG7A 1JAJA 5JUMA 3H8JA 8ICEA 5IIJA 3KHGA 1RZTA 2VANA 5DQGA 2AQ4A 3TANA 1JQRA 1D8LA 4J9SA 4MF8A 3JPSA 5HHIA 1ZQOA 2F1JA 3OHAA 3PW2A 1HJPA 5KT2A 1KDHA 2FMQA 1R8BA 2DR8A 4I2GA 1ZYQA 4C8KA 7ICUA 4J9LA 5L9XA 4I2DA 5DBCA 4LZGA 4X4UA 1S77D 4LT6A 4DS4A 4KLFA 2M2UA 4NY8A 2ZH6A 1TVAA 3EPIA 2ZJAA 4UB3A 4DOAA 3T5LA 1L3UA 7ICTA 4M47A 2KP7A 4B9NA 4I2CA 4RQ0A 2VA2A 3LK9A 4UAZA 4R64A 1XO1A 3GIIA 3AUOA 5J0TA 8ICNA 1OU5A 2XC9A 4O0IA 2NRKA 5J2GA 7ICGA 2RFFA 4WC7A 4X4TA 5HNKA 1BPDA 9ICLA 5D49A 2IHMA 3JPOA 4MEXA 5CJ7A 4B9MA 4ECWA 3RAXA 1X9SA 5DBAA 4ED6A 2VA3A 3RJKA 2ASDA 4YMMA 3PMNA 1CEZA 5HRLA 5DDYA 4Z6FA 3H4BA 1ZQNA 4RWQA 2ZH3A 3OGUA 5IIOA 2R8KA 3G6XA 4UB5A 9ICHA 5L1KA 4DFJA 1NKCA 4E80A 3PR4A 4ECVA 2C2DA 4K4IA 3PY8A 4KLJA 3JPNA 4RT3A 2BCUA 2PFPA 2BDPA 4B9UA 4S3NA 2IBKA 4O5CA 5DLFA 1NJYA 1RXWA 1NZPA 4K4HA 2O1PA 4JWMA 3HPOA 8ICSA 2ZH5A 5HP4A 3JPPA 3GDXA 2KZ3A 3N97B 4RQ2A 1KFSA 2BCVA 5KG5A 3RAQA 4DEZA 4KTQA 1Z3EB 4AT7A 4IRDA 4DQIA 1ZQZA 4R65A 2V9WA 4UQGA 1NKEA 5J29A 1XWLA 1ZQIA 3AQKA 1NK7A 4XQ8A 1ZJNA 3HWTA 3MDCA 3UXPA 1BNOA 3ISDA 3M9OB 4YCXA 4CCHA 1R8AA 5J0UA 2XCAA 2Q0ZX 3SI8A 5KFDA 8ICOA 4ATBB 9ICOA 2BQRA 3HJ4A 1Z00A 1ZQFA 4KLLA 3PVXA 1EXNA 4F5RA 4DL7A 2H5XA 2BQ3A 3C1YA 4NXZA 5KT5A 1K1QA 3H40A 4RUAA 3TAQA 8ICLA 3C5GA 3KTQA 4K4GA 4EBDA 3BJYA 4DL6A 2P6RA 4DSKA 1MC8A 2DPIA 2HHQA 1FA0A 2UVWA 1NOMA 1K1SA 4ECTA 4QZDA 4FHXA 4Z6EA 4AT8A 2PI4A 3RR7A 3LWLA 1RYSA 2J6TA 4RU9A 3V6JA 1L3TA 4KLHA 4O3NA 3MBYA 2Y1JA 2BQUA 5DG9A 5KFXA 1XU4A 2XY5A 1BNPA 4YN4A 5J0RA 1N48A 2XGQA 3QEBZ 3ZDAA 2HHXA 4QWBA 2C28A 2ZUDA 2B21A 5KG2A 1SKSA 1ZQHA 3IHQB 1JN3A 4XRHA 4RUCA 4BDPA 2JZBB 2FMPA 4I2BA 2O5AA 4RPYA 2IA6A 3LDAA 2DPJA 3Q8MA 4ED8A 3C2LA 1ZQQA 1SKWA 4FHPA 3C66A 3HW8A 8ICRA 4GLXA 4RPZA 2KN7A 1XSNA 1C7YA 4ECZA 5TZVA 5CB1A 4BWJA 4RT2A 1RPLA 3RJFA 1QSYA 3OUYB 3EYZA 4XQ7A 9ICWA 3H3AA 4WBZA 2NRTA 2FLLA 1S10A 3GV8B 7ICSA 1SZPA 5KG3A 4QWEA 1U45A 8ICMA 4B9VA 2DR7A 2ASLA 4F93B 4KLOA 1TK8A 3ZDDA 4KLSA 3ETLA 2NRVA 2BPCA 4QZ8A 5J0WA 4QWDA 4C8MA 3BQ0A 5KFMA 1SL0A 1ZQSA 1S76D 5KFNA 5HHHA 3NTUA 5J2KA 3WFQE 4XUSA 4WC1A 3RR8A 2HVIA 1CUKA 2AU0A 1NK8A 1Y88A 4FHWA 2BPGA 4TQSA 3RBDA 4YP3A 1TAUA 8ICGA 2HHSA 4O5EA 4TUQA 3H38A 4MFFA 9ICGA 3KHHA 3GIKA 3KHRA 5KFJA 4R66A 5F2VO 2F1HA 5KFYA 4Z6CA 4YG2A 3UXNA 4QZHA 2M9NA 3M9MB 1ZQAA 4O3SA 2F1IA 1BPXA 4TURA 5IILA 2NRZA 5HRFA 4UB4A 3UQ2A 3G6YA 3EZ5A
chains in the Genus database with same CATH superfamily
4ECYA 3QU2A 1KLNA 3ZDBA 3QXGA 5EOZA 2OWOA 2Y9UA 3H4DA 1IG6A 2H3VA 2NRXA 3RTVA 4KX3A 1V9PA 2XICA 5C5JA 5CP2A 4OO1J 1ZRNA 5J0OA 5DB9A 4TUSA 3B0XA 4ATBA 7ICIA 2I1QA 2RRDA 4EEYA 1TK5A 1OUQA 1KKXA 9ICNA 2MSNA 3NUQA 3FDSA 3UM9A 4DSFA 2IMWP 5CA7A 3M8SA 4F4YA 2NRWA 1JIHA 5AI8A 4RZRA 2JZBA 2KJ9A 4NJ8A 4M9HA 2ZH4A 4QZCA 1N61A 4WQKA 2AHOB 4IG8A 5DKWA 3NVWA 5AKKA 1C20A 9ICSA 4FH3A 4X4QA 3OUYA 1BPBA 1NNLA 4X0AA 3M1YA 1B43A 3HX0A 2C22A 4U7CA 2FLNA 4Z6DA 4ECSA 5HR7A 1UT5A 4EBKA 2KFNA 1RYUA 3WFRE 2UVRA 3E2EA 5KFTA 4EEBA 2EAMA 1CRXA 5L1MA 2KTQA 3T5KA 2LYAA 9ICTA 1RXVA 3LQCB 4J9KA 1JX4A 2PXIA 2P6UA 3HT3A 2LI6A 5HRGA 1KFDA 3PR5B 4I29A 3NVOA 2F3NA 5D46A 4EEKA 3H0LB 4EZ9A 2HOFA 1Q78A 1ZETA 4F2RA 2K8CB 5DDMA 1MIWA 4XA5A 2WF6A 3CYMA 4UAYA 5AKXA 4YR0A 3WK9A 1ZQRA 4GIBA 3Q8SB 1N5XA 1ZQPA 5KTQA 2A1JA 2KK0A 4PHDA 3A0BU 5IINA 3AL0B 2BCQA 3I76A 2Y9TA 2OYYA 1ZQMA 4F50A 1TAQA 4F8RA 1SIJA 2DGZA 5AKEA 9ICFA 2EZZA 4JV0A 4DQSA 2JEIA 3MABA 4DF8A 4F4WA 3Q8PB 3SV4A 4TQRA 4AP9A 4CF3A 5DECA 2XO7A 1PVPA 2R8JA 4EZ6A 3PW0A 3RH5A 2ZH1A 4RQ5A 2XGPA 2A1AA 2WAQC 5L1LA 9ICRA 5HC9A 4DS5A 5J0SA 4KMOB 2BR0A 1IM4A 3K4GA 2ZIXA 4BUGA 4KLTA 4F5PA 4X4VA 3SZ2A 4C8NA 1RQLA 3TACB 5KFRA 5DB6A 2YMLA 3OSPA 5HR6A 5CR0A 4FH5A 4KLEA 4DQQA 1QSSA 9ICAA 5KT7A 4RQ1A 2W9BB 4F3OA 2QARA 2HCFA 3UMBA 2OH2A 4FBUA 5L1JA 8ICXA 3GFKB 1JMSA 1X6IA 7ICHA 3VCBA 4PPXA 3ER9B 2R8GA 3PHZA 4BXOB 1P7DA 2G06A 4M5DA 3MC1A 8ICBA 5ALTA 5EWGA 4Q8EA 1A0PA 1NK4A 3SENA 1ZQXA 5KT3A 1TFYA 3T5HA 2A19A 4DFPA 3CP8A 1S0MA 1UT8A 1Z4NA 3BZKA 4R8UA 3QZ7A 3NGDA 5J2DA 5KFSA 3L9DA 4MFCA 1JUDA 5L1IA 1D8YA 1T3QA 1X66A 3PSPA 2JGAA 1QQ6A 8ICTA 4EBEA 1ZQWA 3TADA 3PSIA 3PSTA 3MFHA 2EZXA 1ZQLA 3AQMA 4RNOA 5CHGA 5J0XA 4E7XA 2HMXA 5DLGA 2V4QA 4JUZA 4HYKA 2ZJ8A 1ZQUA 2WF8A 1D9FA 5ALLA 1IXRA 1ZQYA 3QNMA 2W54A 5AM5A 4NLCA 3RJGA 2YQEA 4QIWF 1OW5A 3HJEA 4DLGA 2NV3A 1HUOA 1HUZA 4NLGA 4PGQA 4FHYA 2FPLA 4O9MA 1KTQA 2EAOA 5AM3A 4Y2XA 1NK5A 5HRHA 1KEJA 1RM6C 4I2JA 3OTQA 5G5GA 4DSLA 2KFZA 3ED5A 5AM0A 4F4ZA 1QSLA 1Z00B 4EGWA 5IIMA 2JEFA 2GAFD 1UA0A 3RJJA 2EANA 2ESEA 5DGBA 4DL5A 2ATLA 2DVIA 1A6SA 2J6SA 2GA9D 3EPGA 5B3QA 4FFDA 4EX7A 2ZH7A 2I6XA 2KSOB 5F9NA 3K75D 3OWGA 4IC9A 4DWIA 5AKYA 4I0UA 3H0RB 4JLXA 3H8JA 3EUB2 5IIJA 1RZTA 2H3IA 3JPSA 5ALXA 1LKYB 4RQMA 1KDHA 4C8KA 5L9XA 4LZGA 1S77D 4LT6A 3TADC 2W3RA 2M2UA 3AQLA 5CFTA 4UATA 4DFDA 2VA2A 4UAZA 4R64A 3AUOA 4O69A 4O0IA 3M6KA 7ICGA 9ICLA 2KG5A 3IG8A 5DBAA 4ED6A 4C4TA 5T14A 2ZIUA 2ZH3A 4Z6FA 1ZQNA 1NKCA 1JRPA 2RHFA 2C2DA 3PY8A 4KLJA 4RT3A 3FAHA 2BCUA 4O67A 4S3NA 4O5CA 5DLFA 1RXWA 3DDHA 2DBYA 2O1PA 1V85A 2ZH5A 3N97B 4RQ2A 3RAQA 1N2XA 5H2FU 1Z3EB 4ICAA 2OEHA 4AT7A 4IRDA 2XIDA 5J29A 1NK7A 1ZJNA 3HWTA 1QQ7A 3M9OB 2XCAA 1Z1BA 3SI8A 8ICOA 4ATBB 3EF2A 5AK5A 2O6KA 4F5RA 1EXNA 5ALHA 4NXZA 1MIVA 3SAHA 3TAQA 3C5GA 2UVWA 3OPXA 2PI4A 4RU9A 1L6NA 2Y1JA 1BNPA 4K9BA 2E8OA 4YN4A 3QEBZ 5KG2A 3DEEA 2N1RA 2JZBB 2FMPA 2Q4TA 2HBLA 2IA6A 1NI3A 4Y2SA 3Q8MA 2E8MA 1SKWA 3HW8A 2KNJA 5TZVA 1ZXIA 5CB1A 5AM1A 4RT2A 1QSYA 3OUYB 3D2SA 3WKDA 3MCRA 3GV8B 8ICMA 3DV9A 4KLOA 2CXYA 1TK8A 2BPCA 5AKZA 4QZ8A 1ZQSA 1SL0A 5KFMA 2MU2A 1S76D 5HHHA 4OJLA 3H0MB 3CW2C 1CUKA 1L7OA 2W11A 4O5EA 4WH5A 5KAFU 3KHRA 4R66A 2IHOA 4YG2A 1JALA 4O3SA 4CGZA 3UQ2A 2YB1A 3AQNA 3QU7A 2G5IB 1SZHA 3ISCA 3PO5A 9ICCA 1S0OA 3H37A 1T4GA 4QNLA 4PHEA 1Q3UA 4J9PA 4NXTA 3HILA 2JMGA 3IDWA 9ICQA 3TAPA 2R8IA 2ZJ5A 3V7KA 3ZDCA 2A1JB 4JWNA 4WC4A 5KG1A 4CDGA 3WK6A 2HVHA 4NM1A 3NVVA 4UAWA 4UB2A 2LYHA 2KHVA 5HRBA 1SWVA 8ICVA 3WK8A 2HI0A 2DRBA 5G5HA 4J9RA 1COKA 3SR6A 4OAGA 1ZQKA 3C1ZA 5EE1A 1SL1A 1N5WA 4FS2A 2HHWA 2LM1A 2HHVA 3E0FA 1XS9D 4NLZA 2FCLA 2YMMA 3GQCA 1QTMA 5DB8A 2OM6A 5DQIA 3TARA 9ICKA 3ERCC 5HRIA 7ICNA 2B4VA 1FFVA 4I2AA 4OJOA 2ZIXB 2LBOA 4WBYA 4O3PA 4AYBC 4NLNA 4O3RA 5J0YA 5KFZA 1X9WA 4F92B 3KHLA 4KLUA 2KMDA 3MFIA 2WF9A 3TFSA 2QARB 2MRLA 7ICRA 1T94A 4YXJA 1X2IA 1PVRA 2GH1A 1PK1A 3QUQA 2ZUCA 5KFQA 4ED1A 3ZD9A 4RNMA 1DK2A 5KNIA 1UA1A 2PFQA 4NKUA 2FPKA 5BOLA 2Y0SC 4YR2A 4AYBF 4IQVA 2WTFA 4R8UB 3V6KA 4E0DA 3PV8A 2UVUA 2M2TA 3C23A 3HKZC 3TQ1A 4F2SA 3ZI4A 2BBJA 2ZHBA 3D2QA 5AKJA 2ZXIA 4KLMA 3RB4A 4Q44A 1H38A 1UPHA 4M9GA 4B9LA 4GXKA 1L3SA 9ICPA 7ICMA 3V6HA 3JZ0A 4EYHB 1TK0A 4WCWA 4F4XA 4PZNA 2UVVA 3OVBA 3GILA 1S5LU 3PZPA 1KSPA 4KB6A 3O0FA 2YN4A 2ZTEA 4M9LA 4FO6A 3ZDEA 2XI9A 3JCFA 5HMLA 3C18A 5J2BA 4YXMA 3LYSA 1LV5A 3N28A 1Z4OA 5J2IA 1XO0A 2WB1C 4YD1A 1TV9A 4M2YA 1NJWA 2AGOA 4HAIA 3RRHA 2BZFA 8ICCA 4IQUA 4LEWA 4KN4A 2KZMA 5KFCA 3BS5A 4RWPA 3EWAA 1COOA 1SWWA 2DQNB 7ICJA 4J9QA 2AGPA 4X4NA 2G0AA 1ZRMA 1JI7A 4YR3A 8ICFA 5KFLA 4EV6A 1AROP 5KG0A 2XCPA 4FHVA 1WUDA 5AI4A 2VJ5A 1A77A 4Q45A 1CI4A 3G6VA 2B56A 1PK3A 1ZJMA 4M04A 8ICAA 4UBCA 4EBJA 1R89A 8ICKA 3F53A 1NK6A 4UARA 3NRWA 5DGAA 4OD0A 2LMRA 4IR1A 4NXXA 2A3VA 3PW7A 3M6ZA 1UETA 1IV8A 2E5SA 3ORYA 4Y2JA 3IRUA 4QW9A 3D6JA 2K8BB 1KQQA 5K4LA 2M2WA 3MR3A 1SXEA 3OSNA 5J0PA 3IM1A 2E1FA 2K4HA 3ALRA 4IR9A 5ALPA 3Q8KA 2YMQA 4P4MA 5JRTA 2YTUA 2NO4A 2ZIUB 2JRZA 2WHEA 4QZIA 5B5EU 2KVSA 4YMNA 3PO4A 4GXJA 3OVAA 4P2HA 4WC3A 2JEGA 1KFTA 2CN1A 5CWRA 2KIWA 4F5NA 4AT8A 3Q8LA 1S9FA 4IS7A 9ICUA 5KFKA 2ZHAA 4QZGA 5HMMA 1ZQJA 3L3FX 2JV3A 1U47A 4M6WA 4AT7B 3V7LA 3OV7A 4BX9C 4M9JA 5JU5A 2JHDA 2DR9A 2HBJA 3K1RB 2ID1A 5KG6A 1T7PA 4M9NA 4JV2A 4J9MA 2YB4A 4FBTA 1U9LA 5B66U 4ED7A 2B51A 3MGHA 5KFOA 4NKTA 4UB6U 3C5FA 1Q3VA 1ZQTA 2ZH2A 3I1YA 5J2CA 4K96A 1MQ3A 1LVHA 4NWIA 2BDUA 2G07A 1ZQGA 2GWSA 4Q8FA 4PL2A 4AT9A 1JAJA 5JUMA 8ICEA 3KHGA 2MA1A 1D8LA 4J9SA 1ZQOA 2F1JA 1R8BA 1V38A 4DOAA 1L3UA 1FEZA 4B9NA 4UAUA 2AXTU 3GIIA 1XO1A 5J0TA 2XC9A 1IIPA 2RFFA 2DUYA 5HNKA 2WAQF 1DGJA 1HIWA 2CRXA 3GU3A 5CJ7A 4B9MA 4ECWA 5HRLA 1L7PA 5DDYA 3H4BA 3OGUA 5ALWA 2KIVA 4UB5A 4DFJA 4FZNA 3PR4A 4B9UA 1S8OA 3F2BA 1FFUA 4K4HA 3FM9A 3JPPA 2KZ3A 1KFSA 2HOIA 2KV2A 4DEZA 1Q46A 1ZQZA 4UQGA 3WK5A 1NKEA 1ZQIA 2KD1A 3F5EA 1ECWA 4CCHA 4OAHA 9ICOA 2BQRA 3HJ4A 1ZQFA 4KLLA 2H3ZA 4Y2QA 1MN8A 1F5SA 4DL7A 2H5XA 1Z19A 3C1YA 5KT5A 3QYPA 3H40A 1PVQA 4RUAA 8ICLA 2HHQA 1MC8A 1NOMA 3RR7A 3LWLA 2J6TA 3V6JA 1L3TA 4KLHA 5ALEA 2BQUA 5KFXA 1RQNA 2C28A 2B21A 5D62A 1ZQHA 3IHQB 2O5AA 3C2LA 4FHPA 4K98A 4BWJA 2FJ6A 3EYZA 4XQ7A 3N7PD 2NRTA 3AMZA 4WQLA 1SXDA 2DR7A 3IP4B 2ASLA 3S6JA 1WYGA 1J97A 4QWDA 3UMGA 2E8PA 2LKYA 3RF9A 2P35A 5ALVA 4LEYA 4WC1A 2HVIA 2AU0A 4G9BA 4FHWA 2BPGA 1PK1B 8ICGA 4TUQA 4CNQA 3GIKA 5KFJA 3M9MB 4QZHA 1ZD3A 1BPXA 4TURA 4UB4A 3G6YA 2J6UA 1URJA 4OCZA 3K1ZA 1WCLA 3RFAA 2EZYA 4ACOA 4ED3A 8ICQA 1YZ6A 5AI6A 5A0LA 1XSLA 2ES6A 2E8NA 4DSJA 3JPQA 2F2AB 2ZG6A 2PFNA 8ICZA 3OHBA 1YLQA 3N7SC 2ZTDA 1MIYA 2QB0A 3ZD8A 4OAFA 4EELA 4X4PA 2P66A 3NKUA 1QLNA 2FLPA 5JTGA 4YVZA 2CPRA 1PUZA 5ALSA 4X5VA 4C80A 3WFSC 2RQ5A 3SAGA 4R63A 4J9NA 3HJ1A 2R8HA 1KL9A 1N56A 3UMCA 1F5AA 1MA7A 3BQ7A 1L3VA 2HW3A 1UEUA 2BBHA 3M9NB 3PNCA 5KFUA 2KZZA 3GZFA 1DOQA 5KFIA 3GIJA 4WOYA 1NK9A 4P4OA 3BS5B 3M7DA 3UPSA 2C2RA 2HHTA 3RJEA 4QZBA 3TI0A 4YMOA 5HRDA 4ZH4A 4DL3A 5DG7A 4KLQA 3RBEA 1FIQA 4CRXA 2W04A 2RDJA 1PX5A 4DSIA 3CRXA 4US8A 3NWIA 1SGGA 1R8CA 1J2MA 4EX6A 2W03A 4RQ7A 5ALKA 3Q8QB 2ISOA 5B3PA 1X9XA 1SL2A 1ZD4A 4ECUA 4JV1A 1WWUA 4B9TA 2ISPA 1N62A 4F5QA 4ELTA 4IL6U 2JEJA 3UQ0A 2ODGA 9ICJA 1JROA 2YY6A 2OCEA 5KFGA 2PBEA 4K99A 1U49A 2HHUA 2HOQA 1MQ2A 2FPMA 3BZCA 4G3IA 3OJSA 4UD5A 4PGXA 2W9CA 2ALZA 1L8LA 3V72A 1ZQCA 2ZTCA 1X6JA 1S97A 2BCRA 1DK3A 2JH7A 4RNNA 1TKDA 3H7IA 1ZQDA 2KE7A 4LVSA 3E58A 5KFVA 2BHNA 4RWOA 4I28A 4ECQA 3QUCA 3WFOA 3H8WA 4PGYA 2M0NA 4Y2YA 3KZIU 4I2HA 4DOBA 4EBCA 3QZ8A 4FE3A 3BQ1A 2D6FC 5DEDA 2KEYA 2B0CA 3PMLA 3KOOA 3AU6A 3UPQA 4P0PA 4K8VA 4AT8B 2W8KA 3C21A 2VKQA 1L5UA 3SMVA 2F8LA 5HREA 4O6AA 2K4PA 2V4RA 4M6WB 2AJQA 3ONNA 4RPXA 2IHNA 5HRKA 1DGSA 2HHPA 2KKPA 2W9MA 3EW9A 3HP6A 1PZNA 3ETRA 3H8SA 4Y2RA 4A8EA 1NJXA 4WC0A 3L4PA 3HIYA 4DQPA 4JLZA 3SQIA 1S0NA 4YD2A 4KITB 5ALNA 2YMPA 3BQTA 5EE3A 4ELVA 2WFAA 7ICOA 2LHTA 2E1EA 4MFAA 4QWAA 1GO3F 2W8LA 1F44A 3NVYA 2XY7A 5FP0A 5F9LA 5IIIA 5KL1B 2PMZC 3WFPA 2JR5A 4I2IA 1BPYA 3NS1A 3UXOA 2IOHA 4YQWA 4QWCA 4AT9B 3RH6A 2BPFA 5KFPA 4I27A 1X9MA 2AH5A 2VJ4A 4BJQA 5J2HA 4IQTA 3F2CA 4O3OA 2YX8A 3NVZA 4UAVA 2FDRA 1U48A 3OJUA 4JMUA 4UW9A 1ED1A 8ICIA 1XC9A 3BQ2A 4MF2A 1Q8KA 4X4SA 5J2EA 4JK1A 1U4BA 3WKAA 1YT3A 4P4PA 5DQHA 2C2EA 4KM5A 1UHUA 3N4MB 4GC7A 4DQRA 9ICBA 4N7RA 4PJ0U 2W43A 4B9SA 2LM4A 5AICA 8ICWA 2MUTA 5AK4A 2ZH9A 1K5OA 1ZQBA 3B9JA 4PL1A 3PX4A 4UD4A 4MEYA 3MR2A 3THVA 3AN1A 2W7PA 3TFRA 2XY6A 1XNSA 3CNHA 3RH4A 1NZBA 5F3XB 5EWEA 5KFEA 4NXVA 4Q43A 1NK0A 4F91B 1ZQ1C 4KMUA 1KNYA 3AU2A 3NRZA 1VJ7A 3F5AA 3KZXA 3C2KA 1VDVA 5ALRA 1UQVA 1DRGA 3SV3A 4FZMA 3BDPA 3AQFA 1S0VA 1M6YA 3NASA 2Y0SF 5KFHA 3JYYA 1LB2B 2MAXA 7ICEA 1YZ7A 4EENA 4QJFB 4USAA 2K4EA 3HKZF 3QU5A 1WWVA 1T3NA 4DF4A 5AKGA 7ICVA 5KT6A 4PH5A 1V4AA 2K89A 2HBKA 1BGXT 1JXLA 5KG7A 4US9A 5DQGA 3IG5A 3TANA 2DKXA 3OHAA 3PW2A 1HJPA 5KT2A 2QB1A 1RDFA 4J9LA 4I2DA 5DBCA 2NO5A 3CK6A 2F77X 1TVAA 3KFUF 2KP7A 4UB3A 3T5LA 7ICTA 4M47A 4I2CA 5CHEA 1SV0A 5J2GA 4KX5A 4K97A 3JPOA 4MEXA 5AM2A 3RAXA 2WB1F 2ASDA 4YMMA 3PMNA 2KJ8A 3FC4A 3G6XA 5AHXA 5L1KA 1DXSA 3JPNA 1SV4A 2PFPA 2BDPA 2EAPA 2W55A 1NJYA 1NZPA 5CFUA 4MKPA 5AIAA 2BCVA 5KG5A 2DL0A 4UASA 4R65A 2V9WA 1XWLA 2K4IA 4XQ8A 3AQEA 3MDCA 1BNOA 3QU4A 2W7OA 5GTIU 5KFDA 4LEZA 3TKAA 2IOFK 2QB0B 2BQ3A 5HR9A 3KTQA 4K4GA 4DL6A 3BJYA 2P6RA 4DSKA 4LEVA 2DPIA 2ZIWA 1K1SA 4FHXA 4Z6EA 3MGVA 1RYSA 2H3FA 5DG9A 1XU4A 2XY5A 1UCVA 1N48A 2HHXA 1VFGA 3ZDAA 2ZUDA 1SKSA 4BDPA 3HRDD 1JN3A 4NLBA 4I2BA 3IV6A 5ALJA 3WKCA 2ZIVA 4OJ6A 1ZQQA 1N63A 2ZXHA 5ALYA 2KN7A 3N7RC 5ALMA 3RJFA 4Y2VA 5CEHA 1VJ5A 4WBZA 3AEVA 2FLLA 1S10A 1SZPA 4QWEA 3BS7A 4F93B 3ZDDA 4KLSA 3ETLA 2NRVA 3BQ0A 4CE6A 5KFNA 1SV0C 5ALZA 4XUSA 2EWRA 2R18A 4YP3A 4MFFA 3KHHA 3R9KA 5F2VO 2F1HA 3UXNA 4Z6CA 1ZQAA 5ALUA 1D8BA 2M9NA 2F1IA 3EZ5A 4RQ3A 5C0YA 4KLGA 9ICEA 2E3TA 5AM4A 4EYIB 8ICPA 4IRCA 1HEKA 5DB7A 5D61A 5EE0A 5AIBA 4Y2UA 4J9OA 5ALGA 5BOMA 2ZUBA 1MSWD 4P0QA 4QW8A 2VA8A 1SB3C 3OVSA 7ICPA 2W9CB 1XSPA 5ALOA 1ZQVA 4MHVA 4ED2A 4WC5A 3IN5A 4DO9A 1ZD2P 2DRAA 3RB6A 4PHPA 3QEAZ 1A76A 2I9GA 2HN1A 5J2FA 2DF4B 5KT4A 1NKBA 5IIKA 3QE9Y 2BCSA 1B22A 3F2DA 4XJEA 4UB1A 4ECXA 5KFWA 3MR6A 2DR5A 4P0PB 2W3SA 1TFWA 4X0BA 3K7DA 5D4BA 3J81j 4QIWC 2XVTA 2G08A 2RDIA 2ASJA 1KRPA 4J03A 1QH9A 4CF4A 4PZOA 9ICVA 4CF5A 1SKRA 2D3DA 5GTHU 4QZFA 1L8OA 3WKBA 5ALQA 5KL8B 1Q79A 4NXUA 3GV7B 2EDUA 5CRXA 4DSEA 1BPZA 5E79U 1AQ6A 4E8FA 1WG8A 1O08A 2BE3A 2PFOA 2DFLA 7ICFA 9ICMA 2PI5A 2DKZA 3T5JA 2LYBA 3LVVA 3Q8RB 3T3FA 7ICKA 4M0AA 4NLKA 1O03A 4LJXA 3PW4A 3V7JA 5BPCA 2F76X 4F72A 3SD7A 4C0ZA 2Z7JA 4C7YA 4C8OA 5ALIA 5KFBA 1VLBA 4FZLA 1D9DA 2GOLA 4DFKA 4O3MA 4U6PA 4TUPA 4DLEA 4RQ8A 4X4RA 4QZAA 7ICQA 1NO5A 2MUTB 3U26A 9ICXA 4QZ9A 2KOBA 2HN2A 4UBBA 3PX6A 4C8LA 3KKAA 4LZDA 4OJPA 3KD3A 4F4KA 4GC6A 3MR5A 5D63A 2QLTA 2OXOA 3ISBA 3C2MA 4KLIA 1BPEA 4F5OA 3QU9A 1WOTA 4WC6A 3QX7A 3M8RA 4O5KA 1ZOLA 4K9AA 1ZQEA 4ECRA 1GPJA 2HDOA 1KW4A 2DWQA 1JXEA 2FMSA 3WU2U 3SEIA 1TFRA 3FYHA 1NJZA 4Y2TA 3H8MA 4GXIA 1QQ5A 2EH9A 1UEVA 2Y1IA 3VC8A 3WKEA 3QUTA 1BVSA 2JXJA 2HSZA 4RQNA 5AI9A 4IRKA 5KAIU 3KBBA 4ELUA 4WC2A 5ALDA 2ZH8A 5J0QA 4IQWA 1V97A 5J2JA 3RB3A 4QZEA 4X4OA 1F0MA 1WCNA 4DL4A 3AM9A 3MDAA 4RQ4A 5J2AA 3RJIA 1TE2A 3LWMA 3NYBA 3H39A 1X40A 4NL9A 1Z1VA 4BGDA 5DBBA 5KG4A 5KFFA 4KN7A 2KICA 4BWMA 5EE9A 2AQ0A 8ICJA 4RQ6A 4RWNA 2BKEA 2RLTA 9ICIA 2Q66A 2L5YA 2OHFA 5EWFA 3JPRA 2F44A 4FS1A 4I2EA 3PSFA 1RYRA 3B0YA 2AGQA 5KFAA 4NM2A 3RB0A 8ICHA 3RRGA 7ICLA 4I2FA 2H3QA 1T8EA 3GIMA 3KKAC 3MGIA 2RP5A 4ED0A 3PW5A 8ICYA 4DL2A 5AKIA 2BGWA 4PHAA 3JPTA 5DG8A 3I28A 4O3QA 4EP7A 2B6GA 3QUBA 3SYZA 2KVCA 2W9BA 5ALFA 4YFKA 2D8CA 3RJHA 2QKQA 4DFMA 4E80A 4KLDA 2NYVA 2ZIWB 4BXOA 4DOCA 3GV5B 3ICXA 5CFSA 2FI1A 2IOFA 2W9AA 5AK3A 2M2VA 3PX0A 8ICUA 4F71A 4C4SA 2ZIVB 3LVWA 3C28A 1X42A 2VANA 5J8YA 2AQ4A 1JQRA 4MF8A 4NV0A 4ZOHC 5HHIA 2JH1A 2FMQA 4EEDA 2DR8A 4DCCA 4I2GA 1ZYQA 7ICUA 4X4UA 4DS4A 4KLFA 4HX0A 4NY8A 2ZH6A 3EPIA 2ZJAA 5AKHA 1FO4A 2G5HB 2K8AA 2PKEA 3WK7A 4RQ0A 3LK9A 5JTIA 8ICNA 2NRKA 1OU5A 3D2NA 4X4TA 2LPEA 5AK6A 1BPDA 2GLEA 4NL9C 2GO7A 5D49A 2IHMA 2EQYA 1X9SA 2WF7A 2VA3A 3RJKA 1CEZA 4RWQA 5IIOA 2R8KA 4B6JA 9ICHA 3SAFA 4ECVA 4K4IA 1L7MA 1TAMA 2IBKA 4JWMA 3HPOA 8ICSA 5HP4A 3GDXA 1QCKA 2KKVA 3WK4A 1KN5A 2G09A 4KTQA 4OAIZ 4DQIA 5TISU 4P0QB 3AQKA 3UXPA 3ISDA 4YCXA 1R8AA 5J0UA 2Q0ZX 4GFJA 1N60A 5AI0A 1Z00A 4UB8U 3PVXA 1B4FA 2PMZF 1K1QA 1OXJA 4EBDA 1FA0A 2F8KA 4ECTA 4QZDA 2FE9A 2K60A 5AKLA 2KJ5A 4WJ3B 3L5KA 4O3NA 3MBYA 4WC7A 5J0RA 2XGQA 4QWBA 2KSOA 4XRHA 4RUCA 4Y2PA 4RPYA 1J2NA 3LDAA 2DPJA 4FO1A 2WF5A 2I5HA 3C29A 4ED8A 2IUBA 4JB3A 3C66A 8ICRA 4GLXA 4RPZA 1XSNA 1C7YA 3T79A 4ECZA 1LKYA 3A0HU 4OJ5A 4NXWA 1RPLA 5J8YC 2HBMA 4C7ZA 2VIXA 9ICWA 1RG6A 3H3AA 7ICSA 5KG3A 1U45A 5AI5A 4B9VA 1KBUA 5J0WA 1B0XA 4C8MA 4C4RA 3NTUA 5J2KA 3WFQE 1L7NA 3RR8A 2KHQA 1NK8A 1Y88A 4TQSA 3RBDA 1TAUA 2HHSA 3H38A 9ICGA 4O68A 5KFYA 3ER8C 5HRFA 1ZD5A 2NRZA 5IILA
chains in the Genus database with same CATH topology
4RQ3A 2J6UA 4KLGA 9ICEA 4EYIB 4ECYA 1KLNA 8ICPA 3ISCA 3PO5A 9ICCA 1S0OA 3H37A 4IRCA 1T4GA 1WCLA 5DB7A 3ZDBA 4PHEA 5EOZA 2OWOA 4J9OA 3H4DA 4J9PA 4ED3A 8ICQA 5BOMA 2NRXA 2ZUBA 3RTVA 1MSWD 1V9PA 4QW8A 5C5JA 5CP2A 9ICQA 3TAPA 2R8IA 2ZJ5A 3V7KA 2VA8A 2A1JB 5J0OA 1XSLA 3ZDCA 4DSJA 5DB9A 3JPQA 4TUSA 2PFNA 8ICZA 4JWNA 3OVSA 3B0XA 3OHBA 1YLQA 7ICPA 2ZTDA 4ATBA 2W9CB 4WC4A 1XSPA 1MIYA 5KG1A 3ZD8A 7ICIA 2HVHA 1ZQVA 2I1QA 4NM1A 4X4PA 4UAWA 2P66A 4ED2A 4UB2A 4EEYA 2LYHA 1QLNA 4WC5A 1TK5A 4DO9A 2FLPA 8ICVA 4YVZA 5HRBA 2DRBA 2DRAA 3RB6A 4PHPA 4J9RA 3QEAZ 9ICNA 1A76A 3FDSA 4DSFA 2IMWP 5CA7A 3M8SA 4F4YA 4X5VA 3C1ZA 1ZQKA 2I9GA 2NRWA 1JIHA 5J2FA 1SL1A 3WFSC 4RZRA 2JZBA 5KT4A 4R63A 4J9NA 4FS2A 2HHWA 1NKBA 5IIKA 2HHVA 3QE9Y 2BCSA 1XS9D 4M9HA 4NLZA 3HJ1A 2R8HA 2ZH4A 4QZCA 1B22A 1N56A 1F5AA 4UB1A 4IG8A 5DKWA 4ECXA 3GQCA 1QTMA 5DB8A 5DQIA 3TARA 9ICKA 5HRIA 5KFWA 3MR6A 9ICSA 1L3VA 2HW3A 1UEUA 2DR5A 3M9NB 3PNCA 7ICNA 4FH3A 1TFWA 4I2AA 4X4QA 4X0BA 3OUYA 5KFUA 5D4BA 4WBYA 1BPBA 2KZZA 4O3PA 4X0AA 1DOQA 5KFIA 3GIJA 2RDIA 2ASJA 1KRPA 4NLNA 4O3RA 5J0YA 5KFZA 1B43A 1X9WA 1NK9A 4P4OA 3HX0A 2C22A 3UPSA 4F92B 2C2RA 2HHTA 3KHLA 2FLNA 9ICVA 4Z6DA 1SKRA 4ECSA 3RJEA 3MFIA 4KLUA 4QZBA 1UT5A 4QZFA 3TI0A 4YMOA 3TFSA 4EBKA 2KFNA 5HRDA 3WFRE 2UVRA 7ICRA 4ZH4A 4DL3A 5DG7A 5KFTA 4YXJA 3E2EA 1Q79A 1X2IA 5HR9A 4KLQA 3RBEA 2RDJA 3GV7B 1PX5A 4DSIA 2ZUCA 5KFQA 2KTQA 3T5KA 9ICTA 1RXVA 3LQCB 4J9KA 4ED1A 2PXIA 4DSEA 2P6UA 3ZD9A 4RQ7A 3HT3A 1JX4A 1BPZA 5HRGA 3JZ0A 1KFDA 3Q8QB 4RNMA 3PR5B 2ISOA 4I29A 5D46A 1SL2A 1DK2A 4ECUA 1UA1A 2PFQA 4JV1A 4NKUA 4B9TA 4EZ9A 1Q78A 2FPKA 1ZETA 2ISPA 4E8FA 4F2RA 3AQLA 5DDMA 5BOLA 1MIWA 4XA5A 4YR2A 2BE3A 2PFOA 2DFLA 4IQVA 4UAYA 2WTFA 4R8UB 4F5QA 7ICFA 3V6KA 4YR0A 2JEJA 3PV8A 2PI5A 3UQ0A 4ELTA 4E0DA 1ZQRA 2UVUA 2M2TA 9ICJA 3C23A 3TQ1A 3Q8SB 3T5JA 4F2SA 5KFGA 2PBEA 1ZQPA 5KTQA 1U49A 2HHUA 2ZHBA 2A1JA 4PHDA 3Q8RB 3T3FA 1MQ2A 2FPMA 7ICKA 4M0AA 5IINA 4KLMA 4G3IA 2BCQA 3OJSA 4NLKA 3RB4A 4Q44A 4PGXA 2W9CA 1H38A 4M9GA 2ALZA 4UD5A 3V72A 1ZQCA 2ZTCA 1ZQMA 4GXKA 1L3SA 4F50A 3PW4A 4B9LA 1TAQA 4F8RA 9ICPA 3V7JA 1S97A 3V6HA 2BCRA 7ICMA 5BPCA 4EYHB 1DK3A 1TK0A 4RNNA 1TKDA 3H7IA 1ZQDA 4LVSA 4WCWA 9ICFA 4F4XA 4C8OA 5KFVA 4JV0A 2BHNA 5KFBA 4DQSA 4RWOA 4I28A 2UVVA 2JEIA 3MABA 4ECQA 4DF8A 3OVBA 3GILA 3H8WA 4F4WA 1D9DA 4PGYA 3Q8PB 3WFOA 4DFKA 3SV4A 1KSPA 4TQRA 4TUPA 4DLEA 4I2HA 4RQ8A 4DOBA 4EBCA 3QZ8A 3BQ1A 4X4RA 5DEDA 4QZAA 7ICQA 5DECA 2ZTEA 4M9LA 4FO6A 2XO7A 1NO5A 2MUTB 2R8JA 4EZ6A 3PW0A 3ZDEA 3RH5A 2ZH1A 4RQ5A 9ICXA 4QZ9A 2XGPA 5HMLA 3PMLA 3C18A 5J2BA 4YXMA 4UBBA 5L1LA 3AU6A 3UPQA 4DS5A 3PX6A 1LV5A 5J0SA 9ICRA 5HC9A 5J2IA 2BR0A 4AT8B 4C8LA 4LZDA 1IM4A 3K4GA 3C21A 2W8KA 4YD1A 4KLTA 1L5UA 1TV9A 4F5PA 4X4VA 4F4KA 4GC6A 4M2YA 1NJWA 3MR5A 2AGOA 3SZ2A 3RRHA 4C8NA 8ICCA 5HREA 4IQUA 3ISBA 4KN4A 2KZMA 5KFRA 5KFCA 2V4RA 4M6WB 4RWPA 5DB6A 3C2MA 3OSPA 1BPEA 3EWAA 5CR0A 4F5OA 4KLIA 2AJQA 1MIVA 4RPXA 2IHNA 4KLEA 4DQQA 4FH5A 5HRKA 1COOA 1DGSA 2HHPA 2W9MA 3EW9A 1WOTA 3HP6A 1QSSA 9ICAA 7ICJA 5KT7A 3AQNA 1PZNA 4J9QA 4WC6A 3H8SA 4RQ1A 2AGPA 2W9BB 1NJXA 3M8RA 4FBUA 4F3OA 4WC0A 4X4NA 4O5KA 5L1JA 3HIYA 4DQPA 1ZQEA 8ICXA 3GFKB 4YR3A 4ECRA 9ICMA 1JMSA 8ICFA 5KFLA 1S0NA 1AROP 4KITB 5KG0A 4YD2A 2XCPA 7ICHA 4FHVA 3BQTA 4PPXA 1JXEA 1A77A 4Q45A 2R8GA 2FMSA 4ELVA 3G6VA 1TFRA 1ZJMA 4M04A 7ICOA 3FYHA 1NJZA 4BXOB 4MFAA 8ICAA 4M5DA 4QWAA 4UBCA 4GXIA 8ICBA 5EWGA 4Q8EA 2W8LA 4EBJA 2XY7A 1UEVA 2Y1IA 1NK4A 1TFYA 1ZQXA 5KT3A 8ICKA 5F9LA 5IIIA 1NK6A 1R89A 3T5HA 1BVSA 3WFPA 4DFPA 1S0MA 4I2IA 5DGAA 1BPYA 3UXOA 1UT8A 4IRKA 4IR1A 1VFGA 4R8UA 3QZ7A 4YQWA 4QWCA 3NGDA 5J2DA 5KFSA 3RH6A 4AT9B 3L9DA 3PW7A 4MFCA 2BPFA 5L1IA 1D8YA 5KFPA 4I27A 1UETA 1X9MA 4ELUA 4WC2A 5J2HA 4IQTA 2ZH8A 4O3OA 5J0QA 4IQWA 8ICTA 4EBEA 3ORYA 5J2JA 1ZQWA 3RB3A 4QZEA 1U48A 3OJUA 4QW9A 4X4OA 1WCNA 4DL4A 3MFHA 3MDAA 8ICIA 1XC9A 4RQ4A 1ZQLA 3AQMA 5J2AA 4RNOA 3RJIA 3BQ2A 3LWMA 5CHGA 4MF2A 2M2WA 5J0XA 4E7XA 4X4SA 5J2EA 4JK1A 5DLGA 3MR3A 2V4QA 3NYBA 3H39A 1U4BA 4JUZA 4BGDA 4HYKA 2ZJ8A 4P4PA 1ZQUA 5DQHA 5DBBA 5J0PA 3IM1A 5KG4A 3OSNA 2C2EA 1D9FA 5KFFA 3Q8KA 4KN7A 4IR9A 1IXRA 4P4MA 4GC7A 4BWMA 3N4MB 4DQRA 2AQ0A 9ICBA 1ZQYA 8ICJA 4RQ6A 4RWNA 2BKEA 9ICIA 2Q66A 5EWFA 3JPRA 3RJGA 4B9SA 8ICWA 4QZIA 2MUTA 2ZH9A 4YMNA 1ZQBA 3PO4A 4GXJA 3OVAA 4P2HA 4FS1A 2JEGA 4I2EA 1KFTA 4WC3A 5CWRA 4F5NA 3PX4A 3B0YA 4DLGA 2AGQA 1RYRA 1HUOA 5KFAA 4UD4A 4MEYA 4NM2A 3MR2A 3Q8LA 3THVA 3RB0A 1S9FA 3RRGA 8ICHA 1HUZA 9ICUA 3TFRA 2XY6A 7ICLA 5KFKA 4I2FA 3RH4A 4NLGA 4PGQA 4FHYA 2ZHAA 1T8EA 3GIMA 5EWEA 2FPLA 4QZGA 4O9MA 1KTQA 3MGIA 5HMMA 5KFEA 1ZQJA 4ED0A 1NK5A 3PW5A 8ICYA 4Q43A 4DL2A 1U47A 4M6WA 4F91B 1NK0A 1R8CA 4AT7B 3V7LA 4KMUA 2BGWA 4PHAA 3JPTA 1KEJA 5HRHA 1KNYA 3AU2A 3OV7A 4I2JA 4M9JA 5DG8A 2DR9A 1VJ7A 2ID1A 5KG6A 4O3QA 1T7PA 4DSLA 4EP7A 2KFZA 3SYZA 3C2KA 4M9NA 2W9BA 4JV2A 4J9MA 4F4ZA 1QSLA 3SV3A 4FBTA 1Z00B 3BDPA 4YFKA 1U9LA 5IIMA 2JEFA 4ED7A 3RJHA 1S0VA 3MGHA 4DFMA 5KFHA 1UA0A 3RJJA 4KLDA 5DGBA 5KFOA 2MAXA 1LB2B 3JYYA 4NKTA 4DL5A 7ICEA 3C5FA 2ATLA 2DVIA 4BXOA 1ZQTA 4DOCA 2J6SA 3EPGA 3GV5B 1T3NA 4DF4A 2ZH2A 7ICVA 5KT6A 4PH5A 5J2CA 1MQ3A 1V4AA 2ZH7A 2W9AA 2M2VA 3PX0A 8ICUA 5F9NA 1BGXT 3K75D 1JXLA 1ZQGA 2GWSA 4DWIA 4Q8FA 4AT9A 5KG7A 1JAJA 5JUMA 3H8JA 8ICEA 5IIJA 3KHGA 1RZTA 2VANA 5DQGA 2AQ4A 3TANA 1JQRA 1D8LA 4J9SA 4MF8A 3JPSA 5HHIA 1ZQOA 2F1JA 3OHAA 3PW2A 1HJPA 5KT2A 1KDHA 2FMQA 1R8BA 2DR8A 4I2GA 1ZYQA 4C8KA 7ICUA 4J9LA 5L9XA 4I2DA 5DBCA 4LZGA 4X4UA 1S77D 4LT6A 4DS4A 4KLFA 2M2UA 4NY8A 2ZH6A 1TVAA 3EPIA 2ZJAA 4UB3A 4DOAA 3T5LA 1L3UA 7ICTA 4M47A 2KP7A 4B9NA 4I2CA 4RQ0A 2VA2A 3LK9A 4UAZA 4R64A 1XO1A 3GIIA 3AUOA 5J0TA 8ICNA 1OU5A 2XC9A 4O0IA 2NRKA 5J2GA 7ICGA 2RFFA 4WC7A 4X4TA 5HNKA 1BPDA 9ICLA 5D49A 2IHMA 3JPOA 4MEXA 5CJ7A 4B9MA 4ECWA 3RAXA 1X9SA 5DBAA 4ED6A 2VA3A 3RJKA 2ASDA 4YMMA 3PMNA 1CEZA 5HRLA 5DDYA 4Z6FA 3H4BA 1ZQNA 4RWQA 2ZH3A 3OGUA 5IIOA 2R8KA 3G6XA 4UB5A 9ICHA 5L1KA 4DFJA 1NKCA 4E80A 3PR4A 4ECVA 2C2DA 4K4IA 3PY8A 4KLJA 3JPNA 4RT3A 2BCUA 2PFPA 2BDPA 4B9UA 4S3NA 2IBKA 4O5CA 5DLFA 1NJYA 1RXWA 1NZPA 4K4HA 2O1PA 4JWMA 3HPOA 8ICSA 2ZH5A 5HP4A 3JPPA 3GDXA 2KZ3A 3N97B 4RQ2A 1KFSA 2BCVA 5KG5A 3RAQA 4DEZA 4KTQA 1Z3EB 4AT7A 4IRDA 4DQIA 1ZQZA 4R65A 2V9WA 4UQGA 1NKEA 5J29A 1XWLA 1ZQIA 3AQKA 1NK7A 4XQ8A 1ZJNA 3HWTA 3MDCA 3UXPA 1BNOA 3ISDA 3M9OB 4YCXA 4CCHA 1R8AA 5J0UA 2XCAA 2Q0ZX 3SI8A 5KFDA 8ICOA 4ATBB 9ICOA 2BQRA 3HJ4A 1Z00A 1ZQFA 4KLLA 3PVXA 1EXNA 4F5RA 4DL7A 2H5XA 2BQ3A 3C1YA 4NXZA 5KT5A 1K1QA 3H40A 4RUAA 3TAQA 8ICLA 3C5GA 3KTQA 4K4GA 4EBDA 3BJYA 4DL6A 2P6RA 4DSKA 1MC8A 2DPIA 2HHQA 1FA0A 2UVWA 1NOMA 1K1SA 4ECTA 4QZDA 4FHXA 4Z6EA 4AT8A 2PI4A 3RR7A 3LWLA 1RYSA 2J6TA 4RU9A 3V6JA 1L3TA 4KLHA 4O3NA 3MBYA 2Y1JA 2BQUA 5DG9A 5KFXA 1XU4A 2XY5A 1BNPA 4YN4A 5J0RA 1N48A 2XGQA 3QEBZ 3ZDAA 2HHXA 4QWBA 2C28A 2ZUDA 2B21A 5KG2A 1SKSA 1ZQHA 3IHQB 1JN3A 4XRHA 4RUCA 4BDPA 2JZBB 2FMPA 4I2BA 2O5AA 4RPYA 2IA6A 3LDAA 2DPJA 3Q8MA 4ED8A 3C2LA 1ZQQA 1SKWA 4FHPA 3C66A 3HW8A 8ICRA 4GLXA 4RPZA 2KN7A 1XSNA 1C7YA 4ECZA 5TZVA 5CB1A 4BWJA 4RT2A 1RPLA 3RJFA 1QSYA 3OUYB 3EYZA 4XQ7A 9ICWA 3H3AA 4WBZA 2NRTA 2FLLA 1S10A 3GV8B 7ICSA 1SZPA 5KG3A 4QWEA 1U45A 8ICMA 4B9VA 2DR7A 2ASLA 4F93B 4KLOA 1TK8A 3ZDDA 4KLSA 3ETLA 2NRVA 2BPCA 4QZ8A 5J0WA 4QWDA 4C8MA 3BQ0A 5KFMA 1SL0A 1ZQSA 1S76D 5KFNA 5HHHA 3NTUA 5J2KA 3WFQE 4XUSA 4WC1A 3RR8A 2HVIA 1CUKA 2AU0A 1NK8A 1Y88A 4FHWA 2BPGA 4TQSA 3RBDA 4YP3A 1TAUA 8ICGA 2HHSA 4O5EA 4TUQA 3H38A 4MFFA 9ICGA 3KHHA 3GIKA 3KHRA 5KFJA 4R66A 5F2VO 2F1HA 5KFYA 4Z6CA 4YG2A 3UXNA 4QZHA 2M9NA 3M9MB 1ZQAA 4O3SA 2F1IA 1BPXA 4TURA 5IILA 2NRZA 5HRFA 4UB4A 3UQ2A 3G6YA 3EZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RQ3 A;  2J6U A;  4KLG A;  9ICE A;  4EYI B;  4ECY A;  1KLN A;  8ICP A;  3ISC A;  3PO5 A;  9ICC A;  1S0O A;  3H37 A;  4IRC A;  1T4G A;  1WCL A;  5DB7 A;  3ZDB A;  4PHE A;  5EOZ A;  2OWO A;  4J9O A;  3H4D A;  4J9P A;  4ED3 A;  8ICQ A;  5BOM A;  2NRX A;  2ZUB A;  3RTV A;  1MSW D;  1V9P A;  4QW8 A;  5C5J A;  5CP2 A;  9ICQ A;  3TAP A;  2R8I A;  2ZJ5 A;  3V7K A;  2VA8 A;  2A1J B;  5J0O A;  1XSL A;  3ZDC A;  4DSJ A;  5DB9 A;  3JPQ A;  4TUS A;  2PFN A;  8ICZ A;  4JWN A;  3OVS A;  3B0X A;  3OHB A;  1YLQ A;  7ICP A;  2ZTD A;  4ATB A;  2W9C B;  4WC4 A;  1XSP A;  1MIY A;  5KG1 A;  3ZD8 A;  7ICI A;  2HVH A;  1ZQV A;  2I1Q A;  4NM1 A;  4X4P A;  4UAW A;  2P66 A;  4ED2 A;  4UB2 A;  4EEY A;  2LYH A;  1QLN A;  4WC5 A;  1TK5 A;  4DO9 A;  2FLP A;  8ICV A;  4YVZ A;  5HRB A;  2DRB A;  2DRA A;  3RB6 A;  4PHP A;  4J9R A;  3QEA Z;  9ICN A;  1A76 A;  3FDS A;  4DSF A;  2IMW P;  5CA7 A;  3M8S A;  4F4Y A;  4X5V A;  3C1Z A;  1ZQK A;  2I9G A;  2NRW A;  1JIH A;  5J2F A;  1SL1 A;  3WFS C;  4RZR A;  2JZB A;  5KT4 A;  4R63 A;  4J9N A;  4FS2 A;  2HHW A;  1NKB A;  5IIK A;  2HHV A;  3QE9 Y;  2BCS A;  1XS9 D;  4M9H A;  4NLZ A;  3HJ1 A;  2R8H A;  2ZH4 A;  4QZC A;  1B22 A;  1N56 A;  1F5A A;  4UB1 A;  4IG8 A;  5DKW A;  4ECX A;  3GQC A;  1QTM A;  5DB8 A;  5DQI A;  3TAR A;  9ICK A;  5HRI A;  5KFW A;  3MR6 A;  9ICS A;  1L3V A;  2HW3 A;  1UEU A;  2DR5 A;  3M9N B;  3PNC A;  7ICN A;  4FH3 A;  1TFW A;  4I2A A;  4X4Q A;  4X0B A;  3OUY A;  5KFU A;  5D4B A;  4WBY A;  1BPB A;  2KZZ A;  4O3P A;  4X0A A;  1DOQ A;  5KFI A;  3GIJ A;  2RDI A;  2ASJ A;  1KRP A;  4NLN A;  4O3R A;  5J0Y A;  5KFZ A;  1B43 A;  1X9W A;  1NK9 A;  4P4O A;  3HX0 A;  2C22 A;  3UPS A;  4F92 B;  2C2R A;  2HHT A;  3KHL A;  2FLN A;  9ICV A;  4Z6D A;  1SKR A;  4ECS A;  3RJE A;  3MFI A;  4KLU A;  4QZB A;  1UT5 A;  4QZF A;  3TI0 A;  4YMO A;  3TFS A;  4EBK A;  2KFN A;  5HRD A;  3WFR E;  2UVR A;  7ICR A;  4ZH4 A;  4DL3 A;  5DG7 A;  5KFT A;  4YXJ A;  3E2E A;  1Q79 A;  1X2I A;  5HR9 A;  4KLQ A;  3RBE A;  2RDJ A;  3GV7 B;  1PX5 A;  4DSI A;  2ZUC A;  5KFQ A;  2KTQ A;  3T5K A;  9ICT A;  1RXV A;  3LQC B;  4J9K A;  4ED1 A;  2PXI A;  4DSE A;  2P6U A;  3ZD9 A;  4RQ7 A;  3HT3 A;  1JX4 A;  1BPZ A;  5HRG A;  3JZ0 A;  1KFD A;  3Q8Q B;  4RNM A;  3PR5 B;  2ISO A;  4I29 A;  5D46 A;  1SL2 A;  1DK2 A;  4ECU A;  1UA1 A;  2PFQ A;  4JV1 A;  4NKU A;  4B9T A;  4EZ9 A;  1Q78 A;  2FPK A;  1ZET A;  2ISP A;  4E8F A;  4F2R A;  3AQL A;  5DDM A;  5BOL A;  1MIW A;  4XA5 A;  4YR2 A;  2BE3 A;  2PFO A;  2DFL A;  4IQV A;  4UAY A;  2WTF A;  4R8U B;  4F5Q A;  7ICF A;  3V6K A;  4YR0 A;  2JEJ A;  3PV8 A;  2PI5 A;  3UQ0 A;  4ELT A;  4E0D A;  1ZQR A;  2UVU A;  2M2T A;  9ICJ A;  3C23 A;  3TQ1 A;  3Q8S B;  3T5J A;  4F2S A;  5KFG A;  2PBE A;  1ZQP A;  5KTQ A;  1U49 A;  2HHU A;  2ZHB A;  2A1J A;  4PHD A;  3Q8R B;  3T3F A;  1MQ2 A;  2FPM A;  7ICK A;  4M0A A;  5IIN A;  4KLM A;  4G3I A;  2BCQ A;  3OJS A;  4NLK A;  3RB4 A;  4Q44 A;  4PGX A;  2W9C A;  1H38 A;  4M9G A;  2ALZ A;  4UD5 A;  3V72 A;  1ZQC A;  2ZTC A;  1ZQM A;  4GXK A;  1L3S A;  4F50 A;  3PW4 A;  4B9L A;  1TAQ A;  4F8R A;  9ICP A;  3V7J A;  1S97 A;  3V6H A;  2BCR A;  7ICM A;  5BPC A;  4EYH B;  1DK3 A;  1TK0 A;  4RNN A;  1TKD A;  3H7I A;  1ZQD A;  4LVS A;  4WCW A;  9ICF A;  4F4X A;  4C8O A;  5KFV A;  4JV0 A;  2BHN A;  5KFB A;  4DQS A;  4RWO A;  4I28 A;  2UVV A;  2JEI A;  3MAB A;  4ECQ A;  4DF8 A;  3OVB A;  3GIL A;  3H8W A;  4F4W A;  1D9D A;  4PGY A;  3Q8P B;  3WFO A;  4DFK A;  3SV4 A;  1KSP A;  4TQR A;  4TUP A;  4DLE A;  4I2H A;  4RQ8 A;  4DOB A;  4EBC A;  3QZ8 A;  3BQ1 A;  4X4R A;  5DED A;  4QZA A;  7ICQ A;  5DEC A;  2ZTE A;  4M9L A;  4FO6 A;  2XO7 A;  1NO5 A;  2MUT B;  2R8J A;  4EZ6 A;  3PW0 A;  3ZDE A;  3RH5 A;  2ZH1 A;  4RQ5 A;  9ICX A;  4QZ9 A;  2XGP A;  5HML A;  3PML A;  3C18 A;  5J2B A;  4YXM A;  4UBB A;  5L1L A;  3AU6 A;  3UPQ A;  4DS5 A;  3PX6 A;  1LV5 A;  5J0S A;  9ICR A;  5HC9 A;  5J2I A;  2BR0 A;  4AT8 B;  4C8L A;  4LZD A;  1IM4 A;  3K4G A;  3C21 A;  2W8K A;  4YD1 A;  4KLT A;  1L5U A;  1TV9 A;  4F5P A;  4X4V A;  4F4K A;  4GC6 A;  4M2Y A;  1NJW A;  3MR5 A;  2AGO A;  3SZ2 A;  3RRH A;  4C8N A;  8ICC A;  5HRE A;  4IQU A;  3ISB A;  4KN4 A;  2KZM A;  5KFR A;  5KFC A;  2V4R A;  4M6W B;  4RWP A;  5DB6 A;  3C2M A;  3OSP A;  1BPE A;  3EWA A;  5CR0 A;  4F5O A;  4KLI A;  2AJQ A;  1MIV A;  4RPX A;  2IHN A;  4KLE A;  4DQQ A;  4FH5 A;  5HRK A;  1COO A;  1DGS A;  2HHP A;  2W9M A;  3EW9 A;  1WOT A;  3HP6 A;  1QSS A;  9ICA A;  7ICJ A;  5KT7 A;  3AQN A;  1PZN A;  4J9Q A;  4WC6 A;  3H8S A;  4RQ1 A;  2AGP A;  2W9B B;  1NJX A;  3M8R A;  4FBU A;  4F3O A;  4WC0 A;  4X4N A;  4O5K A;  5L1J A;  3HIY A;  4DQP A;  1ZQE A;  8ICX A;  3GFK B;  4YR3 A;  4ECR A;  9ICM A;  1JMS A;  8ICF A;  5KFL A;  1S0N A;  1ARO P;  4KIT B;  5KG0 A;  4YD2 A;  2XCP A;  7ICH A;  4FHV A;  3BQT A;  4PPX A;  1JXE A;  1A77 A;  4Q45 A;  2R8G A;  2FMS A;  4ELV A;  3G6V A;  1TFR A;  1ZJM A;  4M04 A;  7ICO A;  3FYH A;  1NJZ A;  4BXO B;  4MFA A;  8ICA A;  4M5D A;  4QWA A;  4UBC A;  4GXI A;  8ICB A;  5EWG A;  4Q8E A;  2W8L A;  4EBJ A;  2XY7 A;  1UEV A;  2Y1I A;  1NK4 A;  1TFY A;  1ZQX A;  5KT3 A;  8ICK A;  5F9L A;  5III A;  1NK6 A;  1R89 A;  3T5H A;  1BVS A;  3WFP A;  4DFP A;  1S0M A;  4I2I A;  5DGA A;  1BPY A;  3UXO A;  1UT8 A;  4IRK A;  4IR1 A;  1VFG A;  4R8U A;  3QZ7 A;  4YQW A;  4QWC A;  3NGD A;  5J2D A;  5KFS A;  3RH6 A;  4AT9 B;  3L9D A;  3PW7 A;  4MFC A;  2BPF A;  5L1I A;  1D8Y A;  5KFP A;  4I27 A;  1UET A;  1X9M A;  4ELU A;  4WC2 A;  5J2H A;  4IQT A;  2ZH8 A;  4O3O A;  5J0Q A;  4IQW A;  8ICT A;  4EBE A;  3ORY A;  5J2J A;  1ZQW A;  3RB3 A;  4QZE A;  1U48 A;  3OJU A;  4QW9 A;  4X4O A;  1WCN A;  4DL4 A;  3MFH A;  3MDA A;  8ICI A;  1XC9 A;  4RQ4 A;  1ZQL A;  3AQM A;  5J2A A;  4RNO A;  3RJI A;  3BQ2 A;  3LWM A;  5CHG A;  4MF2 A;  2M2W A;  5J0X A;  4E7X A;  4X4S A;  5J2E A;  4JK1 A;  5DLG A;  3MR3 A;  2V4Q A;  3NYB A;  3H39 A;  1U4B A;  4JUZ A;  4BGD A;  4HYK A;  2ZJ8 A;  4P4P A;  1ZQU A;  5DQH A;  5DBB A;  5J0P A;  3IM1 A;  5KG4 A;  3OSN A;  2C2E A;  1D9F A;  5KFF A;  3Q8K A;  4KN7 A;  4IR9 A;  1IXR A;  4P4M A;  4GC7 A;  4BWM A;  3N4M B;  4DQR A;  2AQ0 A;  9ICB A;  1ZQY A;  8ICJ A;  4RQ6 A;  4RWN A;  2BKE A;  9ICI A;  2Q66 A;  5EWF A;  3JPR A;  3RJG A;  4B9S A;  8ICW A;  4QZI A;  2MUT A;  2ZH9 A;  4YMN A;  1ZQB A;  3PO4 A;  4GXJ A;  3OVA A;  4P2H A;  4FS1 A;  2JEG A;  4I2E A;  1KFT A;  4WC3 A;  5CWR A;  4F5N A;  3PX4 A;  3B0Y A;  4DLG A;  2AGQ A;  1RYR A;  1HUO A;  5KFA A;  4UD4 A;  4MEY A;  4NM2 A;  3MR2 A;  3Q8L A;  3THV A;  3RB0 A;  1S9F A;  3RRG A;  8ICH A;  1HUZ A;  9ICU A;  3TFR A;  2XY6 A;  7ICL A;  5KFK A;  4I2F A;  3RH4 A;  4NLG A;  4PGQ A;  4FHY A;  2ZHA A;  1T8E A;  3GIM A;  5EWE A;  2FPL A;  4QZG A;  4O9M A;  1KTQ A;  3MGI A;  5HMM A;  5KFE A;  1ZQJ A;  4ED0 A;  1NK5 A;  3PW5 A;  8ICY A;  4Q43 A;  4DL2 A;  1U47 A;  4M6W A;  4F91 B;  1NK0 A;  1R8C A;  4AT7 B;  3V7L A;  4KMU A;  2BGW A;  4PHA A;  3JPT A;  1KEJ A;  5HRH A;  1KNY A;  3AU2 A;  3OV7 A;  4I2J A;  4M9J A;  5DG8 A;  2DR9 A;  1VJ7 A;  2ID1 A;  5KG6 A;  4O3Q A;  1T7P A;  4DSL A;  4EP7 A;  2KFZ A;  3SYZ A;  3C2K A;  4M9N A;  2W9B A;  4JV2 A;  4J9M A;  4F4Z A;  1QSL A;  3SV3 A;  4FBT A;  1Z00 B;  3BDP A;  4YFK A;  1U9L A;  5IIM A;  2JEF A;  4ED7 A;  3RJH A;  1S0V A;  3MGH A;  4DFM A;  5KFH A;  1UA0 A;  3RJJ A;  4KLD A;  5DGB A;  5KFO A;  2MAX A;  1LB2 B;  3JYY A;  4NKT A;  4DL5 A;  7ICE A;  3C5F A;  2ATL A;  2DVI A;  4BXO A;  1ZQT A;  4DOC A;  2J6S A;  3EPG A;  3GV5 B;  1T3N A;  4DF4 A;  2ZH2 A;  7ICV A;  5KT6 A;  4PH5 A;  5J2C A;  1MQ3 A;  1V4A A;  2ZH7 A;  2W9A A;  2M2V A;  3PX0 A;  8ICU A;  5F9N A;  1BGX T;  3K75 D;  1JXL A;  1ZQG A;  2GWS A;  4DWI A;  4Q8F A;  4AT9 A;  5KG7 A;  1JAJ A;  5JUM A;  3H8J A;  8ICE A;  5IIJ A;  3KHG A;  1RZT A;  2VAN A;  5DQG A;  2AQ4 A;  3TAN A;  1JQR A;  1D8L A;  4J9S A;  4MF8 A;  3JPS A;  5HHI A;  1ZQO A;  2F1J A;  3OHA A;  3PW2 A;  1HJP A;  5KT2 A;  1KDH A;  2FMQ A;  1R8B A;  2DR8 A;  4I2G A;  1ZYQ A;  4C8K A;  7ICU A;  4J9L A;  5L9X A;  4I2D A;  5DBC A;  4LZG A;  4X4U A;  1S77 D;  4LT6 A;  4DS4 A;  4KLF A;  2M2U A;  4NY8 A;  2ZH6 A;  1TVA A;  3EPI A;  2ZJA A;  4UB3 A;  4DOA A;  3T5L A;  1L3U A;  7ICT A;  4M47 A;  2KP7 A;  4B9N A;  4I2C A;  4RQ0 A;  2VA2 A;  3LK9 A;  4UAZ A;  4R64 A;  1XO1 A;  3GII A;  3AUO A;  5J0T A;  8ICN A;  1OU5 A;  2XC9 A;  4O0I A;  2NRK A;  5J2G A;  7ICG A;  2RFF A;  4WC7 A;  4X4T A;  5HNK A;  1BPD A;  9ICL A;  5D49 A;  2IHM A;  3JPO A;  4MEX A;  5CJ7 A;  4B9M A;  4ECW A;  3RAX A;  1X9S A;  5DBA A;  4ED6 A;  2VA3 A;  3RJK A;  2ASD A;  4YMM A;  3PMN A;  1CEZ A;  5HRL A;  5DDY A;  4Z6F A;  3H4B A;  1ZQN A;  4RWQ A;  2ZH3 A;  3OGU A;  5IIO A;  2R8K A;  3G6X A;  4UB5 A;  9ICH A;  5L1K A;  4DFJ A;  1NKC A;  4E80 A;  3PR4 A;  4ECV A;  2C2D A;  4K4I A;  3PY8 A;  4KLJ A;  3JPN A;  4RT3 A;  2BCU A;  2PFP A;  2BDP A;  4B9U A;  4S3N A;  2IBK A;  4O5C A;  5DLF A;  1NJY A;  1RXW A;  1NZP A;  4K4H A;  2O1P A;  4JWM A;  3HPO A;  8ICS A;  2ZH5 A;  5HP4 A;  3JPP A;  3GDX A;  2KZ3 A;  3N97 B;  4RQ2 A;  1KFS A;  2BCV A;  5KG5 A;  3RAQ A;  4DEZ A;  4KTQ A;  1Z3E B;  4AT7 A;  4IRD A;  4DQI A;  1ZQZ A;  4R65 A;  2V9W A;  4UQG A;  1NKE A;  5J29 A;  1XWL A;  1ZQI A;  3AQK A;  1NK7 A;  4XQ8 A;  1ZJN A;  3HWT A;  3MDC A;  3UXP A;  1BNO A;  3ISD A;  3M9O B;  4YCX A;  4CCH A;  1R8A A;  5J0U A;  2XCA A;  2Q0Z X;  3SI8 A;  5KFD A;  8ICO A;  4ATB B;  9ICO A;  2BQR A;  3HJ4 A;  1Z00 A;  1ZQF A;  4KLL A;  3PVX A;  1EXN A;  4F5R A;  4DL7 A;  2H5X A;  2BQ3 A;  3C1Y A;  4NXZ A;  5KT5 A;  1K1Q A;  3H40 A;  4RUA A;  3TAQ A;  8ICL A;  3C5G A;  3KTQ A;  4K4G A;  4EBD A;  3BJY A;  4DL6 A;  2P6R A;  4DSK A;  1MC8 A;  2DPI A;  2HHQ A;  1FA0 A;  2UVW A;  1NOM A;  1K1S A;  4ECT A;  4QZD A;  4FHX A;  4Z6E A;  4AT8 A;  2PI4 A;  3RR7 A;  3LWL A;  1RYS A;  2J6T A;  4RU9 A;  3V6J A;  1L3T A;  4KLH A;  4O3N A;  3MBY A;  2Y1J A;  2BQU A;  5DG9 A;  5KFX A;  1XU4 A;  2XY5 A;  1BNP A;  4YN4 A;  5J0R A;  1N48 A;  2XGQ A;  3QEB Z;  3ZDA A;  2HHX A;  4QWB A;  2C28 A;  2ZUD A;  2B21 A;  5KG2 A;  1SKS A;  1ZQH A;  3IHQ B;  1JN3 A;  4XRH A;  4RUC A;  4BDP A;  2JZB B;  2FMP A;  4I2B A;  2O5A A;  4RPY A;  2IA6 A;  3LDA A;  2DPJ A;  3Q8M A;  4ED8 A;  3C2L A;  1ZQQ A;  1SKW A;  4FHP A;  3C66 A;  3HW8 A;  8ICR A;  4GLX A;  4RPZ A;  2KN7 A;  1XSN A;  1C7Y A;  4ECZ A;  5TZV A;  5CB1 A;  4BWJ A;  4RT2 A;  1RPL A;  3RJF A;  1QSY A;  3OUY B;  3EYZ A;  4XQ7 A;  9ICW A;  3H3A A;  4WBZ A;  2NRT A;  2FLL A;  1S10 A;  3GV8 B;  7ICS A;  1SZP A;  5KG3 A;  4QWE A;  1U45 A;  8ICM A;  4B9V A;  2DR7 A;  2ASL A;  4F93 B;  4KLO A;  1TK8 A;  3ZDD A;  4KLS A;  3ETL A;  2NRV A;  2BPC A;  4QZ8 A;  5J0W A;  4QWD A;  4C8M A;  3BQ0 A;  5KFM A;  1SL0 A;  1ZQS A;  1S76 D;  5KFN A;  5HHH A;  3NTU A;  5J2K A;  3WFQ E;  4XUS A;  4WC1 A;  3RR8 A;  2HVI A;  1CUK A;  2AU0 A;  1NK8 A;  1Y88 A;  4FHW A;  2BPG A;  4TQS A;  3RBD A;  4YP3 A;  1TAU A;  8ICG A;  2HHS A;  4O5E A;  4TUQ A;  3H38 A;  4MFF A;  9ICG A;  3KHH A;  3GIK A;  3KHR A;  5KFJ A;  4R66 A;  5F2V O;  2F1H A;  5KFY A;  4Z6C A;  4YG2 A;  3UXN A;  4QZH A;  2M9N A;  3M9M B;  1ZQA A;  4O3S A;  2F1I A;  1BPX A;  4TUR A;  5IIL A;  2NRZ A;  5HRF A;  4UB4 A;  3UQ2 A;  3G6Y A;  3EZ5 A; 
#chains in the Genus database with same CATH topology
 4ECY A;  3QU2 A;  1KLN A;  3ZDB A;  3QXG A;  5EOZ A;  2OWO A;  2Y9U A;  3H4D A;  1IG6 A;  2H3V A;  2NRX A;  3RTV A;  4KX3 A;  1V9P A;  2XIC A;  5C5J A;  5CP2 A;  4OO1 J;  1ZRN A;  5J0O A;  5DB9 A;  4TUS A;  3B0X A;  4ATB A;  7ICI A;  2I1Q A;  2RRD A;  4EEY A;  1TK5 A;  1OUQ A;  1KKX A;  9ICN A;  2MSN A;  3NUQ A;  3FDS A;  3UM9 A;  4DSF A;  2IMW P;  5CA7 A;  3M8S A;  4F4Y A;  2NRW A;  1JIH A;  5AI8 A;  4RZR A;  2JZB A;  2KJ9 A;  4NJ8 A;  4M9H A;  2ZH4 A;  4QZC A;  1N61 A;  4WQK A;  2AHO B;  4IG8 A;  5DKW A;  3NVW A;  5AKK A;  1C20 A;  9ICS A;  4FH3 A;  4X4Q A;  3OUY A;  1BPB A;  1NNL A;  4X0A A;  3M1Y A;  1B43 A;  3HX0 A;  2C22 A;  4U7C A;  2FLN A;  4Z6D A;  4ECS A;  5HR7 A;  1UT5 A;  4EBK A;  2KFN A;  1RYU A;  3WFR E;  2UVR A;  3E2E A;  5KFT A;  4EEB A;  2EAM A;  1CRX A;  5L1M A;  2KTQ A;  3T5K A;  2LYA A;  9ICT A;  1RXV A;  3LQC B;  4J9K A;  1JX4 A;  2PXI A;  2P6U A;  3HT3 A;  2LI6 A;  5HRG A;  1KFD A;  3PR5 B;  4I29 A;  3NVO A;  2F3N A;  5D46 A;  4EEK A;  3H0L B;  4EZ9 A;  2HOF A;  1Q78 A;  1ZET A;  4F2R A;  2K8C B;  5DDM A;  1MIW A;  4XA5 A;  2WF6 A;  3CYM A;  4UAY A;  5AKX A;  4YR0 A;  3WK9 A;  1ZQR A;  4GIB A;  3Q8S B;  1N5X A;  1ZQP A;  5KTQ A;  2A1J A;  2KK0 A;  4PHD A;  3A0B U;  5IIN A;  3AL0 B;  2BCQ A;  3I76 A;  2Y9T A;  2OYY A;  1ZQM A;  4F50 A;  1TAQ A;  4F8R A;  1SIJ A;  2DGZ A;  5AKE A;  9ICF A;  2EZZ A;  4JV0 A;  4DQS A;  2JEI A;  3MAB A;  4DF8 A;  4F4W A;  3Q8P B;  3SV4 A;  4TQR A;  4AP9 A;  4CF3 A;  5DEC A;  2XO7 A;  1PVP A;  2R8J A;  4EZ6 A;  3PW0 A;  3RH5 A;  2ZH1 A;  4RQ5 A;  2XGP A;  2A1A A;  2WAQ C;  5L1L A;  9ICR A;  5HC9 A;  4DS5 A;  5J0S A;  4KMO B;  2BR0 A;  1IM4 A;  3K4G A;  2ZIX A;  4BUG A;  4KLT A;  4F5P A;  4X4V A;  3SZ2 A;  4C8N A;  1RQL A;  3TAC B;  5KFR A;  5DB6 A;  2YML A;  3OSP A;  5HR6 A;  5CR0 A;  4FH5 A;  4KLE A;  4DQQ A;  1QSS A;  9ICA A;  5KT7 A;  4RQ1 A;  2W9B B;  4F3O A;  2QAR A;  2HCF A;  3UMB A;  2OH2 A;  4FBU A;  5L1J A;  8ICX A;  3GFK B;  1JMS A;  1X6I A;  7ICH A;  3VCB A;  4PPX A;  3ER9 B;  2R8G A;  3PHZ A;  4BXO B;  1P7D A;  2G06 A;  4M5D A;  3MC1 A;  8ICB A;  5ALT A;  5EWG A;  4Q8E A;  1A0P A;  1NK4 A;  3SEN A;  1ZQX A;  5KT3 A;  1TFY A;  3T5H A;  2A19 A;  4DFP A;  3CP8 A;  1S0M A;  1UT8 A;  1Z4N A;  3BZK A;  4R8U A;  3QZ7 A;  3NGD A;  5J2D A;  5KFS A;  3L9D A;  4MFC A;  1JUD A;  5L1I A;  1D8Y A;  1T3Q A;  1X66 A;  3PSP A;  2JGA A;  1QQ6 A;  8ICT A;  4EBE A;  1ZQW A;  3TAD A;  3PSI A;  3PST A;  3MFH A;  2EZX A;  1ZQL A;  3AQM A;  4RNO A;  5CHG A;  5J0X A;  4E7X A;  2HMX A;  5DLG A;  2V4Q A;  4JUZ A;  4HYK A;  2ZJ8 A;  1ZQU A;  2WF8 A;  1D9F A;  5ALL A;  1IXR A;  1ZQY A;  3QNM A;  2W54 A;  5AM5 A;  4NLC A;  3RJG A;  2YQE A;  4QIW F;  1OW5 A;  3HJE A;  4DLG A;  2NV3 A;  1HUO A;  1HUZ A;  4NLG A;  4PGQ A;  4FHY A;  2FPL A;  4O9M A;  1KTQ A;  2EAO A;  5AM3 A;  4Y2X A;  1NK5 A;  5HRH A;  1KEJ A;  1RM6 C;  4I2J A;  3OTQ A;  5G5G A;  4DSL A;  2KFZ A;  3ED5 A;  5AM0 A;  4F4Z A;  1QSL A;  1Z00 B;  4EGW A;  5IIM A;  2JEF A;  2GAF D;  1UA0 A;  3RJJ A;  2EAN A;  2ESE A;  5DGB A;  4DL5 A;  2ATL A;  2DVI A;  1A6S A;  2J6S A;  2GA9 D;  3EPG A;  5B3Q A;  4FFD A;  4EX7 A;  2ZH7 A;  2I6X A;  2KSO B;  5F9N A;  3K75 D;  3OWG A;  4IC9 A;  4DWI A;  5AKY A;  4I0U A;  3H0R B;  4JLX A;  3H8J A;  3EUB 2;  5IIJ A;  1RZT A;  2H3I A;  3JPS A;  5ALX A;  1LKY B;  4RQM A;  1KDH A;  4C8K A;  5L9X A;  4LZG A;  1S77 D;  4LT6 A;  3TAD C;  2W3R A;  2M2U A;  3AQL A;  5CFT A;  4UAT A;  4DFD A;  2VA2 A;  4UAZ A;  4R64 A;  3AUO A;  4O69 A;  4O0I A;  3M6K A;  7ICG A;  9ICL A;  2KG5 A;  3IG8 A;  5DBA A;  4ED6 A;  4C4T A;  5T14 A;  2ZIU A;  2ZH3 A;  4Z6F A;  1ZQN A;  1NKC A;  1JRP A;  2RHF A;  2C2D A;  3PY8 A;  4KLJ A;  4RT3 A;  3FAH A;  2BCU A;  4O67 A;  4S3N A;  4O5C A;  5DLF A;  1RXW A;  3DDH A;  2DBY A;  2O1P A;  1V85 A;  2ZH5 A;  3N97 B;  4RQ2 A;  3RAQ A;  1N2X A;  5H2F U;  1Z3E B;  4ICA A;  2OEH A;  4AT7 A;  4IRD A;  2XID A;  5J29 A;  1NK7 A;  1ZJN A;  3HWT A;  1QQ7 A;  3M9O B;  2XCA A;  1Z1B A;  3SI8 A;  8ICO A;  4ATB B;  3EF2 A;  5AK5 A;  2O6K A;  4F5R A;  1EXN A;  5ALH A;  4NXZ A;  1MIV A;  3SAH A;  3TAQ A;  3C5G A;  2UVW A;  3OPX A;  2PI4 A;  4RU9 A;  1L6N A;  2Y1J A;  1BNP A;  4K9B A;  2E8O A;  4YN4 A;  3QEB Z;  5KG2 A;  3DEE A;  2N1R A;  2JZB B;  2FMP A;  2Q4T A;  2HBL A;  2IA6 A;  1NI3 A;  4Y2S A;  3Q8M A;  2E8M A;  1SKW A;  3HW8 A;  2KNJ A;  5TZV A;  1ZXI A;  5CB1 A;  5AM1 A;  4RT2 A;  1QSY A;  3OUY B;  3D2S A;  3WKD A;  3MCR A;  3GV8 B;  8ICM A;  3DV9 A;  4KLO A;  2CXY A;  1TK8 A;  2BPC A;  5AKZ A;  4QZ8 A;  1ZQS A;  1SL0 A;  5KFM A;  2MU2 A;  1S76 D;  5HHH A;  4OJL A;  3H0M B;  3CW2 C;  1CUK A;  1L7O A;  2W11 A;  4O5E A;  4WH5 A;  5KAF U;  3KHR A;  4R66 A;  2IHO A;  4YG2 A;  1JAL A;  4O3S A;  4CGZ A;  3UQ2 A;  2YB1 A;  3AQN A;  3QU7 A;  2G5I B;  1SZH A;  3ISC A;  3PO5 A;  9ICC A;  1S0O A;  3H37 A;  1T4G A;  4QNL A;  4PHE A;  1Q3U A;  4J9P A;  4NXT A;  3HIL A;  2JMG A;  3IDW A;  9ICQ A;  3TAP A;  2R8I A;  2ZJ5 A;  3V7K A;  3ZDC A;  2A1J B;  4JWN A;  4WC4 A;  5KG1 A;  4CDG A;  3WK6 A;  2HVH A;  4NM1 A;  3NVV A;  4UAW A;  4UB2 A;  2LYH A;  2KHV A;  5HRB A;  1SWV A;  8ICV A;  3WK8 A;  2HI0 A;  2DRB A;  5G5H A;  4J9R A;  1COK A;  3SR6 A;  4OAG A;  1ZQK A;  3C1Z A;  5EE1 A;  1SL1 A;  1N5W A;  4FS2 A;  2HHW A;  2LM1 A;  2HHV A;  3E0F A;  1XS9 D;  4NLZ A;  2FCL A;  2YMM A;  3GQC A;  1QTM A;  5DB8 A;  2OM6 A;  5DQI A;  3TAR A;  9ICK A;  3ERC C;  5HRI A;  7ICN A;  2B4V A;  1FFV A;  4I2A A;  4OJO A;  2ZIX B;  2LBO A;  4WBY A;  4O3P A;  4AYB C;  4NLN A;  4O3R A;  5J0Y A;  5KFZ A;  1X9W A;  4F92 B;  3KHL A;  4KLU A;  2KMD A;  3MFI A;  2WF9 A;  3TFS A;  2QAR B;  2MRL A;  7ICR A;  1T94 A;  4YXJ A;  1X2I A;  1PVR A;  2GH1 A;  1PK1 A;  3QUQ A;  2ZUC A;  5KFQ A;  4ED1 A;  3ZD9 A;  4RNM A;  1DK2 A;  5KNI A;  1UA1 A;  2PFQ A;  4NKU A;  2FPK A;  5BOL A;  2Y0S C;  4YR2 A;  4AYB F;  4IQV A;  2WTF A;  4R8U B;  3V6K A;  4E0D A;  3PV8 A;  2UVU A;  2M2T A;  3C23 A;  3HKZ C;  3TQ1 A;  4F2S A;  3ZI4 A;  2BBJ A;  2ZHB A;  3D2Q A;  5AKJ A;  2ZXI A;  4KLM A;  3RB4 A;  4Q44 A;  1H38 A;  1UPH A;  4M9G A;  4B9L A;  4GXK A;  1L3S A;  9ICP A;  7ICM A;  3V6H A;  3JZ0 A;  4EYH B;  1TK0 A;  4WCW A;  4F4X A;  4PZN A;  2UVV A;  3OVB A;  3GIL A;  1S5L U;  3PZP A;  1KSP A;  4KB6 A;  3O0F A;  2YN4 A;  2ZTE A;  4M9L A;  4FO6 A;  3ZDE A;  2XI9 A;  3JCF A;  5HML A;  3C18 A;  5J2B A;  4YXM A;  3LYS A;  1LV5 A;  3N28 A;  1Z4O A;  5J2I A;  1XO0 A;  2WB1 C;  4YD1 A;  1TV9 A;  4M2Y A;  1NJW A;  2AGO A;  4HAI A;  3RRH A;  2BZF A;  8ICC A;  4IQU A;  4LEW A;  4KN4 A;  2KZM A;  5KFC A;  3BS5 A;  4RWP A;  3EWA A;  1COO A;  1SWW A;  2DQN B;  7ICJ A;  4J9Q A;  2AGP A;  4X4N A;  2G0A A;  1ZRM A;  1JI7 A;  4YR3 A;  8ICF A;  5KFL A;  4EV6 A;  1ARO P;  5KG0 A;  2XCP A;  4FHV A;  1WUD A;  5AI4 A;  2VJ5 A;  1A77 A;  4Q45 A;  1CI4 A;  3G6V A;  2B56 A;  1PK3 A;  1ZJM A;  4M04 A;  8ICA A;  4UBC A;  4EBJ A;  1R89 A;  8ICK A;  3F53 A;  1NK6 A;  4UAR A;  3NRW A;  5DGA A;  4OD0 A;  2LMR A;  4IR1 A;  4NXX A;  2A3V A;  3PW7 A;  3M6Z A;  1UET A;  1IV8 A;  2E5S A;  3ORY A;  4Y2J A;  3IRU A;  4QW9 A;  3D6J A;  2K8B B;  1KQQ A;  5K4L A;  2M2W A;  3MR3 A;  1SXE A;  3OSN A;  5J0P A;  3IM1 A;  2E1F A;  2K4H A;  3ALR A;  4IR9 A;  5ALP A;  3Q8K A;  2YMQ A;  4P4M A;  5JRT A;  2YTU A;  2NO4 A;  2ZIU B;  2JRZ A;  2WHE A;  4QZI A;  5B5E U;  2KVS A;  4YMN A;  3PO4 A;  4GXJ A;  3OVA A;  4P2H A;  4WC3 A;  2JEG A;  1KFT A;  2CN1 A;  5CWR A;  2KIW A;  4F5N A;  4AT8 A;  3Q8L A;  1S9F A;  4IS7 A;  9ICU A;  5KFK A;  2ZHA A;  4QZG A;  5HMM A;  1ZQJ A;  3L3F X;  2JV3 A;  1U47 A;  4M6W A;  4AT7 B;  3V7L A;  3OV7 A;  4BX9 C;  4M9J A;  5JU5 A;  2JHD A;  2DR9 A;  2HBJ A;  3K1R B;  2ID1 A;  5KG6 A;  1T7P A;  4M9N A;  4JV2 A;  4J9M A;  2YB4 A;  4FBT A;  1U9L A;  5B66 U;  4ED7 A;  2B51 A;  3MGH A;  5KFO A;  4NKT A;  4UB6 U;  3C5F A;  1Q3V A;  1ZQT A;  2ZH2 A;  3I1Y A;  5J2C A;  4K96 A;  1MQ3 A;  1LVH A;  4NWI A;  2BDU A;  2G07 A;  1ZQG A;  2GWS A;  4Q8F A;  4PL2 A;  4AT9 A;  1JAJ A;  5JUM A;  8ICE A;  3KHG A;  2MA1 A;  1D8L A;  4J9S A;  1ZQO A;  2F1J A;  1R8B A;  1V38 A;  4DOA A;  1L3U A;  1FEZ A;  4B9N A;  4UAU A;  2AXT U;  3GII A;  1XO1 A;  5J0T A;  2XC9 A;  1IIP A;  2RFF A;  2DUY A;  5HNK A;  2WAQ F;  1DGJ A;  1HIW A;  2CRX A;  3GU3 A;  5CJ7 A;  4B9M A;  4ECW A;  5HRL A;  1L7P A;  5DDY A;  3H4B A;  3OGU A;  5ALW A;  2KIV A;  4UB5 A;  4DFJ A;  4FZN A;  3PR4 A;  4B9U A;  1S8O A;  3F2B A;  1FFU A;  4K4H A;  3FM9 A;  3JPP A;  2KZ3 A;  1KFS A;  2HOI A;  2KV2 A;  4DEZ A;  1Q46 A;  1ZQZ A;  4UQG A;  3WK5 A;  1NKE A;  1ZQI A;  2KD1 A;  3F5E A;  1ECW A;  4CCH A;  4OAH A;  9ICO A;  2BQR A;  3HJ4 A;  1ZQF A;  4KLL A;  2H3Z A;  4Y2Q A;  1MN8 A;  1F5S A;  4DL7 A;  2H5X A;  1Z19 A;  3C1Y A;  5KT5 A;  3QYP A;  3H40 A;  1PVQ A;  4RUA A;  8ICL A;  2HHQ A;  1MC8 A;  1NOM A;  3RR7 A;  3LWL A;  2J6T A;  3V6J A;  1L3T A;  4KLH A;  5ALE A;  2BQU A;  5KFX A;  1RQN A;  2C28 A;  2B21 A;  5D62 A;  1ZQH A;  3IHQ B;  2O5A A;  3C2L A;  4FHP A;  4K98 A;  4BWJ A;  2FJ6 A;  3EYZ A;  4XQ7 A;  3N7P D;  2NRT A;  3AMZ A;  4WQL A;  1SXD A;  2DR7 A;  3IP4 B;  2ASL A;  3S6J A;  1WYG A;  1J97 A;  4QWD A;  3UMG A;  2E8P A;  2LKY A;  3RF9 A;  2P35 A;  5ALV A;  4LEY A;  4WC1 A;  2HVI A;  2AU0 A;  4G9B A;  4FHW A;  2BPG A;  1PK1 B;  8ICG A;  4TUQ A;  4CNQ A;  3GIK A;  5KFJ A;  3M9M B;  4QZH A;  1ZD3 A;  1BPX A;  4TUR A;  4UB4 A;  3G6Y A;  2J6U A;  1URJ A;  4OCZ A;  3K1Z A;  1WCL A;  3RFA A;  2EZY A;  4ACO A;  4ED3 A;  8ICQ A;  1YZ6 A;  5AI6 A;  5A0L A;  1XSL A;  2ES6 A;  2E8N A;  4DSJ A;  3JPQ A;  2F2A B;  2ZG6 A;  2PFN A;  8ICZ A;  3OHB A;  1YLQ A;  3N7S C;  2ZTD A;  1MIY A;  2QB0 A;  3ZD8 A;  4OAF A;  4EEL A;  4X4P A;  2P66 A;  3NKU A;  1QLN A;  2FLP A;  5JTG A;  4YVZ A;  2CPR A;  1PUZ A;  5ALS A;  4X5V A;  4C80 A;  3WFS C;  2RQ5 A;  3SAG A;  4R63 A;  4J9N A;  3HJ1 A;  2R8H A;  1KL9 A;  1N56 A;  3UMC A;  1F5A A;  1MA7 A;  3BQ7 A;  1L3V A;  2HW3 A;  1UEU A;  2BBH A;  3M9N B;  3PNC A;  5KFU A;  2KZZ A;  3GZF A;  1DOQ A;  5KFI A;  3GIJ A;  4WOY A;  1NK9 A;  4P4O A;  3BS5 B;  3M7D A;  3UPS A;  2C2R A;  2HHT A;  3RJE A;  4QZB A;  3TI0 A;  4YMO A;  5HRD A;  4ZH4 A;  4DL3 A;  5DG7 A;  4KLQ A;  3RBE A;  1FIQ A;  4CRX A;  2W04 A;  2RDJ A;  1PX5 A;  4DSI A;  3CRX A;  4US8 A;  3NWI A;  1SGG A;  1R8C A;  1J2M A;  4EX6 A;  2W03 A;  4RQ7 A;  5ALK A;  3Q8Q B;  2ISO A;  5B3P A;  1X9X A;  1SL2 A;  1ZD4 A;  4ECU A;  4JV1 A;  1WWU A;  4B9T A;  2ISP A;  1N62 A;  4F5Q A;  4ELT A;  4IL6 U;  2JEJ A;  3UQ0 A;  2ODG A;  9ICJ A;  1JRO A;  2YY6 A;  2OCE A;  5KFG A;  2PBE A;  4K99 A;  1U49 A;  2HHU A;  2HOQ A;  1MQ2 A;  2FPM A;  3BZC A;  4G3I A;  3OJS A;  4UD5 A;  4PGX A;  2W9C A;  2ALZ A;  1L8L A;  3V72 A;  1ZQC A;  2ZTC A;  1X6J A;  1S97 A;  2BCR A;  1DK3 A;  2JH7 A;  4RNN A;  1TKD A;  3H7I A;  1ZQD A;  2KE7 A;  4LVS A;  3E58 A;  5KFV A;  2BHN A;  4RWO A;  4I28 A;  4ECQ A;  3QUC A;  3WFO A;  3H8W A;  4PGY A;  2M0N A;  4Y2Y A;  3KZI U;  4I2H A;  4DOB A;  4EBC A;  3QZ8 A;  4FE3 A;  3BQ1 A;  2D6F C;  5DED A;  2KEY A;  2B0C A;  3PML A;  3KOO A;  3AU6 A;  3UPQ A;  4P0P A;  4K8V A;  4AT8 B;  2W8K A;  3C21 A;  2VKQ A;  1L5U A;  3SMV A;  2F8L A;  5HRE A;  4O6A A;  2K4P A;  2V4R A;  4M6W B;  2AJQ A;  3ONN A;  4RPX A;  2IHN A;  5HRK A;  1DGS A;  2HHP A;  2KKP A;  2W9M A;  3EW9 A;  3HP6 A;  1PZN A;  3ETR A;  3H8S A;  4Y2R A;  4A8E A;  1NJX A;  4WC0 A;  3L4P A;  3HIY A;  4DQP A;  4JLZ A;  3SQI A;  1S0N A;  4YD2 A;  4KIT B;  5ALN A;  2YMP A;  3BQT A;  5EE3 A;  4ELV A;  2WFA A;  7ICO A;  2LHT A;  2E1E A;  4MFA A;  4QWA A;  1GO3 F;  2W8L A;  1F44 A;  3NVY A;  2XY7 A;  5FP0 A;  5F9L A;  5III A;  5KL1 B;  2PMZ C;  3WFP A;  2JR5 A;  4I2I A;  1BPY A;  3NS1 A;  3UXO A;  2IOH A;  4YQW A;  4QWC A;  4AT9 B;  3RH6 A;  2BPF A;  5KFP A;  4I27 A;  1X9M A;  2AH5 A;  2VJ4 A;  4BJQ A;  5J2H A;  4IQT A;  3F2C A;  4O3O A;  2YX8 A;  3NVZ A;  4UAV A;  2FDR A;  1U48 A;  3OJU A;  4JMU A;  4UW9 A;  1ED1 A;  8ICI A;  1XC9 A;  3BQ2 A;  4MF2 A;  1Q8K A;  4X4S A;  5J2E A;  4JK1 A;  1U4B A;  3WKA A;  1YT3 A;  4P4P A;  5DQH A;  2C2E A;  4KM5 A;  1UHU A;  3N4M B;  4GC7 A;  4DQR A;  9ICB A;  4N7R A;  4PJ0 U;  2W43 A;  4B9S A;  2LM4 A;  5AIC A;  8ICW A;  2MUT A;  5AK4 A;  2ZH9 A;  1K5O A;  1ZQB A;  3B9J A;  4PL1 A;  3PX4 A;  4UD4 A;  4MEY A;  3MR2 A;  3THV A;  3AN1 A;  2W7P A;  3TFR A;  2XY6 A;  1XNS A;  3CNH A;  3RH4 A;  1NZB A;  5F3X B;  5EWE A;  5KFE A;  4NXV A;  4Q43 A;  1NK0 A;  4F91 B;  1ZQ1 C;  4KMU A;  1KNY A;  3AU2 A;  3NRZ A;  1VJ7 A;  3F5A A;  3KZX A;  3C2K A;  1VDV A;  5ALR A;  1UQV A;  1DRG A;  3SV3 A;  4FZM A;  3BDP A;  3AQF A;  1S0V A;  1M6Y A;  3NAS A;  2Y0S F;  5KFH A;  3JYY A;  1LB2 B;  2MAX A;  7ICE A;  1YZ7 A;  4EEN A;  4QJF B;  4USA A;  2K4E A;  3HKZ F;  3QU5 A;  1WWV A;  1T3N A;  4DF4 A;  5AKG A;  7ICV A;  5KT6 A;  4PH5 A;  1V4A A;  2K89 A;  2HBK A;  1BGX T;  1JXL A;  5KG7 A;  4US9 A;  5DQG A;  3IG5 A;  3TAN A;  2DKX A;  3OHA A;  3PW2 A;  1HJP A;  5KT2 A;  2QB1 A;  1RDF A;  4J9L A;  4I2D A;  5DBC A;  2NO5 A;  3CK6 A;  2F77 X;  1TVA A;  3KFU F;  2KP7 A;  4UB3 A;  3T5L A;  7ICT A;  4M47 A;  4I2C A;  5CHE A;  1SV0 A;  5J2G A;  4KX5 A;  4K97 A;  3JPO A;  4MEX A;  5AM2 A;  3RAX A;  2WB1 F;  2ASD A;  4YMM A;  3PMN A;  2KJ8 A;  3FC4 A;  3G6X A;  5AHX A;  5L1K A;  1DXS A;  3JPN A;  1SV4 A;  2PFP A;  2BDP A;  2EAP A;  2W55 A;  1NJY A;  1NZP A;  5CFU A;  4MKP A;  5AIA A;  2BCV A;  5KG5 A;  2DL0 A;  4UAS A;  4R65 A;  2V9W A;  1XWL A;  2K4I A;  4XQ8 A;  3AQE A;  3MDC A;  1BNO A;  3QU4 A;  2W7O A;  5GTI U;  5KFD A;  4LEZ A;  3TKA A;  2IOF K;  2QB0 B;  2BQ3 A;  5HR9 A;  3KTQ A;  4K4G A;  4DL6 A;  3BJY A;  2P6R A;  4DSK A;  4LEV A;  2DPI A;  2ZIW A;  1K1S A;  4FHX A;  4Z6E A;  3MGV A;  1RYS A;  2H3F A;  5DG9 A;  1XU4 A;  2XY5 A;  1UCV A;  1N48 A;  2HHX A;  1VFG A;  3ZDA A;  2ZUD A;  1SKS A;  4BDP A;  3HRD D;  1JN3 A;  4NLB A;  4I2B A;  3IV6 A;  5ALJ A;  3WKC A;  2ZIV A;  4OJ6 A;  1ZQQ A;  1N63 A;  2ZXH A;  5ALY A;  2KN7 A;  3N7R C;  5ALM A;  3RJF A;  4Y2V A;  5CEH A;  1VJ5 A;  4WBZ A;  3AEV A;  2FLL A;  1S10 A;  1SZP A;  4QWE A;  3BS7 A;  4F93 B;  3ZDD A;  4KLS A;  3ETL A;  2NRV A;  3BQ0 A;  4CE6 A;  5KFN A;  1SV0 C;  5ALZ A;  4XUS A;  2EWR A;  2R18 A;  4YP3 A;  4MFF A;  3KHH A;  3R9K A;  5F2V O;  2F1H A;  3UXN A;  4Z6C A;  1ZQA A;  5ALU A;  1D8B A;  2M9N A;  2F1I A;  3EZ5 A;  4RQ3 A;  5C0Y A;  4KLG A;  9ICE A;  2E3T A;  5AM4 A;  4EYI B;  8ICP A;  4IRC A;  1HEK A;  5DB7 A;  5D61 A;  5EE0 A;  5AIB A;  4Y2U A;  4J9O A;  5ALG A;  5BOM A;  2ZUB A;  1MSW D;  4P0Q A;  4QW8 A;  2VA8 A;  1SB3 C;  3OVS A;  7ICP A;  2W9C B;  1XSP A;  5ALO A;  1ZQV A;  4MHV A;  4ED2 A;  4WC5 A;  3IN5 A;  4DO9 A;  1ZD2 P;  2DRA A;  3RB6 A;  4PHP A;  3QEA Z;  1A76 A;  2I9G A;  2HN1 A;  5J2F A;  2DF4 B;  5KT4 A;  1NKB A;  5IIK A;  3QE9 Y;  2BCS A;  1B22 A;  3F2D A;  4XJE A;  4UB1 A;  4ECX A;  5KFW A;  3MR6 A;  2DR5 A;  4P0P B;  2W3S A;  1TFW A;  4X0B A;  3K7D A;  5D4B A;  3J81 j;  4QIW C;  2XVT A;  2G08 A;  2RDI A;  2ASJ A;  1KRP A;  4J03 A;  1QH9 A;  4CF4 A;  4PZO A;  9ICV A;  4CF5 A;  1SKR A;  2D3D A;  5GTH U;  4QZF A;  1L8O A;  3WKB A;  5ALQ A;  5KL8 B;  1Q79 A;  4NXU A;  3GV7 B;  2EDU A;  5CRX A;  4DSE A;  1BPZ A;  5E79 U;  1AQ6 A;  4E8F A;  1WG8 A;  1O08 A;  2BE3 A;  2PFO A;  2DFL A;  7ICF A;  9ICM A;  2PI5 A;  2DKZ A;  3T5J A;  2LYB A;  3LVV A;  3Q8R B;  3T3F A;  7ICK A;  4M0A A;  4NLK A;  1O03 A;  4LJX A;  3PW4 A;  3V7J A;  5BPC A;  2F76 X;  4F72 A;  3SD7 A;  4C0Z A;  2Z7J A;  4C7Y A;  4C8O A;  5ALI A;  5KFB A;  1VLB A;  4FZL A;  1D9D A;  2GOL A;  4DFK A;  4O3M A;  4U6P A;  4TUP A;  4DLE A;  4RQ8 A;  4X4R A;  4QZA A;  7ICQ A;  1NO5 A;  2MUT B;  3U26 A;  9ICX A;  4QZ9 A;  2KOB A;  2HN2 A;  4UBB A;  3PX6 A;  4C8L A;  3KKA A;  4LZD A;  4OJP A;  3KD3 A;  4F4K A;  4GC6 A;  3MR5 A;  5D63 A;  2QLT A;  2OXO A;  3ISB A;  3C2M A;  4KLI A;  1BPE A;  4F5O A;  3QU9 A;  1WOT A;  4WC6 A;  3QX7 A;  3M8R A;  4O5K A;  1ZOL A;  4K9A A;  1ZQE A;  4ECR A;  1GPJ A;  2HDO A;  1KW4 A;  2DWQ A;  1JXE A;  2FMS A;  3WU2 U;  3SEI A;  1TFR A;  3FYH A;  1NJZ A;  4Y2T A;  3H8M A;  4GXI A;  1QQ5 A;  2EH9 A;  1UEV A;  2Y1I A;  3VC8 A;  3WKE A;  3QUT A;  1BVS A;  2JXJ A;  2HSZ A;  4RQN A;  5AI9 A;  4IRK A;  5KAI U;  3KBB A;  4ELU A;  4WC2 A;  5ALD A;  2ZH8 A;  5J0Q A;  4IQW A;  1V97 A;  5J2J A;  3RB3 A;  4QZE A;  4X4O A;  1F0M A;  1WCN A;  4DL4 A;  3AM9 A;  3MDA A;  4RQ4 A;  5J2A A;  3RJI A;  1TE2 A;  3LWM A;  3NYB A;  3H39 A;  1X40 A;  4NL9 A;  1Z1V A;  4BGD A;  5DBB A;  5KG4 A;  5KFF A;  4KN7 A;  2KIC A;  4BWM A;  5EE9 A;  2AQ0 A;  8ICJ A;  4RQ6 A;  4RWN A;  2BKE A;  2RLT A;  9ICI A;  2Q66 A;  2L5Y A;  2OHF A;  5EWF A;  3JPR A;  2F44 A;  4FS1 A;  4I2E A;  3PSF A;  1RYR A;  3B0Y A;  2AGQ A;  5KFA A;  4NM2 A;  3RB0 A;  8ICH A;  3RRG A;  7ICL A;  4I2F A;  2H3Q A;  1T8E A;  3GIM A;  3KKA C;  3MGI A;  2RP5 A;  4ED0 A;  3PW5 A;  8ICY A;  4DL2 A;  5AKI A;  2BGW A;  4PHA A;  3JPT A;  5DG8 A;  3I28 A;  4O3Q A;  4EP7 A;  2B6G A;  3QUB A;  3SYZ A;  2KVC A;  2W9B A;  5ALF A;  4YFK A;  2D8C A;  3RJH A;  2QKQ A;  4DFM A;  4E80 A;  4KLD A;  2NYV A;  2ZIW B;  4BXO A;  4DOC A;  3GV5 B;  3ICX A;  5CFS A;  2FI1 A;  2IOF A;  2W9A A;  5AK3 A;  2M2V A;  3PX0 A;  8ICU A;  4F71 A;  4C4S A;  2ZIV B;  3LVW A;  3C28 A;  1X42 A;  2VAN A;  5J8Y A;  2AQ4 A;  1JQR A;  4MF8 A;  4NV0 A;  4ZOH C;  5HHI A;  2JH1 A;  2FMQ A;  4EED A;  2DR8 A;  4DCC A;  4I2G A;  1ZYQ A;  7ICU A;  4X4U A;  4DS4 A;  4KLF A;  4HX0 A;  4NY8 A;  2ZH6 A;  3EPI A;  2ZJA A;  5AKH A;  1FO4 A;  2G5H B;  2K8A A;  2PKE A;  3WK7 A;  4RQ0 A;  3LK9 A;  5JTI A;  8ICN A;  2NRK A;  1OU5 A;  3D2N A;  4X4T A;  2LPE A;  5AK6 A;  1BPD A;  2GLE A;  4NL9 C;  2GO7 A;  5D49 A;  2IHM A;  2EQY A;  1X9S A;  2WF7 A;  2VA3 A;  3RJK A;  1CEZ A;  4RWQ A;  5IIO A;  2R8K A;  4B6J A;  9ICH A;  3SAF A;  4ECV A;  4K4I A;  1L7M A;  1TAM A;  2IBK A;  4JWM A;  3HPO A;  8ICS A;  5HP4 A;  3GDX A;  1QCK A;  2KKV A;  3WK4 A;  1KN5 A;  2G09 A;  4KTQ A;  4OAI Z;  4DQI A;  5TIS U;  4P0Q B;  3AQK A;  3UXP A;  3ISD A;  4YCX A;  1R8A A;  5J0U A;  2Q0Z X;  4GFJ A;  1N60 A;  5AI0 A;  1Z00 A;  4UB8 U;  3PVX A;  1B4F A;  2PMZ F;  1K1Q A;  1OXJ A;  4EBD A;  1FA0 A;  2F8K A;  4ECT A;  4QZD A;  2FE9 A;  2K60 A;  5AKL A;  2KJ5 A;  4WJ3 B;  3L5K A;  4O3N A;  3MBY A;  4WC7 A;  5J0R A;  2XGQ A;  4QWB A;  2KSO A;  4XRH A;  4RUC A;  4Y2P A;  4RPY A;  1J2N A;  3LDA A;  2DPJ A;  4FO1 A;  2WF5 A;  2I5H A;  3C29 A;  4ED8 A;  2IUB A;  4JB3 A;  3C66 A;  8ICR A;  4GLX A;  4RPZ A;  1XSN A;  1C7Y A;  3T79 A;  4ECZ A;  1LKY A;  3A0H U;  4OJ5 A;  4NXW A;  1RPL A;  5J8Y C;  2HBM A;  4C7Z A;  2VIX A;  9ICW A;  1RG6 A;  3H3A A;  7ICS A;  5KG3 A;  1U45 A;  5AI5 A;  4B9V A;  1KBU A;  5J0W A;  1B0X A;  4C8M A;  4C4R A;  3NTU A;  5J2K A;  3WFQ E;  1L7N A;  3RR8 A;  2KHQ A;  1NK8 A;  1Y88 A;  4TQS A;  3RBD A;  1TAU A;  2HHS A;  3H38 A;  9ICG A;  4O68 A;  5KFY A;  3ER8 C;  5HRF A;  1ZD5 A;  2NRZ A;  5IIL A; 
#chains in the Genus database with same CATH homology
 4RQ3 A;  2J6U A;  4KLG A;  9ICE A;  4EYI B;  4ECY A;  1KLN A;  8ICP A;  3ISC A;  3PO5 A;  9ICC A;  1S0O A;  3H37 A;  4IRC A;  1T4G A;  1WCL A;  5DB7 A;  3ZDB A;  4PHE A;  5EOZ A;  2OWO A;  4J9O A;  3H4D A;  4J9P A;  4ED3 A;  8ICQ A;  5BOM A;  2NRX A;  2ZUB A;  3RTV A;  1MSW D;  1V9P A;  4QW8 A;  5C5J A;  5CP2 A;  9ICQ A;  3TAP A;  2R8I A;  2ZJ5 A;  3V7K A;  2VA8 A;  2A1J B;  5J0O A;  1XSL A;  3ZDC A;  4DSJ A;  5DB9 A;  3JPQ A;  4TUS A;  2PFN A;  8ICZ A;  4JWN A;  3OVS A;  3B0X A;  3OHB A;  1YLQ A;  7ICP A;  2ZTD A;  4ATB A;  2W9C B;  4WC4 A;  1XSP A;  1MIY A;  5KG1 A;  3ZD8 A;  7ICI A;  2HVH A;  1ZQV A;  2I1Q A;  4NM1 A;  4X4P A;  4UAW A;  2P66 A;  4ED2 A;  4UB2 A;  4EEY A;  2LYH A;  1QLN A;  4WC5 A;  1TK5 A;  4DO9 A;  2FLP A;  8ICV A;  4YVZ A;  5HRB A;  2DRB A;  2DRA A;  3RB6 A;  4PHP A;  4J9R A;  3QEA Z;  9ICN A;  1A76 A;  3FDS A;  4DSF A;  2IMW P;  5CA7 A;  3M8S A;  4F4Y A;  4X5V A;  3C1Z A;  1ZQK A;  2I9G A;  2NRW A;  1JIH A;  5J2F A;  1SL1 A;  3WFS C;  4RZR A;  2JZB A;  5KT4 A;  4R63 A;  4J9N A;  4FS2 A;  2HHW A;  1NKB A;  5IIK A;  2HHV A;  3QE9 Y;  2BCS A;  1XS9 D;  4M9H A;  4NLZ A;  3HJ1 A;  2R8H A;  2ZH4 A;  4QZC A;  1B22 A;  1N56 A;  1F5A A;  4UB1 A;  4IG8 A;  5DKW A;  4ECX A;  3GQC A;  1QTM A;  5DB8 A;  5DQI A;  3TAR A;  9ICK A;  5HRI A;  5KFW A;  3MR6 A;  9ICS A;  1L3V A;  2HW3 A;  1UEU A;  2DR5 A;  3M9N B;  3PNC A;  7ICN A;  4FH3 A;  1TFW A;  4I2A A;  4X4Q A;  4X0B A;  3OUY A;  5KFU A;  5D4B A;  4WBY A;  1BPB A;  2KZZ A;  4O3P A;  4X0A A;  1DOQ A;  5KFI A;  3GIJ A;  2RDI A;  2ASJ A;  1KRP A;  4NLN A;  4O3R A;  5J0Y A;  5KFZ A;  1B43 A;  1X9W A;  1NK9 A;  4P4O A;  3HX0 A;  2C22 A;  3UPS A;  4F92 B;  2C2R A;  2HHT A;  3KHL A;  2FLN A;  9ICV A;  4Z6D A;  1SKR A;  4ECS A;  3RJE A;  3MFI A;  4KLU A;  4QZB A;  1UT5 A;  4QZF A;  3TI0 A;  4YMO A;  3TFS A;  4EBK A;  2KFN A;  5HRD A;  3WFR E;  2UVR A;  7ICR A;  4ZH4 A;  4DL3 A;  5DG7 A;  5KFT A;  4YXJ A;  3E2E A;  1Q79 A;  1X2I A;  5HR9 A;  4KLQ A;  3RBE A;  2RDJ A;  3GV7 B;  1PX5 A;  4DSI A;  2ZUC A;  5KFQ A;  2KTQ A;  3T5K A;  9ICT A;  1RXV A;  3LQC B;  4J9K A;  4ED1 A;  2PXI A;  4DSE A;  2P6U A;  3ZD9 A;  4RQ7 A;  3HT3 A;  1JX4 A;  1BPZ A;  5HRG A;  3JZ0 A;  1KFD A;  3Q8Q B;  4RNM A;  3PR5 B;  2ISO A;  4I29 A;  5D46 A;  1SL2 A;  1DK2 A;  4ECU A;  1UA1 A;  2PFQ A;  4JV1 A;  4NKU A;  4B9T A;  4EZ9 A;  1Q78 A;  2FPK A;  1ZET A;  2ISP A;  4E8F A;  4F2R A;  3AQL A;  5DDM A;  5BOL A;  1MIW A;  4XA5 A;  4YR2 A;  2BE3 A;  2PFO A;  2DFL A;  4IQV A;  4UAY A;  2WTF A;  4R8U B;  4F5Q A;  7ICF A;  3V6K A;  4YR0 A;  2JEJ A;  3PV8 A;  2PI5 A;  3UQ0 A;  4ELT A;  4E0D A;  1ZQR A;  2UVU A;  2M2T A;  9ICJ A;  3C23 A;  3TQ1 A;  3Q8S B;  3T5J A;  4F2S A;  5KFG A;  2PBE A;  1ZQP A;  5KTQ A;  1U49 A;  2HHU A;  2ZHB A;  2A1J A;  4PHD A;  3Q8R B;  3T3F A;  1MQ2 A;  2FPM A;  7ICK A;  4M0A A;  5IIN A;  4KLM A;  4G3I A;  2BCQ A;  3OJS A;  4NLK A;  3RB4 A;  4Q44 A;  4PGX A;  2W9C A;  1H38 A;  4M9G A;  2ALZ A;  4UD5 A;  3V72 A;  1ZQC A;  2ZTC A;  1ZQM A;  4GXK A;  1L3S A;  4F50 A;  3PW4 A;  4B9L A;  1TAQ A;  4F8R A;  9ICP A;  3V7J A;  1S97 A;  3V6H A;  2BCR A;  7ICM A;  5BPC A;  4EYH B;  1DK3 A;  1TK0 A;  4RNN A;  1TKD A;  3H7I A;  1ZQD A;  4LVS A;  4WCW A;  9ICF A;  4F4X A;  4C8O A;  5KFV A;  4JV0 A;  2BHN A;  5KFB A;  4DQS A;  4RWO A;  4I28 A;  2UVV A;  2JEI A;  3MAB A;  4ECQ A;  4DF8 A;  3OVB A;  3GIL A;  3H8W A;  4F4W A;  1D9D A;  4PGY A;  3Q8P B;  3WFO A;  4DFK A;  3SV4 A;  1KSP A;  4TQR A;  4TUP A;  4DLE A;  4I2H A;  4RQ8 A;  4DOB A;  4EBC A;  3QZ8 A;  3BQ1 A;  4X4R A;  5DED A;  4QZA A;  7ICQ A;  5DEC A;  2ZTE A;  4M9L A;  4FO6 A;  2XO7 A;  1NO5 A;  2MUT B;  2R8J A;  4EZ6 A;  3PW0 A;  3ZDE A;  3RH5 A;  2ZH1 A;  4RQ5 A;  9ICX A;  4QZ9 A;  2XGP A;  5HML A;  3PML A;  3C18 A;  5J2B A;  4YXM A;  4UBB A;  5L1L A;  3AU6 A;  3UPQ A;  4DS5 A;  3PX6 A;  1LV5 A;  5J0S A;  9ICR A;  5HC9 A;  5J2I A;  2BR0 A;  4AT8 B;  4C8L A;  4LZD A;  1IM4 A;  3K4G A;  3C21 A;  2W8K A;  4YD1 A;  4KLT A;  1L5U A;  1TV9 A;  4F5P A;  4X4V A;  4F4K A;  4GC6 A;  4M2Y A;  1NJW A;  3MR5 A;  2AGO A;  3SZ2 A;  3RRH A;  4C8N A;  8ICC A;  5HRE A;  4IQU A;  3ISB A;  4KN4 A;  2KZM A;  5KFR A;  5KFC A;  2V4R A;  4M6W B;  4RWP A;  5DB6 A;  3C2M A;  3OSP A;  1BPE A;  3EWA A;  5CR0 A;  4F5O A;  4KLI A;  2AJQ A;  1MIV A;  4RPX A;  2IHN A;  4KLE A;  4DQQ A;  4FH5 A;  5HRK A;  1COO A;  1DGS A;  2HHP A;  2W9M A;  3EW9 A;  1WOT A;  3HP6 A;  1QSS A;  9ICA A;  7ICJ A;  5KT7 A;  3AQN A;  1PZN A;  4J9Q A;  4WC6 A;  3H8S A;  4RQ1 A;  2AGP A;  2W9B B;  1NJX A;  3M8R A;  4FBU A;  4F3O A;  4WC0 A;  4X4N A;  4O5K A;  5L1J A;  3HIY A;  4DQP A;  1ZQE A;  8ICX A;  3GFK B;  4YR3 A;  4ECR A;  9ICM A;  1JMS A;  8ICF A;  5KFL A;  1S0N A;  1ARO P;  4KIT B;  5KG0 A;  4YD2 A;  2XCP A;  7ICH A;  4FHV A;  3BQT A;  4PPX A;  1JXE A;  1A77 A;  4Q45 A;  2R8G A;  2FMS A;  4ELV A;  3G6V A;  1TFR A;  1ZJM A;  4M04 A;  7ICO A;  3FYH A;  1NJZ A;  4BXO B;  4MFA A;  8ICA A;  4M5D A;  4QWA A;  4UBC A;  4GXI A;  8ICB A;  5EWG A;  4Q8E A;  2W8L A;  4EBJ A;  2XY7 A;  1UEV A;  2Y1I A;  1NK4 A;  1TFY A;  1ZQX A;  5KT3 A;  8ICK A;  5F9L A;  5III A;  1NK6 A;  1R89 A;  3T5H A;  1BVS A;  3WFP A;  4DFP A;  1S0M A;  4I2I A;  5DGA A;  1BPY A;  3UXO A;  1UT8 A;  4IRK A;  4IR1 A;  1VFG A;  4R8U A;  3QZ7 A;  4YQW A;  4QWC A;  3NGD A;  5J2D A;  5KFS A;  3RH6 A;  4AT9 B;  3L9D A;  3PW7 A;  4MFC A;  2BPF A;  5L1I A;  1D8Y A;  5KFP A;  4I27 A;  1UET A;  1X9M A;  4ELU A;  4WC2 A;  5J2H A;  4IQT A;  2ZH8 A;  4O3O A;  5J0Q A;  4IQW A;  8ICT A;  4EBE A;  3ORY A;  5J2J A;  1ZQW A;  3RB3 A;  4QZE A;  1U48 A;  3OJU A;  4QW9 A;  4X4O A;  1WCN A;  4DL4 A;  3MFH A;  3MDA A;  8ICI A;  1XC9 A;  4RQ4 A;  1ZQL A;  3AQM A;  5J2A A;  4RNO A;  3RJI A;  3BQ2 A;  3LWM A;  5CHG A;  4MF2 A;  2M2W A;  5J0X A;  4E7X A;  4X4S A;  5J2E A;  4JK1 A;  5DLG A;  3MR3 A;  2V4Q A;  3NYB A;  3H39 A;  1U4B A;  4JUZ A;  4BGD A;  4HYK A;  2ZJ8 A;  4P4P A;  1ZQU A;  5DQH A;  5DBB A;  5J0P A;  3IM1 A;  5KG4 A;  3OSN A;  2C2E A;  1D9F A;  5KFF A;  3Q8K A;  4KN7 A;  4IR9 A;  1IXR A;  4P4M A;  4GC7 A;  4BWM A;  3N4M B;  4DQR A;  2AQ0 A;  9ICB A;  1ZQY A;  8ICJ A;  4RQ6 A;  4RWN A;  2BKE A;  9ICI A;  2Q66 A;  5EWF A;  3JPR A;  3RJG A;  4B9S A;  8ICW A;  4QZI A;  2MUT A;  2ZH9 A;  4YMN A;  1ZQB A;  3PO4 A;  4GXJ A;  3OVA A;  4P2H A;  4FS1 A;  2JEG A;  4I2E A;  1KFT A;  4WC3 A;  5CWR A;  4F5N A;  3PX4 A;  3B0Y A;  4DLG A;  2AGQ A;  1RYR A;  1HUO A;  5KFA A;  4UD4 A;  4MEY A;  4NM2 A;  3MR2 A;  3Q8L A;  3THV A;  3RB0 A;  1S9F A;  3RRG A;  8ICH A;  1HUZ A;  9ICU A;  3TFR A;  2XY6 A;  7ICL A;  5KFK A;  4I2F A;  3RH4 A;  4NLG A;  4PGQ A;  4FHY A;  2ZHA A;  1T8E A;  3GIM A;  5EWE A;  2FPL A;  4QZG A;  4O9M A;  1KTQ A;  3MGI A;  5HMM A;  5KFE A;  1ZQJ A;  4ED0 A;  1NK5 A;  3PW5 A;  8ICY A;  4Q43 A;  4DL2 A;  1U47 A;  4M6W A;  4F91 B;  1NK0 A;  1R8C A;  4AT7 B;  3V7L A;  4KMU A;  2BGW A;  4PHA A;  3JPT A;  1KEJ A;  5HRH A;  1KNY A;  3AU2 A;  3OV7 A;  4I2J A;  4M9J A;  5DG8 A;  2DR9 A;  1VJ7 A;  2ID1 A;  5KG6 A;  4O3Q A;  1T7P A;  4DSL A;  4EP7 A;  2KFZ A;  3SYZ A;  3C2K A;  4M9N A;  2W9B A;  4JV2 A;  4J9M A;  4F4Z A;  1QSL A;  3SV3 A;  4FBT A;  1Z00 B;  3BDP A;  4YFK A;  1U9L A;  5IIM A;  2JEF A;  4ED7 A;  3RJH A;  1S0V A;  3MGH A;  4DFM A;  5KFH A;  1UA0 A;  3RJJ A;  4KLD A;  5DGB A;  5KFO A;  2MAX A;  1LB2 B;  3JYY A;  4NKT A;  4DL5 A;  7ICE A;  3C5F A;  2ATL A;  2DVI A;  4BXO A;  1ZQT A;  4DOC A;  2J6S A;  3EPG A;  3GV5 B;  1T3N A;  4DF4 A;  2ZH2 A;  7ICV A;  5KT6 A;  4PH5 A;  5J2C A;  1MQ3 A;  1V4A A;  2ZH7 A;  2W9A A;  2M2V A;  3PX0 A;  8ICU A;  5F9N A;  1BGX T;  3K75 D;  1JXL A;  1ZQG A;  2GWS A;  4DWI A;  4Q8F A;  4AT9 A;  5KG7 A;  1JAJ A;  5JUM A;  3H8J A;  8ICE A;  5IIJ A;  3KHG A;  1RZT A;  2VAN A;  5DQG A;  2AQ4 A;  3TAN A;  1JQR A;  1D8L A;  4J9S A;  4MF8 A;  3JPS A;  5HHI A;  1ZQO A;  2F1J A;  3OHA A;  3PW2 A;  1HJP A;  5KT2 A;  1KDH A;  2FMQ A;  1R8B A;  2DR8 A;  4I2G A;  1ZYQ A;  4C8K A;  7ICU A;  4J9L A;  5L9X A;  4I2D A;  5DBC A;  4LZG A;  4X4U A;  1S77 D;  4LT6 A;  4DS4 A;  4KLF A;  2M2U A;  4NY8 A;  2ZH6 A;  1TVA A;  3EPI A;  2ZJA A;  4UB3 A;  4DOA A;  3T5L A;  1L3U A;  7ICT A;  4M47 A;  2KP7 A;  4B9N A;  4I2C A;  4RQ0 A;  2VA2 A;  3LK9 A;  4UAZ A;  4R64 A;  1XO1 A;  3GII A;  3AUO A;  5J0T A;  8ICN A;  1OU5 A;  2XC9 A;  4O0I A;  2NRK A;  5J2G A;  7ICG A;  2RFF A;  4WC7 A;  4X4T A;  5HNK A;  1BPD A;  9ICL A;  5D49 A;  2IHM A;  3JPO A;  4MEX A;  5CJ7 A;  4B9M A;  4ECW A;  3RAX A;  1X9S A;  5DBA A;  4ED6 A;  2VA3 A;  3RJK A;  2ASD A;  4YMM A;  3PMN A;  1CEZ A;  5HRL A;  5DDY A;  4Z6F A;  3H4B A;  1ZQN A;  4RWQ A;  2ZH3 A;  3OGU A;  5IIO A;  2R8K A;  3G6X A;  4UB5 A;  9ICH A;  5L1K A;  4DFJ A;  1NKC A;  4E80 A;  3PR4 A;  4ECV A;  2C2D A;  4K4I A;  3PY8 A;  4KLJ A;  3JPN A;  4RT3 A;  2BCU A;  2PFP A;  2BDP A;  4B9U A;  4S3N A;  2IBK A;  4O5C A;  5DLF A;  1NJY A;  1RXW A;  1NZP A;  4K4H A;  2O1P A;  4JWM A;  3HPO A;  8ICS A;  2ZH5 A;  5HP4 A;  3JPP A;  3GDX A;  2KZ3 A;  3N97 B;  4RQ2 A;  1KFS A;  2BCV A;  5KG5 A;  3RAQ A;  4DEZ A;  4KTQ A;  1Z3E B;  4AT7 A;  4IRD A;  4DQI A;  1ZQZ A;  4R65 A;  2V9W A;  4UQG A;  1NKE A;  5J29 A;  1XWL A;  1ZQI A;  3AQK A;  1NK7 A;  4XQ8 A;  1ZJN A;  3HWT A;  3MDC A;  3UXP A;  1BNO A;  3ISD A;  3M9O B;  4YCX A;  4CCH A;  1R8A A;  5J0U A;  2XCA A;  2Q0Z X;  3SI8 A;  5KFD A;  8ICO A;  4ATB B;  9ICO A;  2BQR A;  3HJ4 A;  1Z00 A;  1ZQF A;  4KLL A;  3PVX A;  1EXN A;  4F5R A;  4DL7 A;  2H5X A;  2BQ3 A;  3C1Y A;  4NXZ A;  5KT5 A;  1K1Q A;  3H40 A;  4RUA A;  3TAQ A;  8ICL A;  3C5G A;  3KTQ A;  4K4G A;  4EBD A;  3BJY A;  4DL6 A;  2P6R A;  4DSK A;  1MC8 A;  2DPI A;  2HHQ A;  1FA0 A;  2UVW A;  1NOM A;  1K1S A;  4ECT A;  4QZD A;  4FHX A;  4Z6E A;  4AT8 A;  2PI4 A;  3RR7 A;  3LWL A;  1RYS A;  2J6T A;  4RU9 A;  3V6J A;  1L3T A;  4KLH A;  4O3N A;  3MBY A;  2Y1J A;  2BQU A;  5DG9 A;  5KFX A;  1XU4 A;  2XY5 A;  1BNP A;  4YN4 A;  5J0R A;  1N48 A;  2XGQ A;  3QEB Z;  3ZDA A;  2HHX A;  4QWB A;  2C28 A;  2ZUD A;  2B21 A;  5KG2 A;  1SKS A;  1ZQH A;  3IHQ B;  1JN3 A;  4XRH A;  4RUC A;  4BDP A;  2JZB B;  2FMP A;  4I2B A;  2O5A A;  4RPY A;  2IA6 A;  3LDA A;  2DPJ A;  3Q8M A;  4ED8 A;  3C2L A;  1ZQQ A;  1SKW A;  4FHP A;  3C66 A;  3HW8 A;  8ICR A;  4GLX A;  4RPZ A;  2KN7 A;  1XSN A;  1C7Y A;  4ECZ A;  5TZV A;  5CB1 A;  4BWJ A;  4RT2 A;  1RPL A;  3RJF A;  1QSY A;  3OUY B;  3EYZ A;  4XQ7 A;  9ICW A;  3H3A A;  4WBZ A;  2NRT A;  2FLL A;  1S10 A;  3GV8 B;  7ICS A;  1SZP A;  5KG3 A;  4QWE A;  1U45 A;  8ICM A;  4B9V A;  2DR7 A;  2ASL A;  4F93 B;  4KLO A;  1TK8 A;  3ZDD A;  4KLS A;  3ETL A;  2NRV A;  2BPC A;  4QZ8 A;  5J0W A;  4QWD A;  4C8M A;  3BQ0 A;  5KFM A;  1SL0 A;  1ZQS A;  1S76 D;  5KFN A;  5HHH A;  3NTU A;  5J2K A;  3WFQ E;  4XUS A;  4WC1 A;  3RR8 A;  2HVI A;  1CUK A;  2AU0 A;  1NK8 A;  1Y88 A;  4FHW A;  2BPG A;  4TQS A;  3RBD A;  4YP3 A;  1TAU A;  8ICG A;  2HHS A;  4O5E A;  4TUQ A;  3H38 A;  4MFF A;  9ICG A;  3KHH A;  3GIK A;  3KHR A;  5KFJ A;  4R66 A;  5F2V O;  2F1H A;  5KFY A;  4Z6C A;  4YG2 A;  3UXN A;  4QZH A;  2M9N A;  3M9M B;  1ZQA A;  4O3S A;  2F1I A;  1BPX A;  4TUR A;  5IIL A;  2NRZ A;  5HRF A;  4UB4 A;  3UQ2 A;  3G6Y A;  3EZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...